1B67A

Crystal structure of the histone hmfa from methanothermus fervidus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
68
structure length
68
Chain Sequence
GELPIAPIGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARKMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HISTONE HMFA)
publication title Crystal structures of recombinant histones HMfA and HMfB from the hyperthermophilic archaeon Methanothermus fervidus.
pubmed doi rcsb
source organism Methanothermus fervidus
molecule tags Dna binding protein
total genus 26
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1b67A00
3AN2D 1P3MA 5AV8C 1EQZD 5CPIA 4J8XA 5B24C 2FJ7B 3B6GB 5AVBA 3KWQA 5B2ID 4YM6A 3C1BC 1P3KC 4EO5B 3AZGB 1TAFA 3W98D 5GT3C 4H9NB 3MNNC 3AN2C 4ZUXB 5CP6D 5B40D 3WKJA 1BH9B 4WZSB 3AZMB 4LD9B 4NE5A 1HQ3C 3VH6A 5B2IC 2NZDA 3REHA 1KX4B 3AFAA 5CP6C 5B40C 4JJND 3AZHC 4XUJB 4Z66B 3KUYC 3W97D 4WU9A 3MGPD 3MGSB 4KGCA 4XZQA 2BYKB 5JRGB 2LY8A 5BT1D 1P3FB 1WWIA 2YFWB 4WU8B 1U35D 3AZJD 5BS7A 1F66D 3X1SD 1BFMA 1P3AC 3WTPD 5BNVB 4M6BA 5GSUC 1P3PD 4H9QA 3REJC 2PYOC 5AV5A 5BT1C 3B6FC 4HGAB 4J8VA 2AROA 1ZLAA 1P3MD 3AZJC 1ULYA 4J8UB 5CPID 5GT0B 4X23C 3MGQB 5CPKC 3KSYA 5AVBD 3KWQD 1P3KA 1M18C 4YM6D 2F8NK 4DRBA 4YS3B 5AV8A 5BO0B 3AZKC 5GT3B 4H9OB 1TZYB 4J8WC 1P3GC 3V9RA 5B24A 4H9PB 1P3MC 1P3BC 1EQZB 3WKJD 1KX5D 3C1BA 3MVDC 4G92C 1M1AB 3MNNA 3UT9A 2NZDD 3AN2A 2HUEB 1AOID 1N1JA 3W98B 5BNXA 3REHD 3AFAD 3AZFC 1HQ3A 5B32A 5B2IA 1KX5C 4E44A 3KXBC 2NQBB 5C3IC 1P3IC 4NFTA 5B40A 5CP6A 1AOIC 4XZQD 4KGCD 1P34D 4KHAB 3REHC 1M19C 3AZHA 3AFAC 3AZEA 3KUYA 2BYMA 4JJNB 4G91B 4H9RB 5B33C 3AYWB 3AV1B 4AWLC 3W97B 5FUGB 3MGPB 3LELC 3VH5W 1P34C 5AV5D 3VH6T 1P3AA 4J8VD 2AROD 1ZLAD 1U35B 5B31A 1F66B 5GSUA 3X1SB 3REJA 2PYOA 3WA9C 4QLCD 3WTPB 3B6FA 5B1LA 1P3KD 1P3PB 1BH8A 5AV5C 3AZLD 4R8PA 4ZBJB 5AV8D 4X23A 4WNNA 5E5AC 3X1VC 3UTAB 1ZLAC 4WV4B 5B32G 5CPKA 1M18A 5CPIB 1S32A 3AV2C 4QLCC 4G92B 4J8XB 3X1TB 3AZKA 3REKB 3MNND 5AVBB 3KWQB 4J8WA 3UT9D 4YM6B 1P3GA 3W96C 3AZLC 1P3BA 4E45A 1TAFB 4NE3A 3MVDA 4DRAA 3C1CC 3REID 1HQ3D 5B32D 3X1UC 3WKJB 1JFIA 3LJAC 5CPJC 3TU4C 2HIOD 1P3LC 3UT9C 2NZDB 3AZFA 3W99A 3REHB 1KX5A 3AZHD 3AZED 3KXBA 3KUYD 3REIC 5B31G 5B32C 1P3IA 1AOIA 5GXQB 2HIOC 1M19A 4WU9B 5B1MC 4KGCB 5F99A 4XZQB 2CV5D 1H3OB 5DNMD 5B33A 3AZEC 1P3AD 4KUDD 5B31D 1KX3D 3LELA 5GSUD 3LZ0C 3LZ1C 3REJD 1P34A 2PYOD 3B6FD 5B1LD 5B0YB 3WTPE 2CV5C 4H9QB 2RVQD 5DNMC 4R8PD 3B0DC 3WA9A 4X23D 4J8VB 2AROB 5B0ZA 4KUDC 5B31C 1KX3C 5CPKD 1M18D 1S32D 3MGRD 3AZKD 5B1LC 3X1VA 5E5AA 4J8WD 1P3GD 3R45A 1P3KB 2RVQC 4R8PC 2F8NH 1P3BD 5AV8B 4CAYA 3AV2A 4QLCA 3MVDD 3V9RB 1Q9CA 5B24B 4XUJA 3A6NC 1S32C 3MGRC 3WAAC 3C1BB 3W96A 3AZLA 2F8NG 5AV9C 3MNNB 5JRGA 3UT9B 1ID3A 5DNND 3AN2B 3C1CA 3AZFD 3X1UA 1N1JB 3W99D 3RELC 5BNXB 4WU8A 3AZND 5KDMA 3KXBD 3LJAA 3TU4A 5CPJA 1HQ3B 1P3LA 5B2IB 1P3ID 4Z5TD 1M19D 5DNNC 5CP6B 5B40B 5F99D 3REIA 3W99C 4Z2MH 5AV6A 3AZNC 3AZHB 5B33D 3AZEB 5B2JC 2HIOA 3KUYB 2IO5C 3MGQA 5B1MA 3LELD 2FJ7D 4Z2MG 4Z5TC 3O62C 3AZGD 5AVCC 5F99C 3B0CT 3NQUA 3WA9D 3LZ0A 3LZ1A 1P3AB 5B0ZD 5B31B 4LD9D 2CV5A 2FJ7C 5GSUB 3REJB 2PYOB 3B6GC 5DNMA 3B6FB 4EO5C 3AZGC 3X1VD 5E5AD 2YFVA 1BH8B 4KUDA 1P3OA 5AY8A 4R8PB 3AZJB 4ZUXC 1KX3A 4X23B 4WNNB 3AV2D 5B0ZC 4XUJD 3AZMC 5CPKB 1M18B 4LD9C 1S32B 3W96D 3NQJA 3AZKB 5JRGD 4J8WB 1P3GB 1ID3D 1P3MB 1KX4C 3A6NA 3C1CD 3VH5A 1P3BB 3X1UD 3MGRA 3WAAA 4WU8D 3MVDB 1A7WA 5JA4A 5CPJD 3LJAD 4XUJC 3TU4D 5AV9A 3AV1A 1P3LD 4Z66C 4UUZA 1JFIB 3MGSC 3RELA 5JRGC 1ID3C 3AZFB 1KU5A 3W99B 1P3FC 5AV6D 1KX5B 4WU8C 4CSRA 5G49A 3KXBB 4J8UD 5C3IB 5DNNA 3MGQD 1P3IB 5B1MD 1AOIB 3AZNA 1M19B 3AFAB 3AZIA 5B2JA 5F99B 4HGAC 5AV6C 3VH6W 5B33B 3LZ0D 3LZ1D 4J8UC 4Z5TA 4AWLB 2F8NA 5GT0C 3UTBA 3O62A 3X1TA 3MGQC 3LELB 5AVCA 3REKA 1M1AD 1P34B 4YS3C 1TZYC 1P3OD 5AY8D 2FJ7A 3WA9B 3B6GA 1EQZC 5B0ZB 3AZGA 2NQBD 1WWSA 1M1AC 4H9NA 5AV5B 4ZUXA 2HUEC 3X1VB 5E5AB 1BH9A 3R45B 1ZLAB 3W98C 1P3OC 3A6ND 5AY8C 3AZMA 4LD9A 4CAYB 3WAAD 3AV2B 4QLCB 5GXQA 5AV9D 3AYWD 3AV1D 2NQBC 1KX4A 3W96B 3AZLB 3RELD 1H3OA 1ID3B 3C1CB 3X1UB 4Z66A 4JJNC 4G91C 5KDMB 3MGSA 3LJAB 5CPJB 3TU4B 3AYWC 2BYKA 3AV1C 1P3LB 3W97C 3MGPC 5B0YA 1P3FA 2YFWA 3AZID 5B2JD 3REIB 5B32B 3UTAD 5AV6B 1U35C 5BNVA 1F66C 2HIOB 3VH5T 2F8ND 3UTBD 3X1SC 3O62D 3X1TD 3WTPC 4J8XD 5B1MB 5AVCD 3REKD 1F1EA 1P3PC 3B0BA 4ZBJC 3AZIC 4J8UA 2BYMB 3NQUB 4H9SC 5GT0A 3UTAC 3LZ0B 3LZ1B 3B6GD 5CPIC 3UTBC 4J8XC 3X1TC 4YS3A 5BO0A 3REKC 2CV5B 5GT3A 4H9OA 5AVBC 1TZYA 3KWQC 4YM6C 5DNMB 2CWEA 4H9PA 4ZUXD 3B0DB 1EQZA 2YFVB 4KUDB 1P3OB 5AY8B 1KX3B 3AZMD 1M1AA 3WKJC 5B1LB 5GXQD 3W98A 1KX4D 3NQJB 2NZDC 4WU9D 1HTAA 3A6NB 2NQBA 4Z66D 3MGRB 3WAAB 2L5AA 5JA4B 3MGSD 5GXQC 5AV9B 4KHAA 4UUZB 4WU9C 5B0YD 3RELB 4NE6A 4XZQC 1P3FD 4JJNA 4KGCC 2JSSA 4H9RA 3AYWA 3W97A 5FUGA 4CSRB 3MGPA 5G49B 5BS7C 1B67A 1B6WA 5DNNB 5CHLB 5B0YC 3AZNB 1U35A 3AZIB 5B2JB 3AZJA 1F66A 1R4VA 3X1SA 3B0CW 5GT0D 2IO5B 2AROC 3WTPA 5B24D 4J8VC 4Z5TB 2F8NB 3UTBB 1P3PA 3C1BD 3O62B 4YS3D 5AVCB 5GT3D 4H9SA 3UTAA 1TZYD
chains in the Genus database with same CATH superfamily
3AN2D 1P3MA 5AV8C 1EQZD 5CPIA 4J8XA 5B24C 2FJ7B 3B6GB 5AVBA 3KWQA 5B2ID 4YM6A 3C1BC 1P3KC 4EO5B 3AZGB 1TAFA 3W98D 5GT3C 4H9NB 3MNNC 3AN2C 4ZUXB 5CP6D 5B40D 3IP4C 3WKJA 1BH9B 4WZSB 3AZMB 4LD9B 4NE5A 1HQ3C 3VH6A 5B2IC 2NZDA 2Y2JA 3REHA 1KX4B 3AFAA 5CP6C 5B40C 3A1IA 4JJND 3AZHC 4XUJB 4Z66B 3KUYC 3W97D 2Y2NA 4WU9A 3MGPD 3MGSB 4KGCA 4XZQA 2BYKB 5JRGB 2LY8A 5BT1D 2G5HC 1P3FB 1WWIA 2YFWB 4WU8B 1U35D 3AZJD 5BS7A 1F66D 3X1SD 1BFMA 1P3AC 3WTPD 2G5IC 5BNVB 4M6BA 2JE5A 5GSUC 1P3PD 4H9QA 3REJC 2PYOC 5AV5A 5BT1C 3B6FC 4HGAB 4J8VA 2AROA 1ZLAA 1P3MD 3AZJC 1ULYA 4J8UB 2DQNC 5CPID 5GT0B 4X23C 3MGQB 5CPKC 3KSYA 5AVBD 3KWQD 1P3KA 1M18C 4YM6D 2F8NK 4DRBA 2RIQA 3AL0C 4YS3B 5AV8A 5BO0B 3AZKC 5GT3B 4H9OB 1TZYB 4J8WC 1P3GC 3V9RA 5B24A 4H9PB 1P3MC 1P3BC 1EQZB 3WKJD 1KX5D 3C1BA 3MVDC 4G92C 1M1AB 3MNNA 3UT9A 2NZDD 3AN2A 2HUEB 1AOID 1N1JA 3W98B 5BNXA 3REHD 2Y2IA 3AFAD 3AZFC 1HQ3A 5B32A 5B2IA 1KX5C 4E44A 3KXBC 2NQBB 5C3IC 1P3IC 4NFTA 5B40A 5CP6A 1AOIC 4XZQD 4KGCD 1P34D 4KHAB 3REHC 1M19C 3AZHA 3AFAC 3AZEA 3KUYA 2BYMA 4JJNB 3KFUG 4G91B 4H9RB 5B33C 3AYWB 3AV1B 4AWLC 3W97B 5FUGB 3MGPB 3LELC 3VH5W 1P34C 5AV5D 2ZY5A 3VH6T 1P3AA 4J8VD 2AROD 1ZLAD 1U35B 5B31A 1F66B 5GSUA 3X1SB 3REJA 2PYOA 3WA9C 4QLCD 3WTPB 3B6FA 5B1LA 1P3KD 1P3PB 1BH8A 5AV5C 3AZLD 4R8PA 4ZBJB 5AV8D 4X23A 4WNNA 5E5AC 3X1VC 3UTAB 1ZLAC 4WV4B 5B32G 5CPKA 1M18A 5CPIB 1S32A 3AV2C 4QLCC 4G92B 4J8XB 3X1TB 3AZKA 3REKB 3MNND 5AVBB 3KWQB 4J8WA 3UT9D 4YM6B 1P3GA 3W96C 3AZLC 1P3BA 4E45A 1TAFB 4NE3A 3MVDA 4DRAA 3C1CC 3REID 1HQ3D 5B32D 3X1UC 3WKJB 1JFIA 3LJAC 5CPJC 3TU4C 2HIOD 2JCHA 4WJ3C 1P3LC 3UT9C 2NZDB 3AZFA 3W99A 3REHB 1KX5A 3AZHD 3AZED 3KXBA 1PZRA 3KUYD 3REIC 5B31G 5B32C 1P3IA 1AOIA 5GXQB 2HIOC 1M19A 4WU9B 5B1MC 4KGCB 5F99A 4XZQB 2CV5D 1H3OB 5DNMD 5B33A 3AZEC 1P3AD 4KUDD 5B31D 1KX3D 3LELA 5GSUD 3LZ0C 3LZ1C 3REJD 1P34A 2PYOD 3B6FD 5B1LD 5B0YB 3H0RC 3WTPE 2CV5C 4H9QB 2RVQD 5DNMC 4R8PD 3B0DC 3WA9A 3P5JB 4X23D 4J8VB 2AROB 3H0MC 5B0ZA 4KUDC 5B31C 1KX3C 5CPKD 1M18D 1S32D 3MGRD 3EPKA 3AZKD 5B1LC 3X1VA 5E5AA 4J8WD 1P3GD 3R45A 1P3KB 2RVQC 4R8PC 2F8NH 1P3BD 5AV8B 4CAYA 3AV2A 4QLCA 3MVDD 3V9RB 1Q9CA 5B24B 4XUJA 3A6NC 2Y2KA 1S32C 3MGRC 3WAAC 3C1BB 3W96A 2ZY3A 3AZLA 2Y2GA 2F8NG 3EPJA 5AV9C 3MNNB 5JRGA 4DQYB 3UT9B 1ID3A 5DNND 3AN2B 4UPKA 3C1CA 2Y2PA 3AZFD 3X1UA 1N1JB 3W99D 3RELC 5BNXB 4WU8A 3AZND 5KDMA 3KXBD 3LJAA 3TU4A 5CPJA 1HQ3B 1P3LA 5B2IB 2VQRA 1P3ID 4Z5TD 1M19D 5DNNC 5CP6B 5B40B 5F99D 3REIA 2F2AC 3W99C 4Z2MH 5AV6A 3AZNC 3AZHB 5B33D 3AZEB 5B2JC 2HIOA 3KUYB 2IO5C 3MGQA 1Z2CB 5B1MA 3LELD 2FJ7D 4Z2MG 4Z5TC 3O62C 3AZGD 5AVCC 5F99C 3B0CT 3NQUA 3WA9D 3LZ0A 3LZ1A 1P3AB 5B0ZD 5B31B 4LD9D 2CV5A 2FJ7C 5GSUB 3REJB 2PYOB 3B6GC 5DNMA 3B6FB 4EO5C 3AZGC 3X1VD 5E5AD 2YFVA 3EG5B 1BH8B 4KUDA 1P3OA 5AY8A 4R8PB 3AZJB 4ZUXC 1KX3A 4X23B 4WNNB 3AV2D 5B0ZC 4XUJD 3AZMC 5CPKB 1M18B 4LD9C 1S32B 3W96D 3NQJA 3AZKB 2W8SA 5JRGD 4J8WB 1P3GB 1ID3D 1P3MB 1KX4C 3A6NA 3C1CD 3VH5A 1P3BB 3X1UD 3MGRA 3WAAA 4WU8D 3MVDB 1A7WA 5JA4A 5CPJD 3LJAD 4XUJC 3TU4D 5AV9A 3AV1A 1P3LD 4Z66C 4UUZA 1JFIB 3MGSC 3RELA 2Y2LA 2BG1A 5JRGC 3F6TA 1ID3C 3AZFB 1KU5A 3W99B 1P3FC 5AV6D 1KX5B 4WU8C 4CSRA 5G49A 3KXBB 4J8UD 5C3IB 5DNNA 3MGQD 1P3IB 5B1MD 1AOIB 2DF4C 3AZNA 1M19B 3AFAB 3AZIA 5B2JA 5F99B 4HGAC 5AV6C 3VH6W 5B33B 3LZ0D 3LZ1D 4J8UC 4Z5TA 4AWLB 2F8NA 5GT0C 3UTBA 3O62A 3X1TA 3MGQC 3LELB 5AVCA 3REKA 1M1AD 1P34B 4YS3C 1TZYC 1P3OD 5AY8D 2FJ7A 3WA9B 3B6GA 1T3UA 1EQZC 5B0ZB 3EPLA 3AZGA 2NQBD 1WWSA 1M1AC 4H9NA 5AV5B 4ZUXA 2HUEC 3A1KA 3X1VB 5E5AB 1BH9A 3R45B 1ZLAB 3W98C 2XD1A 1P3OC 2XD5A 5AY8C 3A6ND 3AZMA 3FDDA 4LD9A 2ZM5A 4CAYB 1W2EA 3WAAD 3AV2B 4QLCB 5GXQA 5AV9D 3AYWD 3AV1D 2NQBC 1KX4A 3W96B 3AZLB 2ZY2A 3RELD 1H3OA 1ID3B 3C1CB 3X1UB 4Z66A 4JJNC 2ZY4A 4G91C 5KDMB 3MGSA 3LJAB 5CPJB 3TU4B 3AYWC 2BYKA 3AV1C 1P3LB 3W97C 2FFFB 3MGPC 5B0YA 1P3FA 2YFWA 3AZID 5B2JD 3EPHA 3REIB 5B32B 3UTAD 5AV6B 1U35C 5BNVA 1F66C 2HIOB 3VH5T 2F8ND 3UTBD 3X1SC 3O62D 3X1TD 3WTPC 4J8XD 5B1MB 5AVCD 3REKD 1F1EA 1P3PC 3B0BA 4ZBJC 3AZIC 4J8UA 2BYMB 3NQUB 4H9SC 5GT0A 3UTAC 3LZ0B 3LZ1B 3B6GD 5CPIC 3UTBC 4J8XC 3X1TC 4YS3A 5BO0A 3REKC 2CV5B 5GT3A 4H9OA 5AVBC 1TZYA 3KWQC 4YM6C 5DNMB 2CWEA 4H9PA 4ZUXD 3B0DB 1EQZA 2YFVB 4KUDB 1P3OB 5AY8B 1KX3B 3AZMD 2J8PA 1M1AA 3WKJC 5B1LB 5GXQD 3W98A 2Y2OA 3H0LC 1KX4D 3NQJB 2NZDC 4WU9D 2Y2QA 1HTAA 3A6NB 2NQBA 4Z66D 3MGRB 3WAAB 2L5AA 5JA4B 3MGSD 5GXQC 5AV9B 4KHAA 4UUZB 4WU9C 5B0YD 3RELB 4NE6A 4XZQC 1P3FD 4JJNA 4KGCC 2JSSA 4H9RA 3AYWA 2Y2HA 2Y2MA 3W97A 5FUGA 4CSRB 3MGPA 5G49B 5BS7C 2UWXA 1B67A 1B6WA 5DNNB 5CHLB 5B0YC 3AZNB 1U35A 3AZIB 5B2JB 3AZJA 1F66A 1R4VA 3X1SA 3B0CW 5GT0D 2IO5B 2AROC 3WTPA 5B24D 4J8VC 4Z5TB 2F8NB 3UTBB 1P3PA 3C1BD 3O62B 4YS3D 5AVCB 5GT3D 4H9SA 3UTAA 1TZYD
chains in the Genus database with same CATH topology
3AN2D 1P3MA 5AV8C 1EQZD 5CPIA 4J8XA 5B24C 2FJ7B 3B6GB 5AVBA 3KWQA 5B2ID 4YM6A 3C1BC 1P3KC 4EO5B 3AZGB 1TAFA 3W98D 5GT3C 4H9NB 3MNNC 3AN2C 4ZUXB 5CP6D 5B40D 3IP4C 3WKJA 1BH9B 4WZSB 3AZMB 4LD9B 4NE5A 1HQ3C 3VH6A 5B2IC 2NZDA 2Y2JA 3REHA 1KX4B 3AFAA 5CP6C 5B40C 3A1IA 4JJND 3AZHC 4XUJB 4Z66B 3KUYC 3W97D 2Y2NA 4WU9A 3MGPD 3MGSB 4KGCA 4XZQA 2BYKB 5JRGB 2LY8A 5BT1D 2G5HC 1P3FB 1WWIA 2YFWB 4WU8B 1U35D 3AZJD 5BS7A 1F66D 3X1SD 1BFMA 1P3AC 3WTPD 2G5IC 5BNVB 4M6BA 2JE5A 5GSUC 1P3PD 4H9QA 3REJC 2PYOC 5AV5A 5BT1C 3B6FC 4HGAB 4J8VA 2AROA 1ZLAA 1P3MD 3AZJC 1ULYA 4J8UB 2DQNC 5CPID 5GT0B 4X23C 3MGQB 5CPKC 3KSYA 5AVBD 3KWQD 1P3KA 1M18C 4YM6D 2F8NK 4DRBA 2RIQA 3AL0C 4YS3B 5AV8A 5BO0B 3AZKC 5GT3B 4H9OB 1TZYB 4J8WC 1P3GC 3V9RA 5B24A 4H9PB 1P3MC 1P3BC 1EQZB 3WKJD 1KX5D 3C1BA 3MVDC 4G92C 1M1AB 3MNNA 3UT9A 2NZDD 3AN2A 2HUEB 1AOID 1N1JA 3W98B 5BNXA 3REHD 2Y2IA 3AFAD 3AZFC 1HQ3A 5B32A 5B2IA 1KX5C 4E44A 3KXBC 2NQBB 5C3IC 1P3IC 4NFTA 5B40A 5CP6A 1AOIC 4XZQD 4KGCD 1P34D 4KHAB 3REHC 1M19C 3AZHA 3AFAC 3AZEA 3KUYA 2BYMA 4JJNB 3KFUG 4G91B 4H9RB 5B33C 3AYWB 3AV1B 4AWLC 3W97B 5FUGB 3MGPB 3LELC 3VH5W 1P34C 5AV5D 2ZY5A 3VH6T 1P3AA 4J8VD 2AROD 1ZLAD 1U35B 5B31A 1F66B 5GSUA 3X1SB 3REJA 2PYOA 3WA9C 4QLCD 3WTPB 3B6FA 5B1LA 1P3KD 1P3PB 1BH8A 5AV5C 3AZLD 4R8PA 4ZBJB 5AV8D 4X23A 4WNNA 5E5AC 3X1VC 3UTAB 1ZLAC 4WV4B 5B32G 5CPKA 1M18A 5CPIB 1S32A 3AV2C 4QLCC 4G92B 4J8XB 3X1TB 3AZKA 3REKB 3MNND 5AVBB 3KWQB 4J8WA 3UT9D 4YM6B 1P3GA 3W96C 3AZLC 1P3BA 4E45A 1TAFB 4NE3A 3MVDA 4DRAA 3C1CC 3REID 1HQ3D 5B32D 3X1UC 3WKJB 1JFIA 3LJAC 5CPJC 3TU4C 2HIOD 2JCHA 4WJ3C 1P3LC 3UT9C 2NZDB 3AZFA 3W99A 3REHB 1KX5A 3AZHD 3AZED 3KXBA 1PZRA 3KUYD 3REIC 5B31G 5B32C 1P3IA 1AOIA 5GXQB 2HIOC 1M19A 4WU9B 5B1MC 4KGCB 5F99A 4XZQB 2CV5D 1H3OB 5DNMD 5B33A 3AZEC 1P3AD 4KUDD 5B31D 1KX3D 3LELA 5GSUD 3LZ0C 3LZ1C 3REJD 1P34A 2PYOD 3B6FD 5B1LD 5B0YB 3H0RC 3WTPE 2CV5C 4H9QB 2RVQD 5DNMC 4R8PD 3B0DC 3WA9A 3P5JB 4X23D 4J8VB 2AROB 3H0MC 5B0ZA 4KUDC 5B31C 1KX3C 5CPKD 1M18D 1S32D 3MGRD 3EPKA 3AZKD 5B1LC 3X1VA 5E5AA 4J8WD 1P3GD 3R45A 1P3KB 2RVQC 4R8PC 2F8NH 1P3BD 5AV8B 4CAYA 3AV2A 4QLCA 3MVDD 3V9RB 1Q9CA 5B24B 4XUJA 3A6NC 2Y2KA 1S32C 3MGRC 3WAAC 3C1BB 3W96A 2ZY3A 3AZLA 2Y2GA 2F8NG 3EPJA 5AV9C 3MNNB 5JRGA 4DQYB 3UT9B 1ID3A 5DNND 3AN2B 4UPKA 3C1CA 2Y2PA 3AZFD 3X1UA 1N1JB 3W99D 3RELC 5BNXB 4WU8A 3AZND 5KDMA 3KXBD 3LJAA 3TU4A 5CPJA 1HQ3B 1P3LA 5B2IB 2VQRA 1P3ID 4Z5TD 1M19D 5DNNC 5CP6B 5B40B 5F99D 3REIA 2F2AC 3W99C 4Z2MH 5AV6A 3AZNC 3AZHB 5B33D 3AZEB 5B2JC 2HIOA 3KUYB 2IO5C 3MGQA 1Z2CB 5B1MA 3LELD 2FJ7D 4Z2MG 4Z5TC 3O62C 3AZGD 5AVCC 5F99C 3B0CT 3NQUA 3WA9D 3LZ0A 3LZ1A 1P3AB 5B0ZD 5B31B 4LD9D 2CV5A 2FJ7C 5GSUB 3REJB 2PYOB 3B6GC 5DNMA 3B6FB 4EO5C 3AZGC 3X1VD 5E5AD 2YFVA 3EG5B 1BH8B 4KUDA 1P3OA 5AY8A 4R8PB 3AZJB 4ZUXC 1KX3A 4X23B 4WNNB 3AV2D 5B0ZC 4XUJD 3AZMC 5CPKB 1M18B 4LD9C 1S32B 3W96D 3NQJA 3AZKB 2W8SA 5JRGD 4J8WB 1P3GB 1ID3D 1P3MB 1KX4C 3A6NA 3C1CD 3VH5A 1P3BB 3X1UD 3MGRA 3WAAA 4WU8D 3MVDB 1A7WA 5JA4A 5CPJD 3LJAD 4XUJC 3TU4D 5AV9A 3AV1A 1P3LD 4Z66C 4UUZA 1JFIB 3MGSC 3RELA 2Y2LA 2BG1A 5JRGC 3F6TA 1ID3C 3AZFB 1KU5A 3W99B 1P3FC 5AV6D 1KX5B 4WU8C 4CSRA 5G49A 3KXBB 4J8UD 5C3IB 5DNNA 3MGQD 1P3IB 5B1MD 1AOIB 2DF4C 3AZNA 1M19B 3AFAB 3AZIA 5B2JA 5F99B 4HGAC 5AV6C 3VH6W 5B33B 3LZ0D 3LZ1D 4J8UC 4Z5TA 4AWLB 2F8NA 5GT0C 3UTBA 3O62A 3X1TA 3MGQC 3LELB 5AVCA 3REKA 1M1AD 1P34B 4YS3C 1TZYC 1P3OD 5AY8D 2FJ7A 3WA9B 3B6GA 1T3UA 1EQZC 5B0ZB 3EPLA 3AZGA 2NQBD 1WWSA 1M1AC 4H9NA 5AV5B 4ZUXA 2HUEC 3A1KA 3X1VB 5E5AB 1BH9A 3R45B 1ZLAB 3W98C 2XD1A 1P3OC 2XD5A 5AY8C 3A6ND 3AZMA 3FDDA 4LD9A 2ZM5A 4CAYB 1W2EA 3WAAD 3AV2B 4QLCB 5GXQA 5AV9D 3AYWD 3AV1D 2NQBC 1KX4A 3W96B 3AZLB 2ZY2A 3RELD 1H3OA 1ID3B 3C1CB 3X1UB 4Z66A 4JJNC 2ZY4A 4G91C 5KDMB 3MGSA 3LJAB 5CPJB 3TU4B 3AYWC 2BYKA 3AV1C 1P3LB 3W97C 2FFFB 3MGPC 5B0YA 1P3FA 2YFWA 3AZID 5B2JD 3EPHA 3REIB 5B32B 3UTAD 5AV6B 1U35C 5BNVA 1F66C 2HIOB 3VH5T 2F8ND 3UTBD 3X1SC 3O62D 3X1TD 3WTPC 4J8XD 5B1MB 5AVCD 3REKD 1F1EA 1P3PC 3B0BA 4ZBJC 3AZIC 4J8UA 2BYMB 3NQUB 4H9SC 5GT0A 3UTAC 3LZ0B 3LZ1B 3B6GD 5CPIC 3UTBC 4J8XC 3X1TC 4YS3A 5BO0A 3REKC 2CV5B 5GT3A 4H9OA 5AVBC 1TZYA 3KWQC 4YM6C 5DNMB 2CWEA 4H9PA 4ZUXD 3B0DB 1EQZA 2YFVB 4KUDB 1P3OB 5AY8B 1KX3B 3AZMD 2J8PA 1M1AA 3WKJC 5B1LB 5GXQD 3W98A 2Y2OA 3H0LC 1KX4D 3NQJB 2NZDC 4WU9D 2Y2QA 1HTAA 3A6NB 2NQBA 4Z66D 3MGRB 3WAAB 2L5AA 5JA4B 3MGSD 5GXQC 5AV9B 4KHAA 4UUZB 4WU9C 5B0YD 3RELB 4NE6A 4XZQC 1P3FD 4JJNA 4KGCC 2JSSA 4H9RA 3AYWA 2Y2HA 2Y2MA 3W97A 5FUGA 4CSRB 3MGPA 5G49B 5BS7C 2UWXA 1B67A 1B6WA 5DNNB 5CHLB 5B0YC 3AZNB 1U35A 3AZIB 5B2JB 3AZJA 1F66A 1R4VA 3X1SA 3B0CW 5GT0D 2IO5B 2AROC 3WTPA 5B24D 4J8VC 4Z5TB 2F8NB 3UTBB 1P3PA 3C1BD 3O62B 4YS3D 5AVCB 5GT3D 4H9SA 3UTAA 1TZYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN2 D;  1P3M A;  5AV8 C;  1EQZ D;  5CPI A;  4J8X A;  5B24 C;  2FJ7 B;  3B6G B;  5AVB A;  3KWQ A;  5B2I D;  4YM6 A;  3C1B C;  1P3K C;  4EO5 B;  3AZG B;  1TAF A;  3W98 D;  5GT3 C;  4H9N B;  3MNN C;  3AN2 C;  4ZUX B;  5CP6 D;  5B40 D;  3WKJ A;  1BH9 B;  4WZS B;  3AZM B;  4LD9 B;  4NE5 A;  1HQ3 C;  3VH6 A;  5B2I C;  2NZD A;  3REH A;  1KX4 B;  3AFA A;  5CP6 C;  5B40 C;  4JJN D;  3AZH C;  4XUJ B;  4Z66 B;  3KUY C;  3W97 D;  4WU9 A;  3MGP D;  3MGS B;  4KGC A;  4XZQ A;  2BYK B;  5JRG B;  2LY8 A;  5BT1 D;  1P3F B;  1WWI A;  2YFW B;  4WU8 B;  1U35 D;  3AZJ D;  5BS7 A;  1F66 D;  3X1S D;  1BFM A;  1P3A C;  3WTP D;  5BNV B;  4M6B A;  5GSU C;  1P3P D;  4H9Q A;  3REJ C;  2PYO C;  5AV5 A;  5BT1 C;  3B6F C;  4HGA B;  4J8V A;  2ARO A;  1ZLA A;  1P3M D;  3AZJ C;  1ULY A;  4J8U B;  5CPI D;  5GT0 B;  4X23 C;  3MGQ B;  5CPK C;  3KSY A;  5AVB D;  3KWQ D;  1P3K A;  1M18 C;  4YM6 D;  2F8N K;  4DRB A;  4YS3 B;  5AV8 A;  5BO0 B;  3AZK C;  5GT3 B;  4H9O B;  1TZY B;  4J8W C;  1P3G C;  3V9R A;  5B24 A;  4H9P B;  1P3M C;  1P3B C;  1EQZ B;  3WKJ D;  1KX5 D;  3C1B A;  3MVD C;  4G92 C;  1M1A B;  3MNN A;  3UT9 A;  2NZD D;  3AN2 A;  2HUE B;  1AOI D;  1N1J A;  3W98 B;  5BNX A;  3REH D;  3AFA D;  3AZF C;  1HQ3 A;  5B32 A;  5B2I A;  1KX5 C;  4E44 A;  3KXB C;  2NQB B;  5C3I C;  1P3I C;  4NFT A;  5B40 A;  5CP6 A;  1AOI C;  4XZQ D;  4KGC D;  1P34 D;  4KHA B;  3REH C;  1M19 C;  3AZH A;  3AFA C;  3AZE A;  3KUY A;  2BYM A;  4JJN B;  4G91 B;  4H9R B;  5B33 C;  3AYW B;  3AV1 B;  4AWL C;  3W97 B;  5FUG B;  3MGP B;  3LEL C;  3VH5 W;  1P34 C;  5AV5 D;  3VH6 T;  1P3A A;  4J8V D;  2ARO D;  1ZLA D;  1U35 B;  5B31 A;  1F66 B;  5GSU A;  3X1S B;  3REJ A;  2PYO A;  3WA9 C;  4QLC D;  3WTP B;  3B6F A;  5B1L A;  1P3K D;  1P3P B;  1BH8 A;  5AV5 C;  3AZL D;  4R8P A;  4ZBJ B;  5AV8 D;  4X23 A;  4WNN A;  5E5A C;  3X1V C;  3UTA B;  1ZLA C;  4WV4 B;  5B32 G;  5CPK A;  1M18 A;  5CPI B;  1S32 A;  3AV2 C;  4QLC C;  4G92 B;  4J8X B;  3X1T B;  3AZK A;  3REK B;  3MNN D;  5AVB B;  3KWQ B;  4J8W A;  3UT9 D;  4YM6 B;  1P3G A;  3W96 C;  3AZL C;  1P3B A;  4E45 A;  1TAF B;  4NE3 A;  3MVD A;  4DRA A;  3C1C C;  3REI D;  1HQ3 D;  5B32 D;  3X1U C;  3WKJ B;  1JFI A;  3LJA C;  5CPJ C;  3TU4 C;  2HIO D;  1P3L C;  3UT9 C;  2NZD B;  3AZF A;  3W99 A;  3REH B;  1KX5 A;  3AZH D;  3AZE D;  3KXB A;  3KUY D;  3REI C;  5B31 G;  5B32 C;  1P3I A;  1AOI A;  5GXQ B;  2HIO C;  1M19 A;  4WU9 B;  5B1M C;  4KGC B;  5F99 A;  4XZQ B;  2CV5 D;  1H3O B;  5DNM D;  5B33 A;  3AZE C;  1P3A D;  4KUD D;  5B31 D;  1KX3 D;  3LEL A;  5GSU D;  3LZ0 C;  3LZ1 C;  3REJ D;  1P34 A;  2PYO D;  3B6F D;  5B1L D;  5B0Y B;  3WTP E;  2CV5 C;  4H9Q B;  2RVQ D;  5DNM C;  4R8P D;  3B0D C;  3WA9 A;  4X23 D;  4J8V B;  2ARO B;  5B0Z A;  4KUD C;  5B31 C;  1KX3 C;  5CPK D;  1M18 D;  1S32 D;  3MGR D;  3AZK D;  5B1L C;  3X1V A;  5E5A A;  4J8W D;  1P3G D;  3R45 A;  1P3K B;  2RVQ C;  4R8P C;  2F8N H;  1P3B D;  5AV8 B;  4CAY A;  3AV2 A;  4QLC A;  3MVD D;  3V9R B;  1Q9C A;  5B24 B;  4XUJ A;  3A6N C;  1S32 C;  3MGR C;  3WAA C;  3C1B B;  3W96 A;  3AZL A;  2F8N G;  5AV9 C;  3MNN B;  5JRG A;  3UT9 B;  1ID3 A;  5DNN D;  3AN2 B;  3C1C A;  3AZF D;  3X1U A;  1N1J B;  3W99 D;  3REL C;  5BNX B;  4WU8 A;  3AZN D;  5KDM A;  3KXB D;  3LJA A;  3TU4 A;  5CPJ A;  1HQ3 B;  1P3L A;  5B2I B;  1P3I D;  4Z5T D;  1M19 D;  5DNN C;  5CP6 B;  5B40 B;  5F99 D;  3REI A;  3W99 C;  4Z2M H;  5AV6 A;  3AZN C;  3AZH B;  5B33 D;  3AZE B;  5B2J C;  2HIO A;  3KUY B;  2IO5 C;  3MGQ A;  5B1M A;  3LEL D;  2FJ7 D;  4Z2M G;  4Z5T C;  3O62 C;  3AZG D;  5AVC C;  5F99 C;  3B0C T;  3NQU A;  3WA9 D;  3LZ0 A;  3LZ1 A;  1P3A B;  5B0Z D;  5B31 B;  4LD9 D;  2CV5 A;  2FJ7 C;  5GSU B;  3REJ B;  2PYO B;  3B6G C;  5DNM A;  3B6F B;  4EO5 C;  3AZG C;  3X1V D;  5E5A D;  2YFV A;  1BH8 B;  4KUD A;  1P3O A;  5AY8 A;  4R8P B;  3AZJ B;  4ZUX C;  1KX3 A;  4X23 B;  4WNN B;  3AV2 D;  5B0Z C;  4XUJ D;  3AZM C;  5CPK B;  1M18 B;  4LD9 C;  1S32 B;  3W96 D;  3NQJ A;  3AZK B;  5JRG D;  4J8W B;  1P3G B;  1ID3 D;  1P3M B;  1KX4 C;  3A6N A;  3C1C D;  3VH5 A;  1P3B B;  3X1U D;  3MGR A;  3WAA A;  4WU8 D;  3MVD B;  1A7W A;  5JA4 A;  5CPJ D;  3LJA D;  4XUJ C;  3TU4 D;  5AV9 A;  3AV1 A;  1P3L D;  4Z66 C;  4UUZ A;  1JFI B;  3MGS C;  3REL A;  5JRG C;  1ID3 C;  3AZF B;  1KU5 A;  3W99 B;  1P3F C;  5AV6 D;  1KX5 B;  4WU8 C;  4CSR A;  5G49 A;  3KXB B;  4J8U D;  5C3I B;  5DNN A;  3MGQ D;  1P3I B;  5B1M D;  1AOI B;  3AZN A;  1M19 B;  3AFA B;  3AZI A;  5B2J A;  5F99 B;  4HGA C;  5AV6 C;  3VH6 W;  5B33 B;  3LZ0 D;  3LZ1 D;  4J8U C;  4Z5T A;  4AWL B;  2F8N A;  5GT0 C;  3UTB A;  3O62 A;  3X1T A;  3MGQ C;  3LEL B;  5AVC A;  3REK A;  1M1A D;  1P34 B;  4YS3 C;  1TZY C;  1P3O D;  5AY8 D;  2FJ7 A;  3WA9 B;  3B6G A;  1EQZ C;  5B0Z B;  3AZG A;  2NQB D;  1WWS A;  1M1A C;  4H9N A;  5AV5 B;  4ZUX A;  2HUE C;  3X1V B;  5E5A B;  1BH9 A;  3R45 B;  1ZLA B;  3W98 C;  1P3O C;  3A6N D;  5AY8 C;  3AZM A;  4LD9 A;  4CAY B;  3WAA D;  3AV2 B;  4QLC B;  5GXQ A;  5AV9 D;  3AYW D;  3AV1 D;  2NQB C;  1KX4 A;  3W96 B;  3AZL B;  3REL D;  1H3O A;  1ID3 B;  3C1C B;  3X1U B;  4Z66 A;  4JJN C;  4G91 C;  5KDM B;  3MGS A;  3LJA B;  5CPJ B;  3TU4 B;  3AYW C;  2BYK A;  3AV1 C;  1P3L B;  3W97 C;  3MGP C;  5B0Y A;  1P3F A;  2YFW A;  3AZI D;  5B2J D;  3REI B;  5B32 B;  3UTA D;  5AV6 B;  1U35 C;  5BNV A;  1F66 C;  2HIO B;  3VH5 T;  2F8N D;  3UTB D;  3X1S C;  3O62 D;  3X1T D;  3WTP C;  4J8X D;  5B1M B;  5AVC D;  3REK D;  1F1E A;  1P3P C;  3B0B A;  4ZBJ C;  3AZI C;  4J8U A;  2BYM B;  3NQU B;  4H9S C;  5GT0 A;  3UTA C;  3LZ0 B;  3LZ1 B;  3B6G D;  5CPI C;  3UTB C;  4J8X C;  3X1T C;  4YS3 A;  5BO0 A;  3REK C;  2CV5 B;  5GT3 A;  4H9O A;  5AVB C;  1TZY A;  3KWQ C;  4YM6 C;  5DNM B;  2CWE A;  4H9P A;  4ZUX D;  3B0D B;  1EQZ A;  2YFV B;  4KUD B;  1P3O B;  5AY8 B;  1KX3 B;  3AZM D;  1M1A A;  3WKJ C;  5B1L B;  5GXQ D;  3W98 A;  1KX4 D;  3NQJ B;  2NZD C;  4WU9 D;  1HTA A;  3A6N B;  2NQB A;  4Z66 D;  3MGR B;  3WAA B;  2L5A A;  5JA4 B;  3MGS D;  5GXQ C;  5AV9 B;  4KHA A;  4UUZ B;  4WU9 C;  5B0Y D;  3REL B;  4NE6 A;  4XZQ C;  1P3F D;  4JJN A;  4KGC C;  2JSS A;  4H9R A;  3AYW A;  3W97 A;  5FUG A;  4CSR B;  3MGP A;  5G49 B;  5BS7 C;  1B67 A;  1B6W A;  5DNN B;  5CHL B;  5B0Y C;  3AZN B;  1U35 A;  3AZI B;  5B2J B;  3AZJ A;  1F66 A;  1R4V A;  3X1S A;  3B0C W;  5GT0 D;  2IO5 B;  2ARO C;  3WTP A;  5B24 D;  4J8V C;  4Z5T B;  2F8N B;  3UTB B;  1P3P A;  3C1B D;  3O62 B;  4YS3 D;  5AVC B;  5GT3 D;  4H9S A;  3UTA A;  1TZY D; 
#chains in the Genus database with same CATH topology
 3AN2 D;  1P3M A;  5AV8 C;  1EQZ D;  5CPI A;  4J8X A;  5B24 C;  2FJ7 B;  3B6G B;  5AVB A;  3KWQ A;  5B2I D;  4YM6 A;  3C1B C;  1P3K C;  4EO5 B;  3AZG B;  1TAF A;  3W98 D;  5GT3 C;  4H9N B;  3MNN C;  3AN2 C;  4ZUX B;  5CP6 D;  5B40 D;  3IP4 C;  3WKJ A;  1BH9 B;  4WZS B;  3AZM B;  4LD9 B;  4NE5 A;  1HQ3 C;  3VH6 A;  5B2I C;  2NZD A;  2Y2J A;  3REH A;  1KX4 B;  3AFA A;  5CP6 C;  5B40 C;  3A1I A;  4JJN D;  3AZH C;  4XUJ B;  4Z66 B;  3KUY C;  3W97 D;  2Y2N A;  4WU9 A;  3MGP D;  3MGS B;  4KGC A;  4XZQ A;  2BYK B;  5JRG B;  2LY8 A;  5BT1 D;  2G5H C;  1P3F B;  1WWI A;  2YFW B;  4WU8 B;  1U35 D;  3AZJ D;  5BS7 A;  1F66 D;  3X1S D;  1BFM A;  1P3A C;  3WTP D;  2G5I C;  5BNV B;  4M6B A;  2JE5 A;  5GSU C;  1P3P D;  4H9Q A;  3REJ C;  2PYO C;  5AV5 A;  5BT1 C;  3B6F C;  4HGA B;  4J8V A;  2ARO A;  1ZLA A;  1P3M D;  3AZJ C;  1ULY A;  4J8U B;  2DQN C;  5CPI D;  5GT0 B;  4X23 C;  3MGQ B;  5CPK C;  3KSY A;  5AVB D;  3KWQ D;  1P3K A;  1M18 C;  4YM6 D;  2F8N K;  4DRB A;  2RIQ A;  3AL0 C;  4YS3 B;  5AV8 A;  5BO0 B;  3AZK C;  5GT3 B;  4H9O B;  1TZY B;  4J8W C;  1P3G C;  3V9R A;  5B24 A;  4H9P B;  1P3M C;  1P3B C;  1EQZ B;  3WKJ D;  1KX5 D;  3C1B A;  3MVD C;  4G92 C;  1M1A B;  3MNN A;  3UT9 A;  2NZD D;  3AN2 A;  2HUE B;  1AOI D;  1N1J A;  3W98 B;  5BNX A;  3REH D;  2Y2I A;  3AFA D;  3AZF C;  1HQ3 A;  5B32 A;  5B2I A;  1KX5 C;  4E44 A;  3KXB C;  2NQB B;  5C3I C;  1P3I C;  4NFT A;  5B40 A;  5CP6 A;  1AOI C;  4XZQ D;  4KGC D;  1P34 D;  4KHA B;  3REH C;  1M19 C;  3AZH A;  3AFA C;  3AZE A;  3KUY A;  2BYM A;  4JJN B;  3KFU G;  4G91 B;  4H9R B;  5B33 C;  3AYW B;  3AV1 B;  4AWL C;  3W97 B;  5FUG B;  3MGP B;  3LEL C;  3VH5 W;  1P34 C;  5AV5 D;  2ZY5 A;  3VH6 T;  1P3A A;  4J8V D;  2ARO D;  1ZLA D;  1U35 B;  5B31 A;  1F66 B;  5GSU A;  3X1S B;  3REJ A;  2PYO A;  3WA9 C;  4QLC D;  3WTP B;  3B6F A;  5B1L A;  1P3K D;  1P3P B;  1BH8 A;  5AV5 C;  3AZL D;  4R8P A;  4ZBJ B;  5AV8 D;  4X23 A;  4WNN A;  5E5A C;  3X1V C;  3UTA B;  1ZLA C;  4WV4 B;  5B32 G;  5CPK A;  1M18 A;  5CPI B;  1S32 A;  3AV2 C;  4QLC C;  4G92 B;  4J8X B;  3X1T B;  3AZK A;  3REK B;  3MNN D;  5AVB B;  3KWQ B;  4J8W A;  3UT9 D;  4YM6 B;  1P3G A;  3W96 C;  3AZL C;  1P3B A;  4E45 A;  1TAF B;  4NE3 A;  3MVD A;  4DRA A;  3C1C C;  3REI D;  1HQ3 D;  5B32 D;  3X1U C;  3WKJ B;  1JFI A;  3LJA C;  5CPJ C;  3TU4 C;  2HIO D;  2JCH A;  4WJ3 C;  1P3L C;  3UT9 C;  2NZD B;  3AZF A;  3W99 A;  3REH B;  1KX5 A;  3AZH D;  3AZE D;  3KXB A;  1PZR A;  3KUY D;  3REI C;  5B31 G;  5B32 C;  1P3I A;  1AOI A;  5GXQ B;  2HIO C;  1M19 A;  4WU9 B;  5B1M C;  4KGC B;  5F99 A;  4XZQ B;  2CV5 D;  1H3O B;  5DNM D;  5B33 A;  3AZE C;  1P3A D;  4KUD D;  5B31 D;  1KX3 D;  3LEL A;  5GSU D;  3LZ0 C;  3LZ1 C;  3REJ D;  1P34 A;  2PYO D;  3B6F D;  5B1L D;  5B0Y B;  3H0R C;  3WTP E;  2CV5 C;  4H9Q B;  2RVQ D;  5DNM C;  4R8P D;  3B0D C;  3WA9 A;  3P5J B;  4X23 D;  4J8V B;  2ARO B;  3H0M C;  5B0Z A;  4KUD C;  5B31 C;  1KX3 C;  5CPK D;  1M18 D;  1S32 D;  3MGR D;  3EPK A;  3AZK D;  5B1L C;  3X1V A;  5E5A A;  4J8W D;  1P3G D;  3R45 A;  1P3K B;  2RVQ C;  4R8P C;  2F8N H;  1P3B D;  5AV8 B;  4CAY A;  3AV2 A;  4QLC A;  3MVD D;  3V9R B;  1Q9C A;  5B24 B;  4XUJ A;  3A6N C;  2Y2K A;  1S32 C;  3MGR C;  3WAA C;  3C1B B;  3W96 A;  2ZY3 A;  3AZL A;  2Y2G A;  2F8N G;  3EPJ A;  5AV9 C;  3MNN B;  5JRG A;  4DQY B;  3UT9 B;  1ID3 A;  5DNN D;  3AN2 B;  4UPK A;  3C1C A;  2Y2P A;  3AZF D;  3X1U A;  1N1J B;  3W99 D;  3REL C;  5BNX B;  4WU8 A;  3AZN D;  5KDM A;  3KXB D;  3LJA A;  3TU4 A;  5CPJ A;  1HQ3 B;  1P3L A;  5B2I B;  2VQR A;  1P3I D;  4Z5T D;  1M19 D;  5DNN C;  5CP6 B;  5B40 B;  5F99 D;  3REI A;  2F2A C;  3W99 C;  4Z2M H;  5AV6 A;  3AZN C;  3AZH B;  5B33 D;  3AZE B;  5B2J C;  2HIO A;  3KUY B;  2IO5 C;  3MGQ A;  1Z2C B;  5B1M A;  3LEL D;  2FJ7 D;  4Z2M G;  4Z5T C;  3O62 C;  3AZG D;  5AVC C;  5F99 C;  3B0C T;  3NQU A;  3WA9 D;  3LZ0 A;  3LZ1 A;  1P3A B;  5B0Z D;  5B31 B;  4LD9 D;  2CV5 A;  2FJ7 C;  5GSU B;  3REJ B;  2PYO B;  3B6G C;  5DNM A;  3B6F B;  4EO5 C;  3AZG C;  3X1V D;  5E5A D;  2YFV A;  3EG5 B;  1BH8 B;  4KUD A;  1P3O A;  5AY8 A;  4R8P B;  3AZJ B;  4ZUX C;  1KX3 A;  4X23 B;  4WNN B;  3AV2 D;  5B0Z C;  4XUJ D;  3AZM C;  5CPK B;  1M18 B;  4LD9 C;  1S32 B;  3W96 D;  3NQJ A;  3AZK B;  2W8S A;  5JRG D;  4J8W B;  1P3G B;  1ID3 D;  1P3M B;  1KX4 C;  3A6N A;  3C1C D;  3VH5 A;  1P3B B;  3X1U D;  3MGR A;  3WAA A;  4WU8 D;  3MVD B;  1A7W A;  5JA4 A;  5CPJ D;  3LJA D;  4XUJ C;  3TU4 D;  5AV9 A;  3AV1 A;  1P3L D;  4Z66 C;  4UUZ A;  1JFI B;  3MGS C;  3REL A;  2Y2L A;  2BG1 A;  5JRG C;  3F6T A;  1ID3 C;  3AZF B;  1KU5 A;  3W99 B;  1P3F C;  5AV6 D;  1KX5 B;  4WU8 C;  4CSR A;  5G49 A;  3KXB B;  4J8U D;  5C3I B;  5DNN A;  3MGQ D;  1P3I B;  5B1M D;  1AOI B;  2DF4 C;  3AZN A;  1M19 B;  3AFA B;  3AZI A;  5B2J A;  5F99 B;  4HGA C;  5AV6 C;  3VH6 W;  5B33 B;  3LZ0 D;  3LZ1 D;  4J8U C;  4Z5T A;  4AWL B;  2F8N A;  5GT0 C;  3UTB A;  3O62 A;  3X1T A;  3MGQ C;  3LEL B;  5AVC A;  3REK A;  1M1A D;  1P34 B;  4YS3 C;  1TZY C;  1P3O D;  5AY8 D;  2FJ7 A;  3WA9 B;  3B6G A;  1T3U A;  1EQZ C;  5B0Z B;  3EPL A;  3AZG A;  2NQB D;  1WWS A;  1M1A C;  4H9N A;  5AV5 B;  4ZUX A;  2HUE C;  3A1K A;  3X1V B;  5E5A B;  1BH9 A;  3R45 B;  1ZLA B;  3W98 C;  2XD1 A;  1P3O C;  2XD5 A;  5AY8 C;  3A6N D;  3AZM A;  3FDD A;  4LD9 A;  2ZM5 A;  4CAY B;  1W2E A;  3WAA D;  3AV2 B;  4QLC B;  5GXQ A;  5AV9 D;  3AYW D;  3AV1 D;  2NQB C;  1KX4 A;  3W96 B;  3AZL B;  2ZY2 A;  3REL D;  1H3O A;  1ID3 B;  3C1C B;  3X1U B;  4Z66 A;  4JJN C;  2ZY4 A;  4G91 C;  5KDM B;  3MGS A;  3LJA B;  5CPJ B;  3TU4 B;  3AYW C;  2BYK A;  3AV1 C;  1P3L B;  3W97 C;  2FFF B;  3MGP C;  5B0Y A;  1P3F A;  2YFW A;  3AZI D;  5B2J D;  3EPH A;  3REI B;  5B32 B;  3UTA D;  5AV6 B;  1U35 C;  5BNV A;  1F66 C;  2HIO B;  3VH5 T;  2F8N D;  3UTB D;  3X1S C;  3O62 D;  3X1T D;  3WTP C;  4J8X D;  5B1M B;  5AVC D;  3REK D;  1F1E A;  1P3P C;  3B0B A;  4ZBJ C;  3AZI C;  4J8U A;  2BYM B;  3NQU B;  4H9S C;  5GT0 A;  3UTA C;  3LZ0 B;  3LZ1 B;  3B6G D;  5CPI C;  3UTB C;  4J8X C;  3X1T C;  4YS3 A;  5BO0 A;  3REK C;  2CV5 B;  5GT3 A;  4H9O A;  5AVB C;  1TZY A;  3KWQ C;  4YM6 C;  5DNM B;  2CWE A;  4H9P A;  4ZUX D;  3B0D B;  1EQZ A;  2YFV B;  4KUD B;  1P3O B;  5AY8 B;  1KX3 B;  3AZM D;  2J8P A;  1M1A A;  3WKJ C;  5B1L B;  5GXQ D;  3W98 A;  2Y2O A;  3H0L C;  1KX4 D;  3NQJ B;  2NZD C;  4WU9 D;  2Y2Q A;  1HTA A;  3A6N B;  2NQB A;  4Z66 D;  3MGR B;  3WAA B;  2L5A A;  5JA4 B;  3MGS D;  5GXQ C;  5AV9 B;  4KHA A;  4UUZ B;  4WU9 C;  5B0Y D;  3REL B;  4NE6 A;  4XZQ C;  1P3F D;  4JJN A;  4KGC C;  2JSS A;  4H9R A;  3AYW A;  2Y2H A;  2Y2M A;  3W97 A;  5FUG A;  4CSR B;  3MGP A;  5G49 B;  5BS7 C;  2UWX A;  1B67 A;  1B6W A;  5DNN B;  5CHL B;  5B0Y C;  3AZN B;  1U35 A;  3AZI B;  5B2J B;  3AZJ A;  1F66 A;  1R4V A;  3X1S A;  3B0C W;  5GT0 D;  2IO5 B;  2ARO C;  3WTP A;  5B24 D;  4J8V C;  4Z5T B;  2F8N B;  3UTB B;  1P3P A;  3C1B D;  3O62 B;  4YS3 D;  5AVC B;  5GT3 D;  4H9S A;  3UTA A;  1TZY D; 
#chains in the Genus database with same CATH homology
 3AN2 D;  1P3M A;  5AV8 C;  1EQZ D;  5CPI A;  4J8X A;  5B24 C;  2FJ7 B;  3B6G B;  5AVB A;  3KWQ A;  5B2I D;  4YM6 A;  3C1B C;  1P3K C;  4EO5 B;  3AZG B;  1TAF A;  3W98 D;  5GT3 C;  4H9N B;  3MNN C;  3AN2 C;  4ZUX B;  5CP6 D;  5B40 D;  3IP4 C;  3WKJ A;  1BH9 B;  4WZS B;  3AZM B;  4LD9 B;  4NE5 A;  1HQ3 C;  3VH6 A;  5B2I C;  2NZD A;  2Y2J A;  3REH A;  1KX4 B;  3AFA A;  5CP6 C;  5B40 C;  3A1I A;  4JJN D;  3AZH C;  4XUJ B;  4Z66 B;  3KUY C;  3W97 D;  2Y2N A;  4WU9 A;  3MGP D;  3MGS B;  4KGC A;  4XZQ A;  2BYK B;  5JRG B;  2LY8 A;  5BT1 D;  2G5H C;  1P3F B;  1WWI A;  2YFW B;  4WU8 B;  1U35 D;  3AZJ D;  5BS7 A;  1F66 D;  3X1S D;  1BFM A;  1P3A C;  3WTP D;  2G5I C;  5BNV B;  4M6B A;  2JE5 A;  5GSU C;  1P3P D;  4H9Q A;  3REJ C;  2PYO C;  5AV5 A;  5BT1 C;  3B6F C;  4HGA B;  4J8V A;  2ARO A;  1ZLA A;  1P3M D;  3AZJ C;  1ULY A;  4J8U B;  2DQN C;  5CPI D;  5GT0 B;  4X23 C;  3MGQ B;  5CPK C;  3KSY A;  5AVB D;  3KWQ D;  1P3K A;  1M18 C;  4YM6 D;  2F8N K;  4DRB A;  2RIQ A;  3AL0 C;  4YS3 B;  5AV8 A;  5BO0 B;  3AZK C;  5GT3 B;  4H9O B;  1TZY B;  4J8W C;  1P3G C;  3V9R A;  5B24 A;  4H9P B;  1P3M C;  1P3B C;  1EQZ B;  3WKJ D;  1KX5 D;  3C1B A;  3MVD C;  4G92 C;  1M1A B;  3MNN A;  3UT9 A;  2NZD D;  3AN2 A;  2HUE B;  1AOI D;  1N1J A;  3W98 B;  5BNX A;  3REH D;  2Y2I A;  3AFA D;  3AZF C;  1HQ3 A;  5B32 A;  5B2I A;  1KX5 C;  4E44 A;  3KXB C;  2NQB B;  5C3I C;  1P3I C;  4NFT A;  5B40 A;  5CP6 A;  1AOI C;  4XZQ D;  4KGC D;  1P34 D;  4KHA B;  3REH C;  1M19 C;  3AZH A;  3AFA C;  3AZE A;  3KUY A;  2BYM A;  4JJN B;  3KFU G;  4G91 B;  4H9R B;  5B33 C;  3AYW B;  3AV1 B;  4AWL C;  3W97 B;  5FUG B;  3MGP B;  3LEL C;  3VH5 W;  1P34 C;  5AV5 D;  2ZY5 A;  3VH6 T;  1P3A A;  4J8V D;  2ARO D;  1ZLA D;  1U35 B;  5B31 A;  1F66 B;  5GSU A;  3X1S B;  3REJ A;  2PYO A;  3WA9 C;  4QLC D;  3WTP B;  3B6F A;  5B1L A;  1P3K D;  1P3P B;  1BH8 A;  5AV5 C;  3AZL D;  4R8P A;  4ZBJ B;  5AV8 D;  4X23 A;  4WNN A;  5E5A C;  3X1V C;  3UTA B;  1ZLA C;  4WV4 B;  5B32 G;  5CPK A;  1M18 A;  5CPI B;  1S32 A;  3AV2 C;  4QLC C;  4G92 B;  4J8X B;  3X1T B;  3AZK A;  3REK B;  3MNN D;  5AVB B;  3KWQ B;  4J8W A;  3UT9 D;  4YM6 B;  1P3G A;  3W96 C;  3AZL C;  1P3B A;  4E45 A;  1TAF B;  4NE3 A;  3MVD A;  4DRA A;  3C1C C;  3REI D;  1HQ3 D;  5B32 D;  3X1U C;  3WKJ B;  1JFI A;  3LJA C;  5CPJ C;  3TU4 C;  2HIO D;  2JCH A;  4WJ3 C;  1P3L C;  3UT9 C;  2NZD B;  3AZF A;  3W99 A;  3REH B;  1KX5 A;  3AZH D;  3AZE D;  3KXB A;  1PZR A;  3KUY D;  3REI C;  5B31 G;  5B32 C;  1P3I A;  1AOI A;  5GXQ B;  2HIO C;  1M19 A;  4WU9 B;  5B1M C;  4KGC B;  5F99 A;  4XZQ B;  2CV5 D;  1H3O B;  5DNM D;  5B33 A;  3AZE C;  1P3A D;  4KUD D;  5B31 D;  1KX3 D;  3LEL A;  5GSU D;  3LZ0 C;  3LZ1 C;  3REJ D;  1P34 A;  2PYO D;  3B6F D;  5B1L D;  5B0Y B;  3H0R C;  3WTP E;  2CV5 C;  4H9Q B;  2RVQ D;  5DNM C;  4R8P D;  3B0D C;  3WA9 A;  3P5J B;  4X23 D;  4J8V B;  2ARO B;  3H0M C;  5B0Z A;  4KUD C;  5B31 C;  1KX3 C;  5CPK D;  1M18 D;  1S32 D;  3MGR D;  3EPK A;  3AZK D;  5B1L C;  3X1V A;  5E5A A;  4J8W D;  1P3G D;  3R45 A;  1P3K B;  2RVQ C;  4R8P C;  2F8N H;  1P3B D;  5AV8 B;  4CAY A;  3AV2 A;  4QLC A;  3MVD D;  3V9R B;  1Q9C A;  5B24 B;  4XUJ A;  3A6N C;  2Y2K A;  1S32 C;  3MGR C;  3WAA C;  3C1B B;  3W96 A;  2ZY3 A;  3AZL A;  2Y2G A;  2F8N G;  3EPJ A;  5AV9 C;  3MNN B;  5JRG A;  4DQY B;  3UT9 B;  1ID3 A;  5DNN D;  3AN2 B;  4UPK A;  3C1C A;  2Y2P A;  3AZF D;  3X1U A;  1N1J B;  3W99 D;  3REL C;  5BNX B;  4WU8 A;  3AZN D;  5KDM A;  3KXB D;  3LJA A;  3TU4 A;  5CPJ A;  1HQ3 B;  1P3L A;  5B2I B;  2VQR A;  1P3I D;  4Z5T D;  1M19 D;  5DNN C;  5CP6 B;  5B40 B;  5F99 D;  3REI A;  2F2A C;  3W99 C;  4Z2M H;  5AV6 A;  3AZN C;  3AZH B;  5B33 D;  3AZE B;  5B2J C;  2HIO A;  3KUY B;  2IO5 C;  3MGQ A;  1Z2C B;  5B1M A;  3LEL D;  2FJ7 D;  4Z2M G;  4Z5T C;  3O62 C;  3AZG D;  5AVC C;  5F99 C;  3B0C T;  3NQU A;  3WA9 D;  3LZ0 A;  3LZ1 A;  1P3A B;  5B0Z D;  5B31 B;  4LD9 D;  2CV5 A;  2FJ7 C;  5GSU B;  3REJ B;  2PYO B;  3B6G C;  5DNM A;  3B6F B;  4EO5 C;  3AZG C;  3X1V D;  5E5A D;  2YFV A;  3EG5 B;  1BH8 B;  4KUD A;  1P3O A;  5AY8 A;  4R8P B;  3AZJ B;  4ZUX C;  1KX3 A;  4X23 B;  4WNN B;  3AV2 D;  5B0Z C;  4XUJ D;  3AZM C;  5CPK B;  1M18 B;  4LD9 C;  1S32 B;  3W96 D;  3NQJ A;  3AZK B;  2W8S A;  5JRG D;  4J8W B;  1P3G B;  1ID3 D;  1P3M B;  1KX4 C;  3A6N A;  3C1C D;  3VH5 A;  1P3B B;  3X1U D;  3MGR A;  3WAA A;  4WU8 D;  3MVD B;  1A7W A;  5JA4 A;  5CPJ D;  3LJA D;  4XUJ C;  3TU4 D;  5AV9 A;  3AV1 A;  1P3L D;  4Z66 C;  4UUZ A;  1JFI B;  3MGS C;  3REL A;  2Y2L A;  2BG1 A;  5JRG C;  3F6T A;  1ID3 C;  3AZF B;  1KU5 A;  3W99 B;  1P3F C;  5AV6 D;  1KX5 B;  4WU8 C;  4CSR A;  5G49 A;  3KXB B;  4J8U D;  5C3I B;  5DNN A;  3MGQ D;  1P3I B;  5B1M D;  1AOI B;  2DF4 C;  3AZN A;  1M19 B;  3AFA B;  3AZI A;  5B2J A;  5F99 B;  4HGA C;  5AV6 C;  3VH6 W;  5B33 B;  3LZ0 D;  3LZ1 D;  4J8U C;  4Z5T A;  4AWL B;  2F8N A;  5GT0 C;  3UTB A;  3O62 A;  3X1T A;  3MGQ C;  3LEL B;  5AVC A;  3REK A;  1M1A D;  1P34 B;  4YS3 C;  1TZY C;  1P3O D;  5AY8 D;  2FJ7 A;  3WA9 B;  3B6G A;  1T3U A;  1EQZ C;  5B0Z B;  3EPL A;  3AZG A;  2NQB D;  1WWS A;  1M1A C;  4H9N A;  5AV5 B;  4ZUX A;  2HUE C;  3A1K A;  3X1V B;  5E5A B;  1BH9 A;  3R45 B;  1ZLA B;  3W98 C;  2XD1 A;  1P3O C;  2XD5 A;  5AY8 C;  3A6N D;  3AZM A;  3FDD A;  4LD9 A;  2ZM5 A;  4CAY B;  1W2E A;  3WAA D;  3AV2 B;  4QLC B;  5GXQ A;  5AV9 D;  3AYW D;  3AV1 D;  2NQB C;  1KX4 A;  3W96 B;  3AZL B;  2ZY2 A;  3REL D;  1H3O A;  1ID3 B;  3C1C B;  3X1U B;  4Z66 A;  4JJN C;  2ZY4 A;  4G91 C;  5KDM B;  3MGS A;  3LJA B;  5CPJ B;  3TU4 B;  3AYW C;  2BYK A;  3AV1 C;  1P3L B;  3W97 C;  2FFF B;  3MGP C;  5B0Y A;  1P3F A;  2YFW A;  3AZI D;  5B2J D;  3EPH A;  3REI B;  5B32 B;  3UTA D;  5AV6 B;  1U35 C;  5BNV A;  1F66 C;  2HIO B;  3VH5 T;  2F8N D;  3UTB D;  3X1S C;  3O62 D;  3X1T D;  3WTP C;  4J8X D;  5B1M B;  5AVC D;  3REK D;  1F1E A;  1P3P C;  3B0B A;  4ZBJ C;  3AZI C;  4J8U A;  2BYM B;  3NQU B;  4H9S C;  5GT0 A;  3UTA C;  3LZ0 B;  3LZ1 B;  3B6G D;  5CPI C;  3UTB C;  4J8X C;  3X1T C;  4YS3 A;  5BO0 A;  3REK C;  2CV5 B;  5GT3 A;  4H9O A;  5AVB C;  1TZY A;  3KWQ C;  4YM6 C;  5DNM B;  2CWE A;  4H9P A;  4ZUX D;  3B0D B;  1EQZ A;  2YFV B;  4KUD B;  1P3O B;  5AY8 B;  1KX3 B;  3AZM D;  2J8P A;  1M1A A;  3WKJ C;  5B1L B;  5GXQ D;  3W98 A;  2Y2O A;  3H0L C;  1KX4 D;  3NQJ B;  2NZD C;  4WU9 D;  2Y2Q A;  1HTA A;  3A6N B;  2NQB A;  4Z66 D;  3MGR B;  3WAA B;  2L5A A;  5JA4 B;  3MGS D;  5GXQ C;  5AV9 B;  4KHA A;  4UUZ B;  4WU9 C;  5B0Y D;  3REL B;  4NE6 A;  4XZQ C;  1P3F D;  4JJN A;  4KGC C;  2JSS A;  4H9R A;  3AYW A;  2Y2H A;  2Y2M A;  3W97 A;  5FUG A;  4CSR B;  3MGP A;  5G49 B;  5BS7 C;  2UWX A;  1B67 A;  1B6W A;  5DNN B;  5CHL B;  5B0Y C;  3AZN B;  1U35 A;  3AZI B;  5B2J B;  3AZJ A;  1F66 A;  1R4V A;  3X1S A;  3B0C W;  5GT0 D;  2IO5 B;  2ARO C;  3WTP A;  5B24 D;  4J8V C;  4Z5T B;  2F8N B;  3UTB B;  1P3P A;  3C1B D;  3O62 B;  4YS3 D;  5AVC B;  5GT3 D;  4H9S A;  3UTA A;  1TZY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...