4UUZB

Mcm2-histone complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HISTONE H3
publication title Structural Insight Into How the Human Helicase Subunit Mcm2 May Act as a Histone Chaperone Together with Asf1 at the Replication Fork.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4uuzB00
2HIOB 5G49B 3W96C 5B1LC 1S32A 4XZQB 3X1TD 1AOIC 2YFWA 3VH5W 3AZEC 4XUJC 4QLCA 3MVDC 3X1VB 4KUDD 5KDMB 4R8PD 1JFIB 3REIC 4ZUXA 3WAAC 3MGSB 1JFIA 4CSRB 5B0YB 3MGPC 3AFAA 3LZ1D 5AVCD 3AZIB 3AZKD 3W98A 5B1MB 3X1UC 2PYOC 4EO5B 5B0YA 4H9RB 3WTPE 4H9QB 5BS7C 3KWQC 3TU4C 1H3OB 3UTAC 5C3IC 3X1TB 3AZNC 4WU8D 1P34C 5CPJD 4J8UD 3WTPD 1P3OD 4KUDB 3W97C 3AZFA 1ID3C 3W99D 2FJ7D 5CP6A 3WKJC 3KXBD 5DNNA 1S32C 5E5AA 3LZ1B 5AVCB 4QLCC 1M18D 3LJAD 1P3FA 3UT9A 4Z66B 3NQJA 5BNXB 4ZUXC 3MNND 3AV2D 4WNNB 4WU8B 5CPIA 1P3MD 4J8UB 5CPJB 3AFAC 5AV5D 1EQZA 4Z66A 5JRGD 3W98C 5BNXA 1M1AA 4WNNA 4KHAA 5B0YC 5AV8A 3W99B 2FJ7B 3AZIC 5B1MC 3KXBB 5B24D 4J8WD 4EO5C 3AZLA 3KSYA 4LD9A 4CAYB 3X1SA 3AZFC 3W96D 5B1LD 5F99A 1AOID 5CP6C 3AZED 4XUJD 5AV6A 5DNNC 1P3MB 5E5AC 5AV5B 5JRGB 1P3FC 5BO0A 3REID 3WAAD 3AV1A 3UT9C 4G92C 3MGPD 3AN2B 1P3KA 4H9PB 1KU5A 5CPIC 3X1UD 2PYOD 4KGCA 1EQZC 4Z66C 3AN2A 4NE3A 3KWQD 1M1AC 3W96B 3TU4D 3UTAD 3AZND 4XUJB 3R45B 3B0CT 4DRAA 3AZLC 1P3BA 3W97D 3W99C 4LD9C 2BYMB 1ID3D 3X1SC 3WKJD 3AZGA 2L5AA 1S32D 5GT3A 3MGPB 5AV6C 1BFMA 4QLCD 1N1JB 4H9NB 4H9OA 3X1UB 5B40A 1A7WA 3REHA 3KWQB 5GSUA 3TU4B 4ZUXD 5C3IB 3UTAB 1P3KC 3AFAD 3V9RB 3W98D 5AVBA 1KX4B 3W97B 5B0YD 4KGCC 2NZDB 3AN2C 3V9RA 4Z2MH 3WKJB 3REJA 1KX4A 3B0BA 2BYKB 3VH6W 1S32B 2YFWB 2NZDA 4QLCB 2BYKA 1P3BC 3AZFD 1U35A 4J8VA 5CP6D 2F8NB 4ZUXB 5DNND 3AZGC 5GT3C 5E5AD 3AFAB 2F8NA 3W98B 1P3FD 2F8NK 5B40C 5B2JA 1TZYA 2YFVA 4NE6A 4AWLC 1WWIA 3UT9D 1BH9A 1ZLAA 2JSSA 5CPID 1EQZD 4Z66D 5AVBC 1M1AD 3AZFB 5AV8D 5CP6B 3REJC 1KX4C 5DNNB 4H9SA 4YS3A 3AZLD 4LD9D 2NZDC 5E5AB 4M6BA 2LY8A 1P3FB 3X1SD 3AZMA 4WU9A 1HQ3A 1U35C 5F99D 4J8VC 3UT9B 4G92B 3NQJB 5AV6D 2HUEC 5CPIB 1EQZB 3B6GB 1M1AB 4KHAB 5B2JC 5AV8B 1TZYC 2NQBA 3AV1D 3B6GA 1P3KD 4G91C 4YM6B 5B31A 1ZLAC 4HGAB 5FUGB 3AZLB 4LD9B 5CPKA 5B32A 3MGQA 4KGCD 4YM6A 3AN2D 3X1SB 5FUGA 5GT0A 5F99B 3C1CA 2AROA 5AV6B 4DRBA 1P3GB 4H9SC 4YS3C 1P3BD 1M19A 3AZMC 5BO0B 1P3GA 2F8NG 1HQ3C 3AV1B 3AZGD 4X23B 5GT3D 1P3KB 3A6NA 5B40D 4X23A 3UTBA 1P3OA 4KGCB 3O62A 3REHD 5B33A 1KX5A 5GSUD 2NQBC 3B6GC 3C1BA 5B31C 1WWSA 5AVBD 5AV8C 1P3BB 1HTAA 5B32C 3MGQC 4YM6C 1P3LA 3RELB 4HGAC 4NE5A 3REJD 1KX4D 5GT0C 3KUYA 3AZGB 2NZDD 2AROC 5GT3B 3RELA 4Z5TA 3AZJA 4H9OB 5F99C 1KX3A 5B40B 1P3AA 1BH8A 4ZBJC 1U35D 4J8VD 3B0CW 4AWLB 3REHB 5GSUB 1P3GC 4E44A 2F8ND 5AVBB 3A6NC 3AV1C 5B31G 5BNVA 5B2JD 1TZYD 4X23C 4NFTA 3O62C 3UTBC 1P3OC 5B33C 5B32G 1P3IA 5AY8A 3REJB 1ZLAD 3REKA 3MVDA 3C1BC 5BT1C 3WA9A 3MGQB 3AYWA 1U35B 4J8VB 1P3LC 2HUEB 3KUYC 4J8XA 3VH6A 4YS3D 3RELC 3NQUA 4Z5TC 3AZJC 3AZMD 1KX3C 4WU9D 1HQ3D 3VH6T 5B2JB 1P3AC 1TZYB 2YFVB 2F8NH 5B0ZA 3VH5A 5JA4A 3AZHA 3B6FB 4G91B 1BH9B 1ZLAB 3VH5T 3REHC 1P34A 5DNMA 5GSUC 3LELA 5GXQA 5B2IA 3B6FA 3LZ0A 5AV9B 2NQBD 1F66A 3B6GD 3MGRA 2CV5B 5AY8C 4JJNA 1P3IC 5AV9A 1P3PA 5B31D 4YS3B 3REKC 2HIOA 5G49A 1Q9CA 2IO5C 5B32D 3MGQD 5CPKD 2CV5A 4XZQA 4YM6D 3WA9C 3AZMB 4WU9B 1HQ3B 3AYWC 5GT0D 3C1CD 3X1VA 5KDMA 2RVQC 2AROD 4J8XC 1M19D 3MGSA 4CSRA 1P3GD 3AZIA 2NQBB 5B0ZC 5B1MA 3AZHC 4H9RA 4H9QA 5B31B 3A6ND 5CPKB 1H3OA 5CHLB 5B32B 5DNMC 4R8PB 4X23D 5GXQC 5B2IC 3O62D 3LELC 3LZ0C 5B33D 3UTBD 3X1TA 1KX5D 3B6FC 5GT0B 3C1CB 4KUDA 1F66C 4R8PA 2AROB 3MGRC 3C1BD 4JJNC 5AV9C 5BT1D 1P3PC 3AZKB 2HIOC 1M19B 4ZBJB 2CV5C 4XZQC 1P3LD 3LZ1A 2CWEA 5AVCA 3AZKA 3KUYD 3X1VC 4UUZB 3RELD 4WU9C 3WTPB 4Z5TD 3A6NB 3AZJD 1KX3D 1P3AD 4UUZA 3MGSC 3UTBB 1B67A 1P3OB 3O62B 5B33B 4WU8A 1KX5B 4J8UA 5CPJA 4Z2MG 3WTPA 3C1BB 3W99A 2FJ7A 1M18B 3LJAB 3KXBA 3X1TC 1ULYA 1TAFB 1P3LB 1P3ID 5AY8D 4CAYA 1M18A 4WV4B 3LJAA 3KUYB 4KUDC 5CPKC 3MNNB 3AV2B 4R8PC 3REKD 1TAFA 3MVDD 4Z5TB 3WA9D 3AZJB 1KX3B 3C1CC 3B0DB 1P3AB 3MNNA 1BH8B 3AV2A 3AYWD 1P3MA 2RVQD 5AV5A 3LZ1C 5AVCC 3AZKC 5JRGA 1M19C 4J8XD 5B24B 4J8WB 5B24A 5BNVB 4J8WA 4H9PA 5B0ZD 5B1LB 4WU8C 4J8UC 3AZHD 5AY8B 3WTPC 5CPJC 1P3IB 1AOIB 3AZEB 3REKB 3W96A 4WZSB 3MVDB 2IO5B 5B1LA 1KX5C 1R4VA 5DNMD 3LELD 1P34D 5GXQD 5B2ID 1AOIA 2FJ7C 3LZ0D 3AZEA 4XUJA 3B6FD 3WA9B 3AYWB 3KXBC 3R45A 4E45A 3REIB 1B6WA 1F66D 3WAAB 3MGRD 2BYMA 4JJND 1M18C 5AV9D 3LJAC 1P3PD 4J8XB 2HIOD 3REIA 3WAAA 2PYOB 3NQUB 2CV5D 4XZQD 3MGPA 3MNNC 3AV2C 1N1JA 4H9NA 5B0ZB 5JA4B 3X1VD 3X1UA 2PYOA 1P3MC 3AZHB 5AV5C 3AZNB 5BS7A 5JRGC 3B0DC 3KWQA 3TU4A 3UTAA 1P34B 3MGSD 3LELB 5DNMB 5GXQB 5B2IB 3AZNA 3LZ0B 1ID3B 5B24C 3AZID 4J8WC 3W97A 1F66B 5B1MD 1F1EA 3MGRB 4JJNB 1ID3A 1P3PB 3WKJA
chains in the Genus database with same CATH superfamily
2HIOB 5G49B 3W96C 5B1LC 1S32A 4XZQB 3X1TD 3EG5B 2YFWA 3VH5W 3AZEC 4XUJC 1AOIC 4QLCA 3MVDC 3X1VB 4KUDD 5KDMB 4R8PD 1JFIB 2ZY5A 3A1KA 3REIC 4ZUXA 3WAAC 3MGSB 1JFIA 4CSRB 5B0YB 3MGPC 3AFAA 3LZ1D 5AVCD 3AZIB 3AZKD 3W98A 5B1MB 3X1UC 2PYOC 4EO5B 5B0YA 4H9RB 3WTPE 4H9QB 5BS7C 3KWQC 3TU4C 1H3OB 3UTAC 3FDDA 5C3IC 3X1TB 3AZNC 2RIQA 4WU8D 1P34C 5CPJD 4J8UD 3WTPD 1P3OD 4KUDB 3W97C 3AZFA 1ID3C 3W99D 2FJ7D 5CP6A 3WKJC 3KXBD 5DNNA 1S32C 3EPHA 5E5AA 3LZ1B 5AVCB 4QLCC 1M18D 3LJAD 1P3FA 3UT9A 4Z66B 3NQJA 5BNXB 4ZUXC 3MNND 3AV2D 4WNNB 4WU8B 5CPIA 1P3MD 4J8UB 5CPJB 3AFAC 5AV5D 1EQZA 4Z66A 5JRGD 3W98C 5BNXA 1M1AA 4WNNA 4KHAA 5B0YC 5AV8A 3W99B 2FJ7B 3EPLA 3AZIC 5B1MC 3KXBB 5B24D 4J8WD 4EO5C 3AZLA 3KSYA 4LD9A 4CAYB 3X1SA 2UWXA 3AZFC 3W96D 4DQYB 5B1LD 5F99A 1AOID 5CP6C 3AZED 4XUJD 5AV6A 5DNNC 1P3MB 5E5AC 5AV5B 2ZY2A 5JRGB 1P3FC 5BO0A 3REID 3WAAD 3AV1A 3UT9C 4G92C 3MGPD 3AN2B 1P3KA 4H9PB 2Y2MA 1KU5A 5CPIC 3X1UD 2PYOD 4KGCA 1EQZC 4Z66C 3AN2A 4NE3A 3KWQD 1M1AC 3W96B 3TU4D 3UTAD 3AZND 4XUJB 3R45B 3B0CT 4DRAA 3AZLC 1P3BA 3W97D 3W99C 4LD9C 3KFUG 2BYMB 1ID3D 2Y2QA 3X1SC 3P5JB 3WKJD 3AZGA 2L5AA 1S32D 5GT3A 3MGPB 5AV6C 1BFMA 4QLCD 1N1JB 4H9NB 4H9OA 3X1UB 5B40A 1A7WA 3REHA 3KWQB 5GSUA 3TU4B 4ZUXD 5C3IB 3UTAB 2VQRA 3IP4C 1P3KC 3AFAD 3V9RB 3W98D 5AVBA 1KX4B 3W97B 5B0YD 4KGCC 2NZDB 3AN2C 3V9RA 4Z2MH 3WKJB 3REJA 1KX4A 3B0BA 2BYKB 3VH6W 1S32B 2YFWB 2NZDA 4QLCB 2BYKA 1P3BC 3AZFD 1U35A 4J8VA 3H0MC 5CP6D 2F8NB 4ZUXB 5DNND 3AZGC 2Y2IA 5GT3C 5E5AD 3AFAB 2F8NA 3W98B 1P3FD 2F8NK 5B40C 5B2JA 1TZYA 2YFVA 4NE6A 4AWLC 1WWIA 3UT9D 2Y2HA 1BH9A 1ZLAA 2JSSA 5CPID 1EQZD 4Z66D 5AVBC 1M1AD 3AZFB 5AV8D 5CP6B 3REJC 2Y2GA 1KX4C 2G5IC 5DNNB 4H9SA 4YS3A 3AZLD 4LD9D 2NZDC 5E5AB 4M6BA 2LY8A 1P3FB 3X1SD 3AZMA 4WU9A 1HQ3A 1U35C 5F99D 4J8VC 2XD5A 3UT9B 4G92B 3NQJB 5AV6D 2HUEC 1W2EA 5CPIB 1EQZB 3B6GB 1M1AB 4KHAB 5B2JC 5AV8B 1TZYC 2NQBA 3AV1D 3B6GA 1P3KD 4G91C 4YM6B 5B31A 1ZLAC 4HGAB 5FUGB 3AZLB 4LD9B 5CPKA 5B32A 3MGQA 4KGCD 4YM6A 3AN2D 3X1SB 5FUGA 5GT0A 5F99B 3C1CA 3H0RC 2AROA 5AV6B 4DRBA 1P3GB 4H9SC 4YS3C 1P3BD 1M19A 3AZMC 5BO0B 1P3GA 2F8NG 1HQ3C 2Y2NA 3AV1B 3AZGD 4X23B 5GT3D 1P3KB 3A6NA 5B40D 4X23A 3UTBA 1P3OA 4KGCB 3O62A 3REHD 5B33A 1KX5A 5GSUD 2NQBC 3B6GC 3C1BA 1T3UA 5B31C 1WWSA 5AVBD 5AV8C 1P3BB 1HTAA 2G5HC 5B32C 3MGQC 4YM6C 1P3LA 3RELB 4HGAC 4NE5A 3REJD 1KX4D 5GT0C 3KUYA 3AZGB 2NZDD 2AROC 5GT3B 3RELA 4Z5TA 3AZJA 4H9OB 5F99C 1KX3A 5B40B 1P3AA 1BH8A 4ZBJC 1U35D 4J8VD 3B0CW 4AWLB 3REHB 5GSUB 1P3GC 4E44A 2F8ND 5AVBB 3A6NC 2Y2LA 3AV1C 5B31G 5BNVA 5B2JD 1TZYD 4X23C 4NFTA 3O62C 3UTBC 1P3OC 5B33C 5B32G 1P3IA 5AY8A 3REJB 1ZLAD 3REKA 3A1IA 2JCHA 3MVDA 3C1BC 5BT1C 3WA9A 3MGQB 2DQNC 3AYWA 1U35B 4J8VB 1P3LC 2JE5A 2HUEB 3KUYC 4J8XA 3VH6A 4YS3D 3RELC 3NQUA 4Z5TC 3AZJC 3AZMD 1KX3C 4WU9D 1HQ3D 3VH6T 5B2JB 1P3AC 1TZYB 2YFVB 4UPKA 5B0ZA 2F8NH 3VH5A 5JA4A 3AZHA 3B6FB 4G91B 1BH9B 1ZLAB 3VH5T 3REHC 1P34A 5DNMA 5GSUC 3LELA 5GXQA 5B2IA 3B6FA 3LZ0A 5AV9B 3AL0C 2Y2KA 2NQBD 1F66A 3B6GD 3MGRA 2CV5B 5AY8C 4JJNA 1Z2CB 1P3IC 5AV9A 1P3PA 5B31D 2DF4C 3REKC 2HIOA 5G49A 4YS3B 1Q9CA 2IO5C 5B32D 3MGQD 5CPKD 2CV5A 4XZQA 4YM6D 3WA9C 3AZMB 4WU9B 1HQ3B 3AYWC 5GT0D 3C1CD 3X1VA 5KDMA 2RVQC 2AROD 3F6TA 2Y2JA 3EPJA 4J8XC 1M19D 3MGSA 4CSRA 2W8SA 1P3GD 3AZIA 2NQBB 5B0ZC 5B1MA 3AZHC 4H9RA 4H9QA 5B31B 3A6ND 2FFFB 5CPKB 1H3OA 5CHLB 5B32B 5DNMC 4R8PB 4X23D 5GXQC 5B2IC 3O62D 3LELC 3LZ0C 5B33D 3UTBD 3X1TA 1KX5D 3B6FC 5GT0B 3C1CB 4KUDA 1F66C 4R8PA 2AROB 3MGRC 3C1BD 4JJNC 2ZM5A 5AV9C 5BT1D 1P3PC 3AZKB 2HIOC 1M19B 4ZBJB 1PZRA 2CV5C 4XZQC 2Y2OA 1P3LD 3LZ1A 2CWEA 5AVCA 3AZKA 3KUYD 3X1VC 4UUZB 3RELD 4WU9C 3WTPB 4Z5TD 3A6NB 3AZJD 1KX3D 1P3AD 4UUZA 3MGSC 3UTBB 1B67A 1P3OB 3O62B 5B33B 4WU8A 1KX5B 4J8UA 5CPJA 4Z2MG 3WTPA 2BG1A 2J8PA 3C1BB 3W99A 2FJ7A 2Y2PA 1M18B 3LJAB 3KXBA 3X1TC 1ULYA 1TAFB 1P3LB 1P3ID 5AY8D 4CAYA 1M18A 4WV4B 3LJAA 3KUYB 4WJ3C 4KUDC 5CPKC 3MNNB 3AV2B 4R8PC 3REKD 1TAFA 3MVDD 4Z5TB 3WA9D 3AZJB 1KX3B 3C1CC 3B0DB 1P3AB 3MNNA 1BH8B 3H0LC 3AYWD 3AV2A 1P3MA 2RVQD 5AV5A 3LZ1C 5AVCC 3AZKC 5JRGA 2ZY4A 1M19C 4J8XD 5B24B 4J8WB 5B24A 5BNVB 4J8WA 4H9PA 5B0ZD 5B1LB 4WU8C 4J8UC 3AZHD 5AY8B 3WTPC 5CPJC 1P3IB 1AOIB 3AZEB 3REKB 3W96A 4WZSB 3MVDB 2IO5B 5B1LA 1KX5C 1R4VA 5DNMD 3LELD 1P34D 5GXQD 5B2ID 1AOIA 2FJ7C 3LZ0D 3AZEA 4XUJA 3B6FD 3WA9B 3AYWB 3KXBC 3R45A 4E45A 3REIB 1B6WA 1F66D 3WAAB 3MGRD 2F2AC 2BYMA 4JJND 1M18C 5AV9D 3LJAC 1P3PD 4J8XB 2HIOD 3REIA 3WAAA 2PYOB 3NQUB 2CV5D 4XZQD 3MGPA 3MNNC 3AV2C 1N1JA 4H9NA 5B0ZB 2XD1A 5JA4B 3X1VD 3X1UA 3EPKA 1P3MC 2PYOA 3AZHB 5AV5C 3AZNB 5BS7A 5JRGC 3B0DC 3KWQA 3TU4A 3UTAA 1P34B 3MGSD 3LELB 5DNMB 5GXQB 5B2IB 3AZNA 3LZ0B 1ID3B 2ZY3A 5B24C 3AZID 4J8WC 3W97A 1F66B 5B1MD 1F1EA 3MGRB 4JJNB 1ID3A 1P3PB 3WKJA
chains in the Genus database with same CATH topology
2HIOB 5G49B 3W96C 5B1LC 1S32A 4XZQB 3X1TD 3EG5B 2YFWA 3VH5W 3AZEC 4XUJC 1AOIC 4QLCA 3MVDC 3X1VB 4KUDD 5KDMB 4R8PD 1JFIB 2ZY5A 3A1KA 3REIC 4ZUXA 3WAAC 3MGSB 1JFIA 4CSRB 5B0YB 3MGPC 3AFAA 3LZ1D 5AVCD 3AZIB 3AZKD 3W98A 5B1MB 3X1UC 2PYOC 4EO5B 5B0YA 4H9RB 3WTPE 4H9QB 5BS7C 3KWQC 3TU4C 1H3OB 3UTAC 3FDDA 5C3IC 3X1TB 3AZNC 2RIQA 4WU8D 1P34C 5CPJD 4J8UD 3WTPD 1P3OD 4KUDB 3W97C 3AZFA 1ID3C 3W99D 2FJ7D 5CP6A 3WKJC 3KXBD 5DNNA 1S32C 3EPHA 5E5AA 3LZ1B 5AVCB 4QLCC 1M18D 3LJAD 1P3FA 3UT9A 4Z66B 3NQJA 5BNXB 4ZUXC 3MNND 3AV2D 4WNNB 4WU8B 5CPIA 1P3MD 4J8UB 5CPJB 3AFAC 5AV5D 1EQZA 4Z66A 5JRGD 3W98C 5BNXA 1M1AA 4WNNA 4KHAA 5B0YC 5AV8A 3W99B 2FJ7B 3EPLA 3AZIC 5B1MC 3KXBB 5B24D 4J8WD 4EO5C 3AZLA 3KSYA 4LD9A 4CAYB 3X1SA 2UWXA 3AZFC 3W96D 4DQYB 5B1LD 5F99A 1AOID 5CP6C 3AZED 4XUJD 5AV6A 5DNNC 1P3MB 5E5AC 5AV5B 2ZY2A 5JRGB 1P3FC 5BO0A 3REID 3WAAD 3AV1A 3UT9C 4G92C 3MGPD 3AN2B 1P3KA 4H9PB 2Y2MA 1KU5A 5CPIC 3X1UD 2PYOD 4KGCA 1EQZC 4Z66C 3AN2A 4NE3A 3KWQD 1M1AC 3W96B 3TU4D 3UTAD 3AZND 4XUJB 3R45B 3B0CT 4DRAA 3AZLC 1P3BA 3W97D 3W99C 4LD9C 3KFUG 2BYMB 1ID3D 2Y2QA 3X1SC 3P5JB 3WKJD 3AZGA 2L5AA 1S32D 5GT3A 3MGPB 5AV6C 1BFMA 4QLCD 1N1JB 4H9NB 4H9OA 3X1UB 5B40A 1A7WA 3REHA 3KWQB 5GSUA 3TU4B 4ZUXD 5C3IB 3UTAB 2VQRA 3IP4C 1P3KC 3AFAD 3V9RB 3W98D 5AVBA 1KX4B 3W97B 5B0YD 4KGCC 2NZDB 3AN2C 3V9RA 4Z2MH 3WKJB 3REJA 1KX4A 3B0BA 2BYKB 3VH6W 1S32B 2YFWB 2NZDA 4QLCB 2BYKA 1P3BC 3AZFD 1U35A 4J8VA 3H0MC 5CP6D 2F8NB 4ZUXB 5DNND 3AZGC 2Y2IA 5GT3C 5E5AD 3AFAB 2F8NA 3W98B 1P3FD 2F8NK 5B40C 5B2JA 1TZYA 2YFVA 4NE6A 4AWLC 1WWIA 3UT9D 2Y2HA 1BH9A 1ZLAA 2JSSA 5CPID 1EQZD 4Z66D 5AVBC 1M1AD 3AZFB 5AV8D 5CP6B 3REJC 2Y2GA 1KX4C 2G5IC 5DNNB 4H9SA 4YS3A 3AZLD 4LD9D 2NZDC 5E5AB 4M6BA 2LY8A 1P3FB 3X1SD 3AZMA 4WU9A 1HQ3A 1U35C 5F99D 4J8VC 2XD5A 3UT9B 4G92B 3NQJB 5AV6D 2HUEC 1W2EA 5CPIB 1EQZB 3B6GB 1M1AB 4KHAB 5B2JC 5AV8B 1TZYC 2NQBA 3AV1D 3B6GA 1P3KD 4G91C 4YM6B 5B31A 1ZLAC 4HGAB 5FUGB 3AZLB 4LD9B 5CPKA 5B32A 3MGQA 4KGCD 4YM6A 3AN2D 3X1SB 5FUGA 5GT0A 5F99B 3C1CA 3H0RC 2AROA 5AV6B 4DRBA 1P3GB 4H9SC 4YS3C 1P3BD 1M19A 3AZMC 5BO0B 1P3GA 2F8NG 1HQ3C 2Y2NA 3AV1B 3AZGD 4X23B 5GT3D 1P3KB 3A6NA 5B40D 4X23A 3UTBA 1P3OA 4KGCB 3O62A 3REHD 5B33A 1KX5A 5GSUD 2NQBC 3B6GC 3C1BA 1T3UA 5B31C 1WWSA 5AVBD 5AV8C 1P3BB 1HTAA 2G5HC 5B32C 3MGQC 4YM6C 1P3LA 3RELB 4HGAC 4NE5A 3REJD 1KX4D 5GT0C 3KUYA 3AZGB 2NZDD 2AROC 5GT3B 3RELA 4Z5TA 3AZJA 4H9OB 5F99C 1KX3A 5B40B 1P3AA 1BH8A 4ZBJC 1U35D 4J8VD 3B0CW 4AWLB 3REHB 5GSUB 1P3GC 4E44A 2F8ND 5AVBB 3A6NC 2Y2LA 3AV1C 5B31G 5BNVA 5B2JD 1TZYD 4X23C 4NFTA 3O62C 3UTBC 1P3OC 5B33C 5B32G 1P3IA 5AY8A 3REJB 1ZLAD 3REKA 3A1IA 2JCHA 3MVDA 3C1BC 5BT1C 3WA9A 3MGQB 2DQNC 3AYWA 1U35B 4J8VB 1P3LC 2JE5A 2HUEB 3KUYC 4J8XA 3VH6A 4YS3D 3RELC 3NQUA 4Z5TC 3AZJC 3AZMD 1KX3C 4WU9D 1HQ3D 3VH6T 5B2JB 1P3AC 1TZYB 2YFVB 4UPKA 5B0ZA 2F8NH 3VH5A 5JA4A 3AZHA 3B6FB 4G91B 1BH9B 1ZLAB 3VH5T 3REHC 1P34A 5DNMA 5GSUC 3LELA 5GXQA 5B2IA 3B6FA 3LZ0A 5AV9B 3AL0C 2Y2KA 2NQBD 1F66A 3B6GD 3MGRA 2CV5B 5AY8C 4JJNA 1Z2CB 1P3IC 5AV9A 1P3PA 5B31D 2DF4C 3REKC 2HIOA 5G49A 4YS3B 1Q9CA 2IO5C 5B32D 3MGQD 5CPKD 2CV5A 4XZQA 4YM6D 3WA9C 3AZMB 4WU9B 1HQ3B 3AYWC 5GT0D 3C1CD 3X1VA 5KDMA 2RVQC 2AROD 3F6TA 2Y2JA 3EPJA 4J8XC 1M19D 3MGSA 4CSRA 2W8SA 1P3GD 3AZIA 2NQBB 5B0ZC 5B1MA 3AZHC 4H9RA 4H9QA 5B31B 3A6ND 2FFFB 5CPKB 1H3OA 5CHLB 5B32B 5DNMC 4R8PB 4X23D 5GXQC 5B2IC 3O62D 3LELC 3LZ0C 5B33D 3UTBD 3X1TA 1KX5D 3B6FC 5GT0B 3C1CB 4KUDA 1F66C 4R8PA 2AROB 3MGRC 3C1BD 4JJNC 2ZM5A 5AV9C 5BT1D 1P3PC 3AZKB 2HIOC 1M19B 4ZBJB 1PZRA 2CV5C 4XZQC 2Y2OA 1P3LD 3LZ1A 2CWEA 5AVCA 3AZKA 3KUYD 3X1VC 4UUZB 3RELD 4WU9C 3WTPB 4Z5TD 3A6NB 3AZJD 1KX3D 1P3AD 4UUZA 3MGSC 3UTBB 1B67A 1P3OB 3O62B 5B33B 4WU8A 1KX5B 4J8UA 5CPJA 4Z2MG 3WTPA 2BG1A 2J8PA 3C1BB 3W99A 2FJ7A 2Y2PA 1M18B 3LJAB 3KXBA 3X1TC 1ULYA 1TAFB 1P3LB 1P3ID 5AY8D 4CAYA 1M18A 4WV4B 3LJAA 3KUYB 4WJ3C 4KUDC 5CPKC 3MNNB 3AV2B 4R8PC 3REKD 1TAFA 3MVDD 4Z5TB 3WA9D 3AZJB 1KX3B 3C1CC 3B0DB 1P3AB 3MNNA 1BH8B 3H0LC 3AYWD 3AV2A 1P3MA 2RVQD 5AV5A 3LZ1C 5AVCC 3AZKC 5JRGA 2ZY4A 1M19C 4J8XD 5B24B 4J8WB 5B24A 5BNVB 4J8WA 4H9PA 5B0ZD 5B1LB 4WU8C 4J8UC 3AZHD 5AY8B 3WTPC 5CPJC 1P3IB 1AOIB 3AZEB 3REKB 3W96A 4WZSB 3MVDB 2IO5B 5B1LA 1KX5C 1R4VA 5DNMD 3LELD 1P34D 5GXQD 5B2ID 1AOIA 2FJ7C 3LZ0D 3AZEA 4XUJA 3B6FD 3WA9B 3AYWB 3KXBC 3R45A 4E45A 3REIB 1B6WA 1F66D 3WAAB 3MGRD 2F2AC 2BYMA 4JJND 1M18C 5AV9D 3LJAC 1P3PD 4J8XB 2HIOD 3REIA 3WAAA 2PYOB 3NQUB 2CV5D 4XZQD 3MGPA 3MNNC 3AV2C 1N1JA 4H9NA 5B0ZB 2XD1A 5JA4B 3X1VD 3X1UA 3EPKA 1P3MC 2PYOA 3AZHB 5AV5C 3AZNB 5BS7A 5JRGC 3B0DC 3KWQA 3TU4A 3UTAA 1P34B 3MGSD 3LELB 5DNMB 5GXQB 5B2IB 3AZNA 3LZ0B 1ID3B 2ZY3A 5B24C 3AZID 4J8WC 3W97A 1F66B 5B1MD 1F1EA 3MGRB 4JJNB 1ID3A 1P3PB 3WKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO B;  5G49 B;  3W96 C;  5B1L C;  1S32 A;  4XZQ B;  3X1T D;  1AOI C;  2YFW A;  3VH5 W;  3AZE C;  4XUJ C;  4QLC A;  3MVD C;  3X1V B;  4KUD D;  5KDM B;  4R8P D;  1JFI B;  3REI C;  4ZUX A;  3WAA C;  3MGS B;  1JFI A;  4CSR B;  5B0Y B;  3MGP C;  3AFA A;  3LZ1 D;  5AVC D;  3AZI B;  3AZK D;  3W98 A;  5B1M B;  3X1U C;  2PYO C;  4EO5 B;  5B0Y A;  4H9R B;  3WTP E;  4H9Q B;  5BS7 C;  3KWQ C;  3TU4 C;  1H3O B;  3UTA C;  5C3I C;  3X1T B;  3AZN C;  4WU8 D;  1P34 C;  5CPJ D;  4J8U D;  3WTP D;  1P3O D;  4KUD B;  3W97 C;  3AZF A;  1ID3 C;  3W99 D;  2FJ7 D;  5CP6 A;  3WKJ C;  3KXB D;  5DNN A;  1S32 C;  5E5A A;  3LZ1 B;  5AVC B;  4QLC C;  1M18 D;  3LJA D;  1P3F A;  3UT9 A;  4Z66 B;  3NQJ A;  5BNX B;  4ZUX C;  3MNN D;  3AV2 D;  4WNN B;  4WU8 B;  5CPI A;  1P3M D;  4J8U B;  5CPJ B;  3AFA C;  5AV5 D;  1EQZ A;  4Z66 A;  5JRG D;  3W98 C;  5BNX A;  1M1A A;  4WNN A;  4KHA A;  5B0Y C;  5AV8 A;  3W99 B;  2FJ7 B;  3AZI C;  5B1M C;  3KXB B;  5B24 D;  4J8W D;  4EO5 C;  3AZL A;  3KSY A;  4LD9 A;  4CAY B;  3X1S A;  3AZF C;  3W96 D;  5B1L D;  5F99 A;  1AOI D;  5CP6 C;  3AZE D;  4XUJ D;  5AV6 A;  5DNN C;  1P3M B;  5E5A C;  5AV5 B;  5JRG B;  1P3F C;  5BO0 A;  3REI D;  3WAA D;  3AV1 A;  3UT9 C;  4G92 C;  3MGP D;  3AN2 B;  1P3K A;  4H9P B;  1KU5 A;  5CPI C;  3X1U D;  2PYO D;  4KGC A;  1EQZ C;  4Z66 C;  3AN2 A;  4NE3 A;  3KWQ D;  1M1A C;  3W96 B;  3TU4 D;  3UTA D;  3AZN D;  4XUJ B;  3R45 B;  3B0C T;  4DRA A;  3AZL C;  1P3B A;  3W97 D;  3W99 C;  4LD9 C;  2BYM B;  1ID3 D;  3X1S C;  3WKJ D;  3AZG A;  2L5A A;  1S32 D;  5GT3 A;  3MGP B;  5AV6 C;  1BFM A;  4QLC D;  1N1J B;  4H9N B;  4H9O A;  3X1U B;  5B40 A;  1A7W A;  3REH A;  3KWQ B;  5GSU A;  3TU4 B;  4ZUX D;  5C3I B;  3UTA B;  1P3K C;  3AFA D;  3V9R B;  3W98 D;  5AVB A;  1KX4 B;  3W97 B;  5B0Y D;  4KGC C;  2NZD B;  3AN2 C;  3V9R A;  4Z2M H;  3WKJ B;  3REJ A;  1KX4 A;  3B0B A;  2BYK B;  3VH6 W;  1S32 B;  2YFW B;  2NZD A;  4QLC B;  2BYK A;  1P3B C;  3AZF D;  1U35 A;  4J8V A;  5CP6 D;  2F8N B;  4ZUX B;  5DNN D;  3AZG C;  5GT3 C;  5E5A D;  3AFA B;  2F8N A;  3W98 B;  1P3F D;  2F8N K;  5B40 C;  5B2J A;  1TZY A;  2YFV A;  4NE6 A;  4AWL C;  1WWI A;  3UT9 D;  1BH9 A;  1ZLA A;  2JSS A;  5CPI D;  1EQZ D;  4Z66 D;  5AVB C;  1M1A D;  3AZF B;  5AV8 D;  5CP6 B;  3REJ C;  1KX4 C;  5DNN B;  4H9S A;  4YS3 A;  3AZL D;  4LD9 D;  2NZD C;  5E5A B;  4M6B A;  2LY8 A;  1P3F B;  3X1S D;  3AZM A;  4WU9 A;  1HQ3 A;  1U35 C;  5F99 D;  4J8V C;  3UT9 B;  4G92 B;  3NQJ B;  5AV6 D;  2HUE C;  5CPI B;  1EQZ B;  3B6G B;  1M1A B;  4KHA B;  5B2J C;  5AV8 B;  1TZY C;  2NQB A;  3AV1 D;  3B6G A;  1P3K D;  4G91 C;  4YM6 B;  5B31 A;  1ZLA C;  4HGA B;  5FUG B;  3AZL B;  4LD9 B;  5CPK A;  5B32 A;  3MGQ A;  4KGC D;  4YM6 A;  3AN2 D;  3X1S B;  5FUG A;  5GT0 A;  5F99 B;  3C1C A;  2ARO A;  5AV6 B;  4DRB A;  1P3G B;  4H9S C;  4YS3 C;  1P3B D;  1M19 A;  3AZM C;  5BO0 B;  1P3G A;  2F8N G;  1HQ3 C;  3AV1 B;  3AZG D;  4X23 B;  5GT3 D;  1P3K B;  3A6N A;  5B40 D;  4X23 A;  3UTB A;  1P3O A;  4KGC B;  3O62 A;  3REH D;  5B33 A;  1KX5 A;  5GSU D;  2NQB C;  3B6G C;  3C1B A;  5B31 C;  1WWS A;  5AVB D;  5AV8 C;  1P3B B;  1HTA A;  5B32 C;  3MGQ C;  4YM6 C;  1P3L A;  3REL B;  4HGA C;  4NE5 A;  3REJ D;  1KX4 D;  5GT0 C;  3KUY A;  3AZG B;  2NZD D;  2ARO C;  5GT3 B;  3REL A;  4Z5T A;  3AZJ A;  4H9O B;  5F99 C;  1KX3 A;  5B40 B;  1P3A A;  1BH8 A;  4ZBJ C;  1U35 D;  4J8V D;  3B0C W;  4AWL B;  3REH B;  5GSU B;  1P3G C;  4E44 A;  2F8N D;  5AVB B;  3A6N C;  3AV1 C;  5B31 G;  5BNV A;  5B2J D;  1TZY D;  4X23 C;  4NFT A;  3O62 C;  3UTB C;  1P3O C;  5B33 C;  5B32 G;  1P3I A;  5AY8 A;  3REJ B;  1ZLA D;  3REK A;  3MVD A;  3C1B C;  5BT1 C;  3WA9 A;  3MGQ B;  3AYW A;  1U35 B;  4J8V B;  1P3L C;  2HUE B;  3KUY C;  4J8X A;  3VH6 A;  4YS3 D;  3REL C;  3NQU A;  4Z5T C;  3AZJ C;  3AZM D;  1KX3 C;  4WU9 D;  1HQ3 D;  3VH6 T;  5B2J B;  1P3A C;  1TZY B;  2YFV B;  2F8N H;  5B0Z A;  3VH5 A;  5JA4 A;  3AZH A;  3B6F B;  4G91 B;  1BH9 B;  1ZLA B;  3VH5 T;  3REH C;  1P34 A;  5DNM A;  5GSU C;  3LEL A;  5GXQ A;  5B2I A;  3B6F A;  3LZ0 A;  5AV9 B;  2NQB D;  1F66 A;  3B6G D;  3MGR A;  2CV5 B;  5AY8 C;  4JJN A;  1P3I C;  5AV9 A;  1P3P A;  5B31 D;  4YS3 B;  3REK C;  2HIO A;  5G49 A;  1Q9C A;  2IO5 C;  5B32 D;  3MGQ D;  5CPK D;  2CV5 A;  4XZQ A;  4YM6 D;  3WA9 C;  3AZM B;  4WU9 B;  1HQ3 B;  3AYW C;  5GT0 D;  3C1C D;  3X1V A;  5KDM A;  2RVQ C;  2ARO D;  4J8X C;  1M19 D;  3MGS A;  4CSR A;  1P3G D;  3AZI A;  2NQB B;  5B0Z C;  5B1M A;  3AZH C;  4H9R A;  4H9Q A;  5B31 B;  3A6N D;  5CPK B;  1H3O A;  5CHL B;  5B32 B;  5DNM C;  4R8P B;  4X23 D;  5GXQ C;  5B2I C;  3O62 D;  3LEL C;  3LZ0 C;  5B33 D;  3UTB D;  3X1T A;  1KX5 D;  3B6F C;  5GT0 B;  3C1C B;  4KUD A;  1F66 C;  4R8P A;  2ARO B;  3MGR C;  3C1B D;  4JJN C;  5AV9 C;  5BT1 D;  1P3P C;  3AZK B;  2HIO C;  1M19 B;  4ZBJ B;  2CV5 C;  4XZQ C;  1P3L D;  3LZ1 A;  2CWE A;  5AVC A;  3AZK A;  3KUY D;  3X1V C;  4UUZ B;  3REL D;  4WU9 C;  3WTP B;  4Z5T D;  3A6N B;  3AZJ D;  1KX3 D;  1P3A D;  4UUZ A;  3MGS C;  3UTB B;  1B67 A;  1P3O B;  3O62 B;  5B33 B;  4WU8 A;  1KX5 B;  4J8U A;  5CPJ A;  4Z2M G;  3WTP A;  3C1B B;  3W99 A;  2FJ7 A;  1M18 B;  3LJA B;  3KXB A;  3X1T C;  1ULY A;  1TAF B;  1P3L B;  1P3I D;  5AY8 D;  4CAY A;  1M18 A;  4WV4 B;  3LJA A;  3KUY B;  4KUD C;  5CPK C;  3MNN B;  3AV2 B;  4R8P C;  3REK D;  1TAF A;  3MVD D;  4Z5T B;  3WA9 D;  3AZJ B;  1KX3 B;  3C1C C;  3B0D B;  1P3A B;  3MNN A;  1BH8 B;  3AV2 A;  3AYW D;  1P3M A;  2RVQ D;  5AV5 A;  3LZ1 C;  5AVC C;  3AZK C;  5JRG A;  1M19 C;  4J8X D;  5B24 B;  4J8W B;  5B24 A;  5BNV B;  4J8W A;  4H9P A;  5B0Z D;  5B1L B;  4WU8 C;  4J8U C;  3AZH D;  5AY8 B;  3WTP C;  5CPJ C;  1P3I B;  1AOI B;  3AZE B;  3REK B;  3W96 A;  4WZS B;  3MVD B;  2IO5 B;  5B1L A;  1KX5 C;  1R4V A;  5DNM D;  3LEL D;  1P34 D;  5GXQ D;  5B2I D;  1AOI A;  2FJ7 C;  3LZ0 D;  3AZE A;  4XUJ A;  3B6F D;  3WA9 B;  3AYW B;  3KXB C;  3R45 A;  4E45 A;  3REI B;  1B6W A;  1F66 D;  3WAA B;  3MGR D;  2BYM A;  4JJN D;  1M18 C;  5AV9 D;  3LJA C;  1P3P D;  4J8X B;  2HIO D;  3REI A;  3WAA A;  2PYO B;  3NQU B;  2CV5 D;  4XZQ D;  3MGP A;  3MNN C;  3AV2 C;  1N1J A;  4H9N A;  5B0Z B;  5JA4 B;  3X1V D;  3X1U A;  2PYO A;  1P3M C;  3AZH B;  5AV5 C;  3AZN B;  5BS7 A;  5JRG C;  3B0D C;  3KWQ A;  3TU4 A;  3UTA A;  1P34 B;  3MGS D;  3LEL B;  5DNM B;  5GXQ B;  5B2I B;  3AZN A;  3LZ0 B;  1ID3 B;  5B24 C;  3AZI D;  4J8W C;  3W97 A;  1F66 B;  5B1M D;  1F1E A;  3MGR B;  4JJN B;  1ID3 A;  1P3P B;  3WKJ A; 
#chains in the Genus database with same CATH topology
 2HIO B;  5G49 B;  3W96 C;  5B1L C;  1S32 A;  4XZQ B;  3X1T D;  3EG5 B;  2YFW A;  3VH5 W;  3AZE C;  4XUJ C;  1AOI C;  4QLC A;  3MVD C;  3X1V B;  4KUD D;  5KDM B;  4R8P D;  1JFI B;  2ZY5 A;  3A1K A;  3REI C;  4ZUX A;  3WAA C;  3MGS B;  1JFI A;  4CSR B;  5B0Y B;  3MGP C;  3AFA A;  3LZ1 D;  5AVC D;  3AZI B;  3AZK D;  3W98 A;  5B1M B;  3X1U C;  2PYO C;  4EO5 B;  5B0Y A;  4H9R B;  3WTP E;  4H9Q B;  5BS7 C;  3KWQ C;  3TU4 C;  1H3O B;  3UTA C;  3FDD A;  5C3I C;  3X1T B;  3AZN C;  2RIQ A;  4WU8 D;  1P34 C;  5CPJ D;  4J8U D;  3WTP D;  1P3O D;  4KUD B;  3W97 C;  3AZF A;  1ID3 C;  3W99 D;  2FJ7 D;  5CP6 A;  3WKJ C;  3KXB D;  5DNN A;  1S32 C;  3EPH A;  5E5A A;  3LZ1 B;  5AVC B;  4QLC C;  1M18 D;  3LJA D;  1P3F A;  3UT9 A;  4Z66 B;  3NQJ A;  5BNX B;  4ZUX C;  3MNN D;  3AV2 D;  4WNN B;  4WU8 B;  5CPI A;  1P3M D;  4J8U B;  5CPJ B;  3AFA C;  5AV5 D;  1EQZ A;  4Z66 A;  5JRG D;  3W98 C;  5BNX A;  1M1A A;  4WNN A;  4KHA A;  5B0Y C;  5AV8 A;  3W99 B;  2FJ7 B;  3EPL A;  3AZI C;  5B1M C;  3KXB B;  5B24 D;  4J8W D;  4EO5 C;  3AZL A;  3KSY A;  4LD9 A;  4CAY B;  3X1S A;  2UWX A;  3AZF C;  3W96 D;  4DQY B;  5B1L D;  5F99 A;  1AOI D;  5CP6 C;  3AZE D;  4XUJ D;  5AV6 A;  5DNN C;  1P3M B;  5E5A C;  5AV5 B;  2ZY2 A;  5JRG B;  1P3F C;  5BO0 A;  3REI D;  3WAA D;  3AV1 A;  3UT9 C;  4G92 C;  3MGP D;  3AN2 B;  1P3K A;  4H9P B;  2Y2M A;  1KU5 A;  5CPI C;  3X1U D;  2PYO D;  4KGC A;  1EQZ C;  4Z66 C;  3AN2 A;  4NE3 A;  3KWQ D;  1M1A C;  3W96 B;  3TU4 D;  3UTA D;  3AZN D;  4XUJ B;  3R45 B;  3B0C T;  4DRA A;  3AZL C;  1P3B A;  3W97 D;  3W99 C;  4LD9 C;  3KFU G;  2BYM B;  1ID3 D;  2Y2Q A;  3X1S C;  3P5J B;  3WKJ D;  3AZG A;  2L5A A;  1S32 D;  5GT3 A;  3MGP B;  5AV6 C;  1BFM A;  4QLC D;  1N1J B;  4H9N B;  4H9O A;  3X1U B;  5B40 A;  1A7W A;  3REH A;  3KWQ B;  5GSU A;  3TU4 B;  4ZUX D;  5C3I B;  3UTA B;  2VQR A;  3IP4 C;  1P3K C;  3AFA D;  3V9R B;  3W98 D;  5AVB A;  1KX4 B;  3W97 B;  5B0Y D;  4KGC C;  2NZD B;  3AN2 C;  3V9R A;  4Z2M H;  3WKJ B;  3REJ A;  1KX4 A;  3B0B A;  2BYK B;  3VH6 W;  1S32 B;  2YFW B;  2NZD A;  4QLC B;  2BYK A;  1P3B C;  3AZF D;  1U35 A;  4J8V A;  3H0M C;  5CP6 D;  2F8N B;  4ZUX B;  5DNN D;  3AZG C;  2Y2I A;  5GT3 C;  5E5A D;  3AFA B;  2F8N A;  3W98 B;  1P3F D;  2F8N K;  5B40 C;  5B2J A;  1TZY A;  2YFV A;  4NE6 A;  4AWL C;  1WWI A;  3UT9 D;  2Y2H A;  1BH9 A;  1ZLA A;  2JSS A;  5CPI D;  1EQZ D;  4Z66 D;  5AVB C;  1M1A D;  3AZF B;  5AV8 D;  5CP6 B;  3REJ C;  2Y2G A;  1KX4 C;  2G5I C;  5DNN B;  4H9S A;  4YS3 A;  3AZL D;  4LD9 D;  2NZD C;  5E5A B;  4M6B A;  2LY8 A;  1P3F B;  3X1S D;  3AZM A;  4WU9 A;  1HQ3 A;  1U35 C;  5F99 D;  4J8V C;  2XD5 A;  3UT9 B;  4G92 B;  3NQJ B;  5AV6 D;  2HUE C;  1W2E A;  5CPI B;  1EQZ B;  3B6G B;  1M1A B;  4KHA B;  5B2J C;  5AV8 B;  1TZY C;  2NQB A;  3AV1 D;  3B6G A;  1P3K D;  4G91 C;  4YM6 B;  5B31 A;  1ZLA C;  4HGA B;  5FUG B;  3AZL B;  4LD9 B;  5CPK A;  5B32 A;  3MGQ A;  4KGC D;  4YM6 A;  3AN2 D;  3X1S B;  5FUG A;  5GT0 A;  5F99 B;  3C1C A;  3H0R C;  2ARO A;  5AV6 B;  4DRB A;  1P3G B;  4H9S C;  4YS3 C;  1P3B D;  1M19 A;  3AZM C;  5BO0 B;  1P3G A;  2F8N G;  1HQ3 C;  2Y2N A;  3AV1 B;  3AZG D;  4X23 B;  5GT3 D;  1P3K B;  3A6N A;  5B40 D;  4X23 A;  3UTB A;  1P3O A;  4KGC B;  3O62 A;  3REH D;  5B33 A;  1KX5 A;  5GSU D;  2NQB C;  3B6G C;  3C1B A;  1T3U A;  5B31 C;  1WWS A;  5AVB D;  5AV8 C;  1P3B B;  1HTA A;  2G5H C;  5B32 C;  3MGQ C;  4YM6 C;  1P3L A;  3REL B;  4HGA C;  4NE5 A;  3REJ D;  1KX4 D;  5GT0 C;  3KUY A;  3AZG B;  2NZD D;  2ARO C;  5GT3 B;  3REL A;  4Z5T A;  3AZJ A;  4H9O B;  5F99 C;  1KX3 A;  5B40 B;  1P3A A;  1BH8 A;  4ZBJ C;  1U35 D;  4J8V D;  3B0C W;  4AWL B;  3REH B;  5GSU B;  1P3G C;  4E44 A;  2F8N D;  5AVB B;  3A6N C;  2Y2L A;  3AV1 C;  5B31 G;  5BNV A;  5B2J D;  1TZY D;  4X23 C;  4NFT A;  3O62 C;  3UTB C;  1P3O C;  5B33 C;  5B32 G;  1P3I A;  5AY8 A;  3REJ B;  1ZLA D;  3REK A;  3A1I A;  2JCH A;  3MVD A;  3C1B C;  5BT1 C;  3WA9 A;  3MGQ B;  2DQN C;  3AYW A;  1U35 B;  4J8V B;  1P3L C;  2JE5 A;  2HUE B;  3KUY C;  4J8X A;  3VH6 A;  4YS3 D;  3REL C;  3NQU A;  4Z5T C;  3AZJ C;  3AZM D;  1KX3 C;  4WU9 D;  1HQ3 D;  3VH6 T;  5B2J B;  1P3A C;  1TZY B;  2YFV B;  4UPK A;  5B0Z A;  2F8N H;  3VH5 A;  5JA4 A;  3AZH A;  3B6F B;  4G91 B;  1BH9 B;  1ZLA B;  3VH5 T;  3REH C;  1P34 A;  5DNM A;  5GSU C;  3LEL A;  5GXQ A;  5B2I A;  3B6F A;  3LZ0 A;  5AV9 B;  3AL0 C;  2Y2K A;  2NQB D;  1F66 A;  3B6G D;  3MGR A;  2CV5 B;  5AY8 C;  4JJN A;  1Z2C B;  1P3I C;  5AV9 A;  1P3P A;  5B31 D;  2DF4 C;  3REK C;  2HIO A;  5G49 A;  4YS3 B;  1Q9C A;  2IO5 C;  5B32 D;  3MGQ D;  5CPK D;  2CV5 A;  4XZQ A;  4YM6 D;  3WA9 C;  3AZM B;  4WU9 B;  1HQ3 B;  3AYW C;  5GT0 D;  3C1C D;  3X1V A;  5KDM A;  2RVQ C;  2ARO D;  3F6T A;  2Y2J A;  3EPJ A;  4J8X C;  1M19 D;  3MGS A;  4CSR A;  2W8S A;  1P3G D;  3AZI A;  2NQB B;  5B0Z C;  5B1M A;  3AZH C;  4H9R A;  4H9Q A;  5B31 B;  3A6N D;  2FFF B;  5CPK B;  1H3O A;  5CHL B;  5B32 B;  5DNM C;  4R8P B;  4X23 D;  5GXQ C;  5B2I C;  3O62 D;  3LEL C;  3LZ0 C;  5B33 D;  3UTB D;  3X1T A;  1KX5 D;  3B6F C;  5GT0 B;  3C1C B;  4KUD A;  1F66 C;  4R8P A;  2ARO B;  3MGR C;  3C1B D;  4JJN C;  2ZM5 A;  5AV9 C;  5BT1 D;  1P3P C;  3AZK B;  2HIO C;  1M19 B;  4ZBJ B;  1PZR A;  2CV5 C;  4XZQ C;  2Y2O A;  1P3L D;  3LZ1 A;  2CWE A;  5AVC A;  3AZK A;  3KUY D;  3X1V C;  4UUZ B;  3REL D;  4WU9 C;  3WTP B;  4Z5T D;  3A6N B;  3AZJ D;  1KX3 D;  1P3A D;  4UUZ A;  3MGS C;  3UTB B;  1B67 A;  1P3O B;  3O62 B;  5B33 B;  4WU8 A;  1KX5 B;  4J8U A;  5CPJ A;  4Z2M G;  3WTP A;  2BG1 A;  2J8P A;  3C1B B;  3W99 A;  2FJ7 A;  2Y2P A;  1M18 B;  3LJA B;  3KXB A;  3X1T C;  1ULY A;  1TAF B;  1P3L B;  1P3I D;  5AY8 D;  4CAY A;  1M18 A;  4WV4 B;  3LJA A;  3KUY B;  4WJ3 C;  4KUD C;  5CPK C;  3MNN B;  3AV2 B;  4R8P C;  3REK D;  1TAF A;  3MVD D;  4Z5T B;  3WA9 D;  3AZJ B;  1KX3 B;  3C1C C;  3B0D B;  1P3A B;  3MNN A;  1BH8 B;  3H0L C;  3AYW D;  3AV2 A;  1P3M A;  2RVQ D;  5AV5 A;  3LZ1 C;  5AVC C;  3AZK C;  5JRG A;  2ZY4 A;  1M19 C;  4J8X D;  5B24 B;  4J8W B;  5B24 A;  5BNV B;  4J8W A;  4H9P A;  5B0Z D;  5B1L B;  4WU8 C;  4J8U C;  3AZH D;  5AY8 B;  3WTP C;  5CPJ C;  1P3I B;  1AOI B;  3AZE B;  3REK B;  3W96 A;  4WZS B;  3MVD B;  2IO5 B;  5B1L A;  1KX5 C;  1R4V A;  5DNM D;  3LEL D;  1P34 D;  5GXQ D;  5B2I D;  1AOI A;  2FJ7 C;  3LZ0 D;  3AZE A;  4XUJ A;  3B6F D;  3WA9 B;  3AYW B;  3KXB C;  3R45 A;  4E45 A;  3REI B;  1B6W A;  1F66 D;  3WAA B;  3MGR D;  2F2A C;  2BYM A;  4JJN D;  1M18 C;  5AV9 D;  3LJA C;  1P3P D;  4J8X B;  2HIO D;  3REI A;  3WAA A;  2PYO B;  3NQU B;  2CV5 D;  4XZQ D;  3MGP A;  3MNN C;  3AV2 C;  1N1J A;  4H9N A;  5B0Z B;  2XD1 A;  5JA4 B;  3X1V D;  3X1U A;  3EPK A;  1P3M C;  2PYO A;  3AZH B;  5AV5 C;  3AZN B;  5BS7 A;  5JRG C;  3B0D C;  3KWQ A;  3TU4 A;  3UTA A;  1P34 B;  3MGS D;  3LEL B;  5DNM B;  5GXQ B;  5B2I B;  3AZN A;  3LZ0 B;  1ID3 B;  2ZY3 A;  5B24 C;  3AZI D;  4J8W C;  3W97 A;  1F66 B;  5B1M D;  1F1E A;  3MGR B;  4JJN B;  1ID3 A;  1P3P B;  3WKJ A; 
#chains in the Genus database with same CATH homology
 2HIO B;  5G49 B;  3W96 C;  5B1L C;  1S32 A;  4XZQ B;  3X1T D;  3EG5 B;  2YFW A;  3VH5 W;  3AZE C;  4XUJ C;  1AOI C;  4QLC A;  3MVD C;  3X1V B;  4KUD D;  5KDM B;  4R8P D;  1JFI B;  2ZY5 A;  3A1K A;  3REI C;  4ZUX A;  3WAA C;  3MGS B;  1JFI A;  4CSR B;  5B0Y B;  3MGP C;  3AFA A;  3LZ1 D;  5AVC D;  3AZI B;  3AZK D;  3W98 A;  5B1M B;  3X1U C;  2PYO C;  4EO5 B;  5B0Y A;  4H9R B;  3WTP E;  4H9Q B;  5BS7 C;  3KWQ C;  3TU4 C;  1H3O B;  3UTA C;  3FDD A;  5C3I C;  3X1T B;  3AZN C;  2RIQ A;  4WU8 D;  1P34 C;  5CPJ D;  4J8U D;  3WTP D;  1P3O D;  4KUD B;  3W97 C;  3AZF A;  1ID3 C;  3W99 D;  2FJ7 D;  5CP6 A;  3WKJ C;  3KXB D;  5DNN A;  1S32 C;  3EPH A;  5E5A A;  3LZ1 B;  5AVC B;  4QLC C;  1M18 D;  3LJA D;  1P3F A;  3UT9 A;  4Z66 B;  3NQJ A;  5BNX B;  4ZUX C;  3MNN D;  3AV2 D;  4WNN B;  4WU8 B;  5CPI A;  1P3M D;  4J8U B;  5CPJ B;  3AFA C;  5AV5 D;  1EQZ A;  4Z66 A;  5JRG D;  3W98 C;  5BNX A;  1M1A A;  4WNN A;  4KHA A;  5B0Y C;  5AV8 A;  3W99 B;  2FJ7 B;  3EPL A;  3AZI C;  5B1M C;  3KXB B;  5B24 D;  4J8W D;  4EO5 C;  3AZL A;  3KSY A;  4LD9 A;  4CAY B;  3X1S A;  2UWX A;  3AZF C;  3W96 D;  4DQY B;  5B1L D;  5F99 A;  1AOI D;  5CP6 C;  3AZE D;  4XUJ D;  5AV6 A;  5DNN C;  1P3M B;  5E5A C;  5AV5 B;  2ZY2 A;  5JRG B;  1P3F C;  5BO0 A;  3REI D;  3WAA D;  3AV1 A;  3UT9 C;  4G92 C;  3MGP D;  3AN2 B;  1P3K A;  4H9P B;  2Y2M A;  1KU5 A;  5CPI C;  3X1U D;  2PYO D;  4KGC A;  1EQZ C;  4Z66 C;  3AN2 A;  4NE3 A;  3KWQ D;  1M1A C;  3W96 B;  3TU4 D;  3UTA D;  3AZN D;  4XUJ B;  3R45 B;  3B0C T;  4DRA A;  3AZL C;  1P3B A;  3W97 D;  3W99 C;  4LD9 C;  3KFU G;  2BYM B;  1ID3 D;  2Y2Q A;  3X1S C;  3P5J B;  3WKJ D;  3AZG A;  2L5A A;  1S32 D;  5GT3 A;  3MGP B;  5AV6 C;  1BFM A;  4QLC D;  1N1J B;  4H9N B;  4H9O A;  3X1U B;  5B40 A;  1A7W A;  3REH A;  3KWQ B;  5GSU A;  3TU4 B;  4ZUX D;  5C3I B;  3UTA B;  2VQR A;  3IP4 C;  1P3K C;  3AFA D;  3V9R B;  3W98 D;  5AVB A;  1KX4 B;  3W97 B;  5B0Y D;  4KGC C;  2NZD B;  3AN2 C;  3V9R A;  4Z2M H;  3WKJ B;  3REJ A;  1KX4 A;  3B0B A;  2BYK B;  3VH6 W;  1S32 B;  2YFW B;  2NZD A;  4QLC B;  2BYK A;  1P3B C;  3AZF D;  1U35 A;  4J8V A;  3H0M C;  5CP6 D;  2F8N B;  4ZUX B;  5DNN D;  3AZG C;  2Y2I A;  5GT3 C;  5E5A D;  3AFA B;  2F8N A;  3W98 B;  1P3F D;  2F8N K;  5B40 C;  5B2J A;  1TZY A;  2YFV A;  4NE6 A;  4AWL C;  1WWI A;  3UT9 D;  2Y2H A;  1BH9 A;  1ZLA A;  2JSS A;  5CPI D;  1EQZ D;  4Z66 D;  5AVB C;  1M1A D;  3AZF B;  5AV8 D;  5CP6 B;  3REJ C;  2Y2G A;  1KX4 C;  2G5I C;  5DNN B;  4H9S A;  4YS3 A;  3AZL D;  4LD9 D;  2NZD C;  5E5A B;  4M6B A;  2LY8 A;  1P3F B;  3X1S D;  3AZM A;  4WU9 A;  1HQ3 A;  1U35 C;  5F99 D;  4J8V C;  2XD5 A;  3UT9 B;  4G92 B;  3NQJ B;  5AV6 D;  2HUE C;  1W2E A;  5CPI B;  1EQZ B;  3B6G B;  1M1A B;  4KHA B;  5B2J C;  5AV8 B;  1TZY C;  2NQB A;  3AV1 D;  3B6G A;  1P3K D;  4G91 C;  4YM6 B;  5B31 A;  1ZLA C;  4HGA B;  5FUG B;  3AZL B;  4LD9 B;  5CPK A;  5B32 A;  3MGQ A;  4KGC D;  4YM6 A;  3AN2 D;  3X1S B;  5FUG A;  5GT0 A;  5F99 B;  3C1C A;  3H0R C;  2ARO A;  5AV6 B;  4DRB A;  1P3G B;  4H9S C;  4YS3 C;  1P3B D;  1M19 A;  3AZM C;  5BO0 B;  1P3G A;  2F8N G;  1HQ3 C;  2Y2N A;  3AV1 B;  3AZG D;  4X23 B;  5GT3 D;  1P3K B;  3A6N A;  5B40 D;  4X23 A;  3UTB A;  1P3O A;  4KGC B;  3O62 A;  3REH D;  5B33 A;  1KX5 A;  5GSU D;  2NQB C;  3B6G C;  3C1B A;  1T3U A;  5B31 C;  1WWS A;  5AVB D;  5AV8 C;  1P3B B;  1HTA A;  2G5H C;  5B32 C;  3MGQ C;  4YM6 C;  1P3L A;  3REL B;  4HGA C;  4NE5 A;  3REJ D;  1KX4 D;  5GT0 C;  3KUY A;  3AZG B;  2NZD D;  2ARO C;  5GT3 B;  3REL A;  4Z5T A;  3AZJ A;  4H9O B;  5F99 C;  1KX3 A;  5B40 B;  1P3A A;  1BH8 A;  4ZBJ C;  1U35 D;  4J8V D;  3B0C W;  4AWL B;  3REH B;  5GSU B;  1P3G C;  4E44 A;  2F8N D;  5AVB B;  3A6N C;  2Y2L A;  3AV1 C;  5B31 G;  5BNV A;  5B2J D;  1TZY D;  4X23 C;  4NFT A;  3O62 C;  3UTB C;  1P3O C;  5B33 C;  5B32 G;  1P3I A;  5AY8 A;  3REJ B;  1ZLA D;  3REK A;  3A1I A;  2JCH A;  3MVD A;  3C1B C;  5BT1 C;  3WA9 A;  3MGQ B;  2DQN C;  3AYW A;  1U35 B;  4J8V B;  1P3L C;  2JE5 A;  2HUE B;  3KUY C;  4J8X A;  3VH6 A;  4YS3 D;  3REL C;  3NQU A;  4Z5T C;  3AZJ C;  3AZM D;  1KX3 C;  4WU9 D;  1HQ3 D;  3VH6 T;  5B2J B;  1P3A C;  1TZY B;  2YFV B;  4UPK A;  5B0Z A;  2F8N H;  3VH5 A;  5JA4 A;  3AZH A;  3B6F B;  4G91 B;  1BH9 B;  1ZLA B;  3VH5 T;  3REH C;  1P34 A;  5DNM A;  5GSU C;  3LEL A;  5GXQ A;  5B2I A;  3B6F A;  3LZ0 A;  5AV9 B;  3AL0 C;  2Y2K A;  2NQB D;  1F66 A;  3B6G D;  3MGR A;  2CV5 B;  5AY8 C;  4JJN A;  1Z2C B;  1P3I C;  5AV9 A;  1P3P A;  5B31 D;  2DF4 C;  3REK C;  2HIO A;  5G49 A;  4YS3 B;  1Q9C A;  2IO5 C;  5B32 D;  3MGQ D;  5CPK D;  2CV5 A;  4XZQ A;  4YM6 D;  3WA9 C;  3AZM B;  4WU9 B;  1HQ3 B;  3AYW C;  5GT0 D;  3C1C D;  3X1V A;  5KDM A;  2RVQ C;  2ARO D;  3F6T A;  2Y2J A;  3EPJ A;  4J8X C;  1M19 D;  3MGS A;  4CSR A;  2W8S A;  1P3G D;  3AZI A;  2NQB B;  5B0Z C;  5B1M A;  3AZH C;  4H9R A;  4H9Q A;  5B31 B;  3A6N D;  2FFF B;  5CPK B;  1H3O A;  5CHL B;  5B32 B;  5DNM C;  4R8P B;  4X23 D;  5GXQ C;  5B2I C;  3O62 D;  3LEL C;  3LZ0 C;  5B33 D;  3UTB D;  3X1T A;  1KX5 D;  3B6F C;  5GT0 B;  3C1C B;  4KUD A;  1F66 C;  4R8P A;  2ARO B;  3MGR C;  3C1B D;  4JJN C;  2ZM5 A;  5AV9 C;  5BT1 D;  1P3P C;  3AZK B;  2HIO C;  1M19 B;  4ZBJ B;  1PZR A;  2CV5 C;  4XZQ C;  2Y2O A;  1P3L D;  3LZ1 A;  2CWE A;  5AVC A;  3AZK A;  3KUY D;  3X1V C;  4UUZ B;  3REL D;  4WU9 C;  3WTP B;  4Z5T D;  3A6N B;  3AZJ D;  1KX3 D;  1P3A D;  4UUZ A;  3MGS C;  3UTB B;  1B67 A;  1P3O B;  3O62 B;  5B33 B;  4WU8 A;  1KX5 B;  4J8U A;  5CPJ A;  4Z2M G;  3WTP A;  2BG1 A;  2J8P A;  3C1B B;  3W99 A;  2FJ7 A;  2Y2P A;  1M18 B;  3LJA B;  3KXB A;  3X1T C;  1ULY A;  1TAF B;  1P3L B;  1P3I D;  5AY8 D;  4CAY A;  1M18 A;  4WV4 B;  3LJA A;  3KUY B;  4WJ3 C;  4KUD C;  5CPK C;  3MNN B;  3AV2 B;  4R8P C;  3REK D;  1TAF A;  3MVD D;  4Z5T B;  3WA9 D;  3AZJ B;  1KX3 B;  3C1C C;  3B0D B;  1P3A B;  3MNN A;  1BH8 B;  3H0L C;  3AYW D;  3AV2 A;  1P3M A;  2RVQ D;  5AV5 A;  3LZ1 C;  5AVC C;  3AZK C;  5JRG A;  2ZY4 A;  1M19 C;  4J8X D;  5B24 B;  4J8W B;  5B24 A;  5BNV B;  4J8W A;  4H9P A;  5B0Z D;  5B1L B;  4WU8 C;  4J8U C;  3AZH D;  5AY8 B;  3WTP C;  5CPJ C;  1P3I B;  1AOI B;  3AZE B;  3REK B;  3W96 A;  4WZS B;  3MVD B;  2IO5 B;  5B1L A;  1KX5 C;  1R4V A;  5DNM D;  3LEL D;  1P34 D;  5GXQ D;  5B2I D;  1AOI A;  2FJ7 C;  3LZ0 D;  3AZE A;  4XUJ A;  3B6F D;  3WA9 B;  3AYW B;  3KXB C;  3R45 A;  4E45 A;  3REI B;  1B6W A;  1F66 D;  3WAA B;  3MGR D;  2F2A C;  2BYM A;  4JJN D;  1M18 C;  5AV9 D;  3LJA C;  1P3P D;  4J8X B;  2HIO D;  3REI A;  3WAA A;  2PYO B;  3NQU B;  2CV5 D;  4XZQ D;  3MGP A;  3MNN C;  3AV2 C;  1N1J A;  4H9N A;  5B0Z B;  2XD1 A;  5JA4 B;  3X1V D;  3X1U A;  3EPK A;  1P3M C;  2PYO A;  3AZH B;  5AV5 C;  3AZN B;  5BS7 A;  5JRG C;  3B0D C;  3KWQ A;  3TU4 A;  3UTA A;  1P34 B;  3MGS D;  3LEL B;  5DNM B;  5GXQ B;  5B2I B;  3AZN A;  3LZ0 B;  1ID3 B;  2ZY3 A;  5B24 C;  3AZI D;  4J8W C;  3W97 A;  1F66 B;  5B1M D;  1F1E A;  3MGR B;  4JJN B;  1ID3 A;  1P3P B;  3WKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...