1BH8B

Htafii18/htafii28 heterodimer crystal structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
b'FSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAFII18
publication title Human TAF(II)28 and TAF(II)18 interact through a histone fold encoded by atypical evolutionary conserved motifs also found in the SPT3 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation complex
total genus 34
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1998-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bh8B00
5AV8C 1P3AB 1ZLAC 5E5AD 3MGRD 2HUEB 1TZYC 4Z66A 4J8XC 3REKC 2F8NK 5DNND 4J8WD 3KXBC 3UTAB 3AV1C 2F8NH 5BS7A 3B0CW 5C3IB 1F66B 3W96B 5CPKC 1KX5A 2NQBD 3VH6A 1P3FC 1P3GD 3R45B 3REHB 3KWQC 5GXQD 3NQUB 1R4VA 3AYWB 5DNMD 3AV2C 3LJAB 4JJNC 4WU9B 4G91C 1WWSA 5FUGB 3AN2B 3W99A 4X23B 3AZMD 5B1MD 5JRGD 3WKJB 5AV5A 3TU4D 4KGCC 5CP6B 5B31A 1P3LD 3AZKB 4LD9D 1U35B 3O62D 1M1AA 1N1JB 3NQJA 4WU8B 4KHAA 3AZLC 3MGQD 5CPIB 3LZ1B 4H9PA 5BNVA 3X1UA 3B6FC 1HQ3B 3AZID 3X1TD 5CPJC 4EO5B 5B24A 3AZJA 4Z66B 2PYOC 5KDMB 3LELC 5GSUA 1AOIA 3AFAB 4WNNA 3C1BA 1F66D 4QLCC 5GT0D 2F8NA 3W96D 4ZUXD 4J8UC 1M18D 1P3BA 1P3MA 2AROD 4R8PC 4KUDC 1KX5B 4XZQA 5B0ZA 3MVDD 3MGPC 4H9OA 3LJAD 4WU9D 2BYKA 4X23D 1EQZD 1BH9A 3W98D 5AVBA 4XUJC 3AZKD 1S32C 3REJC 4Z5TB 3W97D 5B0YC 3WA9A 1WWIA 3X1VA 4WU8D 1P34C 2CV5A 3REIC 3LZ1D 1P3AA 1M1AB 3NQJB 4YS3C 1M18C 1KX4A 3W98C 3AZHC 4KHAB 3V9RA 1P3KB 3WTPC 5AVCC 1ID3A 4Z66D 5B1LB 5G49B 3MNNA 4CSRB 3UTAA 3C1CC 3VH5A 5B33B 3AZJB 4J8WC 5AV9B 1P3PB 3R45A 4WNNB 3C1BB 3B0DC 1KX5D 3A6NC 3RELB 3AYWA 1P3BB 1P3GC 3AZEA 3UTBB 5AV8A 5DNMC 1ZLAA 3AN2A 4H9OB 4YM6B 1TZYA 4J8XA 2BYKB 3WKJA 2L5AA 3MGSB 3W99D 5BT1D 3AZMC 5JRGC 1BH9B 5CP6A 5AV5D 3KXBA 4AWLC 3AV1A 3TU4C 2CWEA 5B31D 2LY8A 3B0CT 5AVBB 1U35A 1P3FA 3KWQA 2HIOC 1P3LC 1KX3C 3WA9B 1M1AD 1B6WA 3O62C 3AV2A 5CPIA 4NE3A 3X1VB 2FJ7C 4JJNA 5GT3B 1HQ3A 2CV5B 1ULYA 3MGQC 3X1UD 1KX4B 3AZGC 1P3OC 3V9RB 3AZIC 5KDMA 3X1TC 1ID3B 3UT9B 4KGCA 5B24D 3AFAA 5GSUD 3MNNB 1AOID 5B32G 1P3IB 5B2IC 3C1BD 2F8ND 4ZBJC 5GT0C 4ZUXC 4J8VB 1P3BD 1P3MD 5F99B 2AROC 2IO5B 5AY8B 4XZQD 5B0ZD 3MVDC 3AZEB 5AV8B 4WZSB 1ZLAB 3KUYC 4G92C 2JSSA 1TZYB 4J8XB 1EQZC 2PYOA 3LZ0C 3LELA 3REKB 3B6GC 3AZNC 5AVBD 4Z5TA 5B2JC 3KXBB 4J8UA 3AZFD 3AV1B 4H9QB 3WA9D 5B32C 5CPKB 3W97C 2RVQD 5AV6C 1P3FB 3X1VD 3MGPA 3KWQB 4H9NB 2CV5D 1P3AD 3X1SC 1P3KA 3AV2B 1KX4D 4JJNB 4G91B 5B1LA 5G49A 4CSRA 1ID3D 5BO0A 2NZDC 5B33A 3MNND 3UTAD 5AV9A 3REJA 1P3PA 4HGAC 4KGCB 3VH6W 3RELA 5BS7C 4H9SC 3REHD 5B40C 3UTBA 1P34A 3AYWD 1KX5C 5JA4B 2YFWA 3AZED 5AV8D 3AZLB 1M19C 4YM6A 3WAAC 5AVCA 3WTPA 3MGSA 3AN2D 3B6FB 1TZYD 4J8XD 1KU5A 3WKJD 3C1CA 5CPJB 3W99C 5BT1C 5CP6D 3KXBD 3AV1D 2PYOB 3LELB 5AV5C 4NE6A 4QLCB 5B31C 3A6NA 4J8UB 1U35D 1P3FD 3KWQD 4R8PB 4KUDB 5GT3A 1M1AC 1F1EA 3AV2D 5CPID 5BNXB 3MGPB 4JJND 1HTAA 1HQ3D 3X1UC 3UT9A 5E5AC 3MGRC 4UUZB 1P3IA 5BO0B 3AFAD 4WV4B 5B24C 4M6BA 5DNNC 5GSUC 1AOIC 4XUJB 4J8VA 2HIOA 1S32B 3REJB 1KX3A 5F99A 5B0YB 5AY8A 2FJ7A 2NQBC 1P3MC 1P34B 5GXQC 3REIB 3MGQA 4XZQC 2YFWB 5B0ZC 4YS3B 3AZHB 1M18B 1JFIA 3AZGA 3W98B 1P3OA 2YFVA 3AZIA 3WTPB 5AVCB 3REKA 1BFMA 2PYOD 5B1MC 3LELD 3C1CB 5B2IA 4Z5TD 4CAYA 4H9QA 4J8WB 4J8UD 3AZFC 5CPKA 3B0DB 4H9NA 3A6NB 4LD9C 1TAFB 1Q9CA 3MGPD 1P3GB 1P3AC 1P3KD 5DNMB 3KUYA 1BH8B 2HUEC 3LZ0A 5B1LD 3B6GA 3AZNA 3AZMB 5JRGB 5B2JA 5B33D 4AWLB 3AZJD 3UTAC 5AV9D 3REJD 1P3PD 3TU4B 5C3IC 1H3OB 5B32A 5AV6A 1F66C 3W96C 3RELD 5JA4A 1P3LB 2HIOB 1KX3B 3REHC 3UTBD 1P34D 3AZLA 3X1SA 3O62B 3AYWC 2FJ7B 3AZEC 4YM6D 3B6FA 3LJAC 4WU9C 5AVCD 3WTPD 3MGSD 3MGQB 3AN2C 5CPJA 1JFIB 4X23C 3AZGB 2NZDA 1P3OB 2YFVB 3AZIB 3WKJC 3C1CD 3X1TB 1B67A 4NFTA 4QLCA 5CP6C 4H9SA 5B2IB 3VH6T 5B40A 4CAYB 4R8PA 3A6ND 4ZBJB 5GT0B 3AZKC 4ZUXB 1U35C 4H9RA 4KUDA 5BNXA 2AROB 1M19A 5GT3D 3WAAA 4WU8C 5CPIC 3LZ1C 3MVDB 1HQ3C 3KUYB 4G92B 4UUZA 3UT9D 4EO5C 1EQZB 3LZ0B 4Z66C 1P3ID 3B6GB 5B31G 3AZNB 4XUJA 1S32A 3AFAC 5B2JB 5B0YA 4J8VD 2BYMB 2HIOD 1KX3D 5F99D 5B32B 4Z2MG 5AV6B 3W97B 5AY8D 3REIA 2FJ7D 4YS3A 1M18A 3W98A 3AZHA 3X1SB 1ZLAD 3AZGD 5E5AA 1P3OD 3MGRA 3REKD 2NZDB 5DNNA 4J8WA 5B2ID 2F8NG 4E44A 4HGAB 4Z5TC 5CPKD 1TAFA 2NQBA 1P3GA 5B40B 5GXQA 4H9RB 1A7WA 5DNMA 1M19B 1BH8A 3WAAB 3WTPE 3KUYD 1P3KC 3AZMA 5B1MA 5JRGA 3LZ0D 3B6GD 5B1LC 3AZND 3W99B 4KGCD 3TU4A 5B2JD 1H3OA 4DRBA 4E45A 5B33C 5AV5B 3AZJC 3AZFA 5AV9C 1P3LA 1P3PC 5B32D 5AV6D 5B31B 3C1BC 4LD9A 3O62A 3RELC 3KSYA 1P3BC 3UTBC 3X1SD 3AZLD 4DRAA 3B6FD 4YM6C 3MGSC 3X1TA 4H9PB 5CPJD 5BNVB 3X1UB 2NZDD 5E5AB 3VH5T 3MGRB 4QLCD 5B24B 1F66A 5AVBC 3W96A 5GT0A 5DNNB 4ZUXA 5GSUB 1AOIB 5CHLB 5B40D 3REHA 4R8PD 2F8NB 2AROA 3NQUA 4KUDD 3WA9C 2RVQC 2NQBB 1P3MB 3X1VC 3MVDA 1M19D 3WAAD 3LJAA 5GXQB 5GT3C 4NE5A 4WU9A 2CV5C 5FUGA 4XZQB 5B0ZB 4X23A 1KX4C 1EQZA 3VH5W 1ID3C 3UT9C 5B1MB 3MNNC 4XUJD 1P3IC 2BYMA 1S32D 3B0BA 3AZKA 5B0YD 3AZFB 3W97A 1N1JA 4J8VC 4Z2MH 5F99C 4WU8A 4LD9B 3REID 2IO5C 5AY8C 3LZ1A 4YS3D 3AZHD
chains in the Genus database with same CATH superfamily
3EPHA 5AV8C 1P3AB 1W2EA 2Y2LA 1ZLAC 5E5AD 3MGRD 2HUEB 1TZYC 4Z66A 4J8XC 3REKC 2F8NK 5DNND 4J8WD 3KXBC 3UTAB 3AV1C 2F8NH 5BS7A 3B0CW 5C3IB 1F66B 3W96B 5CPKC 1KX5A 2NQBD 3VH6A 1P3FC 1P3GD 3R45B 3REHB 2JCHA 2JE5A 3KWQC 5GXQD 3NQUB 1R4VA 3AYWB 5DNMD 3AV2C 3LJAB 4JJNC 4WU9B 1WWSA 4G91C 2XD5A 5FUGB 3AN2B 3W99A 4X23B 3AZMD 5B1MD 5JRGD 3WKJB 5AV5A 2Y2QA 3TU4D 4KGCC 5CP6B 5B31A 1P3LD 3AZKB 4LD9D 1U35B 3O62D 1M1AA 1N1JB 2ZY2A 3EPKA 3NQJA 4WU8B 4KHAA 3AZLC 3MGQD 5CPIB 3LZ1B 3AL0C 4H9PA 5BNVA 3X1UA 3B6FC 1HQ3B 3AZID 3X1TD 5CPJC 4EO5B 5B24A 3AZJA 4Z66B 2PYOC 5KDMB 3LELC 5GSUA 1AOIA 3FDDA 3H0LC 3AFAB 4WNNA 3C1BA 1F66D 4QLCC 5GT0D 2F8NA 3W96D 4ZUXD 4J8UC 1M18D 1P3BA 1P3MA 2AROD 4R8PC 4KUDC 1KX5B 4XZQA 5B0ZA 3MVDD 3MGPC 4H9OA 3LJAD 2Y2GA 4WU9D 2BYKA 4X23D 1EQZD 1BH9A 3W98D 5AVBA 4XUJC 3AZKD 1S32C 3REJC 4Z5TB 3W97D 5B0YC 3WA9A 1WWIA 3X1VA 4WU8D 1P34C 2CV5A 3REIC 3LZ1D 1P3AA 1M1AB 2J8PA 3NQJB 4YS3C 1KX4A 1M18C 3AZHC 3W98C 4KHAB 2W8SA 3V9RA 1P3KB 4DQYB 5AVCC 3WTPC 1ID3A 4Z66D 2ZY5A 5G49B 5B1LB 4CSRB 3MNNA 3UTAA 3C1CC 3VH5A 5B33B 3AZJB 4J8WC 3P5JB 5AV9B 1P3PB 3R45A 4WNNB 3C1BB 3B0DC 1KX5D 3A6NC 3RELB 3AYWA 1P3BB 1P3GC 3AZEA 3UTBB 5AV8A 5DNMC 1ZLAA 3AN2A 4H9OB 2RIQA 4YM6B 1TZYA 4J8XA 2BYKB 3WKJA 2L5AA 3MGSB 3W99D 5BT1D 3AZMC 5JRGC 3EPJA 1BH9B 5CP6A 3IP4C 5AV5D 3KXBA 4AWLC 3AV1A 3TU4C 2CWEA 5B31D 2LY8A 3B0CT 5AVBB 1U35A 1P3FA 3KWQA 2HIOC 1P3LC 1KX3C 3WA9B 1M1AD 1B6WA 3O62C 3AV2A 5CPIA 4NE3A 3X1VB 2FJ7C 4JJNA 5GT3B 1HQ3A 2CV5B 1ULYA 3MGQC 3X1UD 1KX4B 3AZGC 1P3OC 3V9RB 3AZIC 5KDMA 3X1TC 1ID3B 3UT9B 4KGCA 5B24D 3AFAA 5GSUD 3MNNB 1AOID 5B32G 1P3IB 5B2IC 3C1BD 2F8ND 4ZBJC 5GT0C 4ZUXC 4J8VB 1P3BD 1P3MD 5F99B 2AROC 2IO5B 5AY8B 4XZQD 5B0ZD 3MVDC 3AZEB 5AV8B 4WZSB 1ZLAB 3KUYC 4G92C 3A1KA 2JSSA 1TZYB 4J8XB 1EQZC 2PYOA 3LZ0C 3EG5B 3LELA 3REKB 3B6GC 3AZNC 5AVBD 4Z5TA 5B2JC 3KXBB 4J8UA 3AZFD 3AV1B 4H9QB 3F6TA 5B32C 5CPKB 3W97C 2RVQD 5AV6C 3WA9D 1P3FB 3X1VD 3MGPA 2Y2OA 3KWQB 4H9NB 2CV5D 1P3AD 3X1SC 1P3KA 3AV2B 1KX4D 4JJNB 4G91B 5B1LA 5G49A 4CSRA 1ID3D 5BO0A 2NZDC 5B33A 3MNND 3UTAD 2Y2IA 5AV9A 3REJA 2ZY4A 4HGAC 1P3PA 4KGCB 3VH6W 3RELA 5BS7C 4H9SC 3EPLA 3REHD 5B40C 1Z2CB 3UTBA 1P34A 3AYWD 1KX5C 5JA4B 2YFWA 3AZED 5AV8D 3AZLB 1M19C 4YM6A 3WAAC 5AVCA 3WTPA 2XD1A 3MGSA 3AN2D 2Y2KA 3B6FB 1TZYD 4J8XD 1KU5A 3WKJD 3C1CA 5CPJB 3W99C 5BT1C 5CP6D 3KXBD 3AV1D 2PYOB 3LELB 5AV5C 4NE6A 4QLCB 5B31C 3A6NA 4J8UB 1U35D 1P3FD 3KFUG 3KWQD 4R8PB 4KUDB 5GT3A 1M1AC 1F1EA 3AV2D 5CPID 5BNXB 3MGPB 4JJND 1HTAA 1HQ3D 2Y2MA 3X1UC 3UT9A 5E5AC 3MGRC 4UUZB 1P3IA 5BO0B 3AFAD 4WV4B 5B24C 4M6BA 5DNNC 5GSUC 1AOIC 4XUJB 4J8VA 2HIOA 1S32B 2G5HC 3REJB 1KX3A 5F99A 5B0YB 5AY8A 2FJ7A 2NQBC 1P3MC 1P34B 5GXQC 3REIB 3MGQA 4XZQC 2YFWB 5B0ZC 4YS3B 3AZHB 1M18B 1JFIA 3AZGA 3W98B 1P3OA 2YFVA 3AZIA 3WTPB 5AVCB 3REKA 1BFMA 2PYOD 5B1MC 3LELD 2FFFB 3C1CB 5B2IA 4Z5TD 4CAYA 4H9QA 4J8WB 4J8UD 3AZFC 5CPKA 3B0DB 4H9NA 3A6NB 4LD9C 1TAFB 1Q9CA 3MGPD 1P3GB 1T3UA 2Y2NA 1P3AC 1P3KD 5DNMB 3KUYA 1BH8B 2HUEC 3LZ0A 5B1LD 3B6GA 3AZNA 3AZMB 5JRGB 5B2JA 5B33D 4AWLB 3AZJD 3UTAC 5AV9D 3REJD 1P3PD 3TU4B 5C3IC 1H3OB 5B32A 5AV6A 1F66C 3W96C 3RELD 5JA4A 1P3LB 2HIOB 1KX3B 3REHC 3UTBD 1P34D 3AZLA 3X1SA 3O62B 3AYWC 2FJ7B 3AZEC 4YM6D 3B6FA 2UWXA 3LJAC 4WU9C 5AVCD 3WTPD 3MGSD 3MGQB 3AN2C 5CPJA 1JFIB 4X23C 3AZGB 2NZDA 1P3OB 2YFVB 3AZIB 3WKJC 3C1CD 3X1TB 1B67A 4NFTA 4QLCA 5CP6C 4H9SA 5B2IB 3VH6T 5B40A 4CAYB 4R8PA 3A6ND 4ZBJB 5GT0B 3AZKC 4ZUXB 1U35C 4H9RA 4KUDA 5BNXA 2AROB 3H0RC 1M19A 2G5IC 5GT3D 4WU8C 3WAAA 5CPIC 3LZ1C 3MVDB 1HQ3C 3KUYB 4G92B 4UUZA 3UT9D 4EO5C 1EQZB 3LZ0B 4Z66C 1P3ID 3B6GB 2DF4C 5B31G 3AZNB 4XUJA 1S32A 3AFAC 2F2AC 5B2JB 5B0YA 4J8VD 2BYMB 2HIOD 1KX3D 5F99D 5B32B 4Z2MG 5AV6B 3W97B 5AY8D 1PZRA 3REIA 2FJ7D 2DQNC 4YS3A 1M18A 3W98A 3AZHA 3X1SB 3A1IA 1ZLAD 3AZGD 5E5AA 1P3OD 3MGRA 3REKD 2NZDB 5DNNA 4J8WA 5B2ID 2F8NG 4UPKA 4E44A 4HGAB 2Y2JA 4Z5TC 2BG1A 5CPKD 1TAFA 2NQBA 1P3GA 5B40B 5GXQA 4H9RB 1A7WA 5DNMA 2VQRA 1M19B 1BH8A 3WAAB 3WTPE 3KUYD 1P3KC 4WJ3C 3AZMA 5B1MA 5JRGA 3LZ0D 3B6GD 5B1LC 3AZND 3W99B 4KGCD 3TU4A 5B2JD 1H3OA 4DRBA 4E45A 5B33C 5AV5B 3AZJC 3AZFA 5AV9C 1P3LA 1P3PC 5B32D 5AV6D 5B31B 2ZM5A 3C1BC 4LD9A 3O62A 3RELC 3KSYA 1P3BC 3UTBC 3X1SD 3AZLD 4DRAA 3B6FD 4YM6C 3MGSC 3X1TA 4H9PB 5CPJD 5BNVB 3X1UB 2NZDD 5E5AB 3VH5T 3MGRB 4QLCD 5B24B 1F66A 5AVBC 3W96A 5GT0A 5DNNB 4ZUXA 5GSUB 1AOIB 5CHLB 5B40D 3REHA 4R8PD 2F8NB 2AROA 3NQUA 4KUDD 3WA9C 2RVQC 2NQBB 1P3MB 3X1VC 3MVDA 1M19D 3WAAD 3LJAA 5GXQB 5GT3C 4NE5A 4WU9A 2CV5C 5FUGA 4XZQB 2ZY3A 5B0ZB 4X23A 2Y2PA 1KX4C 1EQZA 3H0MC 3VH5W 1ID3C 3UT9C 5B1MB 3MNNC 4XUJD 1P3IC 2BYMA 1S32D 3B0BA 3AZKA 5B0YD 3AZFB 3W97A 1N1JA 4J8VC 4Z2MH 5F99C 4WU8A 4LD9B 2Y2HA 3REID 2IO5C 5AY8C 3LZ1A 4YS3D 3AZHD
chains in the Genus database with same CATH topology
3EPHA 5AV8C 1P3AB 1W2EA 2Y2LA 1ZLAC 5E5AD 3MGRD 2HUEB 1TZYC 4Z66A 4J8XC 3REKC 2F8NK 5DNND 4J8WD 3KXBC 3UTAB 3AV1C 2F8NH 5BS7A 3B0CW 5C3IB 1F66B 3W96B 5CPKC 1KX5A 2NQBD 3VH6A 1P3FC 1P3GD 3R45B 3REHB 2JCHA 2JE5A 3KWQC 5GXQD 3NQUB 1R4VA 3AYWB 5DNMD 3AV2C 3LJAB 4JJNC 4WU9B 1WWSA 4G91C 2XD5A 5FUGB 3AN2B 3W99A 4X23B 3AZMD 5B1MD 5JRGD 3WKJB 5AV5A 2Y2QA 3TU4D 4KGCC 5CP6B 5B31A 1P3LD 3AZKB 4LD9D 1U35B 3O62D 1M1AA 1N1JB 2ZY2A 3EPKA 3NQJA 4WU8B 4KHAA 3AZLC 3MGQD 5CPIB 3LZ1B 3AL0C 4H9PA 5BNVA 3X1UA 3B6FC 1HQ3B 3AZID 3X1TD 5CPJC 4EO5B 5B24A 3AZJA 4Z66B 2PYOC 5KDMB 3LELC 5GSUA 1AOIA 3FDDA 3H0LC 3AFAB 4WNNA 3C1BA 1F66D 4QLCC 5GT0D 2F8NA 3W96D 4ZUXD 4J8UC 1M18D 1P3BA 1P3MA 2AROD 4R8PC 4KUDC 1KX5B 4XZQA 5B0ZA 3MVDD 3MGPC 4H9OA 3LJAD 2Y2GA 4WU9D 2BYKA 4X23D 1EQZD 1BH9A 3W98D 5AVBA 4XUJC 3AZKD 1S32C 3REJC 4Z5TB 3W97D 5B0YC 3WA9A 1WWIA 3X1VA 4WU8D 1P34C 2CV5A 3REIC 3LZ1D 1P3AA 1M1AB 2J8PA 3NQJB 4YS3C 1KX4A 1M18C 3AZHC 3W98C 4KHAB 2W8SA 3V9RA 1P3KB 4DQYB 5AVCC 3WTPC 1ID3A 4Z66D 2ZY5A 5G49B 5B1LB 4CSRB 3MNNA 3UTAA 3C1CC 3VH5A 5B33B 3AZJB 4J8WC 3P5JB 5AV9B 1P3PB 3R45A 4WNNB 3C1BB 3B0DC 1KX5D 3A6NC 3RELB 3AYWA 1P3BB 1P3GC 3AZEA 3UTBB 5AV8A 5DNMC 1ZLAA 3AN2A 4H9OB 2RIQA 4YM6B 1TZYA 4J8XA 2BYKB 3WKJA 2L5AA 3MGSB 3W99D 5BT1D 3AZMC 5JRGC 3EPJA 1BH9B 5CP6A 3IP4C 5AV5D 3KXBA 4AWLC 3AV1A 3TU4C 2CWEA 5B31D 2LY8A 3B0CT 5AVBB 1U35A 1P3FA 3KWQA 2HIOC 1P3LC 1KX3C 3WA9B 1M1AD 1B6WA 3O62C 3AV2A 5CPIA 4NE3A 3X1VB 2FJ7C 4JJNA 5GT3B 1HQ3A 2CV5B 1ULYA 3MGQC 3X1UD 1KX4B 3AZGC 1P3OC 3V9RB 3AZIC 5KDMA 3X1TC 1ID3B 3UT9B 4KGCA 5B24D 3AFAA 5GSUD 3MNNB 1AOID 5B32G 1P3IB 5B2IC 3C1BD 2F8ND 4ZBJC 5GT0C 4ZUXC 4J8VB 1P3BD 1P3MD 5F99B 2AROC 2IO5B 5AY8B 4XZQD 5B0ZD 3MVDC 3AZEB 5AV8B 4WZSB 1ZLAB 3KUYC 4G92C 3A1KA 2JSSA 1TZYB 4J8XB 1EQZC 2PYOA 3LZ0C 3EG5B 3LELA 3REKB 3B6GC 3AZNC 5AVBD 4Z5TA 5B2JC 3KXBB 4J8UA 3AZFD 3AV1B 4H9QB 3F6TA 5B32C 5CPKB 3W97C 2RVQD 5AV6C 3WA9D 1P3FB 3X1VD 3MGPA 2Y2OA 3KWQB 4H9NB 2CV5D 1P3AD 3X1SC 1P3KA 3AV2B 1KX4D 4JJNB 4G91B 5B1LA 5G49A 4CSRA 1ID3D 5BO0A 2NZDC 5B33A 3MNND 3UTAD 2Y2IA 5AV9A 3REJA 2ZY4A 4HGAC 1P3PA 4KGCB 3VH6W 3RELA 5BS7C 4H9SC 3EPLA 3REHD 5B40C 1Z2CB 3UTBA 1P34A 3AYWD 1KX5C 5JA4B 2YFWA 3AZED 5AV8D 3AZLB 1M19C 4YM6A 3WAAC 5AVCA 3WTPA 2XD1A 3MGSA 3AN2D 2Y2KA 3B6FB 1TZYD 4J8XD 1KU5A 3WKJD 3C1CA 5CPJB 3W99C 5BT1C 5CP6D 3KXBD 3AV1D 2PYOB 3LELB 5AV5C 4NE6A 4QLCB 5B31C 3A6NA 4J8UB 1U35D 1P3FD 3KFUG 3KWQD 4R8PB 4KUDB 5GT3A 1M1AC 1F1EA 3AV2D 5CPID 5BNXB 3MGPB 4JJND 1HTAA 1HQ3D 2Y2MA 3X1UC 3UT9A 5E5AC 3MGRC 4UUZB 1P3IA 5BO0B 3AFAD 4WV4B 5B24C 4M6BA 5DNNC 5GSUC 1AOIC 4XUJB 4J8VA 2HIOA 1S32B 2G5HC 3REJB 1KX3A 5F99A 5B0YB 5AY8A 2FJ7A 2NQBC 1P3MC 1P34B 5GXQC 3REIB 3MGQA 4XZQC 2YFWB 5B0ZC 4YS3B 3AZHB 1M18B 1JFIA 3AZGA 3W98B 1P3OA 2YFVA 3AZIA 3WTPB 5AVCB 3REKA 1BFMA 2PYOD 5B1MC 3LELD 2FFFB 3C1CB 5B2IA 4Z5TD 4CAYA 4H9QA 4J8WB 4J8UD 3AZFC 5CPKA 3B0DB 4H9NA 3A6NB 4LD9C 1TAFB 1Q9CA 3MGPD 1P3GB 1T3UA 2Y2NA 1P3AC 1P3KD 5DNMB 3KUYA 1BH8B 2HUEC 3LZ0A 5B1LD 3B6GA 3AZNA 3AZMB 5JRGB 5B2JA 5B33D 4AWLB 3AZJD 3UTAC 5AV9D 3REJD 1P3PD 3TU4B 5C3IC 1H3OB 5B32A 5AV6A 1F66C 3W96C 3RELD 5JA4A 1P3LB 2HIOB 1KX3B 3REHC 3UTBD 1P34D 3AZLA 3X1SA 3O62B 3AYWC 2FJ7B 3AZEC 4YM6D 3B6FA 2UWXA 3LJAC 4WU9C 5AVCD 3WTPD 3MGSD 3MGQB 3AN2C 5CPJA 1JFIB 4X23C 3AZGB 2NZDA 1P3OB 2YFVB 3AZIB 3WKJC 3C1CD 3X1TB 1B67A 4NFTA 4QLCA 5CP6C 4H9SA 5B2IB 3VH6T 5B40A 4CAYB 4R8PA 3A6ND 4ZBJB 5GT0B 3AZKC 4ZUXB 1U35C 4H9RA 4KUDA 5BNXA 2AROB 3H0RC 1M19A 2G5IC 5GT3D 4WU8C 3WAAA 5CPIC 3LZ1C 3MVDB 1HQ3C 3KUYB 4G92B 4UUZA 3UT9D 4EO5C 1EQZB 3LZ0B 4Z66C 1P3ID 3B6GB 2DF4C 5B31G 3AZNB 4XUJA 1S32A 3AFAC 2F2AC 5B2JB 5B0YA 4J8VD 2BYMB 2HIOD 1KX3D 5F99D 5B32B 4Z2MG 5AV6B 3W97B 5AY8D 1PZRA 3REIA 2FJ7D 2DQNC 4YS3A 1M18A 3W98A 3AZHA 3X1SB 3A1IA 1ZLAD 3AZGD 5E5AA 1P3OD 3MGRA 3REKD 2NZDB 5DNNA 4J8WA 5B2ID 2F8NG 4UPKA 4E44A 4HGAB 2Y2JA 4Z5TC 2BG1A 5CPKD 1TAFA 2NQBA 1P3GA 5B40B 5GXQA 4H9RB 1A7WA 5DNMA 2VQRA 1M19B 1BH8A 3WAAB 3WTPE 3KUYD 1P3KC 4WJ3C 3AZMA 5B1MA 5JRGA 3LZ0D 3B6GD 5B1LC 3AZND 3W99B 4KGCD 3TU4A 5B2JD 1H3OA 4DRBA 4E45A 5B33C 5AV5B 3AZJC 3AZFA 5AV9C 1P3LA 1P3PC 5B32D 5AV6D 5B31B 2ZM5A 3C1BC 4LD9A 3O62A 3RELC 3KSYA 1P3BC 3UTBC 3X1SD 3AZLD 4DRAA 3B6FD 4YM6C 3MGSC 3X1TA 4H9PB 5CPJD 5BNVB 3X1UB 2NZDD 5E5AB 3VH5T 3MGRB 4QLCD 5B24B 1F66A 5AVBC 3W96A 5GT0A 5DNNB 4ZUXA 5GSUB 1AOIB 5CHLB 5B40D 3REHA 4R8PD 2F8NB 2AROA 3NQUA 4KUDD 3WA9C 2RVQC 2NQBB 1P3MB 3X1VC 3MVDA 1M19D 3WAAD 3LJAA 5GXQB 5GT3C 4NE5A 4WU9A 2CV5C 5FUGA 4XZQB 2ZY3A 5B0ZB 4X23A 2Y2PA 1KX4C 1EQZA 3H0MC 3VH5W 1ID3C 3UT9C 5B1MB 3MNNC 4XUJD 1P3IC 2BYMA 1S32D 3B0BA 3AZKA 5B0YD 3AZFB 3W97A 1N1JA 4J8VC 4Z2MH 5F99C 4WU8A 4LD9B 2Y2HA 3REID 2IO5C 5AY8C 3LZ1A 4YS3D 3AZHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV8 C;  1P3A B;  1ZLA C;  5E5A D;  3MGR D;  2HUE B;  1TZY C;  4Z66 A;  4J8X C;  3REK C;  2F8N K;  5DNN D;  4J8W D;  3KXB C;  3UTA B;  3AV1 C;  2F8N H;  5BS7 A;  3B0C W;  5C3I B;  1F66 B;  3W96 B;  5CPK C;  1KX5 A;  2NQB D;  3VH6 A;  1P3F C;  1P3G D;  3R45 B;  3REH B;  3KWQ C;  5GXQ D;  3NQU B;  1R4V A;  3AYW B;  5DNM D;  3AV2 C;  3LJA B;  4JJN C;  4WU9 B;  4G91 C;  1WWS A;  5FUG B;  3AN2 B;  3W99 A;  4X23 B;  3AZM D;  5B1M D;  5JRG D;  3WKJ B;  5AV5 A;  3TU4 D;  4KGC C;  5CP6 B;  5B31 A;  1P3L D;  3AZK B;  4LD9 D;  1U35 B;  3O62 D;  1M1A A;  1N1J B;  3NQJ A;  4WU8 B;  4KHA A;  3AZL C;  3MGQ D;  5CPI B;  3LZ1 B;  4H9P A;  5BNV A;  3X1U A;  3B6F C;  1HQ3 B;  3AZI D;  3X1T D;  5CPJ C;  4EO5 B;  5B24 A;  3AZJ A;  4Z66 B;  2PYO C;  5KDM B;  3LEL C;  5GSU A;  1AOI A;  3AFA B;  4WNN A;  3C1B A;  1F66 D;  4QLC C;  5GT0 D;  2F8N A;  3W96 D;  4ZUX D;  4J8U C;  1M18 D;  1P3B A;  1P3M A;  2ARO D;  4R8P C;  4KUD C;  1KX5 B;  4XZQ A;  5B0Z A;  3MVD D;  3MGP C;  4H9O A;  3LJA D;  4WU9 D;  2BYK A;  4X23 D;  1EQZ D;  1BH9 A;  3W98 D;  5AVB A;  4XUJ C;  3AZK D;  1S32 C;  3REJ C;  4Z5T B;  3W97 D;  5B0Y C;  3WA9 A;  1WWI A;  3X1V A;  4WU8 D;  1P34 C;  2CV5 A;  3REI C;  3LZ1 D;  1P3A A;  1M1A B;  3NQJ B;  4YS3 C;  1M18 C;  1KX4 A;  3W98 C;  3AZH C;  4KHA B;  3V9R A;  1P3K B;  3WTP C;  5AVC C;  1ID3 A;  4Z66 D;  5B1L B;  5G49 B;  3MNN A;  4CSR B;  3UTA A;  3C1C C;  3VH5 A;  5B33 B;  3AZJ B;  4J8W C;  5AV9 B;  1P3P B;  3R45 A;  4WNN B;  3C1B B;  3B0D C;  1KX5 D;  3A6N C;  3REL B;  3AYW A;  1P3B B;  1P3G C;  3AZE A;  3UTB B;  5AV8 A;  5DNM C;  1ZLA A;  3AN2 A;  4H9O B;  4YM6 B;  1TZY A;  4J8X A;  2BYK B;  3WKJ A;  2L5A A;  3MGS B;  3W99 D;  5BT1 D;  3AZM C;  5JRG C;  1BH9 B;  5CP6 A;  5AV5 D;  3KXB A;  4AWL C;  3AV1 A;  3TU4 C;  2CWE A;  5B31 D;  2LY8 A;  3B0C T;  5AVB B;  1U35 A;  1P3F A;  3KWQ A;  2HIO C;  1P3L C;  1KX3 C;  3WA9 B;  1M1A D;  1B6W A;  3O62 C;  3AV2 A;  5CPI A;  4NE3 A;  3X1V B;  2FJ7 C;  4JJN A;  5GT3 B;  1HQ3 A;  2CV5 B;  1ULY A;  3MGQ C;  3X1U D;  1KX4 B;  3AZG C;  1P3O C;  3V9R B;  3AZI C;  5KDM A;  3X1T C;  1ID3 B;  3UT9 B;  4KGC A;  5B24 D;  3AFA A;  5GSU D;  3MNN B;  1AOI D;  5B32 G;  1P3I B;  5B2I C;  3C1B D;  2F8N D;  4ZBJ C;  5GT0 C;  4ZUX C;  4J8V B;  1P3B D;  1P3M D;  5F99 B;  2ARO C;  2IO5 B;  5AY8 B;  4XZQ D;  5B0Z D;  3MVD C;  3AZE B;  5AV8 B;  4WZS B;  1ZLA B;  3KUY C;  4G92 C;  2JSS A;  1TZY B;  4J8X B;  1EQZ C;  2PYO A;  3LZ0 C;  3LEL A;  3REK B;  3B6G C;  3AZN C;  5AVB D;  4Z5T A;  5B2J C;  3KXB B;  4J8U A;  3AZF D;  3AV1 B;  4H9Q B;  3WA9 D;  5B32 C;  5CPK B;  3W97 C;  2RVQ D;  5AV6 C;  1P3F B;  3X1V D;  3MGP A;  3KWQ B;  4H9N B;  2CV5 D;  1P3A D;  3X1S C;  1P3K A;  3AV2 B;  1KX4 D;  4JJN B;  4G91 B;  5B1L A;  5G49 A;  4CSR A;  1ID3 D;  5BO0 A;  2NZD C;  5B33 A;  3MNN D;  3UTA D;  5AV9 A;  3REJ A;  1P3P A;  4HGA C;  4KGC B;  3VH6 W;  3REL A;  5BS7 C;  4H9S C;  3REH D;  5B40 C;  3UTB A;  1P34 A;  3AYW D;  1KX5 C;  5JA4 B;  2YFW A;  3AZE D;  5AV8 D;  3AZL B;  1M19 C;  4YM6 A;  3WAA C;  5AVC A;  3WTP A;  3MGS A;  3AN2 D;  3B6F B;  1TZY D;  4J8X D;  1KU5 A;  3WKJ D;  3C1C A;  5CPJ B;  3W99 C;  5BT1 C;  5CP6 D;  3KXB D;  3AV1 D;  2PYO B;  3LEL B;  5AV5 C;  4NE6 A;  4QLC B;  5B31 C;  3A6N A;  4J8U B;  1U35 D;  1P3F D;  3KWQ D;  4R8P B;  4KUD B;  5GT3 A;  1M1A C;  1F1E A;  3AV2 D;  5CPI D;  5BNX B;  3MGP B;  4JJN D;  1HTA A;  1HQ3 D;  3X1U C;  3UT9 A;  5E5A C;  3MGR C;  4UUZ B;  1P3I A;  5BO0 B;  3AFA D;  4WV4 B;  5B24 C;  4M6B A;  5DNN C;  5GSU C;  1AOI C;  4XUJ B;  4J8V A;  2HIO A;  1S32 B;  3REJ B;  1KX3 A;  5F99 A;  5B0Y B;  5AY8 A;  2FJ7 A;  2NQB C;  1P3M C;  1P34 B;  5GXQ C;  3REI B;  3MGQ A;  4XZQ C;  2YFW B;  5B0Z C;  4YS3 B;  3AZH B;  1M18 B;  1JFI A;  3AZG A;  3W98 B;  1P3O A;  2YFV A;  3AZI A;  3WTP B;  5AVC B;  3REK A;  1BFM A;  2PYO D;  5B1M C;  3LEL D;  3C1C B;  5B2I A;  4Z5T D;  4CAY A;  4H9Q A;  4J8W B;  4J8U D;  3AZF C;  5CPK A;  3B0D B;  4H9N A;  3A6N B;  4LD9 C;  1TAF B;  1Q9C A;  3MGP D;  1P3G B;  1P3A C;  1P3K D;  5DNM B;  3KUY A;  1BH8 B;  2HUE C;  3LZ0 A;  5B1L D;  3B6G A;  3AZN A;  3AZM B;  5JRG B;  5B2J A;  5B33 D;  4AWL B;  3AZJ D;  3UTA C;  5AV9 D;  3REJ D;  1P3P D;  3TU4 B;  5C3I C;  1H3O B;  5B32 A;  5AV6 A;  1F66 C;  3W96 C;  3REL D;  5JA4 A;  1P3L B;  2HIO B;  1KX3 B;  3REH C;  3UTB D;  1P34 D;  3AZL A;  3X1S A;  3O62 B;  3AYW C;  2FJ7 B;  3AZE C;  4YM6 D;  3B6F A;  3LJA C;  4WU9 C;  5AVC D;  3WTP D;  3MGS D;  3MGQ B;  3AN2 C;  5CPJ A;  1JFI B;  4X23 C;  3AZG B;  2NZD A;  1P3O B;  2YFV B;  3AZI B;  3WKJ C;  3C1C D;  3X1T B;  1B67 A;  4NFT A;  4QLC A;  5CP6 C;  4H9S A;  5B2I B;  3VH6 T;  5B40 A;  4CAY B;  4R8P A;  3A6N D;  4ZBJ B;  5GT0 B;  3AZK C;  4ZUX B;  1U35 C;  4H9R A;  4KUD A;  5BNX A;  2ARO B;  1M19 A;  5GT3 D;  3WAA A;  4WU8 C;  5CPI C;  3LZ1 C;  3MVD B;  1HQ3 C;  3KUY B;  4G92 B;  4UUZ A;  3UT9 D;  4EO5 C;  1EQZ B;  3LZ0 B;  4Z66 C;  1P3I D;  3B6G B;  5B31 G;  3AZN B;  4XUJ A;  1S32 A;  3AFA C;  5B2J B;  5B0Y A;  4J8V D;  2BYM B;  2HIO D;  1KX3 D;  5F99 D;  5B32 B;  4Z2M G;  5AV6 B;  3W97 B;  5AY8 D;  3REI A;  2FJ7 D;  4YS3 A;  1M18 A;  3W98 A;  3AZH A;  3X1S B;  1ZLA D;  3AZG D;  5E5A A;  1P3O D;  3MGR A;  3REK D;  2NZD B;  5DNN A;  4J8W A;  5B2I D;  2F8N G;  4E44 A;  4HGA B;  4Z5T C;  5CPK D;  1TAF A;  2NQB A;  1P3G A;  5B40 B;  5GXQ A;  4H9R B;  1A7W A;  5DNM A;  1M19 B;  1BH8 A;  3WAA B;  3WTP E;  3KUY D;  1P3K C;  3AZM A;  5B1M A;  5JRG A;  3LZ0 D;  3B6G D;  5B1L C;  3AZN D;  3W99 B;  4KGC D;  3TU4 A;  5B2J D;  1H3O A;  4DRB A;  4E45 A;  5B33 C;  5AV5 B;  3AZJ C;  3AZF A;  5AV9 C;  1P3L A;  1P3P C;  5B32 D;  5AV6 D;  5B31 B;  3C1B C;  4LD9 A;  3O62 A;  3REL C;  3KSY A;  1P3B C;  3UTB C;  3X1S D;  3AZL D;  4DRA A;  3B6F D;  4YM6 C;  3MGS C;  3X1T A;  4H9P B;  5CPJ D;  5BNV B;  3X1U B;  2NZD D;  5E5A B;  3VH5 T;  3MGR B;  4QLC D;  5B24 B;  1F66 A;  5AVB C;  3W96 A;  5GT0 A;  5DNN B;  4ZUX A;  5GSU B;  1AOI B;  5CHL B;  5B40 D;  3REH A;  4R8P D;  2F8N B;  2ARO A;  3NQU A;  4KUD D;  3WA9 C;  2RVQ C;  2NQB B;  1P3M B;  3X1V C;  3MVD A;  1M19 D;  3WAA D;  3LJA A;  5GXQ B;  5GT3 C;  4NE5 A;  4WU9 A;  2CV5 C;  5FUG A;  4XZQ B;  5B0Z B;  4X23 A;  1KX4 C;  1EQZ A;  3VH5 W;  1ID3 C;  3UT9 C;  5B1M B;  3MNN C;  4XUJ D;  1P3I C;  2BYM A;  1S32 D;  3B0B A;  3AZK A;  5B0Y D;  3AZF B;  3W97 A;  1N1J A;  4J8V C;  4Z2M H;  5F99 C;  4WU8 A;  4LD9 B;  3REI D;  2IO5 C;  5AY8 C;  3LZ1 A;  4YS3 D;  3AZH D; 
#chains in the Genus database with same CATH topology
 3EPH A;  5AV8 C;  1P3A B;  1W2E A;  2Y2L A;  1ZLA C;  5E5A D;  3MGR D;  2HUE B;  1TZY C;  4Z66 A;  4J8X C;  3REK C;  2F8N K;  5DNN D;  4J8W D;  3KXB C;  3UTA B;  3AV1 C;  2F8N H;  5BS7 A;  3B0C W;  5C3I B;  1F66 B;  3W96 B;  5CPK C;  1KX5 A;  2NQB D;  3VH6 A;  1P3F C;  1P3G D;  3R45 B;  3REH B;  2JCH A;  2JE5 A;  3KWQ C;  5GXQ D;  3NQU B;  1R4V A;  3AYW B;  5DNM D;  3AV2 C;  3LJA B;  4JJN C;  4WU9 B;  1WWS A;  4G91 C;  2XD5 A;  5FUG B;  3AN2 B;  3W99 A;  4X23 B;  3AZM D;  5B1M D;  5JRG D;  3WKJ B;  5AV5 A;  2Y2Q A;  3TU4 D;  4KGC C;  5CP6 B;  5B31 A;  1P3L D;  3AZK B;  4LD9 D;  1U35 B;  3O62 D;  1M1A A;  1N1J B;  2ZY2 A;  3EPK A;  3NQJ A;  4WU8 B;  4KHA A;  3AZL C;  3MGQ D;  5CPI B;  3LZ1 B;  3AL0 C;  4H9P A;  5BNV A;  3X1U A;  3B6F C;  1HQ3 B;  3AZI D;  3X1T D;  5CPJ C;  4EO5 B;  5B24 A;  3AZJ A;  4Z66 B;  2PYO C;  5KDM B;  3LEL C;  5GSU A;  1AOI A;  3FDD A;  3H0L C;  3AFA B;  4WNN A;  3C1B A;  1F66 D;  4QLC C;  5GT0 D;  2F8N A;  3W96 D;  4ZUX D;  4J8U C;  1M18 D;  1P3B A;  1P3M A;  2ARO D;  4R8P C;  4KUD C;  1KX5 B;  4XZQ A;  5B0Z A;  3MVD D;  3MGP C;  4H9O A;  3LJA D;  2Y2G A;  4WU9 D;  2BYK A;  4X23 D;  1EQZ D;  1BH9 A;  3W98 D;  5AVB A;  4XUJ C;  3AZK D;  1S32 C;  3REJ C;  4Z5T B;  3W97 D;  5B0Y C;  3WA9 A;  1WWI A;  3X1V A;  4WU8 D;  1P34 C;  2CV5 A;  3REI C;  3LZ1 D;  1P3A A;  1M1A B;  2J8P A;  3NQJ B;  4YS3 C;  1KX4 A;  1M18 C;  3AZH C;  3W98 C;  4KHA B;  2W8S A;  3V9R A;  1P3K B;  4DQY B;  5AVC C;  3WTP C;  1ID3 A;  4Z66 D;  2ZY5 A;  5G49 B;  5B1L B;  4CSR B;  3MNN A;  3UTA A;  3C1C C;  3VH5 A;  5B33 B;  3AZJ B;  4J8W C;  3P5J B;  5AV9 B;  1P3P B;  3R45 A;  4WNN B;  3C1B B;  3B0D C;  1KX5 D;  3A6N C;  3REL B;  3AYW A;  1P3B B;  1P3G C;  3AZE A;  3UTB B;  5AV8 A;  5DNM C;  1ZLA A;  3AN2 A;  4H9O B;  2RIQ A;  4YM6 B;  1TZY A;  4J8X A;  2BYK B;  3WKJ A;  2L5A A;  3MGS B;  3W99 D;  5BT1 D;  3AZM C;  5JRG C;  3EPJ A;  1BH9 B;  5CP6 A;  3IP4 C;  5AV5 D;  3KXB A;  4AWL C;  3AV1 A;  3TU4 C;  2CWE A;  5B31 D;  2LY8 A;  3B0C T;  5AVB B;  1U35 A;  1P3F A;  3KWQ A;  2HIO C;  1P3L C;  1KX3 C;  3WA9 B;  1M1A D;  1B6W A;  3O62 C;  3AV2 A;  5CPI A;  4NE3 A;  3X1V B;  2FJ7 C;  4JJN A;  5GT3 B;  1HQ3 A;  2CV5 B;  1ULY A;  3MGQ C;  3X1U D;  1KX4 B;  3AZG C;  1P3O C;  3V9R B;  3AZI C;  5KDM A;  3X1T C;  1ID3 B;  3UT9 B;  4KGC A;  5B24 D;  3AFA A;  5GSU D;  3MNN B;  1AOI D;  5B32 G;  1P3I B;  5B2I C;  3C1B D;  2F8N D;  4ZBJ C;  5GT0 C;  4ZUX C;  4J8V B;  1P3B D;  1P3M D;  5F99 B;  2ARO C;  2IO5 B;  5AY8 B;  4XZQ D;  5B0Z D;  3MVD C;  3AZE B;  5AV8 B;  4WZS B;  1ZLA B;  3KUY C;  4G92 C;  3A1K A;  2JSS A;  1TZY B;  4J8X B;  1EQZ C;  2PYO A;  3LZ0 C;  3EG5 B;  3LEL A;  3REK B;  3B6G C;  3AZN C;  5AVB D;  4Z5T A;  5B2J C;  3KXB B;  4J8U A;  3AZF D;  3AV1 B;  4H9Q B;  3F6T A;  5B32 C;  5CPK B;  3W97 C;  2RVQ D;  5AV6 C;  3WA9 D;  1P3F B;  3X1V D;  3MGP A;  2Y2O A;  3KWQ B;  4H9N B;  2CV5 D;  1P3A D;  3X1S C;  1P3K A;  3AV2 B;  1KX4 D;  4JJN B;  4G91 B;  5B1L A;  5G49 A;  4CSR A;  1ID3 D;  5BO0 A;  2NZD C;  5B33 A;  3MNN D;  3UTA D;  2Y2I A;  5AV9 A;  3REJ A;  2ZY4 A;  4HGA C;  1P3P A;  4KGC B;  3VH6 W;  3REL A;  5BS7 C;  4H9S C;  3EPL A;  3REH D;  5B40 C;  1Z2C B;  3UTB A;  1P34 A;  3AYW D;  1KX5 C;  5JA4 B;  2YFW A;  3AZE D;  5AV8 D;  3AZL B;  1M19 C;  4YM6 A;  3WAA C;  5AVC A;  3WTP A;  2XD1 A;  3MGS A;  3AN2 D;  2Y2K A;  3B6F B;  1TZY D;  4J8X D;  1KU5 A;  3WKJ D;  3C1C A;  5CPJ B;  3W99 C;  5BT1 C;  5CP6 D;  3KXB D;  3AV1 D;  2PYO B;  3LEL B;  5AV5 C;  4NE6 A;  4QLC B;  5B31 C;  3A6N A;  4J8U B;  1U35 D;  1P3F D;  3KFU G;  3KWQ D;  4R8P B;  4KUD B;  5GT3 A;  1M1A C;  1F1E A;  3AV2 D;  5CPI D;  5BNX B;  3MGP B;  4JJN D;  1HTA A;  1HQ3 D;  2Y2M A;  3X1U C;  3UT9 A;  5E5A C;  3MGR C;  4UUZ B;  1P3I A;  5BO0 B;  3AFA D;  4WV4 B;  5B24 C;  4M6B A;  5DNN C;  5GSU C;  1AOI C;  4XUJ B;  4J8V A;  2HIO A;  1S32 B;  2G5H C;  3REJ B;  1KX3 A;  5F99 A;  5B0Y B;  5AY8 A;  2FJ7 A;  2NQB C;  1P3M C;  1P34 B;  5GXQ C;  3REI B;  3MGQ A;  4XZQ C;  2YFW B;  5B0Z C;  4YS3 B;  3AZH B;  1M18 B;  1JFI A;  3AZG A;  3W98 B;  1P3O A;  2YFV A;  3AZI A;  3WTP B;  5AVC B;  3REK A;  1BFM A;  2PYO D;  5B1M C;  3LEL D;  2FFF B;  3C1C B;  5B2I A;  4Z5T D;  4CAY A;  4H9Q A;  4J8W B;  4J8U D;  3AZF C;  5CPK A;  3B0D B;  4H9N A;  3A6N B;  4LD9 C;  1TAF B;  1Q9C A;  3MGP D;  1P3G B;  1T3U A;  2Y2N A;  1P3A C;  1P3K D;  5DNM B;  3KUY A;  1BH8 B;  2HUE C;  3LZ0 A;  5B1L D;  3B6G A;  3AZN A;  3AZM B;  5JRG B;  5B2J A;  5B33 D;  4AWL B;  3AZJ D;  3UTA C;  5AV9 D;  3REJ D;  1P3P D;  3TU4 B;  5C3I C;  1H3O B;  5B32 A;  5AV6 A;  1F66 C;  3W96 C;  3REL D;  5JA4 A;  1P3L B;  2HIO B;  1KX3 B;  3REH C;  3UTB D;  1P34 D;  3AZL A;  3X1S A;  3O62 B;  3AYW C;  2FJ7 B;  3AZE C;  4YM6 D;  3B6F A;  2UWX A;  3LJA C;  4WU9 C;  5AVC D;  3WTP D;  3MGS D;  3MGQ B;  3AN2 C;  5CPJ A;  1JFI B;  4X23 C;  3AZG B;  2NZD A;  1P3O B;  2YFV B;  3AZI B;  3WKJ C;  3C1C D;  3X1T B;  1B67 A;  4NFT A;  4QLC A;  5CP6 C;  4H9S A;  5B2I B;  3VH6 T;  5B40 A;  4CAY B;  4R8P A;  3A6N D;  4ZBJ B;  5GT0 B;  3AZK C;  4ZUX B;  1U35 C;  4H9R A;  4KUD A;  5BNX A;  2ARO B;  3H0R C;  1M19 A;  2G5I C;  5GT3 D;  4WU8 C;  3WAA A;  5CPI C;  3LZ1 C;  3MVD B;  1HQ3 C;  3KUY B;  4G92 B;  4UUZ A;  3UT9 D;  4EO5 C;  1EQZ B;  3LZ0 B;  4Z66 C;  1P3I D;  3B6G B;  2DF4 C;  5B31 G;  3AZN B;  4XUJ A;  1S32 A;  3AFA C;  2F2A C;  5B2J B;  5B0Y A;  4J8V D;  2BYM B;  2HIO D;  1KX3 D;  5F99 D;  5B32 B;  4Z2M G;  5AV6 B;  3W97 B;  5AY8 D;  1PZR A;  3REI A;  2FJ7 D;  2DQN C;  4YS3 A;  1M18 A;  3W98 A;  3AZH A;  3X1S B;  3A1I A;  1ZLA D;  3AZG D;  5E5A A;  1P3O D;  3MGR A;  3REK D;  2NZD B;  5DNN A;  4J8W A;  5B2I D;  2F8N G;  4UPK A;  4E44 A;  4HGA B;  2Y2J A;  4Z5T C;  2BG1 A;  5CPK D;  1TAF A;  2NQB A;  1P3G A;  5B40 B;  5GXQ A;  4H9R B;  1A7W A;  5DNM A;  2VQR A;  1M19 B;  1BH8 A;  3WAA B;  3WTP E;  3KUY D;  1P3K C;  4WJ3 C;  3AZM A;  5B1M A;  5JRG A;  3LZ0 D;  3B6G D;  5B1L C;  3AZN D;  3W99 B;  4KGC D;  3TU4 A;  5B2J D;  1H3O A;  4DRB A;  4E45 A;  5B33 C;  5AV5 B;  3AZJ C;  3AZF A;  5AV9 C;  1P3L A;  1P3P C;  5B32 D;  5AV6 D;  5B31 B;  2ZM5 A;  3C1B C;  4LD9 A;  3O62 A;  3REL C;  3KSY A;  1P3B C;  3UTB C;  3X1S D;  3AZL D;  4DRA A;  3B6F D;  4YM6 C;  3MGS C;  3X1T A;  4H9P B;  5CPJ D;  5BNV B;  3X1U B;  2NZD D;  5E5A B;  3VH5 T;  3MGR B;  4QLC D;  5B24 B;  1F66 A;  5AVB C;  3W96 A;  5GT0 A;  5DNN B;  4ZUX A;  5GSU B;  1AOI B;  5CHL B;  5B40 D;  3REH A;  4R8P D;  2F8N B;  2ARO A;  3NQU A;  4KUD D;  3WA9 C;  2RVQ C;  2NQB B;  1P3M B;  3X1V C;  3MVD A;  1M19 D;  3WAA D;  3LJA A;  5GXQ B;  5GT3 C;  4NE5 A;  4WU9 A;  2CV5 C;  5FUG A;  4XZQ B;  2ZY3 A;  5B0Z B;  4X23 A;  2Y2P A;  1KX4 C;  1EQZ A;  3H0M C;  3VH5 W;  1ID3 C;  3UT9 C;  5B1M B;  3MNN C;  4XUJ D;  1P3I C;  2BYM A;  1S32 D;  3B0B A;  3AZK A;  5B0Y D;  3AZF B;  3W97 A;  1N1J A;  4J8V C;  4Z2M H;  5F99 C;  4WU8 A;  4LD9 B;  2Y2H A;  3REI D;  2IO5 C;  5AY8 C;  3LZ1 A;  4YS3 D;  3AZH D; 
#chains in the Genus database with same CATH homology
 3EPH A;  5AV8 C;  1P3A B;  1W2E A;  2Y2L A;  1ZLA C;  5E5A D;  3MGR D;  2HUE B;  1TZY C;  4Z66 A;  4J8X C;  3REK C;  2F8N K;  5DNN D;  4J8W D;  3KXB C;  3UTA B;  3AV1 C;  2F8N H;  5BS7 A;  3B0C W;  5C3I B;  1F66 B;  3W96 B;  5CPK C;  1KX5 A;  2NQB D;  3VH6 A;  1P3F C;  1P3G D;  3R45 B;  3REH B;  2JCH A;  2JE5 A;  3KWQ C;  5GXQ D;  3NQU B;  1R4V A;  3AYW B;  5DNM D;  3AV2 C;  3LJA B;  4JJN C;  4WU9 B;  1WWS A;  4G91 C;  2XD5 A;  5FUG B;  3AN2 B;  3W99 A;  4X23 B;  3AZM D;  5B1M D;  5JRG D;  3WKJ B;  5AV5 A;  2Y2Q A;  3TU4 D;  4KGC C;  5CP6 B;  5B31 A;  1P3L D;  3AZK B;  4LD9 D;  1U35 B;  3O62 D;  1M1A A;  1N1J B;  2ZY2 A;  3EPK A;  3NQJ A;  4WU8 B;  4KHA A;  3AZL C;  3MGQ D;  5CPI B;  3LZ1 B;  3AL0 C;  4H9P A;  5BNV A;  3X1U A;  3B6F C;  1HQ3 B;  3AZI D;  3X1T D;  5CPJ C;  4EO5 B;  5B24 A;  3AZJ A;  4Z66 B;  2PYO C;  5KDM B;  3LEL C;  5GSU A;  1AOI A;  3FDD A;  3H0L C;  3AFA B;  4WNN A;  3C1B A;  1F66 D;  4QLC C;  5GT0 D;  2F8N A;  3W96 D;  4ZUX D;  4J8U C;  1M18 D;  1P3B A;  1P3M A;  2ARO D;  4R8P C;  4KUD C;  1KX5 B;  4XZQ A;  5B0Z A;  3MVD D;  3MGP C;  4H9O A;  3LJA D;  2Y2G A;  4WU9 D;  2BYK A;  4X23 D;  1EQZ D;  1BH9 A;  3W98 D;  5AVB A;  4XUJ C;  3AZK D;  1S32 C;  3REJ C;  4Z5T B;  3W97 D;  5B0Y C;  3WA9 A;  1WWI A;  3X1V A;  4WU8 D;  1P34 C;  2CV5 A;  3REI C;  3LZ1 D;  1P3A A;  1M1A B;  2J8P A;  3NQJ B;  4YS3 C;  1KX4 A;  1M18 C;  3AZH C;  3W98 C;  4KHA B;  2W8S A;  3V9R A;  1P3K B;  4DQY B;  5AVC C;  3WTP C;  1ID3 A;  4Z66 D;  2ZY5 A;  5G49 B;  5B1L B;  4CSR B;  3MNN A;  3UTA A;  3C1C C;  3VH5 A;  5B33 B;  3AZJ B;  4J8W C;  3P5J B;  5AV9 B;  1P3P B;  3R45 A;  4WNN B;  3C1B B;  3B0D C;  1KX5 D;  3A6N C;  3REL B;  3AYW A;  1P3B B;  1P3G C;  3AZE A;  3UTB B;  5AV8 A;  5DNM C;  1ZLA A;  3AN2 A;  4H9O B;  2RIQ A;  4YM6 B;  1TZY A;  4J8X A;  2BYK B;  3WKJ A;  2L5A A;  3MGS B;  3W99 D;  5BT1 D;  3AZM C;  5JRG C;  3EPJ A;  1BH9 B;  5CP6 A;  3IP4 C;  5AV5 D;  3KXB A;  4AWL C;  3AV1 A;  3TU4 C;  2CWE A;  5B31 D;  2LY8 A;  3B0C T;  5AVB B;  1U35 A;  1P3F A;  3KWQ A;  2HIO C;  1P3L C;  1KX3 C;  3WA9 B;  1M1A D;  1B6W A;  3O62 C;  3AV2 A;  5CPI A;  4NE3 A;  3X1V B;  2FJ7 C;  4JJN A;  5GT3 B;  1HQ3 A;  2CV5 B;  1ULY A;  3MGQ C;  3X1U D;  1KX4 B;  3AZG C;  1P3O C;  3V9R B;  3AZI C;  5KDM A;  3X1T C;  1ID3 B;  3UT9 B;  4KGC A;  5B24 D;  3AFA A;  5GSU D;  3MNN B;  1AOI D;  5B32 G;  1P3I B;  5B2I C;  3C1B D;  2F8N D;  4ZBJ C;  5GT0 C;  4ZUX C;  4J8V B;  1P3B D;  1P3M D;  5F99 B;  2ARO C;  2IO5 B;  5AY8 B;  4XZQ D;  5B0Z D;  3MVD C;  3AZE B;  5AV8 B;  4WZS B;  1ZLA B;  3KUY C;  4G92 C;  3A1K A;  2JSS A;  1TZY B;  4J8X B;  1EQZ C;  2PYO A;  3LZ0 C;  3EG5 B;  3LEL A;  3REK B;  3B6G C;  3AZN C;  5AVB D;  4Z5T A;  5B2J C;  3KXB B;  4J8U A;  3AZF D;  3AV1 B;  4H9Q B;  3F6T A;  5B32 C;  5CPK B;  3W97 C;  2RVQ D;  5AV6 C;  3WA9 D;  1P3F B;  3X1V D;  3MGP A;  2Y2O A;  3KWQ B;  4H9N B;  2CV5 D;  1P3A D;  3X1S C;  1P3K A;  3AV2 B;  1KX4 D;  4JJN B;  4G91 B;  5B1L A;  5G49 A;  4CSR A;  1ID3 D;  5BO0 A;  2NZD C;  5B33 A;  3MNN D;  3UTA D;  2Y2I A;  5AV9 A;  3REJ A;  2ZY4 A;  4HGA C;  1P3P A;  4KGC B;  3VH6 W;  3REL A;  5BS7 C;  4H9S C;  3EPL A;  3REH D;  5B40 C;  1Z2C B;  3UTB A;  1P34 A;  3AYW D;  1KX5 C;  5JA4 B;  2YFW A;  3AZE D;  5AV8 D;  3AZL B;  1M19 C;  4YM6 A;  3WAA C;  5AVC A;  3WTP A;  2XD1 A;  3MGS A;  3AN2 D;  2Y2K A;  3B6F B;  1TZY D;  4J8X D;  1KU5 A;  3WKJ D;  3C1C A;  5CPJ B;  3W99 C;  5BT1 C;  5CP6 D;  3KXB D;  3AV1 D;  2PYO B;  3LEL B;  5AV5 C;  4NE6 A;  4QLC B;  5B31 C;  3A6N A;  4J8U B;  1U35 D;  1P3F D;  3KFU G;  3KWQ D;  4R8P B;  4KUD B;  5GT3 A;  1M1A C;  1F1E A;  3AV2 D;  5CPI D;  5BNX B;  3MGP B;  4JJN D;  1HTA A;  1HQ3 D;  2Y2M A;  3X1U C;  3UT9 A;  5E5A C;  3MGR C;  4UUZ B;  1P3I A;  5BO0 B;  3AFA D;  4WV4 B;  5B24 C;  4M6B A;  5DNN C;  5GSU C;  1AOI C;  4XUJ B;  4J8V A;  2HIO A;  1S32 B;  2G5H C;  3REJ B;  1KX3 A;  5F99 A;  5B0Y B;  5AY8 A;  2FJ7 A;  2NQB C;  1P3M C;  1P34 B;  5GXQ C;  3REI B;  3MGQ A;  4XZQ C;  2YFW B;  5B0Z C;  4YS3 B;  3AZH B;  1M18 B;  1JFI A;  3AZG A;  3W98 B;  1P3O A;  2YFV A;  3AZI A;  3WTP B;  5AVC B;  3REK A;  1BFM A;  2PYO D;  5B1M C;  3LEL D;  2FFF B;  3C1C B;  5B2I A;  4Z5T D;  4CAY A;  4H9Q A;  4J8W B;  4J8U D;  3AZF C;  5CPK A;  3B0D B;  4H9N A;  3A6N B;  4LD9 C;  1TAF B;  1Q9C A;  3MGP D;  1P3G B;  1T3U A;  2Y2N A;  1P3A C;  1P3K D;  5DNM B;  3KUY A;  1BH8 B;  2HUE C;  3LZ0 A;  5B1L D;  3B6G A;  3AZN A;  3AZM B;  5JRG B;  5B2J A;  5B33 D;  4AWL B;  3AZJ D;  3UTA C;  5AV9 D;  3REJ D;  1P3P D;  3TU4 B;  5C3I C;  1H3O B;  5B32 A;  5AV6 A;  1F66 C;  3W96 C;  3REL D;  5JA4 A;  1P3L B;  2HIO B;  1KX3 B;  3REH C;  3UTB D;  1P34 D;  3AZL A;  3X1S A;  3O62 B;  3AYW C;  2FJ7 B;  3AZE C;  4YM6 D;  3B6F A;  2UWX A;  3LJA C;  4WU9 C;  5AVC D;  3WTP D;  3MGS D;  3MGQ B;  3AN2 C;  5CPJ A;  1JFI B;  4X23 C;  3AZG B;  2NZD A;  1P3O B;  2YFV B;  3AZI B;  3WKJ C;  3C1C D;  3X1T B;  1B67 A;  4NFT A;  4QLC A;  5CP6 C;  4H9S A;  5B2I B;  3VH6 T;  5B40 A;  4CAY B;  4R8P A;  3A6N D;  4ZBJ B;  5GT0 B;  3AZK C;  4ZUX B;  1U35 C;  4H9R A;  4KUD A;  5BNX A;  2ARO B;  3H0R C;  1M19 A;  2G5I C;  5GT3 D;  4WU8 C;  3WAA A;  5CPI C;  3LZ1 C;  3MVD B;  1HQ3 C;  3KUY B;  4G92 B;  4UUZ A;  3UT9 D;  4EO5 C;  1EQZ B;  3LZ0 B;  4Z66 C;  1P3I D;  3B6G B;  2DF4 C;  5B31 G;  3AZN B;  4XUJ A;  1S32 A;  3AFA C;  2F2A C;  5B2J B;  5B0Y A;  4J8V D;  2BYM B;  2HIO D;  1KX3 D;  5F99 D;  5B32 B;  4Z2M G;  5AV6 B;  3W97 B;  5AY8 D;  1PZR A;  3REI A;  2FJ7 D;  2DQN C;  4YS3 A;  1M18 A;  3W98 A;  3AZH A;  3X1S B;  3A1I A;  1ZLA D;  3AZG D;  5E5A A;  1P3O D;  3MGR A;  3REK D;  2NZD B;  5DNN A;  4J8W A;  5B2I D;  2F8N G;  4UPK A;  4E44 A;  4HGA B;  2Y2J A;  4Z5T C;  2BG1 A;  5CPK D;  1TAF A;  2NQB A;  1P3G A;  5B40 B;  5GXQ A;  4H9R B;  1A7W A;  5DNM A;  2VQR A;  1M19 B;  1BH8 A;  3WAA B;  3WTP E;  3KUY D;  1P3K C;  4WJ3 C;  3AZM A;  5B1M A;  5JRG A;  3LZ0 D;  3B6G D;  5B1L C;  3AZN D;  3W99 B;  4KGC D;  3TU4 A;  5B2J D;  1H3O A;  4DRB A;  4E45 A;  5B33 C;  5AV5 B;  3AZJ C;  3AZF A;  5AV9 C;  1P3L A;  1P3P C;  5B32 D;  5AV6 D;  5B31 B;  2ZM5 A;  3C1B C;  4LD9 A;  3O62 A;  3REL C;  3KSY A;  1P3B C;  3UTB C;  3X1S D;  3AZL D;  4DRA A;  3B6F D;  4YM6 C;  3MGS C;  3X1T A;  4H9P B;  5CPJ D;  5BNV B;  3X1U B;  2NZD D;  5E5A B;  3VH5 T;  3MGR B;  4QLC D;  5B24 B;  1F66 A;  5AVB C;  3W96 A;  5GT0 A;  5DNN B;  4ZUX A;  5GSU B;  1AOI B;  5CHL B;  5B40 D;  3REH A;  4R8P D;  2F8N B;  2ARO A;  3NQU A;  4KUD D;  3WA9 C;  2RVQ C;  2NQB B;  1P3M B;  3X1V C;  3MVD A;  1M19 D;  3WAA D;  3LJA A;  5GXQ B;  5GT3 C;  4NE5 A;  4WU9 A;  2CV5 C;  5FUG A;  4XZQ B;  2ZY3 A;  5B0Z B;  4X23 A;  2Y2P A;  1KX4 C;  1EQZ A;  3H0M C;  3VH5 W;  1ID3 C;  3UT9 C;  5B1M B;  3MNN C;  4XUJ D;  1P3I C;  2BYM A;  1S32 D;  3B0B A;  3AZK A;  5B0Y D;  3AZF B;  3W97 A;  1N1J A;  4J8V C;  4Z2M H;  5F99 C;  4WU8 A;  4LD9 B;  2Y2H A;  3REI D;  2IO5 C;  5AY8 C;  3LZ1 A;  4YS3 D;  3AZH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...