1B67A

Crystal structure of the histone hmfa from methanothermus fervidus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
68
structure length
68
Chain Sequence
GELPIAPIGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARKMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords PROTEIN (HISTONE HMFA)
publication title Crystal structures of recombinant histones HMfA and HMfB from the hyperthermophilic archaeon Methanothermus fervidus.
pubmed doi rcsb
source organism Methanothermus fervidus
total genus 26
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1b67A00
1S32A 2BYKA 3RELA 5KDMA 3X1UC 4J8XB 1P3LB 5B2ID 1ZLAB 1ZLAC 5GXQB 1P3KA 5BNVA 4J8UC 3MNND 4KGCA 1F66A 4LD9C 3MGQD 3MGPA 3TU4A 2HUEC 5CPKD 4XUJB 4XUJC 3REJB 3KXBB 5B31B 5CPIB 1KX4B 3WTPD 5B33B 3C1CA 3AYWB 1B67A 4WU8C 4H9OB 5AVBA 2FJ7B 3MVDA 3X1VC 3AZKA 1H3OA 3B0BA 5DNMC 5DNMB 4R8PB 1HTAA 1KX3C 3O62A 5AV8A 3KWQD 3B6GB 1TAFA 5FUGA 4QLCA 4J8VB 3B6FC 4WU9D 3W97C 4Z66C 3X1UA 4M6BA 1A7WA 1P3PD 1ZLAA 5GXQA 4J8UA 1P3MD 4H9NA 1P3GD 4LD9A 5G49B 4ZUXD 5GT3D 4HGAB 3REHD 4YM6B 4XUJA 3AZLC 3AZGC 1P3BD 1U35D 5AV5B 5AV5C 3AV2C 1P3OB 1ULYA 4WU8A 5B0ZD 3KSYA 5B31G 5B2JC 3B0DB 3AZED 3KUYB 4X23D 5CP6D 4KUDC 3X1VA 5E5AB 1P34C 5BNXB 5DNMA 5B2IB 4AWLC 4J8WD 5F99B 1KX3A 1ID3C 4KHAA 3MGQB 5CPKB 5JRGB 4WNNB 2CV5C 3X1SC 3WTPB 3AZIB 4J8VA 5AV6D 4H9RB 3REKC 4Z66A 1M1AD 1P3IC 3AZFD 2JSSA 1KU5A 3AZHC 3VH6A 5AV9D 5G49A 3C1BC 2NQBD 2HIOC 3UT9D 4YM6A 3O62D 2F8ND 3AZLA 5AV8D 3AZGA 5AV5A 3KWQB 4QLCD 5B2JA 3W99C 5B32C 1P3FB 4KUDA 4WU9B 4WZSB 3AV1B 3AV1C 5E5AA 1P34A 3UTBD 4KGCC 1P3PB 5B0YD 5B24D 1AOIC 4H9QB 1ID3A 5GT3B 3REHB 5JRGA 2CV5A 3LZ1D 3X1SA 2RVQC 1U35B 3WA9C 3AZIA 5B0ZB 4H9RA 2F8NH 3REKA 3AZEB 2BYMB 1M19C 4Z5TD 3AZHA 3W98D 5B40D 1BH8B 3X1TD 2HIOA 2F8NK 3LZ0D 5BT1D 4J8WB 3VH5A 1BH9B 3AZND 4YS3C 4YS3B 1EQZB 5B1LB 2AROD 5AVCC 3W97D 3B6FD 5BS7C 3AN2D 3W99A 5B32A 4NE3A 4J8XC 5AV6B 1P3LC 5GXQC 3AV1A 5AY8D 5CPJD 1M18D 1M1AB 3WKJD 1Q9CA 1AOIA 4XZQD 3REJC 4H9QA 5AV9B 3KXBC 5B31C 5CPIC 1KX4C 4CAYA 5B33C 4H9PA 3AV2D 2PYOB 3AYWC 2PYOC 1BFMA 3MGSD 2FJ7C 4G92B 4G92C 3WA9A 2L5AA 3UTAD 3LJAB 5BO0A 1M19A 3NQJB 4R8PC 3UTBB 3WAAB 3WAAC 5B0YB 5B24B 4YS3A 4CSRA 5GSUD 5B1LA 3B6GC 3W96D 3AFAD 1JFIB 4UUZB 5AVCA 1HQ3B 5GT0D 4J8VC 5BS7A 3LZ1B 3LELD 3MGRD 3A6NB 3A6NC 3REIB 1F1EA 3REIC 4J8XA 1P3LA 1P3ID 5B1MD 2LY8A 3C1BD 3AZJD 4HGAC 4Z5TB 5DNND 3W98B 4YM6C 3REJA 5B40B 5B31A 3KXBA 1TZYD 3X1TB 1KX5D 5CPIA 1KX4A 3LZ0B 5B33A 1P3OC 3AYWA 2PYOA 3AZNB 2NZDD 3AZMD 4JJND 3B0DC 4H9OA 2FJ7A 1S32D 4DRAA 2F8NG 3W99D 5B32D 2AROB 3KUYC 3RELD 3LJAA 1P3KD 5E5AC 2YFVB 4KGCD 1F66D 5B2IC 4R8PA 5F99C 3MGPD 5AY8B 3MNNB 3TU4D 5CPJB 1M18B 3WKJB 3WAAA 3MGQC 4ZBJB 1N1JB 4XZQB 3C1CD 5CPKC 5JRGC 3B6GA 4E45A 3WTPC 1JFIA 5AVBD 1HQ3A 3AZIC 3A6NA 3REIA 2YFWB 3MVDD 3AZKD 4G91B 2CWEA 5CHLB 3NQUB 4Z2MH 4H9SC 1P3OA 5C3IB 3KWQC 5GSUB 3R45B 3W96B 3AFAB 1P3FC 5GT0B 3X1UD 3KUYA 3MGRB 4WU9C 1ZLAD 5GXQD 4J8UD 5BNXA 5B2IA 1P3PC 4LD9D 5F99A 3MNNA 1P3MB 1P3MC 1P3GB 4XUJD 4ZUXB 3REJD 3AZJB 5GT3C 3MGQA 3REHC 5DNNB 5CPKA 4WNNA 1WWSA 1KX5B 4WU8D 1P3BB 1P3BC 3WTPA 3VH6T 1U35C 2NZDB 3AZMB 5B0ZC 4JJNB 1P3AD 1S32B 2BYKB 3AZEC 3RELB 3X1VD 5KDMB 4X23B 5DNMD 5CP6B 5CP6C 1P3KB 5BNVB 1KX3D 4J8WC 3TU4B 3VH6W 1EQZC 5B1LC 4H9SA 3KWQA 4J8VD 1P3FA 5AVBB 4Z66D 5AV6C 4WU9A 3WTPE 3MVDB 3AZKB 1M1AC 1P3PA 3AZFB 3AZFC 1P3MA 4YM6D 1P3GA 5AV9C 3AZLD 5GT3A 2NQBB 3UT9B 3REHA 3UT9C 3AZGD 4EO5B 2IO5B 3O62B 5JA4B 3B0CT 5AV8B 5AV5D 2F8NB 1P3BA 5B2JD 1U35A 4QLCB 5B0ZA 4E44A 4KUDD 3VH5T 3LJAC 3AZEA 1P34D 5E5AD 2BYMA 3X1UB 4X23A 5CP6A 5F99D 4J8UB 3UTBC 4H9NB 1BH8A 5B32G 3B0CW 1WWIA 5B0YC 1ID3D 4LD9B 4J8WA 5B24C 2HUEB 1BH9A 4Z2MG 5JRGD 1EQZA 2CV5D 3X1SD 3VH5W 1HQ3C 4WU8B 3AZID 3LZ1C 3REKD 5AV6A 3AZHD 3X1VB 1M1AA 2HIOD 4Z5TC 3AZFA 3W98C 5AV9A 5B40C 2NQBA 3X1TC 3UT9A 1KX3B 3LZ0C 5BT1C 4KHAB 5JA4A 2F8NA 3AZNC 1P3FD 2AROC 3W97B 3B6FB 3AN2B 3AN2C 4NE5A 3AV1D 4Z66B 3NQJA 1AOID 5AY8C 3MNNC 3UTBA 5CPJC 1M18C 3WKJC 5B0YA 5B24A 4NE6A 4ZBJC 4XZQC 3AZLB 3AZGB 2RVQD 3AV2B 4UUZA 3WA9D 3MGSB 3MGSC 3LZ1A 5B2JB 3UTAB 3UTAC 1M19D 4KUDB 4G91C 1P34B 4AWLB 4Z5TA 3W98A 5B40A 3X1TA 4YS3D 1ID3B 1EQZD 3LZ0A 5B1LD 5C3IC 3AZNA 5GSUC 5AVCD 2CV5B 3W96C 3X1SB 4NFTA 3AFAC 2AROA 5GT0C 3W97A 4J8XD 1P3AB 3LELB 3LELC 3MGRC 3REKB 3AN2A 1P3AC 1P3LD 3B6FA 2YFVA 4DRBA 1P3IB 5B1MB 5B1MC 5AY8A 3AZHB 5CPJA 1M18A 1P3GC 3WKJA 4ZUXC 3KXBD 5B31D 3C1BB 2HIOB 3AZJC 5CPID 1N1JA 5DNNC 1KX4D 4XZQA 5B33D 3V9RB 3AYWD 2PYOD 1TZYB 1TZYC 1KX5C 3AV2A 2FJ7D 2NZDC 3MGSA 3AZMC 4JJNC 2YFWA 3LJAD 1S32C 3UTAA 5B32B 3RELC 3W99B 1R4VA 4X23C 4R8PD 1P3KC 4KGCB 1F66B 1F66C 3WAAD 3MGPB 3NQUA 3MGPC 3TU4C 1AOIB 3B6GD 4CAYB 3C1CB 3C1CC 4H9PB 5GSUA 1HQ3D 3R45A 3W96A 3A6ND 3REID 3AFAA 5GT0A 5AVBC 3WA9B 1P3AA 3MGRA 3LELA 4WV4B 3MVDC 3AZKC 1P3IA 5BO0B 1H3OB 1M19B 5B1MA 4ZUXA 3C1BA 3AZJA 2NQBC 5DNNA 4EO5C 2IO5C 1P3OD 3O62C 3V9RA 5AV8C 1KX5A 1TZYA 4CSRB 1TAFB 5FUGB 2NZDA 1B6WA 4QLCC 4JJNA 3AZMA 5AVCB 3KUYD
chains in the Genus database with same CATH superfamily
1S32A 2BYKA 3RELA 3H0RC 5KDMA 3X1UC 4J8XB 1P3LB 5B2ID 1ZLAB 1ZLAC 5GXQB 1P3KA 5BNVA 4J8UC 3MNND 4KGCA 1F66A 4LD9C 2UWXA 3MGQD 3MGPA 3TU4A 2HUEC 5CPKD 4XUJB 4XUJC 3REJB 3KXBB 5B31B 5CPIB 1KX4B 3WTPD 5B33B 3C1CA 3AYWB 1B67A 4WU8C 1T3UA 4H9OB 5AVBA 2FJ7B 3MVDA 3X1VC 3AZKA 1H3OA 3B0BA 5DNMC 5DNMB 4R8PB 3F6TA 1HTAA 1KX3C 2ZY5A 3O62A 5AV8A 3KWQD 3B6GB 1TAFA 5FUGA 4QLCA 4J8VB 3B6FC 4WU9D 3W97C 3A1KA 3X1UA 4Z66C 4M6BA 1A7WA 1P3PD 1ZLAA 5GXQA 4J8UA 1P3MD 4H9NA 2F2AC 1P3GD 4LD9A 5G49B 4ZUXD 5GT3D 4HGAB 3REHD 4YM6B 4XUJA 3AZLC 3AZGC 1P3BD 1U35D 5AV5B 5AV5C 3AV2C 1P3OB 1ULYA 4WU8A 5B0ZD 3KSYA 5B31G 5B2JC 3B0DB 2G5HC 3AZED 3KUYB 4X23D 5CP6D 4KUDC 3X1VA 5E5AB 1P34C 5BNXB 3EPHA 5DNMA 5B2IB 4AWLC 4J8WD 5F99B 2JE5A 1KX3A 1ID3C 4KHAA 3MGQB 5CPKB 5JRGB 4WNNB 2CV5C 3X1SC 3WTPB 3AZIB 4J8VA 5AV6D 4H9RB 2ZY4A 3REKC 4Z66A 1M1AD 1P3IC 3AZFD 2JSSA 1KU5A 3AZHC 3VH6A 5AV9D 5G49A 3C1BC 2NQBD 2HIOC 3UT9D 4YM6A 3O62D 2F8ND 3AZLA 5AV8D 3AZGA 5AV5A 3KWQB 4QLCD 5B2JA 2G5IC 3W99C 5B32C 1P3FB 4KUDA 4WU9B 4WZSB 3AV1B 3AV1C 2JCHA 5E5AA 1P34A 3UTBD 4KGCC 1P3PB 5B0YD 5B24D 1AOIC 4UPKA 4H9QB 1ID3A 5GT3B 3REHB 2ZY3A 5JRGA 2CV5A 3LZ1D 3X1SA 2RVQC 1U35B 3WA9C 3AZIA 5B0ZB 4H9RA 2F8NH 3REKA 3AZEB 2BYMB 1M19C 4Z5TD 3AZHA 3W98D 1PZRA 5B40D 1BH8B 3X1TD 2HIOA 2F8NK 3LZ0D 5BT1D 4J8WB 3VH5A 1BH9B 3AZND 4YS3C 4YS3B 1EQZB 5B1LB 2AROD 5AVCC 3W97D 3B6FD 3A1IA 5BS7C 3AN2D 3W99A 5B32A 4NE3A 2Y2QA 4J8XC 5AV6B 1P3LC 3AL0C 5GXQC 3AV1A 5AY8D 5CPJD 1M18D 1M1AB 3WKJD 1Q9CA 1AOIA 4XZQD 3REJC 4H9QA 5AV9B 3KXBC 5B31C 5CPIC 1KX4C 4CAYA 5B33C 4H9PA 3AV2D 2PYOB 3AYWC 2PYOC 1BFMA 3MGSD 2FJ7C 4G92B 4G92C 3WA9A 2L5AA 3UTAD 2XD1A 3LJAB 5BO0A 1M19A 3NQJB 4R8PC 3UTBB 3WAAB 3WAAC 5B0YB 5B24B 4YS3A 4CSRA 5GSUD 5B1LA 3B6GC 2RIQA 3W96D 3AFAD 1JFIB 4UUZB 5AVCA 1HQ3B 5GT0D 4J8VC 5BS7A 3LZ1B 3LELD 3MGRD 3A6NB 3A6NC 3REIB 1F1EA 3REIC 4J8XA 1P3LA 1P3ID 2Y2KA 5B1MD 2LY8A 3IP4C 3C1BD 3AZJD 4HGAC 4Z5TB 5DNND 3W98B 4YM6C 3REJA 5B40B 5B31A 3KXBA 1TZYD 3X1TB 1KX5D 5CPIA 1KX4A 3LZ0B 5B33A 1P3OC 3AYWA 2PYOA 3AZNB 2NZDD 3AZMD 4JJND 3B0DC 4H9OA 2FJ7A 1S32D 4DRAA 2F8NG 3W99D 5B32D 2AROB 3KUYC 3RELD 3LJAA 1P3KD 5E5AC 2YFVB 4KGCD 1F66D 5B2IC 4R8PA 5F99C 3MGPD 5AY8B 3MNNB 3TU4D 5CPJB 1M18B 3WKJB 3WAAA 3MGQC 4ZBJB 1N1JB 3KFUG 4XZQB 3C1CD 5CPKC 5JRGC 3B6GA 4E45A 3WTPC 1JFIA 5AVBD 1HQ3A 3AZIC 3A6NA 3REIA 2YFWB 2Y2OA 3MVDD 3AZKD 3EPJA 4G91B 2CWEA 2Y2HA 5CHLB 3NQUB 4Z2MH 4H9SC 1P3OA 5C3IB 3KWQC 5GSUB 3H0MC 2VQRA 3R45B 3W96B 3AFAB 1P3FC 5GT0B 3X1UD 3KUYA 3MGRB 4WU9C 1ZLAD 5GXQD 4DQYB 4J8UD 5BNXA 5B2IA 1P3PC 4LD9D 5F99A 3MNNA 1P3MB 1P3MC 1P3GB 4XUJD 4ZUXB 3REJD 3AZJB 5GT3C 3MGQA 3REHC 5DNNB 5CPKA 4WNNA 1WWSA 1KX5B 4WU8D 1Z2CB 1P3BB 1P3BC 3WTPA 3VH6T 1U35C 2NZDB 3AZMB 5B0ZC 4JJNB 1P3AD 1S32B 2BYKB 3AZEC 3RELB 3X1VD 5KDMB 2Y2MA 5DNMD 5CP6B 5CP6C 4X23B 1P3KB 5BNVB 1KX3D 4J8WC 3TU4B 3VH6W 1EQZC 5B1LC 4H9SA 3KWQA 4J8VD 2Y2NA 3P5JB 1P3FA 5AVBB 4Z66D 2XD5A 5AV6C 4WU9A 3WTPE 3MVDB 3AZKB 1M1AC 1P3PA 3AZFB 3AZFC 1P3MA 4YM6D 1P3GA 5AV9C 3AZLD 5GT3A 2NQBB 3UT9B 3REHA 3UT9C 3AZGD 4EO5B 2IO5B 3O62B 5JA4B 3B0CT 5AV8B 5AV5D 2F8NB 1P3BA 5B2JD 2FFFB 1U35A 1W2EA 4QLCB 5B0ZA 4E44A 4KUDD 3VH5T 2ZM5A 3LJAC 3AZEA 1P34D 5E5AD 2BYMA 3X1UB 4X23A 5CP6A 5F99D 4J8UB 3UTBC 4H9NB 1BH8A 5B32G 3B0CW 1WWIA 5B0YC 1ID3D 4LD9B 4J8WA 5B24C 2HUEB 1BH9A 4Z2MG 5JRGD 1EQZA 2DF4C 2CV5D 3X1SD 3VH5W 1HQ3C 4WU8B 3AZID 3LZ1C 3REKD 5AV6A 3AZHD 3X1VB 1M1AA 2HIOD 4Z5TC 3AZFA 3W98C 3FDDA 5AV9A 5B40C 2NQBA 3X1TC 3UT9A 1KX3B 3LZ0C 5BT1C 4KHAB 5JA4A 2F8NA 3EPLA 3AZNC 2Y2PA 1P3FD 2AROC 3W97B 3B6FB 2DQNC 3AN2B 3AN2C 4NE5A 3AV1D 2Y2JA 4Z66B 3NQJA 1AOID 5AY8C 3MNNC 3UTBA 5CPJC 1M18C 3WKJC 5B0YA 5B24A 4NE6A 4ZBJC 4XZQC 3AZLB 3AZGB 2RVQD 3EG5B 3AV2B 4UUZA 3WA9D 3MGSB 3MGSC 3LZ1A 5B2JB 3UTAB 3UTAC 1M19D 4KUDB 4G91C 2W8SA 1P34B 4AWLB 4Z5TA 3W98A 5B40A 3X1TA 4YS3D 1ID3B 1EQZD 3LZ0A 5B1LD 5C3IC 3AZNA 5GSUC 5AVCD 2CV5B 3W96C 3X1SB 4NFTA 2BG1A 3AFAC 2AROA 5GT0C 3W97A 4J8XD 1P3AB 3LELB 3LELC 3MGRC 3REKB 3AN2A 1P3AC 1P3LD 3B6FA 2YFVA 4DRBA 1P3IB 5B1MB 5B1MC 5AY8A 2J8PA 3AZHB 5CPJA 1M18A 1P3GC 3H0LC 3WKJA 4ZUXC 3KXBD 5B31D 3C1BB 2HIOB 3AZJC 5CPID 1N1JA 5DNNC 1KX4D 4XZQA 2Y2IA 5B33D 3V9RB 3AYWD 2PYOD 1TZYB 1TZYC 1KX5C 3AV2A 2FJ7D 2NZDC 3MGSA 3AZMC 4JJNC 2YFWA 3LJAD 2Y2GA 1S32C 3UTAA 5B32B 3RELC 3W99B 1R4VA 2Y2LA 4X23C 4R8PD 1P3KC 4KGCB 1F66B 1F66C 3WAAD 3EPKA 3MGPB 3NQUA 3MGPC 3TU4C 1AOIB 3B6GD 4CAYB 3C1CB 3C1CC 4H9PB 5GSUA 1HQ3D 3R45A 3W96A 3A6ND 3REID 2ZY2A 3AFAA 5GT0A 5AVBC 3WA9B 1P3AA 3MGRA 3LELA 4WV4B 3MVDC 3AZKC 1P3IA 5BO0B 1H3OB 1M19B 5B1MA 4ZUXA 3C1BA 3AZJA 2NQBC 5DNNA 4EO5C 2IO5C 1P3OD 3O62C 3V9RA 5AV8C 1KX5A 1TZYA 4CSRB 1TAFB 5FUGB 2NZDA 1B6WA 4QLCC 4JJNA 3AZMA 5AVCB 3KUYD 4WJ3C
chains in the Genus database with same CATH topology
1S32A 2BYKA 3RELA 3H0RC 5KDMA 3X1UC 4J8XB 1P3LB 5B2ID 1ZLAB 1ZLAC 5GXQB 1P3KA 5BNVA 4J8UC 3MNND 4KGCA 1F66A 4LD9C 2UWXA 3MGQD 3MGPA 3TU4A 2HUEC 5CPKD 4XUJB 4XUJC 3REJB 3KXBB 5B31B 5CPIB 1KX4B 3WTPD 5B33B 3C1CA 3AYWB 1B67A 4WU8C 1T3UA 4H9OB 5AVBA 2FJ7B 3MVDA 3X1VC 3AZKA 1H3OA 3B0BA 5DNMC 5DNMB 4R8PB 3F6TA 1HTAA 1KX3C 2ZY5A 3O62A 5AV8A 3KWQD 3B6GB 1TAFA 5FUGA 4QLCA 4J8VB 3B6FC 4WU9D 3W97C 3A1KA 3X1UA 4Z66C 4M6BA 1A7WA 1P3PD 1ZLAA 5GXQA 4J8UA 1P3MD 4H9NA 2F2AC 1P3GD 4LD9A 5G49B 4ZUXD 5GT3D 4HGAB 3REHD 4YM6B 4XUJA 3AZLC 3AZGC 1P3BD 1U35D 5AV5B 5AV5C 3AV2C 1P3OB 1ULYA 4WU8A 5B0ZD 3KSYA 5B31G 5B2JC 3B0DB 2G5HC 3AZED 3KUYB 4X23D 5CP6D 4KUDC 3X1VA 5E5AB 1P34C 5BNXB 3EPHA 5DNMA 5B2IB 4AWLC 4J8WD 5F99B 2JE5A 1KX3A 1ID3C 4KHAA 3MGQB 5CPKB 5JRGB 4WNNB 2CV5C 3X1SC 3WTPB 3AZIB 4J8VA 5AV6D 4H9RB 2ZY4A 3REKC 4Z66A 1M1AD 1P3IC 3AZFD 2JSSA 1KU5A 3AZHC 3VH6A 5AV9D 5G49A 3C1BC 2NQBD 2HIOC 3UT9D 4YM6A 3O62D 2F8ND 3AZLA 5AV8D 3AZGA 5AV5A 3KWQB 4QLCD 5B2JA 2G5IC 3W99C 5B32C 1P3FB 4KUDA 4WU9B 4WZSB 3AV1B 3AV1C 2JCHA 5E5AA 1P34A 3UTBD 4KGCC 1P3PB 5B0YD 5B24D 1AOIC 4UPKA 4H9QB 1ID3A 5GT3B 3REHB 2ZY3A 5JRGA 2CV5A 3LZ1D 3X1SA 2RVQC 1U35B 3WA9C 3AZIA 5B0ZB 4H9RA 2F8NH 3REKA 3AZEB 2BYMB 1M19C 4Z5TD 3AZHA 3W98D 1PZRA 5B40D 1BH8B 3X1TD 2HIOA 2F8NK 3LZ0D 5BT1D 4J8WB 3VH5A 1BH9B 3AZND 4YS3C 4YS3B 1EQZB 5B1LB 2AROD 5AVCC 3W97D 3B6FD 3A1IA 5BS7C 3AN2D 3W99A 5B32A 4NE3A 2Y2QA 4J8XC 5AV6B 1P3LC 3AL0C 5GXQC 3AV1A 5AY8D 5CPJD 1M18D 1M1AB 3WKJD 1Q9CA 1AOIA 4XZQD 3REJC 4H9QA 5AV9B 3KXBC 5B31C 5CPIC 1KX4C 4CAYA 5B33C 4H9PA 3AV2D 2PYOB 3AYWC 2PYOC 1BFMA 3MGSD 2FJ7C 4G92B 4G92C 3WA9A 2L5AA 3UTAD 2XD1A 3LJAB 5BO0A 1M19A 3NQJB 4R8PC 3UTBB 3WAAB 3WAAC 5B0YB 5B24B 4YS3A 4CSRA 5GSUD 5B1LA 3B6GC 2RIQA 3W96D 3AFAD 1JFIB 4UUZB 5AVCA 1HQ3B 5GT0D 4J8VC 5BS7A 3LZ1B 3LELD 3MGRD 3A6NB 3A6NC 3REIB 1F1EA 3REIC 4J8XA 1P3LA 1P3ID 2Y2KA 5B1MD 2LY8A 3IP4C 3C1BD 3AZJD 4HGAC 4Z5TB 5DNND 3W98B 4YM6C 3REJA 5B40B 5B31A 3KXBA 1TZYD 3X1TB 1KX5D 5CPIA 1KX4A 3LZ0B 5B33A 1P3OC 3AYWA 2PYOA 3AZNB 2NZDD 3AZMD 4JJND 3B0DC 4H9OA 2FJ7A 1S32D 4DRAA 2F8NG 3W99D 5B32D 2AROB 3KUYC 3RELD 3LJAA 1P3KD 5E5AC 2YFVB 4KGCD 1F66D 5B2IC 4R8PA 5F99C 3MGPD 5AY8B 3MNNB 3TU4D 5CPJB 1M18B 3WKJB 3WAAA 3MGQC 4ZBJB 1N1JB 3KFUG 4XZQB 3C1CD 5CPKC 5JRGC 3B6GA 4E45A 3WTPC 1JFIA 5AVBD 1HQ3A 3AZIC 3A6NA 3REIA 2YFWB 2Y2OA 3MVDD 3AZKD 3EPJA 4G91B 2CWEA 2Y2HA 5CHLB 3NQUB 4Z2MH 4H9SC 1P3OA 5C3IB 3KWQC 5GSUB 3H0MC 2VQRA 3R45B 3W96B 3AFAB 1P3FC 5GT0B 3X1UD 3KUYA 3MGRB 4WU9C 1ZLAD 5GXQD 4DQYB 4J8UD 5BNXA 5B2IA 1P3PC 4LD9D 5F99A 3MNNA 1P3MB 1P3MC 1P3GB 4XUJD 4ZUXB 3REJD 3AZJB 5GT3C 3MGQA 3REHC 5DNNB 5CPKA 4WNNA 1WWSA 1KX5B 4WU8D 1Z2CB 1P3BB 1P3BC 3WTPA 3VH6T 1U35C 2NZDB 3AZMB 5B0ZC 4JJNB 1P3AD 1S32B 2BYKB 3AZEC 3RELB 3X1VD 5KDMB 2Y2MA 5DNMD 5CP6B 5CP6C 4X23B 1P3KB 5BNVB 1KX3D 4J8WC 3TU4B 3VH6W 1EQZC 5B1LC 4H9SA 3KWQA 4J8VD 2Y2NA 3P5JB 1P3FA 5AVBB 4Z66D 2XD5A 5AV6C 4WU9A 3WTPE 3MVDB 3AZKB 1M1AC 1P3PA 3AZFB 3AZFC 1P3MA 4YM6D 1P3GA 5AV9C 3AZLD 5GT3A 2NQBB 3UT9B 3REHA 3UT9C 3AZGD 4EO5B 2IO5B 3O62B 5JA4B 3B0CT 5AV8B 5AV5D 2F8NB 1P3BA 5B2JD 2FFFB 1U35A 1W2EA 4QLCB 5B0ZA 4E44A 4KUDD 3VH5T 2ZM5A 3LJAC 3AZEA 1P34D 5E5AD 2BYMA 3X1UB 4X23A 5CP6A 5F99D 4J8UB 3UTBC 4H9NB 1BH8A 5B32G 3B0CW 1WWIA 5B0YC 1ID3D 4LD9B 4J8WA 5B24C 2HUEB 1BH9A 4Z2MG 5JRGD 1EQZA 2DF4C 2CV5D 3X1SD 3VH5W 1HQ3C 4WU8B 3AZID 3LZ1C 3REKD 5AV6A 3AZHD 3X1VB 1M1AA 2HIOD 4Z5TC 3AZFA 3W98C 3FDDA 5AV9A 5B40C 2NQBA 3X1TC 3UT9A 1KX3B 3LZ0C 5BT1C 4KHAB 5JA4A 2F8NA 3EPLA 3AZNC 2Y2PA 1P3FD 2AROC 3W97B 3B6FB 2DQNC 3AN2B 3AN2C 4NE5A 3AV1D 2Y2JA 4Z66B 3NQJA 1AOID 5AY8C 3MNNC 3UTBA 5CPJC 1M18C 3WKJC 5B0YA 5B24A 4NE6A 4ZBJC 4XZQC 3AZLB 3AZGB 2RVQD 3EG5B 3AV2B 4UUZA 3WA9D 3MGSB 3MGSC 3LZ1A 5B2JB 3UTAB 3UTAC 1M19D 4KUDB 4G91C 2W8SA 1P34B 4AWLB 4Z5TA 3W98A 5B40A 3X1TA 4YS3D 1ID3B 1EQZD 3LZ0A 5B1LD 5C3IC 3AZNA 5GSUC 5AVCD 2CV5B 3W96C 3X1SB 4NFTA 2BG1A 3AFAC 2AROA 5GT0C 3W97A 4J8XD 1P3AB 3LELB 3LELC 3MGRC 3REKB 3AN2A 1P3AC 1P3LD 3B6FA 2YFVA 4DRBA 1P3IB 5B1MB 5B1MC 5AY8A 2J8PA 3AZHB 5CPJA 1M18A 1P3GC 3H0LC 3WKJA 4ZUXC 3KXBD 5B31D 3C1BB 2HIOB 3AZJC 5CPID 1N1JA 5DNNC 1KX4D 4XZQA 2Y2IA 5B33D 3V9RB 3AYWD 2PYOD 1TZYB 1TZYC 1KX5C 3AV2A 2FJ7D 2NZDC 3MGSA 3AZMC 4JJNC 2YFWA 3LJAD 2Y2GA 1S32C 3UTAA 5B32B 3RELC 3W99B 1R4VA 2Y2LA 4X23C 4R8PD 1P3KC 4KGCB 1F66B 1F66C 3WAAD 3EPKA 3MGPB 3NQUA 3MGPC 3TU4C 1AOIB 3B6GD 4CAYB 3C1CB 3C1CC 4H9PB 5GSUA 1HQ3D 3R45A 3W96A 3A6ND 3REID 2ZY2A 3AFAA 5GT0A 5AVBC 3WA9B 1P3AA 3MGRA 3LELA 4WV4B 3MVDC 3AZKC 1P3IA 5BO0B 1H3OB 1M19B 5B1MA 4ZUXA 3C1BA 3AZJA 2NQBC 5DNNA 4EO5C 2IO5C 1P3OD 3O62C 3V9RA 5AV8C 1KX5A 1TZYA 4CSRB 1TAFB 5FUGB 2NZDA 1B6WA 4QLCC 4JJNA 3AZMA 5AVCB 3KUYD 4WJ3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S32 A;  2BYK A;  3REL A;  5KDM A;  3X1U C;  4J8X B;  1P3L B;  5B2I D;  1ZLA B;  1ZLA C;  5GXQ B;  1P3K A;  5BNV A;  4J8U C;  3MNN D;  4KGC A;  1F66 A;  4LD9 C;  3MGQ D;  3MGP A;  3TU4 A;  2HUE C;  5CPK D;  4XUJ B;  4XUJ C;  3REJ B;  3KXB B;  5B31 B;  5CPI B;  1KX4 B;  3WTP D;  5B33 B;  3C1C A;  3AYW B;  1B67 A;  4WU8 C;  4H9O B;  5AVB A;  2FJ7 B;  3MVD A;  3X1V C;  3AZK A;  1H3O A;  3B0B A;  5DNM C;  5DNM B;  4R8P B;  1HTA A;  1KX3 C;  3O62 A;  5AV8 A;  3KWQ D;  3B6G B;  1TAF A;  5FUG A;  4QLC A;  4J8V B;  3B6F C;  4WU9 D;  3W97 C;  4Z66 C;  3X1U A;  4M6B A;  1A7W A;  1P3P D;  1ZLA A;  5GXQ A;  4J8U A;  1P3M D;  4H9N A;  1P3G D;  4LD9 A;  5G49 B;  4ZUX D;  5GT3 D;  4HGA B;  3REH D;  4YM6 B;  4XUJ A;  3AZL C;  3AZG C;  1P3B D;  1U35 D;  5AV5 B;  5AV5 C;  3AV2 C;  1P3O B;  1ULY A;  4WU8 A;  5B0Z D;  3KSY A;  5B31 G;  5B2J C;  3B0D B;  3AZE D;  3KUY B;  4X23 D;  5CP6 D;  4KUD C;  3X1V A;  5E5A B;  1P34 C;  5BNX B;  5DNM A;  5B2I B;  4AWL C;  4J8W D;  5F99 B;  1KX3 A;  1ID3 C;  4KHA A;  3MGQ B;  5CPK B;  5JRG B;  4WNN B;  2CV5 C;  3X1S C;  3WTP B;  3AZI B;  4J8V A;  5AV6 D;  4H9R B;  3REK C;  4Z66 A;  1M1A D;  1P3I C;  3AZF D;  2JSS A;  1KU5 A;  3AZH C;  3VH6 A;  5AV9 D;  5G49 A;  3C1B C;  2NQB D;  2HIO C;  3UT9 D;  4YM6 A;  3O62 D;  2F8N D;  3AZL A;  5AV8 D;  3AZG A;  5AV5 A;  3KWQ B;  4QLC D;  5B2J A;  3W99 C;  5B32 C;  1P3F B;  4KUD A;  4WU9 B;  4WZS B;  3AV1 B;  3AV1 C;  5E5A A;  1P34 A;  3UTB D;  4KGC C;  1P3P B;  5B0Y D;  5B24 D;  1AOI C;  4H9Q B;  1ID3 A;  5GT3 B;  3REH B;  5JRG A;  2CV5 A;  3LZ1 D;  3X1S A;  2RVQ C;  1U35 B;  3WA9 C;  3AZI A;  5B0Z B;  4H9R A;  2F8N H;  3REK A;  3AZE B;  2BYM B;  1M19 C;  4Z5T D;  3AZH A;  3W98 D;  5B40 D;  1BH8 B;  3X1T D;  2HIO A;  2F8N K;  3LZ0 D;  5BT1 D;  4J8W B;  3VH5 A;  1BH9 B;  3AZN D;  4YS3 C;  4YS3 B;  1EQZ B;  5B1L B;  2ARO D;  5AVC C;  3W97 D;  3B6F D;  5BS7 C;  3AN2 D;  3W99 A;  5B32 A;  4NE3 A;  4J8X C;  5AV6 B;  1P3L C;  5GXQ C;  3AV1 A;  5AY8 D;  5CPJ D;  1M18 D;  1M1A B;  3WKJ D;  1Q9C A;  1AOI A;  4XZQ D;  3REJ C;  4H9Q A;  5AV9 B;  3KXB C;  5B31 C;  5CPI C;  1KX4 C;  4CAY A;  5B33 C;  4H9P A;  3AV2 D;  2PYO B;  3AYW C;  2PYO C;  1BFM A;  3MGS D;  2FJ7 C;  4G92 B;  4G92 C;  3WA9 A;  2L5A A;  3UTA D;  3LJA B;  5BO0 A;  1M19 A;  3NQJ B;  4R8P C;  3UTB B;  3WAA B;  3WAA C;  5B0Y B;  5B24 B;  4YS3 A;  4CSR A;  5GSU D;  5B1L A;  3B6G C;  3W96 D;  3AFA D;  1JFI B;  4UUZ B;  5AVC A;  1HQ3 B;  5GT0 D;  4J8V C;  5BS7 A;  3LZ1 B;  3LEL D;  3MGR D;  3A6N B;  3A6N C;  3REI B;  1F1E A;  3REI C;  4J8X A;  1P3L A;  1P3I D;  5B1M D;  2LY8 A;  3C1B D;  3AZJ D;  4HGA C;  4Z5T B;  5DNN D;  3W98 B;  4YM6 C;  3REJ A;  5B40 B;  5B31 A;  3KXB A;  1TZY D;  3X1T B;  1KX5 D;  5CPI A;  1KX4 A;  3LZ0 B;  5B33 A;  1P3O C;  3AYW A;  2PYO A;  3AZN B;  2NZD D;  3AZM D;  4JJN D;  3B0D C;  4H9O A;  2FJ7 A;  1S32 D;  4DRA A;  2F8N G;  3W99 D;  5B32 D;  2ARO B;  3KUY C;  3REL D;  3LJA A;  1P3K D;  5E5A C;  2YFV B;  4KGC D;  1F66 D;  5B2I C;  4R8P A;  5F99 C;  3MGP D;  5AY8 B;  3MNN B;  3TU4 D;  5CPJ B;  1M18 B;  3WKJ B;  3WAA A;  3MGQ C;  4ZBJ B;  1N1J B;  4XZQ B;  3C1C D;  5CPK C;  5JRG C;  3B6G A;  4E45 A;  3WTP C;  1JFI A;  5AVB D;  1HQ3 A;  3AZI C;  3A6N A;  3REI A;  2YFW B;  3MVD D;  3AZK D;  4G91 B;  2CWE A;  5CHL B;  3NQU B;  4Z2M H;  4H9S C;  1P3O A;  5C3I B;  3KWQ C;  5GSU B;  3R45 B;  3W96 B;  3AFA B;  1P3F C;  5GT0 B;  3X1U D;  3KUY A;  3MGR B;  4WU9 C;  1ZLA D;  5GXQ D;  4J8U D;  5BNX A;  5B2I A;  1P3P C;  4LD9 D;  5F99 A;  3MNN A;  1P3M B;  1P3M C;  1P3G B;  4XUJ D;  4ZUX B;  3REJ D;  3AZJ B;  5GT3 C;  3MGQ A;  3REH C;  5DNN B;  5CPK A;  4WNN A;  1WWS A;  1KX5 B;  4WU8 D;  1P3B B;  1P3B C;  3WTP A;  3VH6 T;  1U35 C;  2NZD B;  3AZM B;  5B0Z C;  4JJN B;  1P3A D;  1S32 B;  2BYK B;  3AZE C;  3REL B;  3X1V D;  5KDM B;  4X23 B;  5DNM D;  5CP6 B;  5CP6 C;  1P3K B;  5BNV B;  1KX3 D;  4J8W C;  3TU4 B;  3VH6 W;  1EQZ C;  5B1L C;  4H9S A;  3KWQ A;  4J8V D;  1P3F A;  5AVB B;  4Z66 D;  5AV6 C;  4WU9 A;  3WTP E;  3MVD B;  3AZK B;  1M1A C;  1P3P A;  3AZF B;  3AZF C;  1P3M A;  4YM6 D;  1P3G A;  5AV9 C;  3AZL D;  5GT3 A;  2NQB B;  3UT9 B;  3REH A;  3UT9 C;  3AZG D;  4EO5 B;  2IO5 B;  3O62 B;  5JA4 B;  3B0C T;  5AV8 B;  5AV5 D;  2F8N B;  1P3B A;  5B2J D;  1U35 A;  4QLC B;  5B0Z A;  4E44 A;  4KUD D;  3VH5 T;  3LJA C;  3AZE A;  1P34 D;  5E5A D;  2BYM A;  3X1U B;  4X23 A;  5CP6 A;  5F99 D;  4J8U B;  3UTB C;  4H9N B;  1BH8 A;  5B32 G;  3B0C W;  1WWI A;  5B0Y C;  1ID3 D;  4LD9 B;  4J8W A;  5B24 C;  2HUE B;  1BH9 A;  4Z2M G;  5JRG D;  1EQZ A;  2CV5 D;  3X1S D;  3VH5 W;  1HQ3 C;  4WU8 B;  3AZI D;  3LZ1 C;  3REK D;  5AV6 A;  3AZH D;  3X1V B;  1M1A A;  2HIO D;  4Z5T C;  3AZF A;  3W98 C;  5AV9 A;  5B40 C;  2NQB A;  3X1T C;  3UT9 A;  1KX3 B;  3LZ0 C;  5BT1 C;  4KHA B;  5JA4 A;  2F8N A;  3AZN C;  1P3F D;  2ARO C;  3W97 B;  3B6F B;  3AN2 B;  3AN2 C;  4NE5 A;  3AV1 D;  4Z66 B;  3NQJ A;  1AOI D;  5AY8 C;  3MNN C;  3UTB A;  5CPJ C;  1M18 C;  3WKJ C;  5B0Y A;  5B24 A;  4NE6 A;  4ZBJ C;  4XZQ C;  3AZL B;  3AZG B;  2RVQ D;  3AV2 B;  4UUZ A;  3WA9 D;  3MGS B;  3MGS C;  3LZ1 A;  5B2J B;  3UTA B;  3UTA C;  1M19 D;  4KUD B;  4G91 C;  1P34 B;  4AWL B;  4Z5T A;  3W98 A;  5B40 A;  3X1T A;  4YS3 D;  1ID3 B;  1EQZ D;  3LZ0 A;  5B1L D;  5C3I C;  3AZN A;  5GSU C;  5AVC D;  2CV5 B;  3W96 C;  3X1S B;  4NFT A;  3AFA C;  2ARO A;  5GT0 C;  3W97 A;  4J8X D;  1P3A B;  3LEL B;  3LEL C;  3MGR C;  3REK B;  3AN2 A;  1P3A C;  1P3L D;  3B6F A;  2YFV A;  4DRB A;  1P3I B;  5B1M B;  5B1M C;  5AY8 A;  3AZH B;  5CPJ A;  1M18 A;  1P3G C;  3WKJ A;  4ZUX C;  3KXB D;  5B31 D;  3C1B B;  2HIO B;  3AZJ C;  5CPI D;  1N1J A;  5DNN C;  1KX4 D;  4XZQ A;  5B33 D;  3V9R B;  3AYW D;  2PYO D;  1TZY B;  1TZY C;  1KX5 C;  3AV2 A;  2FJ7 D;  2NZD C;  3MGS A;  3AZM C;  4JJN C;  2YFW A;  3LJA D;  1S32 C;  3UTA A;  5B32 B;  3REL C;  3W99 B;  1R4V A;  4X23 C;  4R8P D;  1P3K C;  4KGC B;  1F66 B;  1F66 C;  3WAA D;  3MGP B;  3NQU A;  3MGP C;  3TU4 C;  1AOI B;  3B6G D;  4CAY B;  3C1C B;  3C1C C;  4H9P B;  5GSU A;  1HQ3 D;  3R45 A;  3W96 A;  3A6N D;  3REI D;  3AFA A;  5GT0 A;  5AVB C;  3WA9 B;  1P3A A;  3MGR A;  3LEL A;  4WV4 B;  3MVD C;  3AZK C;  1P3I A;  5BO0 B;  1H3O B;  1M19 B;  5B1M A;  4ZUX A;  3C1B A;  3AZJ A;  2NQB C;  5DNN A;  4EO5 C;  2IO5 C;  1P3O D;  3O62 C;  3V9R A;  5AV8 C;  1KX5 A;  1TZY A;  4CSR B;  1TAF B;  5FUG B;  2NZD A;  1B6W A;  4QLC C;  4JJN A;  3AZM A;  5AVC B;  3KUY D; 
#chains in the Genus database with same CATH topology
 1S32 A;  2BYK A;  3REL A;  3H0R C;  5KDM A;  3X1U C;  4J8X B;  1P3L B;  5B2I D;  1ZLA B;  1ZLA C;  5GXQ B;  1P3K A;  5BNV A;  4J8U C;  3MNN D;  4KGC A;  1F66 A;  4LD9 C;  2UWX A;  3MGQ D;  3MGP A;  3TU4 A;  2HUE C;  5CPK D;  4XUJ B;  4XUJ C;  3REJ B;  3KXB B;  5B31 B;  5CPI B;  1KX4 B;  3WTP D;  5B33 B;  3C1C A;  3AYW B;  1B67 A;  4WU8 C;  1T3U A;  4H9O B;  5AVB A;  2FJ7 B;  3MVD A;  3X1V C;  3AZK A;  1H3O A;  3B0B A;  5DNM C;  5DNM B;  4R8P B;  3F6T A;  1HTA A;  1KX3 C;  2ZY5 A;  3O62 A;  5AV8 A;  3KWQ D;  3B6G B;  1TAF A;  5FUG A;  4QLC A;  4J8V B;  3B6F C;  4WU9 D;  3W97 C;  3A1K A;  3X1U A;  4Z66 C;  4M6B A;  1A7W A;  1P3P D;  1ZLA A;  5GXQ A;  4J8U A;  1P3M D;  4H9N A;  2F2A C;  1P3G D;  4LD9 A;  5G49 B;  4ZUX D;  5GT3 D;  4HGA B;  3REH D;  4YM6 B;  4XUJ A;  3AZL C;  3AZG C;  1P3B D;  1U35 D;  5AV5 B;  5AV5 C;  3AV2 C;  1P3O B;  1ULY A;  4WU8 A;  5B0Z D;  3KSY A;  5B31 G;  5B2J C;  3B0D B;  2G5H C;  3AZE D;  3KUY B;  4X23 D;  5CP6 D;  4KUD C;  3X1V A;  5E5A B;  1P34 C;  5BNX B;  3EPH A;  5DNM A;  5B2I B;  4AWL C;  4J8W D;  5F99 B;  2JE5 A;  1KX3 A;  1ID3 C;  4KHA A;  3MGQ B;  5CPK B;  5JRG B;  4WNN B;  2CV5 C;  3X1S C;  3WTP B;  3AZI B;  4J8V A;  5AV6 D;  4H9R B;  2ZY4 A;  3REK C;  4Z66 A;  1M1A D;  1P3I C;  3AZF D;  2JSS A;  1KU5 A;  3AZH C;  3VH6 A;  5AV9 D;  5G49 A;  3C1B C;  2NQB D;  2HIO C;  3UT9 D;  4YM6 A;  3O62 D;  2F8N D;  3AZL A;  5AV8 D;  3AZG A;  5AV5 A;  3KWQ B;  4QLC D;  5B2J A;  2G5I C;  3W99 C;  5B32 C;  1P3F B;  4KUD A;  4WU9 B;  4WZS B;  3AV1 B;  3AV1 C;  2JCH A;  5E5A A;  1P34 A;  3UTB D;  4KGC C;  1P3P B;  5B0Y D;  5B24 D;  1AOI C;  4UPK A;  4H9Q B;  1ID3 A;  5GT3 B;  3REH B;  2ZY3 A;  5JRG A;  2CV5 A;  3LZ1 D;  3X1S A;  2RVQ C;  1U35 B;  3WA9 C;  3AZI A;  5B0Z B;  4H9R A;  2F8N H;  3REK A;  3AZE B;  2BYM B;  1M19 C;  4Z5T D;  3AZH A;  3W98 D;  1PZR A;  5B40 D;  1BH8 B;  3X1T D;  2HIO A;  2F8N K;  3LZ0 D;  5BT1 D;  4J8W B;  3VH5 A;  1BH9 B;  3AZN D;  4YS3 C;  4YS3 B;  1EQZ B;  5B1L B;  2ARO D;  5AVC C;  3W97 D;  3B6F D;  3A1I A;  5BS7 C;  3AN2 D;  3W99 A;  5B32 A;  4NE3 A;  2Y2Q A;  4J8X C;  5AV6 B;  1P3L C;  3AL0 C;  5GXQ C;  3AV1 A;  5AY8 D;  5CPJ D;  1M18 D;  1M1A B;  3WKJ D;  1Q9C A;  1AOI A;  4XZQ D;  3REJ C;  4H9Q A;  5AV9 B;  3KXB C;  5B31 C;  5CPI C;  1KX4 C;  4CAY A;  5B33 C;  4H9P A;  3AV2 D;  2PYO B;  3AYW C;  2PYO C;  1BFM A;  3MGS D;  2FJ7 C;  4G92 B;  4G92 C;  3WA9 A;  2L5A A;  3UTA D;  2XD1 A;  3LJA B;  5BO0 A;  1M19 A;  3NQJ B;  4R8P C;  3UTB B;  3WAA B;  3WAA C;  5B0Y B;  5B24 B;  4YS3 A;  4CSR A;  5GSU D;  5B1L A;  3B6G C;  2RIQ A;  3W96 D;  3AFA D;  1JFI B;  4UUZ B;  5AVC A;  1HQ3 B;  5GT0 D;  4J8V C;  5BS7 A;  3LZ1 B;  3LEL D;  3MGR D;  3A6N B;  3A6N C;  3REI B;  1F1E A;  3REI C;  4J8X A;  1P3L A;  1P3I D;  2Y2K A;  5B1M D;  2LY8 A;  3IP4 C;  3C1B D;  3AZJ D;  4HGA C;  4Z5T B;  5DNN D;  3W98 B;  4YM6 C;  3REJ A;  5B40 B;  5B31 A;  3KXB A;  1TZY D;  3X1T B;  1KX5 D;  5CPI A;  1KX4 A;  3LZ0 B;  5B33 A;  1P3O C;  3AYW A;  2PYO A;  3AZN B;  2NZD D;  3AZM D;  4JJN D;  3B0D C;  4H9O A;  2FJ7 A;  1S32 D;  4DRA A;  2F8N G;  3W99 D;  5B32 D;  2ARO B;  3KUY C;  3REL D;  3LJA A;  1P3K D;  5E5A C;  2YFV B;  4KGC D;  1F66 D;  5B2I C;  4R8P A;  5F99 C;  3MGP D;  5AY8 B;  3MNN B;  3TU4 D;  5CPJ B;  1M18 B;  3WKJ B;  3WAA A;  3MGQ C;  4ZBJ B;  1N1J B;  3KFU G;  4XZQ B;  3C1C D;  5CPK C;  5JRG C;  3B6G A;  4E45 A;  3WTP C;  1JFI A;  5AVB D;  1HQ3 A;  3AZI C;  3A6N A;  3REI A;  2YFW B;  2Y2O A;  3MVD D;  3AZK D;  3EPJ A;  4G91 B;  2CWE A;  2Y2H A;  5CHL B;  3NQU B;  4Z2M H;  4H9S C;  1P3O A;  5C3I B;  3KWQ C;  5GSU B;  3H0M C;  2VQR A;  3R45 B;  3W96 B;  3AFA B;  1P3F C;  5GT0 B;  3X1U D;  3KUY A;  3MGR B;  4WU9 C;  1ZLA D;  5GXQ D;  4DQY B;  4J8U D;  5BNX A;  5B2I A;  1P3P C;  4LD9 D;  5F99 A;  3MNN A;  1P3M B;  1P3M C;  1P3G B;  4XUJ D;  4ZUX B;  3REJ D;  3AZJ B;  5GT3 C;  3MGQ A;  3REH C;  5DNN B;  5CPK A;  4WNN A;  1WWS A;  1KX5 B;  4WU8 D;  1Z2C B;  1P3B B;  1P3B C;  3WTP A;  3VH6 T;  1U35 C;  2NZD B;  3AZM B;  5B0Z C;  4JJN B;  1P3A D;  1S32 B;  2BYK B;  3AZE C;  3REL B;  3X1V D;  5KDM B;  2Y2M A;  5DNM D;  5CP6 B;  5CP6 C;  4X23 B;  1P3K B;  5BNV B;  1KX3 D;  4J8W C;  3TU4 B;  3VH6 W;  1EQZ C;  5B1L C;  4H9S A;  3KWQ A;  4J8V D;  2Y2N A;  3P5J B;  1P3F A;  5AVB B;  4Z66 D;  2XD5 A;  5AV6 C;  4WU9 A;  3WTP E;  3MVD B;  3AZK B;  1M1A C;  1P3P A;  3AZF B;  3AZF C;  1P3M A;  4YM6 D;  1P3G A;  5AV9 C;  3AZL D;  5GT3 A;  2NQB B;  3UT9 B;  3REH A;  3UT9 C;  3AZG D;  4EO5 B;  2IO5 B;  3O62 B;  5JA4 B;  3B0C T;  5AV8 B;  5AV5 D;  2F8N B;  1P3B A;  5B2J D;  2FFF B;  1U35 A;  1W2E A;  4QLC B;  5B0Z A;  4E44 A;  4KUD D;  3VH5 T;  2ZM5 A;  3LJA C;  3AZE A;  1P34 D;  5E5A D;  2BYM A;  3X1U B;  4X23 A;  5CP6 A;  5F99 D;  4J8U B;  3UTB C;  4H9N B;  1BH8 A;  5B32 G;  3B0C W;  1WWI A;  5B0Y C;  1ID3 D;  4LD9 B;  4J8W A;  5B24 C;  2HUE B;  1BH9 A;  4Z2M G;  5JRG D;  1EQZ A;  2DF4 C;  2CV5 D;  3X1S D;  3VH5 W;  1HQ3 C;  4WU8 B;  3AZI D;  3LZ1 C;  3REK D;  5AV6 A;  3AZH D;  3X1V B;  1M1A A;  2HIO D;  4Z5T C;  3AZF A;  3W98 C;  3FDD A;  5AV9 A;  5B40 C;  2NQB A;  3X1T C;  3UT9 A;  1KX3 B;  3LZ0 C;  5BT1 C;  4KHA B;  5JA4 A;  2F8N A;  3EPL A;  3AZN C;  2Y2P A;  1P3F D;  2ARO C;  3W97 B;  3B6F B;  2DQN C;  3AN2 B;  3AN2 C;  4NE5 A;  3AV1 D;  2Y2J A;  4Z66 B;  3NQJ A;  1AOI D;  5AY8 C;  3MNN C;  3UTB A;  5CPJ C;  1M18 C;  3WKJ C;  5B0Y A;  5B24 A;  4NE6 A;  4ZBJ C;  4XZQ C;  3AZL B;  3AZG B;  2RVQ D;  3EG5 B;  3AV2 B;  4UUZ A;  3WA9 D;  3MGS B;  3MGS C;  3LZ1 A;  5B2J B;  3UTA B;  3UTA C;  1M19 D;  4KUD B;  4G91 C;  2W8S A;  1P34 B;  4AWL B;  4Z5T A;  3W98 A;  5B40 A;  3X1T A;  4YS3 D;  1ID3 B;  1EQZ D;  3LZ0 A;  5B1L D;  5C3I C;  3AZN A;  5GSU C;  5AVC D;  2CV5 B;  3W96 C;  3X1S B;  4NFT A;  2BG1 A;  3AFA C;  2ARO A;  5GT0 C;  3W97 A;  4J8X D;  1P3A B;  3LEL B;  3LEL C;  3MGR C;  3REK B;  3AN2 A;  1P3A C;  1P3L D;  3B6F A;  2YFV A;  4DRB A;  1P3I B;  5B1M B;  5B1M C;  5AY8 A;  2J8P A;  3AZH B;  5CPJ A;  1M18 A;  1P3G C;  3H0L C;  3WKJ A;  4ZUX C;  3KXB D;  5B31 D;  3C1B B;  2HIO B;  3AZJ C;  5CPI D;  1N1J A;  5DNN C;  1KX4 D;  4XZQ A;  2Y2I A;  5B33 D;  3V9R B;  3AYW D;  2PYO D;  1TZY B;  1TZY C;  1KX5 C;  3AV2 A;  2FJ7 D;  2NZD C;  3MGS A;  3AZM C;  4JJN C;  2YFW A;  3LJA D;  2Y2G A;  1S32 C;  3UTA A;  5B32 B;  3REL C;  3W99 B;  1R4V A;  2Y2L A;  4X23 C;  4R8P D;  1P3K C;  4KGC B;  1F66 B;  1F66 C;  3WAA D;  3EPK A;  3MGP B;  3NQU A;  3MGP C;  3TU4 C;  1AOI B;  3B6G D;  4CAY B;  3C1C B;  3C1C C;  4H9P B;  5GSU A;  1HQ3 D;  3R45 A;  3W96 A;  3A6N D;  3REI D;  2ZY2 A;  3AFA A;  5GT0 A;  5AVB C;  3WA9 B;  1P3A A;  3MGR A;  3LEL A;  4WV4 B;  3MVD C;  3AZK C;  1P3I A;  5BO0 B;  1H3O B;  1M19 B;  5B1M A;  4ZUX A;  3C1B A;  3AZJ A;  2NQB C;  5DNN A;  4EO5 C;  2IO5 C;  1P3O D;  3O62 C;  3V9R A;  5AV8 C;  1KX5 A;  1TZY A;  4CSR B;  1TAF B;  5FUG B;  2NZD A;  1B6W A;  4QLC C;  4JJN A;  3AZM A;  5AVC B;  3KUY D;  4WJ3 C; 
#chains in the Genus database with same CATH homology
 1S32 A;  2BYK A;  3REL A;  3H0R C;  5KDM A;  3X1U C;  4J8X B;  1P3L B;  5B2I D;  1ZLA B;  1ZLA C;  5GXQ B;  1P3K A;  5BNV A;  4J8U C;  3MNN D;  4KGC A;  1F66 A;  4LD9 C;  2UWX A;  3MGQ D;  3MGP A;  3TU4 A;  2HUE C;  5CPK D;  4XUJ B;  4XUJ C;  3REJ B;  3KXB B;  5B31 B;  5CPI B;  1KX4 B;  3WTP D;  5B33 B;  3C1C A;  3AYW B;  1B67 A;  4WU8 C;  1T3U A;  4H9O B;  5AVB A;  2FJ7 B;  3MVD A;  3X1V C;  3AZK A;  1H3O A;  3B0B A;  5DNM C;  5DNM B;  4R8P B;  3F6T A;  1HTA A;  1KX3 C;  2ZY5 A;  3O62 A;  5AV8 A;  3KWQ D;  3B6G B;  1TAF A;  5FUG A;  4QLC A;  4J8V B;  3B6F C;  4WU9 D;  3W97 C;  3A1K A;  3X1U A;  4Z66 C;  4M6B A;  1A7W A;  1P3P D;  1ZLA A;  5GXQ A;  4J8U A;  1P3M D;  4H9N A;  2F2A C;  1P3G D;  4LD9 A;  5G49 B;  4ZUX D;  5GT3 D;  4HGA B;  3REH D;  4YM6 B;  4XUJ A;  3AZL C;  3AZG C;  1P3B D;  1U35 D;  5AV5 B;  5AV5 C;  3AV2 C;  1P3O B;  1ULY A;  4WU8 A;  5B0Z D;  3KSY A;  5B31 G;  5B2J C;  3B0D B;  2G5H C;  3AZE D;  3KUY B;  4X23 D;  5CP6 D;  4KUD C;  3X1V A;  5E5A B;  1P34 C;  5BNX B;  3EPH A;  5DNM A;  5B2I B;  4AWL C;  4J8W D;  5F99 B;  2JE5 A;  1KX3 A;  1ID3 C;  4KHA A;  3MGQ B;  5CPK B;  5JRG B;  4WNN B;  2CV5 C;  3X1S C;  3WTP B;  3AZI B;  4J8V A;  5AV6 D;  4H9R B;  2ZY4 A;  3REK C;  4Z66 A;  1M1A D;  1P3I C;  3AZF D;  2JSS A;  1KU5 A;  3AZH C;  3VH6 A;  5AV9 D;  5G49 A;  3C1B C;  2NQB D;  2HIO C;  3UT9 D;  4YM6 A;  3O62 D;  2F8N D;  3AZL A;  5AV8 D;  3AZG A;  5AV5 A;  3KWQ B;  4QLC D;  5B2J A;  2G5I C;  3W99 C;  5B32 C;  1P3F B;  4KUD A;  4WU9 B;  4WZS B;  3AV1 B;  3AV1 C;  2JCH A;  5E5A A;  1P34 A;  3UTB D;  4KGC C;  1P3P B;  5B0Y D;  5B24 D;  1AOI C;  4UPK A;  4H9Q B;  1ID3 A;  5GT3 B;  3REH B;  2ZY3 A;  5JRG A;  2CV5 A;  3LZ1 D;  3X1S A;  2RVQ C;  1U35 B;  3WA9 C;  3AZI A;  5B0Z B;  4H9R A;  2F8N H;  3REK A;  3AZE B;  2BYM B;  1M19 C;  4Z5T D;  3AZH A;  3W98 D;  1PZR A;  5B40 D;  1BH8 B;  3X1T D;  2HIO A;  2F8N K;  3LZ0 D;  5BT1 D;  4J8W B;  3VH5 A;  1BH9 B;  3AZN D;  4YS3 C;  4YS3 B;  1EQZ B;  5B1L B;  2ARO D;  5AVC C;  3W97 D;  3B6F D;  3A1I A;  5BS7 C;  3AN2 D;  3W99 A;  5B32 A;  4NE3 A;  2Y2Q A;  4J8X C;  5AV6 B;  1P3L C;  3AL0 C;  5GXQ C;  3AV1 A;  5AY8 D;  5CPJ D;  1M18 D;  1M1A B;  3WKJ D;  1Q9C A;  1AOI A;  4XZQ D;  3REJ C;  4H9Q A;  5AV9 B;  3KXB C;  5B31 C;  5CPI C;  1KX4 C;  4CAY A;  5B33 C;  4H9P A;  3AV2 D;  2PYO B;  3AYW C;  2PYO C;  1BFM A;  3MGS D;  2FJ7 C;  4G92 B;  4G92 C;  3WA9 A;  2L5A A;  3UTA D;  2XD1 A;  3LJA B;  5BO0 A;  1M19 A;  3NQJ B;  4R8P C;  3UTB B;  3WAA B;  3WAA C;  5B0Y B;  5B24 B;  4YS3 A;  4CSR A;  5GSU D;  5B1L A;  3B6G C;  2RIQ A;  3W96 D;  3AFA D;  1JFI B;  4UUZ B;  5AVC A;  1HQ3 B;  5GT0 D;  4J8V C;  5BS7 A;  3LZ1 B;  3LEL D;  3MGR D;  3A6N B;  3A6N C;  3REI B;  1F1E A;  3REI C;  4J8X A;  1P3L A;  1P3I D;  2Y2K A;  5B1M D;  2LY8 A;  3IP4 C;  3C1B D;  3AZJ D;  4HGA C;  4Z5T B;  5DNN D;  3W98 B;  4YM6 C;  3REJ A;  5B40 B;  5B31 A;  3KXB A;  1TZY D;  3X1T B;  1KX5 D;  5CPI A;  1KX4 A;  3LZ0 B;  5B33 A;  1P3O C;  3AYW A;  2PYO A;  3AZN B;  2NZD D;  3AZM D;  4JJN D;  3B0D C;  4H9O A;  2FJ7 A;  1S32 D;  4DRA A;  2F8N G;  3W99 D;  5B32 D;  2ARO B;  3KUY C;  3REL D;  3LJA A;  1P3K D;  5E5A C;  2YFV B;  4KGC D;  1F66 D;  5B2I C;  4R8P A;  5F99 C;  3MGP D;  5AY8 B;  3MNN B;  3TU4 D;  5CPJ B;  1M18 B;  3WKJ B;  3WAA A;  3MGQ C;  4ZBJ B;  1N1J B;  3KFU G;  4XZQ B;  3C1C D;  5CPK C;  5JRG C;  3B6G A;  4E45 A;  3WTP C;  1JFI A;  5AVB D;  1HQ3 A;  3AZI C;  3A6N A;  3REI A;  2YFW B;  2Y2O A;  3MVD D;  3AZK D;  3EPJ A;  4G91 B;  2CWE A;  2Y2H A;  5CHL B;  3NQU B;  4Z2M H;  4H9S C;  1P3O A;  5C3I B;  3KWQ C;  5GSU B;  3H0M C;  2VQR A;  3R45 B;  3W96 B;  3AFA B;  1P3F C;  5GT0 B;  3X1U D;  3KUY A;  3MGR B;  4WU9 C;  1ZLA D;  5GXQ D;  4DQY B;  4J8U D;  5BNX A;  5B2I A;  1P3P C;  4LD9 D;  5F99 A;  3MNN A;  1P3M B;  1P3M C;  1P3G B;  4XUJ D;  4ZUX B;  3REJ D;  3AZJ B;  5GT3 C;  3MGQ A;  3REH C;  5DNN B;  5CPK A;  4WNN A;  1WWS A;  1KX5 B;  4WU8 D;  1Z2C B;  1P3B B;  1P3B C;  3WTP A;  3VH6 T;  1U35 C;  2NZD B;  3AZM B;  5B0Z C;  4JJN B;  1P3A D;  1S32 B;  2BYK B;  3AZE C;  3REL B;  3X1V D;  5KDM B;  2Y2M A;  5DNM D;  5CP6 B;  5CP6 C;  4X23 B;  1P3K B;  5BNV B;  1KX3 D;  4J8W C;  3TU4 B;  3VH6 W;  1EQZ C;  5B1L C;  4H9S A;  3KWQ A;  4J8V D;  2Y2N A;  3P5J B;  1P3F A;  5AVB B;  4Z66 D;  2XD5 A;  5AV6 C;  4WU9 A;  3WTP E;  3MVD B;  3AZK B;  1M1A C;  1P3P A;  3AZF B;  3AZF C;  1P3M A;  4YM6 D;  1P3G A;  5AV9 C;  3AZL D;  5GT3 A;  2NQB B;  3UT9 B;  3REH A;  3UT9 C;  3AZG D;  4EO5 B;  2IO5 B;  3O62 B;  5JA4 B;  3B0C T;  5AV8 B;  5AV5 D;  2F8N B;  1P3B A;  5B2J D;  2FFF B;  1U35 A;  1W2E A;  4QLC B;  5B0Z A;  4E44 A;  4KUD D;  3VH5 T;  2ZM5 A;  3LJA C;  3AZE A;  1P34 D;  5E5A D;  2BYM A;  3X1U B;  4X23 A;  5CP6 A;  5F99 D;  4J8U B;  3UTB C;  4H9N B;  1BH8 A;  5B32 G;  3B0C W;  1WWI A;  5B0Y C;  1ID3 D;  4LD9 B;  4J8W A;  5B24 C;  2HUE B;  1BH9 A;  4Z2M G;  5JRG D;  1EQZ A;  2DF4 C;  2CV5 D;  3X1S D;  3VH5 W;  1HQ3 C;  4WU8 B;  3AZI D;  3LZ1 C;  3REK D;  5AV6 A;  3AZH D;  3X1V B;  1M1A A;  2HIO D;  4Z5T C;  3AZF A;  3W98 C;  3FDD A;  5AV9 A;  5B40 C;  2NQB A;  3X1T C;  3UT9 A;  1KX3 B;  3LZ0 C;  5BT1 C;  4KHA B;  5JA4 A;  2F8N A;  3EPL A;  3AZN C;  2Y2P A;  1P3F D;  2ARO C;  3W97 B;  3B6F B;  2DQN C;  3AN2 B;  3AN2 C;  4NE5 A;  3AV1 D;  2Y2J A;  4Z66 B;  3NQJ A;  1AOI D;  5AY8 C;  3MNN C;  3UTB A;  5CPJ C;  1M18 C;  3WKJ C;  5B0Y A;  5B24 A;  4NE6 A;  4ZBJ C;  4XZQ C;  3AZL B;  3AZG B;  2RVQ D;  3EG5 B;  3AV2 B;  4UUZ A;  3WA9 D;  3MGS B;  3MGS C;  3LZ1 A;  5B2J B;  3UTA B;  3UTA C;  1M19 D;  4KUD B;  4G91 C;  2W8S A;  1P34 B;  4AWL B;  4Z5T A;  3W98 A;  5B40 A;  3X1T A;  4YS3 D;  1ID3 B;  1EQZ D;  3LZ0 A;  5B1L D;  5C3I C;  3AZN A;  5GSU C;  5AVC D;  2CV5 B;  3W96 C;  3X1S B;  4NFT A;  2BG1 A;  3AFA C;  2ARO A;  5GT0 C;  3W97 A;  4J8X D;  1P3A B;  3LEL B;  3LEL C;  3MGR C;  3REK B;  3AN2 A;  1P3A C;  1P3L D;  3B6F A;  2YFV A;  4DRB A;  1P3I B;  5B1M B;  5B1M C;  5AY8 A;  2J8P A;  3AZH B;  5CPJ A;  1M18 A;  1P3G C;  3H0L C;  3WKJ A;  4ZUX C;  3KXB D;  5B31 D;  3C1B B;  2HIO B;  3AZJ C;  5CPI D;  1N1J A;  5DNN C;  1KX4 D;  4XZQ A;  2Y2I A;  5B33 D;  3V9R B;  3AYW D;  2PYO D;  1TZY B;  1TZY C;  1KX5 C;  3AV2 A;  2FJ7 D;  2NZD C;  3MGS A;  3AZM C;  4JJN C;  2YFW A;  3LJA D;  2Y2G A;  1S32 C;  3UTA A;  5B32 B;  3REL C;  3W99 B;  1R4V A;  2Y2L A;  4X23 C;  4R8P D;  1P3K C;  4KGC B;  1F66 B;  1F66 C;  3WAA D;  3EPK A;  3MGP B;  3NQU A;  3MGP C;  3TU4 C;  1AOI B;  3B6G D;  4CAY B;  3C1C B;  3C1C C;  4H9P B;  5GSU A;  1HQ3 D;  3R45 A;  3W96 A;  3A6N D;  3REI D;  2ZY2 A;  3AFA A;  5GT0 A;  5AVB C;  3WA9 B;  1P3A A;  3MGR A;  3LEL A;  4WV4 B;  3MVD C;  3AZK C;  1P3I A;  5BO0 B;  1H3O B;  1M19 B;  5B1M A;  4ZUX A;  3C1B A;  3AZJ A;  2NQB C;  5DNN A;  4EO5 C;  2IO5 C;  1P3O D;  3O62 C;  3V9R A;  5AV8 C;  1KX5 A;  1TZY A;  4CSR B;  1TAF B;  5FUG B;  2NZD A;  1B6W A;  4QLC C;  4JJN A;  3AZM A;  5AVC B;  3KUY D;  4WJ3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...