1BH8B

Htafii18/htafii28 heterodimer crystal structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
FSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulation complex
molecule keywords TAFII18
publication title Human TAF(II)28 and TAF(II)18 interact through a histone fold encoded by atypical evolutionary conserved motifs also found in the SPT3 family.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1998-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bh8B00
4UUZA 5B2IA 1BH9A 4HGAC 5GT3A 3X1VB 2L5AA 5FUGA 4KGCC 3A6NA 5B40C 5BNVA 1M1AA 5GXQB 4Z2MH 4G91B 3KXBD 5DNND 4H9RB 5GXQC 3REHA 4H9OA 3A6NB 4J8VC 4UUZB 5B2IB 1BH9B 5GT3B 4G91C 5FUGB 1TZYA 3X1SA 3X1VD 4JJNA 5BO0A 3A6NC 5BNVB 3MVDC 5GT3C 3UTBA 3UTAC 5B1LA 5BNXA 3TU4D 3O62A 3AZKD 5B0ZD 3REKA 1P34D 1KX4D 5F99A 5AV9A 1KX5B 1P3GA 5B32D 5B2ID 1TZYB 4DRBA 3X1SB 3B0DB 5BO0B 1AOIB 5AV8D 1KX5C 3UTBB 1TZYC 1M1AD 5B1LB 5AVBA 3B0DC 3WA9D 5BNXB 3NQJA 3O62B 4AWLB 3B0CW 4ZUXB 4Z66A 1U35A 1AOIC 3REKB 3UTBC 3W96A 5F99B 5GSUC 1P3IA 5AV9B 3REHD 3MNNA 4AWLC 3O62C 1P3GB 3WKJD 1H3OA 4ZUXC 3REKC 3X1SD 4JJND 3AZMA 5AV9C 1P3GC 3WTPE 4H9PB 2BYKB 2NQBB 5AVBB 3AN2C 3AYWA 1U35B 5B1LD 4Z66B 5E5AB 3X1TA 1P3LD 3LELD 3MGPA 3W96B 1P3IB 2NQBC 3AZLD 5AVBC 5F99D 5B31A 1U35C 4Z66C 5E5AC 1P3GD 1F66B 5CPJD 5AVCD 4J8UC 3AZMB 5B33A 1F66C 1HQ3D 5JRGD 3X1TB 3AZMC 1P3AA 1U35D 3MGPB 3AV1D 1P3KA 5B31B 3W99C 3W96D 1P3ID 1ZLAA 3X1TC 4WNNA 3MNND 3C1BB 5B24A 3MGPC 5AY8D 4XZQA 2F8NG 3AZFA 5B31C 2NZDA 5B0YA 3AZJB 2CWEA 5C3IB 3C1BC 4R8PA 5KDMA 1P3AB 3AYWD 5CHLB 3V9RA 3AZJC 1F1EA 5CP6D 5C3IC 1P3KB 3LZ1D 4WNNB 1P3AC 4EO5B 4Z2MG 5B24B 5GXQA 4X23D 1B67A 4XZQB 2AROD 3MGQC 3AZFB 4J8VA 1P3KC 5B0YB 4CSRA 2IO5B 3VH5W 4EO5C 5B33D 5B24C 1KX3A 5AV5A 4R8PB 4XZQC 5B0YC 3AZID 3B6FB 4CAYA 3MVDA 1ID3B 2IO5C 3V9RB 4WU8B 3B6GD 3UTAA 5B2JA 4H9QA 4R8PC 1ZLAD 5B31G 3B6FC 4XUJA 3LZ0D 1ID3C 3LJAA 4WU8C 4J8VB 4M6BA 3MGQD 4CSRB 3AZFD 2NZDD 5GT0A 5AV5B 2RVQC 1P3FA 1KX3B 2YFWA 4KGCD 5B40D 3AZNA 4CAYB 3MVDB 1R4VA 1KX5A 3UTAB 4Z5TC 5B2JB 5B1MA 1KX3C 5AV5C 3W98C 4H9QB 1AOIA 3KUYA 4XUJB 3WAAA 3LJAB 5GSUA 5GXQD 3AZEB 5B2JC 3AV2A 4J8VD 4ZUXA 4XUJC 5GT0B 3LJAC 3MGSA 1P3FB 3REIA 2YFWB 3AZEC 3A6ND 3AZNB 2F8NA 3MVDD 5GT3D 5B1MB 5GT0C 3AN2A 1P3FC 3UTAD 3KUYB 3UT9A 1M18B 1M19A 3AZNC 3WAAB 4H9PA 3X1UA 2BYKA 5GSUB 3VH6W 3C1CA 2NQBA 5B1MC 4G92B 3AV2B 5CPIC 5E5AA 3KUYC 1M18C 3WAAC 3MGSB 3WTPA 5CPKB 1WWSA 4J8UA 3REIB 4G92C 3AV2C 3MGRC 1EQZA 1KX5D 2F8NB 4WV4B 1TZYD 3AN2B 1F66A 3MGSC 2F8NK 5CPKC 3REIC 3UT9B 1M19B 1AOID 3W97A 3X1UB 3C1CB 3UTBD 3W99A 5GSUD 3O62D 3UT9C 1M19C 4ZUXD 3WTPB 3X1UC 3REKD 3C1CC 4J8UB 3REID 5AV9D 4KHAA 1EQZB 3C1BA 2F8ND 3WTPC 3AZGA 3AN2D 4NFTA 4YM6A 3AFAA 3W97B 1EQZC 3AZJA 3W99B 2NQBD 1P3BA 1P3OA 5AVBD 2BYMA 4Z66D 5E5AD 3W97C 3KWQA 1S32A 4J8UD 3R45A 4KHAB 3AZGB 3AZHB 1F66D 4YM6B 3AFAB 3AZMD 4YS3B 4J8XB 4J8WB 1P3BB 1P3OB 3AZGC 3W99D 3AZHC 2BYMB 4QLCA 4YM6C 1ULYA 5AV6A 3X1TD 3AFAC 3B6FA 1ID3A 4WU8A 4YS3C 4J8XC 3KWQB 3MGPD 1S32B 1A7WA 5JA4A 4J8WC 1P3BC 3R45B 1P3OC 5B31D 2FJ7C 5BS7A 3RELA 3C1BD 3KWQC 1S32C 1P3MB 4YM6D 2YFVB 1N1JA 3B0BA 4Z5TA 3AZJD 3W98A 2CV5C 2HIOB 4QLCB 1TAFB 5BT1C 5AV6B 1P3AD 1P3MC 3NQUA 5JA4B 1P3KD 2HIOC 4QLCC 5AV6C 3RELB 5B24D 3AZEA 4XZQD 3TU4A 5B0YD 4WU9A 3KXBB 5DNNB 3AZKA 5B0ZA 4Z5TB 1N1JB 5BS7C 3RELC 1P34A 3W98B 4R8PD 1JFIB 3NQUB 5B32A 3B6FD 3VH6T 3KXBC 5DNNC 1ID3D 4WU8D 3B0CT 5CPIA 5AV8A 1M18A 2LY8A 3RELD 2RVQD 3X1VC 3WA9A 3REJA 3TU4B 3MGRA 4WU9B 3AZKB 5B0ZB 1P34B 1KX4B 5CPKA 4Z5TD 1KX3D 5AV5D 3W98D 3VH6A 4ZBJB 3TU4C 3WKJA 5B32B 1HTAA 4WU9C 3AZKC 5B0ZC 1P34C 4KUDA 1KX4C 5B2JD 5CPIB 5DNMA 5AV8B 4NE6A 4ZBJC 5B32C 5G49A 5B2IC 4XUJD 1M1AB 3LJAD 3WA9B 3REJB 3AZED 3MGRB 5AV8C 4WU9D 1P3LA 3LELA 1M1AC 5GT0D 1P3FD 3AZLA 3REHB 4H9OB 3WA9C 3REJC 3WKJB 2JSSA 3AZND 4KUDB 2PYOA 5B1MD 4E45A 5CPJA 5DNMB 5AVCA 4JJNB 3REHC 5CPID 3KUYD 3WKJC 5G49B 1M18D 3WAAD 4KUDC 1HQ3A 5JRGA 3X1SC 4NE3A 5DNMC 4JJNC 3REJD 3AV2D 3MGRD 4LD9A 1P3LB 3LELB 3MGSD 3AZLB 3AV1A 5CPKD 5B1LC 1BH8A 2PYOB 1P3LC 5B32G 3LELC 5AY8A 5CPJB 3AZHA 5AVCB 4KUDD 3AZLC 5F99C 5DNMD 3UT9D 1M19D 4YS3A 4J8XA 3X1UD 2PYOC 3C1CD 4J8WA 2FJ7A 1HQ3B 5JRGB 5CPJC 5AVCC 4DRAA 3NQJB 1P3PA 4LD9B 5CP6A 3WTPD 3AV1B 1HQ3C 3VH5T 5JRGC 3LZ1A 3MNNB 1BH8B 1B6WA 1H3OB 1EQZD 4LD9C 4X23A 5AY8B 2CV5A 2PYOD 3AV1C 2AROA 3W96C 4WZSB 1P3IC 1P3MA 3MNNC 3W97D 2YFVA 2FJ7B 5AY8C 2HIOA 1TAFA 3AYWB 1P3PB 3AZIA 4H9SA 5CP6B 4LD9D 3VH5A 3B6GA 3LZ1B 1P3PC 3AYWC 3LZ0A 4X23B 5CP6C 2CV5B 2AROB 3AZGD 3AZHD 3MGQA 4H9NA 1KU5A 3LZ1C 3KXBA 3AFAD 1WWIA 5DNNA 5B33B 1Q9CA 4YS3D 4J8XD 4X23C 3KSYA 2AROC 4J8WD 1P3BD 1P3OD 2FJ7D 3AZIB 1JFIA 4KGCA 5B40A 1P3PD 3B6GB 3X1VA 5B33C 3KWQD 1S32D 1ZLAB 3AZIC 3LZ0B 4H9SC 2HUEB 3B6GC 2CV5D 3MGQB 4H9NB 5BT1D 2NZDB 1P3MD 4HGAB 1ZLAC 3LZ0C 1KX4A 2F8NH 3AZFC 4H9RA 2HUEC 1BFMA 4NE5A 2HIOD 5KDMB 4QLCD 5B40B 4KGCB 4E44A 2NZDC 5AV6D
chains in the Genus database with same CATH superfamily
4UUZA 5B2IA 1BH9A 4HGAC 5GT3A 3X1VB 2L5AA 5FUGA 3EPHA 4KGCC 3A6NA 5B40C 5BNVA 1M1AA 5GXQB 4Z2MH 2JE5A 4G91B 3KXBD 5DNND 4H9RB 5GXQC 3REHA 4H9OA 3A6NB 4J8VC 1Z2CB 4UUZB 5B2IB 1BH9B 5GT3B 4G91C 5FUGB 1TZYA 3X1SA 3X1VD 4JJNA 5BO0A 3A6NC 5BNVB 3MVDC 5GT3C 3UTBA 3UTAC 5B1LA 5BNXA 3TU4D 2Y2MA 3O62A 3AZKD 5B0ZD 3REKA 1P34D 1KX4D 5F99A 5AV9A 1KX5B 1P3GA 2Y2PA 5B32D 5B2ID 1TZYB 4DRBA 3X1SB 3B0DB 5BO0B 1AOIB 5AV8D 1KX5C 2RIQA 3UTBB 1TZYC 1M1AD 5B1LB 5AVBA 3B0DC 3WA9D 5BNXB 3NQJA 3O62B 4AWLB 3B0CW 4ZUXB 4Z66A 1U35A 1AOIC 3REKB 3UTBC 3W96A 5F99B 5GSUC 1P3IA 5AV9B 3REHD 3MNNA 4AWLC 3O62C 1P3GB 3WKJD 1H3OA 4ZUXC 3REKC 2Y2QA 3X1SD 4JJND 3AZMA 5AV9C 3A1KA 1P3GC 3WTPE 4H9PB 2BYKB 2NQBB 5AVBB 3AN2C 3AYWA 1U35B 5B1LD 4Z66B 5E5AB 3X1TA 1P3LD 3LELD 3MGPA 3W96B 1P3IB 2NQBC 3AZLD 5B31A 5AVBC 5F99D 2ZY3A 2F2AC 1U35C 4Z66C 5E5AC 1P3GD 1F66B 2ZM5A 5CPJD 5AVCD 4J8UC 3AZMB 5B33A 1F66C 1HQ3D 5JRGD 3X1TB 3AZMC 1P3AA 1U35D 3MGPB 3AV1D 1P3KA 5B31B 3W99C 3W96D 1P3ID 1ZLAA 3X1TC 4WNNA 3MNND 3C1BB 5B24A 3MGPC 5AY8D 4XZQA 2F8NG 3AZFA 5B31C 2NZDA 5B0YA 3AZJB 2CWEA 5C3IB 3C1BC 4R8PA 5KDMA 1P3AB 3AYWD 5CHLB 3V9RA 3AZJC 1F1EA 5CP6D 5C3IC 1P3KB 3LZ1D 1W2EA 2ZY4A 4WNNB 4EO5B 1P3AC 4Z2MG 5B24B 5GXQA 4X23D 1B67A 4XZQB 2AROD 3MGQC 3AZFB 4J8VA 1P3KC 5B0YB 4CSRA 2IO5B 3VH5W 2Y2GA 4EO5C 5B33D 5B24C 2XD1A 5AV5A 1KX3A 4R8PB 4XZQC 5B0YC 3AZID 3B6FB 4CAYA 3MVDA 1ID3B 2IO5C 3V9RB 4WJ3C 4WU8B 2G5HC 3UTAA 3B6GD 5B2JA 2W8SA 4H9QA 4R8PC 1ZLAD 5B31G 3B6FC 4XUJA 3LZ0D 1ID3C 3LJAA 4WU8C 4J8VB 4M6BA 3MGQD 4CSRB 3AZFD 2NZDD 2Y2JA 5GT0A 5AV5B 2RVQC 1P3FA 1KX3B 2Y2HA 2YFWA 4KGCD 5B40D 3AZNA 4CAYB 3MVDB 1R4VA 1KX5A 3UTAB 4Z5TC 5B2JB 5B1MA 1KX3C 5AV5C 3W98C 4H9QB 1AOIA 3KUYA 4XUJB 3WAAA 3LJAB 5GSUA 5GXQD 3AZEB 5B2JC 3AV2A 4J8VD 4ZUXA 3KFUG 4XUJC 5GT0B 3LJAC 3MGSA 1P3FB 3REIA 2YFWB 3AZEC 4UPKA 3A6ND 3AZNB 2F8NA 3MVDD 5GT3D 5B1MB 5GT0C 3AN2A 1P3FC 3UTAD 3KUYB 3UT9A 1M18B 1M19A 3AZNC 3WAAB 4H9PA 3X1UA 2BYKA 5GSUB 3VH6W 3C1CA 2NQBA 5B1MC 4G92B 3AV2B 5CPIC 5E5AA 3KUYC 1M18C 3WAAC 3MGSB 3WTPA 5CPKB 1WWSA 4J8UA 3REIB 4G92C 3AV2C 3MGRC 1EQZA 1KX5D 2F8NB 4WV4B 1TZYD 3AN2B 1F66A 3MGSC 2F8NK 5CPKC 3REIC 2DF4C 3UT9B 1M19B 1PZRA 1AOID 3W97A 3H0RC 3X1UB 3C1CB 3UTBD 3W99A 5GSUD 3O62D 3UT9C 1M19C 4ZUXD 3WTPB 3X1UC 3REKD 3C1CC 4J8UB 3REID 5AV9D 4KHAA 1EQZB 2BG1A 2FFFB 3C1BA 3H0MC 2F8ND 3WTPC 3AZGA 3AN2D 4NFTA 4YM6A 3AFAA 3W97B 1EQZC 3AZJA 3W99B 2NQBD 1P3BA 2JCHA 1P3OA 5AVBD 2BYMA 4Z66D 5E5AD 3W97C 3KWQA 1S32A 4J8UD 3R45A 4KHAB 3FDDA 3EPLA 4DQYB 3AZGB 3AZHB 1F66D 4YM6B 3AFAB 3AZMD 4YS3B 4J8XB 4J8WB 1P3BB 1P3OB 3AZGC 3W99D 3AZHC 2BYMB 4QLCA 3EPKA 4YM6C 1ULYA 5AV6A 3X1TD 3AFAC 3B6FA 1ID3A 4WU8A 4YS3C 4J8XC 3KWQB 3MGPD 1S32B 3AL0C 1A7WA 5JA4A 4J8WC 1P3BC 3R45B 1P3OC 5B31D 2FJ7C 5BS7A 3RELA 3C1BD 3KWQC 1S32C 2Y2OA 2UWXA 1P3MB 3F6TA 4YM6D 2YFVB 1N1JA 3B0BA 4Z5TA 3AZJD 3W98A 1T3UA 2HIOB 2CV5C 4QLCB 1TAFB 5BT1C 5AV6B 1P3AD 1P3MC 3NQUA 5JA4B 1P3KD 2HIOC 4QLCC 5AV6C 3RELB 5B24D 3AZEA 4XZQD 3TU4A 5B0YD 4WU9A 3KXBB 5DNNB 3AZKA 5B0ZA 4Z5TB 1N1JB 5BS7C 3RELC 1P34A 3W98B 4R8PD 1JFIB 3NQUB 5B32A 3B6FD 3VH6T 3KXBC 5DNNC 1ID3D 4WU8D 2J8PA 3B0CT 5CPIA 5AV8A 3A1IA 1M18A 2LY8A 3RELD 2RVQD 3X1VC 3WA9A 3REJA 3TU4B 3MGRA 4WU9B 3AZKB 5B0ZB 2ZY2A 1P34B 1KX4B 5CPKA 4Z5TD 1KX3D 5AV5D 3W98D 3VH6A 4ZBJB 3TU4C 3WKJA 5B32B 1HTAA 4WU9C 3AZKC 5B0ZC 1P34C 4KUDA 1KX4C 3P5JB 5B2JD 5DNMA 5CPIB 5AV8B 4NE6A 4ZBJC 5B32C 5G49A 5B2IC 4XUJD 1M1AB 3LJAD 3WA9B 3REJB 3AZED 3MGRB 5AV8C 3H0LC 3EPJA 4WU9D 1P3LA 3LELA 1M1AC 5GT0D 1P3FD 3AZLA 3REHB 4H9OB 3WA9C 3REJC 3WKJB 2JSSA 3AZND 4KUDB 2PYOA 5B1MD 4E45A 5CPJA 5DNMB 5AVCA 4JJNB 3REHC 5CPID 3KUYD 3WKJC 5G49B 1M18D 3WAAD 4KUDC 1HQ3A 5JRGA 3X1SC 4NE3A 5DNMC 4JJNC 3REJD 3AV2D 3MGRD 4LD9A 1P3LB 3LELB 3MGSD 3AZLB 3AV1A 5CPKD 2Y2NA 5B1LC 1BH8A 2PYOB 1P3LC 5B32G 3LELC 5AY8A 5CPJB 3AZHA 3EG5B 5AVCB 3AZLC 4KUDD 5F99C 5DNMD 3UT9D 1M19D 4YS3A 4J8XA 3X1UD 2PYOC 3C1CD 4J8WA 2FJ7A 1HQ3B 5JRGB 5CPJC 5AVCC 4DRAA 3NQJB 1P3PA 4LD9B 2G5IC 5CP6A 3WTPD 3AV1B 2Y2KA 2DQNC 2ZY5A 1HQ3C 3VH5T 5JRGC 3LZ1A 3MNNB 1BH8B 3IP4C 1B6WA 1H3OB 1EQZD 4LD9C 4X23A 5AY8B 2CV5A 2PYOD 3AV1C 2AROA 3W96C 4WZSB 1P3IC 1P3MA 3MNNC 3W97D 2YFVA 2FJ7B 5AY8C 2HIOA 1TAFA 3AYWB 1P3PB 3AZIA 4H9SA 5CP6B 4LD9D 3VH5A 3B6GA 3LZ1B 1P3PC 3AYWC 3LZ0A 4X23B 2VQRA 5CP6C 2CV5B 2AROB 3AZGD 3AZHD 3MGQA 4H9NA 1KU5A 3LZ1C 3KXBA 3AFAD 1WWIA 5DNNA 5B33B 1Q9CA 4YS3D 4J8XD 4X23C 3KSYA 2AROC 4J8WD 1P3BD 1P3OD 2FJ7D 3AZIB 1JFIA 4KGCA 5B40A 1P3PD 2Y2IA 3B6GB 3X1VA 5B33C 3KWQD 1S32D 1ZLAB 3AZIC 2XD5A 3LZ0B 4H9SC 2HUEB 3B6GC 2CV5D 3MGQB 4H9NB 5BT1D 2NZDB 1P3MD 4HGAB 1ZLAC 3LZ0C 1KX4A 2F8NH 3AZFC 4H9RA 2HUEC 2Y2LA 1BFMA 4NE5A 2HIOD 5KDMB 4QLCD 5B40B 4KGCB 4E44A 2NZDC 5AV6D
chains in the Genus database with same CATH topology
4UUZA 5B2IA 1BH9A 4HGAC 5GT3A 3X1VB 2L5AA 5FUGA 3EPHA 4KGCC 3A6NA 5B40C 5BNVA 1M1AA 5GXQB 4Z2MH 2JE5A 4G91B 3KXBD 5DNND 4H9RB 5GXQC 3REHA 4H9OA 3A6NB 4J8VC 1Z2CB 4UUZB 5B2IB 1BH9B 5GT3B 4G91C 5FUGB 1TZYA 3X1SA 3X1VD 4JJNA 5BO0A 3A6NC 5BNVB 3MVDC 5GT3C 3UTBA 3UTAC 5B1LA 5BNXA 3TU4D 2Y2MA 3O62A 3AZKD 5B0ZD 3REKA 1P34D 1KX4D 5F99A 5AV9A 1KX5B 1P3GA 2Y2PA 5B32D 5B2ID 1TZYB 4DRBA 3X1SB 3B0DB 5BO0B 1AOIB 5AV8D 1KX5C 2RIQA 3UTBB 1TZYC 1M1AD 5B1LB 5AVBA 3B0DC 3WA9D 5BNXB 3NQJA 3O62B 4AWLB 3B0CW 4ZUXB 4Z66A 1U35A 1AOIC 3REKB 3UTBC 3W96A 5F99B 5GSUC 1P3IA 5AV9B 3REHD 3MNNA 4AWLC 3O62C 1P3GB 3WKJD 1H3OA 4ZUXC 3REKC 2Y2QA 3X1SD 4JJND 3AZMA 5AV9C 3A1KA 1P3GC 3WTPE 4H9PB 2BYKB 2NQBB 5AVBB 3AN2C 3AYWA 1U35B 5B1LD 4Z66B 5E5AB 3X1TA 1P3LD 3LELD 3MGPA 3W96B 1P3IB 2NQBC 3AZLD 5B31A 5AVBC 5F99D 2ZY3A 2F2AC 1U35C 4Z66C 5E5AC 1P3GD 1F66B 2ZM5A 5CPJD 5AVCD 4J8UC 3AZMB 5B33A 1F66C 1HQ3D 5JRGD 3X1TB 3AZMC 1P3AA 1U35D 3MGPB 3AV1D 1P3KA 5B31B 3W99C 3W96D 1P3ID 1ZLAA 3X1TC 4WNNA 3MNND 3C1BB 5B24A 3MGPC 5AY8D 4XZQA 2F8NG 3AZFA 5B31C 2NZDA 5B0YA 3AZJB 2CWEA 5C3IB 3C1BC 4R8PA 5KDMA 1P3AB 3AYWD 5CHLB 3V9RA 3AZJC 1F1EA 5CP6D 5C3IC 1P3KB 3LZ1D 1W2EA 2ZY4A 4WNNB 4EO5B 1P3AC 4Z2MG 5B24B 5GXQA 4X23D 1B67A 4XZQB 2AROD 3MGQC 3AZFB 4J8VA 1P3KC 5B0YB 4CSRA 2IO5B 3VH5W 2Y2GA 4EO5C 5B33D 5B24C 2XD1A 5AV5A 1KX3A 4R8PB 4XZQC 5B0YC 3AZID 3B6FB 4CAYA 3MVDA 1ID3B 2IO5C 3V9RB 4WJ3C 4WU8B 2G5HC 3UTAA 3B6GD 5B2JA 2W8SA 4H9QA 4R8PC 1ZLAD 5B31G 3B6FC 4XUJA 3LZ0D 1ID3C 3LJAA 4WU8C 4J8VB 4M6BA 3MGQD 4CSRB 3AZFD 2NZDD 2Y2JA 5GT0A 5AV5B 2RVQC 1P3FA 1KX3B 2Y2HA 2YFWA 4KGCD 5B40D 3AZNA 4CAYB 3MVDB 1R4VA 1KX5A 3UTAB 4Z5TC 5B2JB 5B1MA 1KX3C 5AV5C 3W98C 4H9QB 1AOIA 3KUYA 4XUJB 3WAAA 3LJAB 5GSUA 5GXQD 3AZEB 5B2JC 3AV2A 4J8VD 4ZUXA 3KFUG 4XUJC 5GT0B 3LJAC 3MGSA 1P3FB 3REIA 2YFWB 3AZEC 4UPKA 3A6ND 3AZNB 2F8NA 3MVDD 5GT3D 5B1MB 5GT0C 3AN2A 1P3FC 3UTAD 3KUYB 3UT9A 1M18B 1M19A 3AZNC 3WAAB 4H9PA 3X1UA 2BYKA 5GSUB 3VH6W 3C1CA 2NQBA 5B1MC 4G92B 3AV2B 5CPIC 5E5AA 3KUYC 1M18C 3WAAC 3MGSB 3WTPA 5CPKB 1WWSA 4J8UA 3REIB 4G92C 3AV2C 3MGRC 1EQZA 1KX5D 2F8NB 4WV4B 1TZYD 3AN2B 1F66A 3MGSC 2F8NK 5CPKC 3REIC 2DF4C 3UT9B 1M19B 1PZRA 1AOID 3W97A 3H0RC 3X1UB 3C1CB 3UTBD 3W99A 5GSUD 3O62D 3UT9C 1M19C 4ZUXD 3WTPB 3X1UC 3REKD 3C1CC 4J8UB 3REID 5AV9D 4KHAA 1EQZB 2BG1A 2FFFB 3C1BA 3H0MC 2F8ND 3WTPC 3AZGA 3AN2D 4NFTA 4YM6A 3AFAA 3W97B 1EQZC 3AZJA 3W99B 2NQBD 1P3BA 2JCHA 1P3OA 5AVBD 2BYMA 4Z66D 5E5AD 3W97C 3KWQA 1S32A 4J8UD 3R45A 4KHAB 3FDDA 3EPLA 4DQYB 3AZGB 3AZHB 1F66D 4YM6B 3AFAB 3AZMD 4YS3B 4J8XB 4J8WB 1P3BB 1P3OB 3AZGC 3W99D 3AZHC 2BYMB 4QLCA 3EPKA 4YM6C 1ULYA 5AV6A 3X1TD 3AFAC 3B6FA 1ID3A 4WU8A 4YS3C 4J8XC 3KWQB 3MGPD 1S32B 3AL0C 1A7WA 5JA4A 4J8WC 1P3BC 3R45B 1P3OC 5B31D 2FJ7C 5BS7A 3RELA 3C1BD 3KWQC 1S32C 2Y2OA 2UWXA 1P3MB 3F6TA 4YM6D 2YFVB 1N1JA 3B0BA 4Z5TA 3AZJD 3W98A 1T3UA 2HIOB 2CV5C 4QLCB 1TAFB 5BT1C 5AV6B 1P3AD 1P3MC 3NQUA 5JA4B 1P3KD 2HIOC 4QLCC 5AV6C 3RELB 5B24D 3AZEA 4XZQD 3TU4A 5B0YD 4WU9A 3KXBB 5DNNB 3AZKA 5B0ZA 4Z5TB 1N1JB 5BS7C 3RELC 1P34A 3W98B 4R8PD 1JFIB 3NQUB 5B32A 3B6FD 3VH6T 3KXBC 5DNNC 1ID3D 4WU8D 2J8PA 3B0CT 5CPIA 5AV8A 3A1IA 1M18A 2LY8A 3RELD 2RVQD 3X1VC 3WA9A 3REJA 3TU4B 3MGRA 4WU9B 3AZKB 5B0ZB 2ZY2A 1P34B 1KX4B 5CPKA 4Z5TD 1KX3D 5AV5D 3W98D 3VH6A 4ZBJB 3TU4C 3WKJA 5B32B 1HTAA 4WU9C 3AZKC 5B0ZC 1P34C 4KUDA 1KX4C 3P5JB 5B2JD 5DNMA 5CPIB 5AV8B 4NE6A 4ZBJC 5B32C 5G49A 5B2IC 4XUJD 1M1AB 3LJAD 3WA9B 3REJB 3AZED 3MGRB 5AV8C 3H0LC 3EPJA 4WU9D 1P3LA 3LELA 1M1AC 5GT0D 1P3FD 3AZLA 3REHB 4H9OB 3WA9C 3REJC 3WKJB 2JSSA 3AZND 4KUDB 2PYOA 5B1MD 4E45A 5CPJA 5DNMB 5AVCA 4JJNB 3REHC 5CPID 3KUYD 3WKJC 5G49B 1M18D 3WAAD 4KUDC 1HQ3A 5JRGA 3X1SC 4NE3A 5DNMC 4JJNC 3REJD 3AV2D 3MGRD 4LD9A 1P3LB 3LELB 3MGSD 3AZLB 3AV1A 5CPKD 2Y2NA 5B1LC 1BH8A 2PYOB 1P3LC 5B32G 3LELC 5AY8A 5CPJB 3AZHA 3EG5B 5AVCB 3AZLC 4KUDD 5F99C 5DNMD 3UT9D 1M19D 4YS3A 4J8XA 3X1UD 2PYOC 3C1CD 4J8WA 2FJ7A 1HQ3B 5JRGB 5CPJC 5AVCC 4DRAA 3NQJB 1P3PA 4LD9B 2G5IC 5CP6A 3WTPD 3AV1B 2Y2KA 2DQNC 2ZY5A 1HQ3C 3VH5T 5JRGC 3LZ1A 3MNNB 1BH8B 3IP4C 1B6WA 1H3OB 1EQZD 4LD9C 4X23A 5AY8B 2CV5A 2PYOD 3AV1C 2AROA 3W96C 4WZSB 1P3IC 1P3MA 3MNNC 3W97D 2YFVA 2FJ7B 5AY8C 2HIOA 1TAFA 3AYWB 1P3PB 3AZIA 4H9SA 5CP6B 4LD9D 3VH5A 3B6GA 3LZ1B 1P3PC 3AYWC 3LZ0A 4X23B 2VQRA 5CP6C 2CV5B 2AROB 3AZGD 3AZHD 3MGQA 4H9NA 1KU5A 3LZ1C 3KXBA 3AFAD 1WWIA 5DNNA 5B33B 1Q9CA 4YS3D 4J8XD 4X23C 3KSYA 2AROC 4J8WD 1P3BD 1P3OD 2FJ7D 3AZIB 1JFIA 4KGCA 5B40A 1P3PD 2Y2IA 3B6GB 3X1VA 5B33C 3KWQD 1S32D 1ZLAB 3AZIC 2XD5A 3LZ0B 4H9SC 2HUEB 3B6GC 2CV5D 3MGQB 4H9NB 5BT1D 2NZDB 1P3MD 4HGAB 1ZLAC 3LZ0C 1KX4A 2F8NH 3AZFC 4H9RA 2HUEC 2Y2LA 1BFMA 4NE5A 2HIOD 5KDMB 4QLCD 5B40B 4KGCB 4E44A 2NZDC 5AV6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUZ A;  5B2I A;  1BH9 A;  4HGA C;  5GT3 A;  3X1V B;  2L5A A;  5FUG A;  4KGC C;  3A6N A;  5B40 C;  5BNV A;  1M1A A;  5GXQ B;  4Z2M H;  4G91 B;  3KXB D;  5DNN D;  4H9R B;  5GXQ C;  3REH A;  4H9O A;  3A6N B;  4J8V C;  4UUZ B;  5B2I B;  1BH9 B;  5GT3 B;  4G91 C;  5FUG B;  1TZY A;  3X1S A;  3X1V D;  4JJN A;  5BO0 A;  3A6N C;  5BNV B;  3MVD C;  5GT3 C;  3UTB A;  3UTA C;  5B1L A;  5BNX A;  3TU4 D;  3O62 A;  3AZK D;  5B0Z D;  3REK A;  1P34 D;  1KX4 D;  5F99 A;  5AV9 A;  1KX5 B;  1P3G A;  5B32 D;  5B2I D;  1TZY B;  4DRB A;  3X1S B;  3B0D B;  5BO0 B;  1AOI B;  5AV8 D;  1KX5 C;  3UTB B;  1TZY C;  1M1A D;  5B1L B;  5AVB A;  3B0D C;  3WA9 D;  5BNX B;  3NQJ A;  3O62 B;  4AWL B;  3B0C W;  4ZUX B;  4Z66 A;  1U35 A;  1AOI C;  3REK B;  3UTB C;  3W96 A;  5F99 B;  5GSU C;  1P3I A;  5AV9 B;  3REH D;  3MNN A;  4AWL C;  3O62 C;  1P3G B;  3WKJ D;  1H3O A;  4ZUX C;  3REK C;  3X1S D;  4JJN D;  3AZM A;  5AV9 C;  1P3G C;  3WTP E;  4H9P B;  2BYK B;  2NQB B;  5AVB B;  3AN2 C;  3AYW A;  1U35 B;  5B1L D;  4Z66 B;  5E5A B;  3X1T A;  1P3L D;  3LEL D;  3MGP A;  3W96 B;  1P3I B;  2NQB C;  3AZL D;  5AVB C;  5F99 D;  5B31 A;  1U35 C;  4Z66 C;  5E5A C;  1P3G D;  1F66 B;  5CPJ D;  5AVC D;  4J8U C;  3AZM B;  5B33 A;  1F66 C;  1HQ3 D;  5JRG D;  3X1T B;  3AZM C;  1P3A A;  1U35 D;  3MGP B;  3AV1 D;  1P3K A;  5B31 B;  3W99 C;  3W96 D;  1P3I D;  1ZLA A;  3X1T C;  4WNN A;  3MNN D;  3C1B B;  5B24 A;  3MGP C;  5AY8 D;  4XZQ A;  2F8N G;  3AZF A;  5B31 C;  2NZD A;  5B0Y A;  3AZJ B;  2CWE A;  5C3I B;  3C1B C;  4R8P A;  5KDM A;  1P3A B;  3AYW D;  5CHL B;  3V9R A;  3AZJ C;  1F1E A;  5CP6 D;  5C3I C;  1P3K B;  3LZ1 D;  4WNN B;  1P3A C;  4EO5 B;  4Z2M G;  5B24 B;  5GXQ A;  4X23 D;  1B67 A;  4XZQ B;  2ARO D;  3MGQ C;  3AZF B;  4J8V A;  1P3K C;  5B0Y B;  4CSR A;  2IO5 B;  3VH5 W;  4EO5 C;  5B33 D;  5B24 C;  1KX3 A;  5AV5 A;  4R8P B;  4XZQ C;  5B0Y C;  3AZI D;  3B6F B;  4CAY A;  3MVD A;  1ID3 B;  2IO5 C;  3V9R B;  4WU8 B;  3B6G D;  3UTA A;  5B2J A;  4H9Q A;  4R8P C;  1ZLA D;  5B31 G;  3B6F C;  4XUJ A;  3LZ0 D;  1ID3 C;  3LJA A;  4WU8 C;  4J8V B;  4M6B A;  3MGQ D;  4CSR B;  3AZF D;  2NZD D;  5GT0 A;  5AV5 B;  2RVQ C;  1P3F A;  1KX3 B;  2YFW A;  4KGC D;  5B40 D;  3AZN A;  4CAY B;  3MVD B;  1R4V A;  1KX5 A;  3UTA B;  4Z5T C;  5B2J B;  5B1M A;  1KX3 C;  5AV5 C;  3W98 C;  4H9Q B;  1AOI A;  3KUY A;  4XUJ B;  3WAA A;  3LJA B;  5GSU A;  5GXQ D;  3AZE B;  5B2J C;  3AV2 A;  4J8V D;  4ZUX A;  4XUJ C;  5GT0 B;  3LJA C;  3MGS A;  1P3F B;  3REI A;  2YFW B;  3AZE C;  3A6N D;  3AZN B;  2F8N A;  3MVD D;  5GT3 D;  5B1M B;  5GT0 C;  3AN2 A;  1P3F C;  3UTA D;  3KUY B;  3UT9 A;  1M18 B;  1M19 A;  3AZN C;  3WAA B;  4H9P A;  3X1U A;  2BYK A;  5GSU B;  3VH6 W;  3C1C A;  2NQB A;  5B1M C;  4G92 B;  3AV2 B;  5CPI C;  5E5A A;  3KUY C;  1M18 C;  3WAA C;  3MGS B;  3WTP A;  5CPK B;  1WWS A;  4J8U A;  3REI B;  4G92 C;  3AV2 C;  3MGR C;  1EQZ A;  1KX5 D;  2F8N B;  4WV4 B;  1TZY D;  3AN2 B;  1F66 A;  3MGS C;  2F8N K;  5CPK C;  3REI C;  3UT9 B;  1M19 B;  1AOI D;  3W97 A;  3X1U B;  3C1C B;  3UTB D;  3W99 A;  5GSU D;  3O62 D;  3UT9 C;  1M19 C;  4ZUX D;  3WTP B;  3X1U C;  3REK D;  3C1C C;  4J8U B;  3REI D;  5AV9 D;  4KHA A;  1EQZ B;  3C1B A;  2F8N D;  3WTP C;  3AZG A;  3AN2 D;  4NFT A;  4YM6 A;  3AFA A;  3W97 B;  1EQZ C;  3AZJ A;  3W99 B;  2NQB D;  1P3B A;  1P3O A;  5AVB D;  2BYM A;  4Z66 D;  5E5A D;  3W97 C;  3KWQ A;  1S32 A;  4J8U D;  3R45 A;  4KHA B;  3AZG B;  3AZH B;  1F66 D;  4YM6 B;  3AFA B;  3AZM D;  4YS3 B;  4J8X B;  4J8W B;  1P3B B;  1P3O B;  3AZG C;  3W99 D;  3AZH C;  2BYM B;  4QLC A;  4YM6 C;  1ULY A;  5AV6 A;  3X1T D;  3AFA C;  3B6F A;  1ID3 A;  4WU8 A;  4YS3 C;  4J8X C;  3KWQ B;  3MGP D;  1S32 B;  1A7W A;  5JA4 A;  4J8W C;  1P3B C;  3R45 B;  1P3O C;  5B31 D;  2FJ7 C;  5BS7 A;  3REL A;  3C1B D;  3KWQ C;  1S32 C;  1P3M B;  4YM6 D;  2YFV B;  1N1J A;  3B0B A;  4Z5T A;  3AZJ D;  3W98 A;  2CV5 C;  2HIO B;  4QLC B;  1TAF B;  5BT1 C;  5AV6 B;  1P3A D;  1P3M C;  3NQU A;  5JA4 B;  1P3K D;  2HIO C;  4QLC C;  5AV6 C;  3REL B;  5B24 D;  3AZE A;  4XZQ D;  3TU4 A;  5B0Y D;  4WU9 A;  3KXB B;  5DNN B;  3AZK A;  5B0Z A;  4Z5T B;  1N1J B;  5BS7 C;  3REL C;  1P34 A;  3W98 B;  4R8P D;  1JFI B;  3NQU B;  5B32 A;  3B6F D;  3VH6 T;  3KXB C;  5DNN C;  1ID3 D;  4WU8 D;  3B0C T;  5CPI A;  5AV8 A;  1M18 A;  2LY8 A;  3REL D;  2RVQ D;  3X1V C;  3WA9 A;  3REJ A;  3TU4 B;  3MGR A;  4WU9 B;  3AZK B;  5B0Z B;  1P34 B;  1KX4 B;  5CPK A;  4Z5T D;  1KX3 D;  5AV5 D;  3W98 D;  3VH6 A;  4ZBJ B;  3TU4 C;  3WKJ A;  5B32 B;  1HTA A;  4WU9 C;  3AZK C;  5B0Z C;  1P34 C;  4KUD A;  1KX4 C;  5B2J D;  5CPI B;  5DNM A;  5AV8 B;  4NE6 A;  4ZBJ C;  5B32 C;  5G49 A;  5B2I C;  4XUJ D;  1M1A B;  3LJA D;  3WA9 B;  3REJ B;  3AZE D;  3MGR B;  5AV8 C;  4WU9 D;  1P3L A;  3LEL A;  1M1A C;  5GT0 D;  1P3F D;  3AZL A;  3REH B;  4H9O B;  3WA9 C;  3REJ C;  3WKJ B;  2JSS A;  3AZN D;  4KUD B;  2PYO A;  5B1M D;  4E45 A;  5CPJ A;  5DNM B;  5AVC A;  4JJN B;  3REH C;  5CPI D;  3KUY D;  3WKJ C;  5G49 B;  1M18 D;  3WAA D;  4KUD C;  1HQ3 A;  5JRG A;  3X1S C;  4NE3 A;  5DNM C;  4JJN C;  3REJ D;  3AV2 D;  3MGR D;  4LD9 A;  1P3L B;  3LEL B;  3MGS D;  3AZL B;  3AV1 A;  5CPK D;  5B1L C;  1BH8 A;  2PYO B;  1P3L C;  5B32 G;  3LEL C;  5AY8 A;  5CPJ B;  3AZH A;  5AVC B;  4KUD D;  3AZL C;  5F99 C;  5DNM D;  3UT9 D;  1M19 D;  4YS3 A;  4J8X A;  3X1U D;  2PYO C;  3C1C D;  4J8W A;  2FJ7 A;  1HQ3 B;  5JRG B;  5CPJ C;  5AVC C;  4DRA A;  3NQJ B;  1P3P A;  4LD9 B;  5CP6 A;  3WTP D;  3AV1 B;  1HQ3 C;  3VH5 T;  5JRG C;  3LZ1 A;  3MNN B;  1BH8 B;  1B6W A;  1H3O B;  1EQZ D;  4LD9 C;  4X23 A;  5AY8 B;  2CV5 A;  2PYO D;  3AV1 C;  2ARO A;  3W96 C;  4WZS B;  1P3I C;  1P3M A;  3MNN C;  3W97 D;  2YFV A;  2FJ7 B;  5AY8 C;  2HIO A;  1TAF A;  3AYW B;  1P3P B;  3AZI A;  4H9S A;  5CP6 B;  4LD9 D;  3VH5 A;  3B6G A;  3LZ1 B;  1P3P C;  3AYW C;  3LZ0 A;  4X23 B;  5CP6 C;  2CV5 B;  2ARO B;  3AZG D;  3AZH D;  3MGQ A;  4H9N A;  1KU5 A;  3LZ1 C;  3KXB A;  3AFA D;  1WWI A;  5DNN A;  5B33 B;  1Q9C A;  4YS3 D;  4J8X D;  4X23 C;  3KSY A;  2ARO C;  4J8W D;  1P3B D;  1P3O D;  2FJ7 D;  3AZI B;  1JFI A;  4KGC A;  5B40 A;  1P3P D;  3B6G B;  3X1V A;  5B33 C;  3KWQ D;  1S32 D;  1ZLA B;  3AZI C;  3LZ0 B;  4H9S C;  2HUE B;  3B6G C;  2CV5 D;  3MGQ B;  4H9N B;  5BT1 D;  2NZD B;  1P3M D;  4HGA B;  1ZLA C;  3LZ0 C;  1KX4 A;  2F8N H;  3AZF C;  4H9R A;  2HUE C;  1BFM A;  4NE5 A;  2HIO D;  5KDM B;  4QLC D;  5B40 B;  4KGC B;  4E44 A;  2NZD C;  5AV6 D; 
#chains in the Genus database with same CATH topology
 4UUZ A;  5B2I A;  1BH9 A;  4HGA C;  5GT3 A;  3X1V B;  2L5A A;  5FUG A;  3EPH A;  4KGC C;  3A6N A;  5B40 C;  5BNV A;  1M1A A;  5GXQ B;  4Z2M H;  2JE5 A;  4G91 B;  3KXB D;  5DNN D;  4H9R B;  5GXQ C;  3REH A;  4H9O A;  3A6N B;  4J8V C;  1Z2C B;  4UUZ B;  5B2I B;  1BH9 B;  5GT3 B;  4G91 C;  5FUG B;  1TZY A;  3X1S A;  3X1V D;  4JJN A;  5BO0 A;  3A6N C;  5BNV B;  3MVD C;  5GT3 C;  3UTB A;  3UTA C;  5B1L A;  5BNX A;  3TU4 D;  2Y2M A;  3O62 A;  3AZK D;  5B0Z D;  3REK A;  1P34 D;  1KX4 D;  5F99 A;  5AV9 A;  1KX5 B;  1P3G A;  2Y2P A;  5B32 D;  5B2I D;  1TZY B;  4DRB A;  3X1S B;  3B0D B;  5BO0 B;  1AOI B;  5AV8 D;  1KX5 C;  2RIQ A;  3UTB B;  1TZY C;  1M1A D;  5B1L B;  5AVB A;  3B0D C;  3WA9 D;  5BNX B;  3NQJ A;  3O62 B;  4AWL B;  3B0C W;  4ZUX B;  4Z66 A;  1U35 A;  1AOI C;  3REK B;  3UTB C;  3W96 A;  5F99 B;  5GSU C;  1P3I A;  5AV9 B;  3REH D;  3MNN A;  4AWL C;  3O62 C;  1P3G B;  3WKJ D;  1H3O A;  4ZUX C;  3REK C;  2Y2Q A;  3X1S D;  4JJN D;  3AZM A;  5AV9 C;  3A1K A;  1P3G C;  3WTP E;  4H9P B;  2BYK B;  2NQB B;  5AVB B;  3AN2 C;  3AYW A;  1U35 B;  5B1L D;  4Z66 B;  5E5A B;  3X1T A;  1P3L D;  3LEL D;  3MGP A;  3W96 B;  1P3I B;  2NQB C;  3AZL D;  5B31 A;  5AVB C;  5F99 D;  2ZY3 A;  2F2A C;  1U35 C;  4Z66 C;  5E5A C;  1P3G D;  1F66 B;  2ZM5 A;  5CPJ D;  5AVC D;  4J8U C;  3AZM B;  5B33 A;  1F66 C;  1HQ3 D;  5JRG D;  3X1T B;  3AZM C;  1P3A A;  1U35 D;  3MGP B;  3AV1 D;  1P3K A;  5B31 B;  3W99 C;  3W96 D;  1P3I D;  1ZLA A;  3X1T C;  4WNN A;  3MNN D;  3C1B B;  5B24 A;  3MGP C;  5AY8 D;  4XZQ A;  2F8N G;  3AZF A;  5B31 C;  2NZD A;  5B0Y A;  3AZJ B;  2CWE A;  5C3I B;  3C1B C;  4R8P A;  5KDM A;  1P3A B;  3AYW D;  5CHL B;  3V9R A;  3AZJ C;  1F1E A;  5CP6 D;  5C3I C;  1P3K B;  3LZ1 D;  1W2E A;  2ZY4 A;  4WNN B;  4EO5 B;  1P3A C;  4Z2M G;  5B24 B;  5GXQ A;  4X23 D;  1B67 A;  4XZQ B;  2ARO D;  3MGQ C;  3AZF B;  4J8V A;  1P3K C;  5B0Y B;  4CSR A;  2IO5 B;  3VH5 W;  2Y2G A;  4EO5 C;  5B33 D;  5B24 C;  2XD1 A;  5AV5 A;  1KX3 A;  4R8P B;  4XZQ C;  5B0Y C;  3AZI D;  3B6F B;  4CAY A;  3MVD A;  1ID3 B;  2IO5 C;  3V9R B;  4WJ3 C;  4WU8 B;  2G5H C;  3UTA A;  3B6G D;  5B2J A;  2W8S A;  4H9Q A;  4R8P C;  1ZLA D;  5B31 G;  3B6F C;  4XUJ A;  3LZ0 D;  1ID3 C;  3LJA A;  4WU8 C;  4J8V B;  4M6B A;  3MGQ D;  4CSR B;  3AZF D;  2NZD D;  2Y2J A;  5GT0 A;  5AV5 B;  2RVQ C;  1P3F A;  1KX3 B;  2Y2H A;  2YFW A;  4KGC D;  5B40 D;  3AZN A;  4CAY B;  3MVD B;  1R4V A;  1KX5 A;  3UTA B;  4Z5T C;  5B2J B;  5B1M A;  1KX3 C;  5AV5 C;  3W98 C;  4H9Q B;  1AOI A;  3KUY A;  4XUJ B;  3WAA A;  3LJA B;  5GSU A;  5GXQ D;  3AZE B;  5B2J C;  3AV2 A;  4J8V D;  4ZUX A;  3KFU G;  4XUJ C;  5GT0 B;  3LJA C;  3MGS A;  1P3F B;  3REI A;  2YFW B;  3AZE C;  4UPK A;  3A6N D;  3AZN B;  2F8N A;  3MVD D;  5GT3 D;  5B1M B;  5GT0 C;  3AN2 A;  1P3F C;  3UTA D;  3KUY B;  3UT9 A;  1M18 B;  1M19 A;  3AZN C;  3WAA B;  4H9P A;  3X1U A;  2BYK A;  5GSU B;  3VH6 W;  3C1C A;  2NQB A;  5B1M C;  4G92 B;  3AV2 B;  5CPI C;  5E5A A;  3KUY C;  1M18 C;  3WAA C;  3MGS B;  3WTP A;  5CPK B;  1WWS A;  4J8U A;  3REI B;  4G92 C;  3AV2 C;  3MGR C;  1EQZ A;  1KX5 D;  2F8N B;  4WV4 B;  1TZY D;  3AN2 B;  1F66 A;  3MGS C;  2F8N K;  5CPK C;  3REI C;  2DF4 C;  3UT9 B;  1M19 B;  1PZR A;  1AOI D;  3W97 A;  3H0R C;  3X1U B;  3C1C B;  3UTB D;  3W99 A;  5GSU D;  3O62 D;  3UT9 C;  1M19 C;  4ZUX D;  3WTP B;  3X1U C;  3REK D;  3C1C C;  4J8U B;  3REI D;  5AV9 D;  4KHA A;  1EQZ B;  2BG1 A;  2FFF B;  3C1B A;  3H0M C;  2F8N D;  3WTP C;  3AZG A;  3AN2 D;  4NFT A;  4YM6 A;  3AFA A;  3W97 B;  1EQZ C;  3AZJ A;  3W99 B;  2NQB D;  1P3B A;  2JCH A;  1P3O A;  5AVB D;  2BYM A;  4Z66 D;  5E5A D;  3W97 C;  3KWQ A;  1S32 A;  4J8U D;  3R45 A;  4KHA B;  3FDD A;  3EPL A;  4DQY B;  3AZG B;  3AZH B;  1F66 D;  4YM6 B;  3AFA B;  3AZM D;  4YS3 B;  4J8X B;  4J8W B;  1P3B B;  1P3O B;  3AZG C;  3W99 D;  3AZH C;  2BYM B;  4QLC A;  3EPK A;  4YM6 C;  1ULY A;  5AV6 A;  3X1T D;  3AFA C;  3B6F A;  1ID3 A;  4WU8 A;  4YS3 C;  4J8X C;  3KWQ B;  3MGP D;  1S32 B;  3AL0 C;  1A7W A;  5JA4 A;  4J8W C;  1P3B C;  3R45 B;  1P3O C;  5B31 D;  2FJ7 C;  5BS7 A;  3REL A;  3C1B D;  3KWQ C;  1S32 C;  2Y2O A;  2UWX A;  1P3M B;  3F6T A;  4YM6 D;  2YFV B;  1N1J A;  3B0B A;  4Z5T A;  3AZJ D;  3W98 A;  1T3U A;  2HIO B;  2CV5 C;  4QLC B;  1TAF B;  5BT1 C;  5AV6 B;  1P3A D;  1P3M C;  3NQU A;  5JA4 B;  1P3K D;  2HIO C;  4QLC C;  5AV6 C;  3REL B;  5B24 D;  3AZE A;  4XZQ D;  3TU4 A;  5B0Y D;  4WU9 A;  3KXB B;  5DNN B;  3AZK A;  5B0Z A;  4Z5T B;  1N1J B;  5BS7 C;  3REL C;  1P34 A;  3W98 B;  4R8P D;  1JFI B;  3NQU B;  5B32 A;  3B6F D;  3VH6 T;  3KXB C;  5DNN C;  1ID3 D;  4WU8 D;  2J8P A;  3B0C T;  5CPI A;  5AV8 A;  3A1I A;  1M18 A;  2LY8 A;  3REL D;  2RVQ D;  3X1V C;  3WA9 A;  3REJ A;  3TU4 B;  3MGR A;  4WU9 B;  3AZK B;  5B0Z B;  2ZY2 A;  1P34 B;  1KX4 B;  5CPK A;  4Z5T D;  1KX3 D;  5AV5 D;  3W98 D;  3VH6 A;  4ZBJ B;  3TU4 C;  3WKJ A;  5B32 B;  1HTA A;  4WU9 C;  3AZK C;  5B0Z C;  1P34 C;  4KUD A;  1KX4 C;  3P5J B;  5B2J D;  5DNM A;  5CPI B;  5AV8 B;  4NE6 A;  4ZBJ C;  5B32 C;  5G49 A;  5B2I C;  4XUJ D;  1M1A B;  3LJA D;  3WA9 B;  3REJ B;  3AZE D;  3MGR B;  5AV8 C;  3H0L C;  3EPJ A;  4WU9 D;  1P3L A;  3LEL A;  1M1A C;  5GT0 D;  1P3F D;  3AZL A;  3REH B;  4H9O B;  3WA9 C;  3REJ C;  3WKJ B;  2JSS A;  3AZN D;  4KUD B;  2PYO A;  5B1M D;  4E45 A;  5CPJ A;  5DNM B;  5AVC A;  4JJN B;  3REH C;  5CPI D;  3KUY D;  3WKJ C;  5G49 B;  1M18 D;  3WAA D;  4KUD C;  1HQ3 A;  5JRG A;  3X1S C;  4NE3 A;  5DNM C;  4JJN C;  3REJ D;  3AV2 D;  3MGR D;  4LD9 A;  1P3L B;  3LEL B;  3MGS D;  3AZL B;  3AV1 A;  5CPK D;  2Y2N A;  5B1L C;  1BH8 A;  2PYO B;  1P3L C;  5B32 G;  3LEL C;  5AY8 A;  5CPJ B;  3AZH A;  3EG5 B;  5AVC B;  3AZL C;  4KUD D;  5F99 C;  5DNM D;  3UT9 D;  1M19 D;  4YS3 A;  4J8X A;  3X1U D;  2PYO C;  3C1C D;  4J8W A;  2FJ7 A;  1HQ3 B;  5JRG B;  5CPJ C;  5AVC C;  4DRA A;  3NQJ B;  1P3P A;  4LD9 B;  2G5I C;  5CP6 A;  3WTP D;  3AV1 B;  2Y2K A;  2DQN C;  2ZY5 A;  1HQ3 C;  3VH5 T;  5JRG C;  3LZ1 A;  3MNN B;  1BH8 B;  3IP4 C;  1B6W A;  1H3O B;  1EQZ D;  4LD9 C;  4X23 A;  5AY8 B;  2CV5 A;  2PYO D;  3AV1 C;  2ARO A;  3W96 C;  4WZS B;  1P3I C;  1P3M A;  3MNN C;  3W97 D;  2YFV A;  2FJ7 B;  5AY8 C;  2HIO A;  1TAF A;  3AYW B;  1P3P B;  3AZI A;  4H9S A;  5CP6 B;  4LD9 D;  3VH5 A;  3B6G A;  3LZ1 B;  1P3P C;  3AYW C;  3LZ0 A;  4X23 B;  2VQR A;  5CP6 C;  2CV5 B;  2ARO B;  3AZG D;  3AZH D;  3MGQ A;  4H9N A;  1KU5 A;  3LZ1 C;  3KXB A;  3AFA D;  1WWI A;  5DNN A;  5B33 B;  1Q9C A;  4YS3 D;  4J8X D;  4X23 C;  3KSY A;  2ARO C;  4J8W D;  1P3B D;  1P3O D;  2FJ7 D;  3AZI B;  1JFI A;  4KGC A;  5B40 A;  1P3P D;  2Y2I A;  3B6G B;  3X1V A;  5B33 C;  3KWQ D;  1S32 D;  1ZLA B;  3AZI C;  2XD5 A;  3LZ0 B;  4H9S C;  2HUE B;  3B6G C;  2CV5 D;  3MGQ B;  4H9N B;  5BT1 D;  2NZD B;  1P3M D;  4HGA B;  1ZLA C;  3LZ0 C;  1KX4 A;  2F8N H;  3AZF C;  4H9R A;  2HUE C;  2Y2L A;  1BFM A;  4NE5 A;  2HIO D;  5KDM B;  4QLC D;  5B40 B;  4KGC B;  4E44 A;  2NZD C;  5AV6 D; 
#chains in the Genus database with same CATH homology
 4UUZ A;  5B2I A;  1BH9 A;  4HGA C;  5GT3 A;  3X1V B;  2L5A A;  5FUG A;  3EPH A;  4KGC C;  3A6N A;  5B40 C;  5BNV A;  1M1A A;  5GXQ B;  4Z2M H;  2JE5 A;  4G91 B;  3KXB D;  5DNN D;  4H9R B;  5GXQ C;  3REH A;  4H9O A;  3A6N B;  4J8V C;  1Z2C B;  4UUZ B;  5B2I B;  1BH9 B;  5GT3 B;  4G91 C;  5FUG B;  1TZY A;  3X1S A;  3X1V D;  4JJN A;  5BO0 A;  3A6N C;  5BNV B;  3MVD C;  5GT3 C;  3UTB A;  3UTA C;  5B1L A;  5BNX A;  3TU4 D;  2Y2M A;  3O62 A;  3AZK D;  5B0Z D;  3REK A;  1P34 D;  1KX4 D;  5F99 A;  5AV9 A;  1KX5 B;  1P3G A;  2Y2P A;  5B32 D;  5B2I D;  1TZY B;  4DRB A;  3X1S B;  3B0D B;  5BO0 B;  1AOI B;  5AV8 D;  1KX5 C;  2RIQ A;  3UTB B;  1TZY C;  1M1A D;  5B1L B;  5AVB A;  3B0D C;  3WA9 D;  5BNX B;  3NQJ A;  3O62 B;  4AWL B;  3B0C W;  4ZUX B;  4Z66 A;  1U35 A;  1AOI C;  3REK B;  3UTB C;  3W96 A;  5F99 B;  5GSU C;  1P3I A;  5AV9 B;  3REH D;  3MNN A;  4AWL C;  3O62 C;  1P3G B;  3WKJ D;  1H3O A;  4ZUX C;  3REK C;  2Y2Q A;  3X1S D;  4JJN D;  3AZM A;  5AV9 C;  3A1K A;  1P3G C;  3WTP E;  4H9P B;  2BYK B;  2NQB B;  5AVB B;  3AN2 C;  3AYW A;  1U35 B;  5B1L D;  4Z66 B;  5E5A B;  3X1T A;  1P3L D;  3LEL D;  3MGP A;  3W96 B;  1P3I B;  2NQB C;  3AZL D;  5B31 A;  5AVB C;  5F99 D;  2ZY3 A;  2F2A C;  1U35 C;  4Z66 C;  5E5A C;  1P3G D;  1F66 B;  2ZM5 A;  5CPJ D;  5AVC D;  4J8U C;  3AZM B;  5B33 A;  1F66 C;  1HQ3 D;  5JRG D;  3X1T B;  3AZM C;  1P3A A;  1U35 D;  3MGP B;  3AV1 D;  1P3K A;  5B31 B;  3W99 C;  3W96 D;  1P3I D;  1ZLA A;  3X1T C;  4WNN A;  3MNN D;  3C1B B;  5B24 A;  3MGP C;  5AY8 D;  4XZQ A;  2F8N G;  3AZF A;  5B31 C;  2NZD A;  5B0Y A;  3AZJ B;  2CWE A;  5C3I B;  3C1B C;  4R8P A;  5KDM A;  1P3A B;  3AYW D;  5CHL B;  3V9R A;  3AZJ C;  1F1E A;  5CP6 D;  5C3I C;  1P3K B;  3LZ1 D;  1W2E A;  2ZY4 A;  4WNN B;  4EO5 B;  1P3A C;  4Z2M G;  5B24 B;  5GXQ A;  4X23 D;  1B67 A;  4XZQ B;  2ARO D;  3MGQ C;  3AZF B;  4J8V A;  1P3K C;  5B0Y B;  4CSR A;  2IO5 B;  3VH5 W;  2Y2G A;  4EO5 C;  5B33 D;  5B24 C;  2XD1 A;  5AV5 A;  1KX3 A;  4R8P B;  4XZQ C;  5B0Y C;  3AZI D;  3B6F B;  4CAY A;  3MVD A;  1ID3 B;  2IO5 C;  3V9R B;  4WJ3 C;  4WU8 B;  2G5H C;  3UTA A;  3B6G D;  5B2J A;  2W8S A;  4H9Q A;  4R8P C;  1ZLA D;  5B31 G;  3B6F C;  4XUJ A;  3LZ0 D;  1ID3 C;  3LJA A;  4WU8 C;  4J8V B;  4M6B A;  3MGQ D;  4CSR B;  3AZF D;  2NZD D;  2Y2J A;  5GT0 A;  5AV5 B;  2RVQ C;  1P3F A;  1KX3 B;  2Y2H A;  2YFW A;  4KGC D;  5B40 D;  3AZN A;  4CAY B;  3MVD B;  1R4V A;  1KX5 A;  3UTA B;  4Z5T C;  5B2J B;  5B1M A;  1KX3 C;  5AV5 C;  3W98 C;  4H9Q B;  1AOI A;  3KUY A;  4XUJ B;  3WAA A;  3LJA B;  5GSU A;  5GXQ D;  3AZE B;  5B2J C;  3AV2 A;  4J8V D;  4ZUX A;  3KFU G;  4XUJ C;  5GT0 B;  3LJA C;  3MGS A;  1P3F B;  3REI A;  2YFW B;  3AZE C;  4UPK A;  3A6N D;  3AZN B;  2F8N A;  3MVD D;  5GT3 D;  5B1M B;  5GT0 C;  3AN2 A;  1P3F C;  3UTA D;  3KUY B;  3UT9 A;  1M18 B;  1M19 A;  3AZN C;  3WAA B;  4H9P A;  3X1U A;  2BYK A;  5GSU B;  3VH6 W;  3C1C A;  2NQB A;  5B1M C;  4G92 B;  3AV2 B;  5CPI C;  5E5A A;  3KUY C;  1M18 C;  3WAA C;  3MGS B;  3WTP A;  5CPK B;  1WWS A;  4J8U A;  3REI B;  4G92 C;  3AV2 C;  3MGR C;  1EQZ A;  1KX5 D;  2F8N B;  4WV4 B;  1TZY D;  3AN2 B;  1F66 A;  3MGS C;  2F8N K;  5CPK C;  3REI C;  2DF4 C;  3UT9 B;  1M19 B;  1PZR A;  1AOI D;  3W97 A;  3H0R C;  3X1U B;  3C1C B;  3UTB D;  3W99 A;  5GSU D;  3O62 D;  3UT9 C;  1M19 C;  4ZUX D;  3WTP B;  3X1U C;  3REK D;  3C1C C;  4J8U B;  3REI D;  5AV9 D;  4KHA A;  1EQZ B;  2BG1 A;  2FFF B;  3C1B A;  3H0M C;  2F8N D;  3WTP C;  3AZG A;  3AN2 D;  4NFT A;  4YM6 A;  3AFA A;  3W97 B;  1EQZ C;  3AZJ A;  3W99 B;  2NQB D;  1P3B A;  2JCH A;  1P3O A;  5AVB D;  2BYM A;  4Z66 D;  5E5A D;  3W97 C;  3KWQ A;  1S32 A;  4J8U D;  3R45 A;  4KHA B;  3FDD A;  3EPL A;  4DQY B;  3AZG B;  3AZH B;  1F66 D;  4YM6 B;  3AFA B;  3AZM D;  4YS3 B;  4J8X B;  4J8W B;  1P3B B;  1P3O B;  3AZG C;  3W99 D;  3AZH C;  2BYM B;  4QLC A;  3EPK A;  4YM6 C;  1ULY A;  5AV6 A;  3X1T D;  3AFA C;  3B6F A;  1ID3 A;  4WU8 A;  4YS3 C;  4J8X C;  3KWQ B;  3MGP D;  1S32 B;  3AL0 C;  1A7W A;  5JA4 A;  4J8W C;  1P3B C;  3R45 B;  1P3O C;  5B31 D;  2FJ7 C;  5BS7 A;  3REL A;  3C1B D;  3KWQ C;  1S32 C;  2Y2O A;  2UWX A;  1P3M B;  3F6T A;  4YM6 D;  2YFV B;  1N1J A;  3B0B A;  4Z5T A;  3AZJ D;  3W98 A;  1T3U A;  2HIO B;  2CV5 C;  4QLC B;  1TAF B;  5BT1 C;  5AV6 B;  1P3A D;  1P3M C;  3NQU A;  5JA4 B;  1P3K D;  2HIO C;  4QLC C;  5AV6 C;  3REL B;  5B24 D;  3AZE A;  4XZQ D;  3TU4 A;  5B0Y D;  4WU9 A;  3KXB B;  5DNN B;  3AZK A;  5B0Z A;  4Z5T B;  1N1J B;  5BS7 C;  3REL C;  1P34 A;  3W98 B;  4R8P D;  1JFI B;  3NQU B;  5B32 A;  3B6F D;  3VH6 T;  3KXB C;  5DNN C;  1ID3 D;  4WU8 D;  2J8P A;  3B0C T;  5CPI A;  5AV8 A;  3A1I A;  1M18 A;  2LY8 A;  3REL D;  2RVQ D;  3X1V C;  3WA9 A;  3REJ A;  3TU4 B;  3MGR A;  4WU9 B;  3AZK B;  5B0Z B;  2ZY2 A;  1P34 B;  1KX4 B;  5CPK A;  4Z5T D;  1KX3 D;  5AV5 D;  3W98 D;  3VH6 A;  4ZBJ B;  3TU4 C;  3WKJ A;  5B32 B;  1HTA A;  4WU9 C;  3AZK C;  5B0Z C;  1P34 C;  4KUD A;  1KX4 C;  3P5J B;  5B2J D;  5DNM A;  5CPI B;  5AV8 B;  4NE6 A;  4ZBJ C;  5B32 C;  5G49 A;  5B2I C;  4XUJ D;  1M1A B;  3LJA D;  3WA9 B;  3REJ B;  3AZE D;  3MGR B;  5AV8 C;  3H0L C;  3EPJ A;  4WU9 D;  1P3L A;  3LEL A;  1M1A C;  5GT0 D;  1P3F D;  3AZL A;  3REH B;  4H9O B;  3WA9 C;  3REJ C;  3WKJ B;  2JSS A;  3AZN D;  4KUD B;  2PYO A;  5B1M D;  4E45 A;  5CPJ A;  5DNM B;  5AVC A;  4JJN B;  3REH C;  5CPI D;  3KUY D;  3WKJ C;  5G49 B;  1M18 D;  3WAA D;  4KUD C;  1HQ3 A;  5JRG A;  3X1S C;  4NE3 A;  5DNM C;  4JJN C;  3REJ D;  3AV2 D;  3MGR D;  4LD9 A;  1P3L B;  3LEL B;  3MGS D;  3AZL B;  3AV1 A;  5CPK D;  2Y2N A;  5B1L C;  1BH8 A;  2PYO B;  1P3L C;  5B32 G;  3LEL C;  5AY8 A;  5CPJ B;  3AZH A;  3EG5 B;  5AVC B;  3AZL C;  4KUD D;  5F99 C;  5DNM D;  3UT9 D;  1M19 D;  4YS3 A;  4J8X A;  3X1U D;  2PYO C;  3C1C D;  4J8W A;  2FJ7 A;  1HQ3 B;  5JRG B;  5CPJ C;  5AVC C;  4DRA A;  3NQJ B;  1P3P A;  4LD9 B;  2G5I C;  5CP6 A;  3WTP D;  3AV1 B;  2Y2K A;  2DQN C;  2ZY5 A;  1HQ3 C;  3VH5 T;  5JRG C;  3LZ1 A;  3MNN B;  1BH8 B;  3IP4 C;  1B6W A;  1H3O B;  1EQZ D;  4LD9 C;  4X23 A;  5AY8 B;  2CV5 A;  2PYO D;  3AV1 C;  2ARO A;  3W96 C;  4WZS B;  1P3I C;  1P3M A;  3MNN C;  3W97 D;  2YFV A;  2FJ7 B;  5AY8 C;  2HIO A;  1TAF A;  3AYW B;  1P3P B;  3AZI A;  4H9S A;  5CP6 B;  4LD9 D;  3VH5 A;  3B6G A;  3LZ1 B;  1P3P C;  3AYW C;  3LZ0 A;  4X23 B;  2VQR A;  5CP6 C;  2CV5 B;  2ARO B;  3AZG D;  3AZH D;  3MGQ A;  4H9N A;  1KU5 A;  3LZ1 C;  3KXB A;  3AFA D;  1WWI A;  5DNN A;  5B33 B;  1Q9C A;  4YS3 D;  4J8X D;  4X23 C;  3KSY A;  2ARO C;  4J8W D;  1P3B D;  1P3O D;  2FJ7 D;  3AZI B;  1JFI A;  4KGC A;  5B40 A;  1P3P D;  2Y2I A;  3B6G B;  3X1V A;  5B33 C;  3KWQ D;  1S32 D;  1ZLA B;  3AZI C;  2XD5 A;  3LZ0 B;  4H9S C;  2HUE B;  3B6G C;  2CV5 D;  3MGQ B;  4H9N B;  5BT1 D;  2NZD B;  1P3M D;  4HGA B;  1ZLA C;  3LZ0 C;  1KX4 A;  2F8N H;  3AZF C;  4H9R A;  2HUE C;  2Y2L A;  1BFM A;  4NE5 A;  2HIO D;  5KDM B;  4QLC D;  5B40 B;  4KGC B;  4E44 A;  2NZD C;  5AV6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...