3AZND

Crystal structure of human nucleosome core particle containing h4k91q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
b'KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aznD00
1ULYA 5AV8B 5F99D 1F66D 3NQJB 2NZDD 3LELC 3LELA 4J8VB 4H9QA 3X1UB 3W98C 3W98A 1HQ3D 5DNMB 2CV5D 5CPJB 3B0CW 3O62C 4KGCD 5B0ZB 4H9OA 3KWQD 3KXBD 1P3FB 4WNNB 3MVDD 5B32G 2F8NK 5KDMA 3LZ0A 3LZ0C 1ZLAD 4H9RB 1P3KD 2F8NA 5AV9D 5BNXB 3X1VB 4G92B 4R8PB 4KHAB 3A6ND 5CP6B 5AY8C 5AY8A 4ZBJB 2F8NG 4WU9B 1P3BA 3W99B 3X1TC 3X1TA 3AN2A 3C1CD 3MGPB 5B40B 5AV8D 5G49B 5CPIB 3B0CT 4J8VD 3MNNC 3MNNA 3X1UD 3VH6W 5DNMD 3VH6A 5JA4B 1B6WA 3MGQB 1WWIA 3W97C 3W97A 3UT9B 5CPJD 4WV4B 3AZLC 3AZLA 5AVBC 5AVBA 1U35A 5B0ZD 5B1MC 5B1MA 4J8WB 1P3FD 3V9RA 3UTAC 3UTAA 4WU8A 4WU8C 1S32D 1A7WA 5AV6D 4CAYA 2BYKB 3MGRB 3X1VD 3AZNC 3AZNA 2HIOB 4R8PD 2AROB 3MGSA 4E45A 3MGSC 1KX4C 1KX4A 5CPKA 5CP6D 1M1AC 1M1AA 4WU9D 3W99D 3AV1B 1AOIB 3LJAB 2FJ7B 2BYMB 3VH6T 3RELC 4Z66B 3RELA 3MGPD 5B40D 1P3OC 1P3OA 3REKC 3REKA 4LD9B 3LZ1C 4HGAC 5DNNB 3LZ1A 4J8UB 1P3LC 1P3LA 3KUYB 3REIC 3REIA 2LY8A 4EO5C 3WTPD 3UT9D 3AYWB 5B31C 5B31A 3REHA 3REHC 4M6BA 5B33A 4QLCC 4QLCA 5JRGC 5JRGA 5B33C 3X1SC 3X1SA 4J8WD 4YM6C 4YM6A 5AVCB 3AZEB 4G91C 5B31G 5GT3C 5GT3A 5GT0D 4X23B 3WAAD 3MGRD 1P3PC 1P3PA 2NQBA 2NQBC 2HIOD 3AZIB 1P3GC 1P3GA 3WTPE 1P3IA 1P3IC 5JA4A 5B0YB 4H9SC 4H9SA 3MGQA 2YFWA 2HUEB 1P3MC 1P3MA 3B6GA 3B6GC 3AV1D 3LJAD 1M19B 2JSSA 3B6FB 4Z66D 4AWLB 3UTBB 1BFMA 3WA9B 4JJNB 4XUJB 3C1BB 4J8XB 2CWEA 1ZLAB 4LD9D 3B0BA 3R45A 5DNND 5AV9B 4J8UD 3KUYD 4YS3C 4YS3A 1BH8B 3WKJC 2AROA 3WKJA 5B2JC 5B2JA 3AYWD 3B0DC 3NQUA 3AZHC 4Z5TA 1AOIA 1ID3B 2FJ7A 3AZED 4XZQC 4XZQA 5AVCD 1B67A 4E44A 4KUDC 4KUDA 1TZYB 4X23D 5GSUB 5GXQB 1EQZC 1EQZA 3AZID 1TAFA 4NFTA 5B0YD 1F1EA 5B32A 5B32C 3AZKA 3AZKC 3AZJB 1JFIA 1M19D 2PYOB 3O62D 3B6FD 3UTBD 1H3OA 3WA9D 4JJND 4XUJD 3C1BD 1S32B 5F99C 5F99A 4Z2MG 1F66A 5AV6B 4J8XD 1F66C 5B1LC 5B1LA 2NZDC 2NZDA 3AZGC 3AZGA 1HQ3C 1HQ3A 3TU4B 1M18B 2L5AA 2CV5A 2CV5C 1P3BC 4KGCC 4KGCA 3AN2C 1ID3D 3KWQC 3KWQA 3KXBC 3KXBA 3MVDC 3MVDA 1TZYD 3AZFB 5GSUD 5GXQD 5BO0A 1ZLAA 1P3KC 1P3KA 5AV9A 5C3IB 2IO5B 3A6NC 3A6NA 4CSRB 3WTPB 5E5AB 1U35C 3AZJD 1BH9B 1KX5B 2PYOD 5B2IB 5AV5B 3C1CC 3C1CA 3AFAB 4UUZB 5AV8C 5BNVB 5AV8A 4G91B 3W96B 5GT0B 3NQJA 3WAAB 4J8VC 4J8VA 3AV2B 1KX3B 3X1UC 3X1UA 1HTAA 5DNMC 5DNMA 3TU4D 5CPKC 1M18D 3AZMB 5CPJC 5CPJA 5B0ZC 5B0ZA 5B24B 1P3FC 1P3FA 4WNNA 4H9PB 2YFVB 1S32A 5AV6A 3AZFD 4H9RA 1P34B 5BNXA 2F8NH 3X1VA 3REJB 4R8PA 4KHAA 5CP6C 5CP6A 5E5AD 4ZBJC 3W99C 4WU9A 3W99A 4ZUXB 3B0DB 1KX5D 5B2ID 5JRGD 5AV5D 5FUGB 1P3AB 3AFAD 3MGPA 5B40C 5B40A 4NE6A 3W96D 5G49A 5CPIC 5CPIA 3AV2D 5BT1D 3LELB 1KX3D 3W98B 3MGQC 3AZMD 3WTPA 3UT9C 3UT9A 3O62B 4J8WA 4J8WC 5B24D 4H9OB 5GT0A 2BYKA 3MGRA 5KDMB 3LZ0B 3MGRC 1P34D 2F8NB 3WAAA 2HIOC 2HIOA 3REJD 2AROC 2RVQD 5AY8B 4Z5TC 3AV1C 3AV1A 4ZUXD 1AOIC 3LJAC 3LJAA 2FJ7C 3X1TB 2BYMA 3AZHD 1P3AD 4Z66C 4Z66A 4NE3A 4LD9C 4LD9A 5DNNC 5DNNA 4J8UA 4J8UC 3LELD 3KUYC 3KUYA 3MNNB 1WWSA 3W98D 3AYWC 3AYWA 3W97B 1P3AC 5B32D 1U35B 3AZLB 5AVBB 5B1MB 5AVCC 5AVCA 3AZEA 3V9RB 3UTAB 4WU8B 1Q9CA 4X23C 4X23A 1R4VA 4CAYB 3LZ0D 2F8ND 5B1LD 3AZGD 4H9NB 3AZNB 3AZIC 3AZIA 3MGSB 5B0YC 5B0YA 5BS7C 5BS7A 1KX4B 5CPKB 2HUEC 4NE5A 5AY8D 1M1AB 3VH5W 1P3BD 1M19C 1M19A 3X1TD 3VH5A 3O62A 3B6FC 3B6FA 3AN2D 4AWLC 3UTBA 3UTBC 1N1JB 3WA9C 4JJNC 4XUJC 4XUJA 3C1BA 3C1BC 4JJNA 3RELB 3WA9A 4J8XC 4J8XA 3REKB 1P3OB 1ZLAC 5AV9C 3LZ1B 4HGAB 1BH8A 3MNND 1P3LB 3REIB 4EO5B 3W97D 5B31B 3REHB 1U35D 5B33B 3AZLD 5JRGB 5AVBD 4QLCB 1ID3A 1ID3C 5B1MD 3X1SB 4YM6B 3UTAD 4WU8D 1TZYC 1TZYA 5GSUC 3VH5T 5GXQC 5GSUA 5GXQA 5GT3B 1P3PB 2NQBB 3AZND 4DRAA 3MGSD 1P3GB 1P3IB 1KX4D 5CPKD 1M1AD 3AZJC 2YFWB 3AZJA 1P3MB 3B6GB 4Z2MH 2PYOC 2PYOA 3RELD 1S32C 5AV6C 1P3OD 3REKD 3X1VC 3R45B 3LZ1D 4G92C 4R8PC 1P3LD 4H9NA 4YS3B 3REID 3TU4C 3TU4A 1M18C 1M18A 3WKJB 4WU9C 5B2JB 5B31D 3NQUB 3REHD 5B33D 4Z5TB 4QLCD 3AZHB 4WZSB 3X1SD 3MGPC 4YM6D 4XZQB 1N1JA 3AZFC 3AZFA 4KUDB 5GT3D 5CPID 5C3IC 1P3PD 2NQBD 2IO5C 1EQZB 4H9QB 1P3GD 1TAFB 4CSRA 3WTPC 1P3ID 5E5AC 5E5AA 3MGQD 1P3MD 3B6GD 5B32B 1BH9A 3AZKB 1KX5A 1KX5C 5B2IC 5B2IA 5AV5C 5AV5A 1JFIB 3AFAC 3AFAA 1KU5A 4UUZA 4DRBA 5BNVA 1H3OB 3W96C 3W96A 5CHLB 5GT0C 5F99B 1F66B 3WAAC 5B1LB 3AV2C 3AV2A 5BT1C 1KX3C 1KX3A 3AZGB 2NZDB 4YS3D 1HQ3B 2AROD 3AZMC 3AZMA 3WKJD 5B2JD 2CV5B 1P3BB 4Z5TD 4KGCB 1AOID 5B24C 5B24A 3AN2B 2FJ7D 3KSYA 3KWQB 3KXBB 4H9PA 2YFVA 4XZQD 3MVDB 4KUDD 5BO0B 1P34C 1P34A 1P3KB 1EQZD 3REJC 3REJA 2RVQC 3A6NB 4ZUXC 4ZUXA 3AZKD 3AZHA 3AZEC 5FUGA 1P3AA 3C1CB
chains in the Genus database with same CATH superfamily
1ULYA 5AV8B 5F99D 1F66D 3NQJB 2Y2NA 2NZDD 3LELC 3LELA 4J8VB 4H9QA 3X1UB 3W98C 3W98A 2Y2OA 1HQ3D 5DNMB 2CV5D 5CPJB 3KFUG 3B0CW 3O62C 4KGCD 5B0ZB 4H9OA 3KWQD 3KXBD 1P3FB 4WNNB 3MVDD 5B32G 2G5IC 2F8NK 5KDMA 3LZ0A 3LZ0C 1ZLAD 4H9RB 3A1IA 1P3KD 2F8NA 5AV9D 5BNXB 3X1VB 4G92B 4R8PB 4KHAB 2DF4C 3A6ND 5CP6B 5AY8C 5AY8A 4ZBJB 2Y2PA 2F8NG 4WU9B 1P3BA 3W99B 3X1TC 3X1TA 3AN2A 3C1CD 2F2AC 3MGPB 5B40B 5AV8D 5G49B 5CPIB 3B0CT 4J8VD 3MNNC 3MNNA 3X1UD 3VH6W 5DNMD 3VH6A 5JA4B 1B6WA 3MGQB 1WWIA 3W97C 3W97A 3UT9B 5CPJD 4WV4B 3AZLC 3AZLA 5AVBC 5AVBA 1U35A 5B0ZD 5B1MC 5B1MA 4J8WB 1P3FD 3V9RA 3UTAC 3UTAA 4WU8A 4WU8C 1S32D 1A7WA 5AV6D 4CAYA 2BYKB 3MGRB 3X1VD 3AZNC 3AZNA 2HIOB 4R8PD 2AROB 3MGSA 4E45A 3MGSC 1KX4C 1KX4A 5CPKA 5CP6D 1M1AC 1M1AA 4WU9D 3W99D 3AV1B 1AOIB 3LJAB 2FJ7B 2BYMB 3VH6T 3RELC 4Z66B 3RELA 3MGPD 5B40D 1P3OC 1P3OA 3REKC 3REKA 4LD9B 3LZ1C 4HGAC 5DNNB 3LZ1A 4J8UB 1P3LC 1P3LA 3KUYB 3REIC 3REIA 2LY8A 4EO5C 3WTPD 3UT9D 3AYWB 5B31C 5B31A 3REHA 3REHC 4M6BA 5B33A 4QLCC 4QLCA 5JRGC 5JRGA 5B33C 3EPJA 3X1SC 3X1SA 4J8WD 4YM6C 4YM6A 5AVCB 3AZEB 4G91C 5B31G 5GT3C 5GT3A 5GT0D 4X23B 3WAAD 3MGRD 1P3PC 1P3PA 2NQBA 2NQBC 2HIOD 2VQRA 3AZIB 1P3GC 1P3GA 3WTPE 1P3IA 4DQYB 1P3IC 5JA4A 5B0YB 4H9SC 4H9SA 3MGQA 3EPKA 2YFWA 2HUEB 1P3MC 1P3MA 3B6GA 2W8SA 3B6GC 3AV1D 3LJAD 1M19B 2JSSA 3B6FB 4Z66D 4AWLB 3UTBB 1BFMA 3WA9B 4JJNB 4XUJB 3C1BB 1T3UA 4J8XB 2CWEA 1ZLAB 4LD9D 3B0BA 3R45A 5DNND 5AV9B 4J8UD 2Y2MA 3KUYD 4YS3C 4YS3A 1BH8B 3WKJC 2AROA 3WKJA 2Y2GA 5B2JC 5B2JA 3AYWD 3B0DC 3NQUA 3AZHC 4Z5TA 1AOIA 1ID3B 2FJ7A 3AZED 4XZQC 4XZQA 5AVCD 2JCHA 1B67A 4E44A 4KUDC 4UPKA 4KUDA 1TZYB 4X23D 5GSUB 5GXQB 1EQZC 1EQZA 3AZID 1TAFA 4NFTA 5B0YD 3A1KA 1F1EA 5B32A 5B32C 3AZKA 3AZKC 3AZJB 1JFIA 1M19D 2PYOB 3O62D 3B6FD 3UTBD 1H3OA 3WA9D 4JJND 4XUJD 3C1BD 1S32B 5F99C 5F99A 3AL0C 4Z2MG 1F66A 5AV6B 4J8XD 1F66C 5B1LC 5B1LA 2NZDC 2NZDA 3AZGC 3AZGA 2FFFB 1HQ3C 1HQ3A 3TU4B 1M18B 2L5AA 2CV5A 2CV5C 1P3BC 4KGCC 4KGCA 3AN2C 1ID3D 3KWQC 3KWQA 3KXBC 3KXBA 3MVDC 3MVDA 1TZYD 3AZFB 5GSUD 5GXQD 5BO0A 1ZLAA 1P3KC 1P3KA 5AV9A 5C3IB 2IO5B 3A6NC 3A6NA 4CSRB 3WTPB 5E5AB 3H0RC 1U35C 3AZJD 1BH9B 1KX5B 2PYOD 5B2IB 5AV5B 3C1CC 3C1CA 3AFAB 4UUZB 5AV8C 5BNVB 5AV8A 4G91B 3W96B 5GT0B 3NQJA 2ZY5A 3WAAB 4J8VC 4J8VA 2J8PA 3AV2B 1KX3B 2Y2JA 3X1UA 3X1UC 1HTAA 5DNMC 5DNMA 3TU4D 5CPKC 1M18D 3AZMB 5CPJC 5CPJA 5B0ZC 5B0ZA 5B24B 1P3FC 1P3FA 4WNNA 4H9PB 2YFVB 1S32A 5AV6A 3AZFD 4H9RA 1P34B 5BNXA 2F8NH 3X1VA 3REJB 4R8PA 4KHAA 2Y2KA 5CP6C 5CP6A 5E5AD 4ZBJC 2Y2IA 3W99C 4WU9A 3W99A 4ZUXB 3B0DB 1KX5D 5B2ID 5JRGD 5AV5D 5FUGB 1P3AB 3AFAD 3MGPA 5B40C 5B40A 4NE6A 3W96D 5G49A 5CPIC 5CPIA 1W2EA 3AV2D 5BT1D 3LELB 1KX3D 3W98B 3MGQC 3AZMD 3WTPA 3UT9C 3UT9A 3P5JB 3O62B 4J8WA 4J8WC 2UWXA 5B24D 4H9OB 5GT0A 2BYKA 3MGRA 5KDMB 3LZ0B 3MGRC 1P34D 2F8NB 3WAAA 2HIOC 2HIOA 3REJD 2AROC 2RVQD 2ZM5A 5AY8B 4Z5TC 3AV1C 3AV1A 4ZUXD 1AOIC 3LJAC 3LJAA 2FJ7C 3X1TB 2BYMA 3AZHD 1P3AD 4Z66C 4Z66A 4NE3A 4LD9C 4LD9A 5DNNC 5DNNA 4J8UA 4J8UC 3LELD 3KUYC 3KUYA 3MNNB 1WWSA 3W98D 2JE5A 3AYWC 3AYWA 3W97B 1P3AC 3H0MC 5B32D 1U35B 3AZLB 5AVBB 5B1MB 5AVCC 5AVCA 3AZEA 3EPLA 3V9RB 3UTAB 4WU8B 1Q9CA 4X23C 4X23A 1R4VA 4CAYB 3LZ0D 2F8ND 5B1LD 3AZGD 4H9NB 3AZNB 3AZIC 3AZIA 2ZY3A 3MGSB 5B0YC 5B0YA 5BS7C 5BS7A 1PZRA 5CPKB 1KX4B 2HUEC 4NE5A 5AY8D 1M1AB 2G5HC 3EPHA 3VH5W 1P3BD 1M19C 1M19A 3X1TD 3VH5A 3O62A 3B6FC 3B6FA 3AN2D 4AWLC 3UTBA 3UTBC 1N1JB 3WA9C 4JJNC 4XUJC 4XUJA 3C1BA 3C1BC 4JJNA 3RELB 3WA9A 4J8XC 4J8XA 3REKB 1P3OB 1ZLAC 2Y2QA 5AV9C 4WJ3C 3LZ1B 4HGAB 1BH8A 3MNND 1P3LB 3REIB 4EO5B 3W97D 5B31B 3REHB 1U35D 5B33B 3AZLD 5JRGB 5AVBD 4QLCB 1ID3A 1ID3C 5B1MD 3X1SB 4YM6B 3UTAD 4WU8D 1TZYC 1TZYA 5GSUC 3VH5T 5GXQC 5GSUA 5GXQA 5GT3B 1P3PB 2NQBB 3AZND 4DRAA 2ZY2A 2ZY4A 3MGSD 1P3GB 1P3IB 1KX4D 5CPKD 1M1AD 3AZJC 2Y2HA 2YFWB 3AZJA 1P3MB 3B6GB 4Z2MH 2PYOC 2PYOA 3RELD 1S32C 5AV6C 1P3OD 3REKD 2RIQA 3R45B 3X1VC 3LZ1D 4G92C 4R8PC 1P3LD 4H9NA 4YS3B 3REID 3TU4C 3TU4A 1M18C 1M18A 3WKJB 4WU9C 5B2JB 5B31D 3NQUB 3REHD 3IP4C 5B33D 4Z5TB 4QLCD 3AZHB 4WZSB 3X1SD 3MGPC 4YM6D 4XZQB 1N1JA 3AZFC 3AZFA 3H0LC 4KUDB 5GT3D 5CPID 5C3IC 1P3PD 2NQBD 2IO5C 3EG5B 1EQZB 4H9QB 1P3GD 1TAFB 4CSRA 3WTPC 1P3ID 5E5AC 5E5AA 3MGQD 1P3MD 3B6GD 5B32B 1BH9A 3AZKB 1KX5A 1KX5C 5B2IC 5B2IA 5AV5C 5AV5A 1JFIB 3AFAC 3AFAA 1KU5A 2XD5A 4UUZA 4DRBA 5BNVA 1H3OB 3W96C 3W96A 5CHLB 5GT0C 5F99B 1F66B 3WAAC 5B1LB 3AV2C 3AV2A 5BT1C 1KX3C 1KX3A 3AZGB 2DQNC 2NZDB 4YS3D 1HQ3B 2AROD 3AZMC 3AZMA 3WKJD 1Z2CB 5B2JD 2CV5B 1P3BB 4Z5TD 4KGCB 1AOID 5B24C 5B24A 3AN2B 2FJ7D 3KSYA 3KWQB 3KXBB 4H9PA 2YFVA 4XZQD 2XD1A 3MVDB 4KUDD 5BO0B 1P34C 1P34A 1P3KB 1EQZD 3REJC 3REJA 3F6TA 2RVQC 2BG1A 3A6NB 3FDDA 4ZUXC 4ZUXA 3AZKD 2Y2LA 3AZHA 3AZEC 5FUGA 1P3AA 3C1CB
chains in the Genus database with same CATH topology
1ULYA 5AV8B 5F99D 1F66D 3NQJB 2Y2NA 2NZDD 3LELC 3LELA 4J8VB 4H9QA 3X1UB 3W98C 3W98A 2Y2OA 1HQ3D 5DNMB 2CV5D 5CPJB 3KFUG 3B0CW 3O62C 4KGCD 5B0ZB 4H9OA 3KWQD 3KXBD 1P3FB 4WNNB 3MVDD 5B32G 2G5IC 2F8NK 5KDMA 3LZ0A 3LZ0C 1ZLAD 4H9RB 3A1IA 1P3KD 2F8NA 5AV9D 5BNXB 3X1VB 4G92B 4R8PB 4KHAB 2DF4C 3A6ND 5CP6B 5AY8C 5AY8A 4ZBJB 2Y2PA 2F8NG 4WU9B 1P3BA 3W99B 3X1TC 3X1TA 3AN2A 3C1CD 2F2AC 3MGPB 5B40B 5AV8D 5G49B 5CPIB 3B0CT 4J8VD 3MNNC 3MNNA 3X1UD 3VH6W 5DNMD 3VH6A 5JA4B 1B6WA 3MGQB 1WWIA 3W97C 3W97A 3UT9B 5CPJD 4WV4B 3AZLC 3AZLA 5AVBC 5AVBA 1U35A 5B0ZD 5B1MC 5B1MA 4J8WB 1P3FD 3V9RA 3UTAC 3UTAA 4WU8A 4WU8C 1S32D 1A7WA 5AV6D 4CAYA 2BYKB 3MGRB 3X1VD 3AZNC 3AZNA 2HIOB 4R8PD 2AROB 3MGSA 4E45A 3MGSC 1KX4C 1KX4A 5CPKA 5CP6D 1M1AC 1M1AA 4WU9D 3W99D 3AV1B 1AOIB 3LJAB 2FJ7B 2BYMB 3VH6T 3RELC 4Z66B 3RELA 3MGPD 5B40D 1P3OC 1P3OA 3REKC 3REKA 4LD9B 3LZ1C 4HGAC 5DNNB 3LZ1A 4J8UB 1P3LC 1P3LA 3KUYB 3REIC 3REIA 2LY8A 4EO5C 3WTPD 3UT9D 3AYWB 5B31C 5B31A 3REHA 3REHC 4M6BA 5B33A 4QLCC 4QLCA 5JRGC 5JRGA 5B33C 3EPJA 3X1SC 3X1SA 4J8WD 4YM6C 4YM6A 5AVCB 3AZEB 4G91C 5B31G 5GT3C 5GT3A 5GT0D 4X23B 3WAAD 3MGRD 1P3PC 1P3PA 2NQBA 2NQBC 2HIOD 2VQRA 3AZIB 1P3GC 1P3GA 3WTPE 1P3IA 4DQYB 1P3IC 5JA4A 5B0YB 4H9SC 4H9SA 3MGQA 3EPKA 2YFWA 2HUEB 1P3MC 1P3MA 3B6GA 2W8SA 3B6GC 3AV1D 3LJAD 1M19B 2JSSA 3B6FB 4Z66D 4AWLB 3UTBB 1BFMA 3WA9B 4JJNB 4XUJB 3C1BB 1T3UA 4J8XB 2CWEA 1ZLAB 4LD9D 3B0BA 3R45A 5DNND 5AV9B 4J8UD 2Y2MA 3KUYD 4YS3C 4YS3A 1BH8B 3WKJC 2AROA 3WKJA 2Y2GA 5B2JC 5B2JA 3AYWD 3B0DC 3NQUA 3AZHC 4Z5TA 1AOIA 1ID3B 2FJ7A 3AZED 4XZQC 4XZQA 5AVCD 2JCHA 1B67A 4E44A 4KUDC 4UPKA 4KUDA 1TZYB 4X23D 5GSUB 5GXQB 1EQZC 1EQZA 3AZID 1TAFA 4NFTA 5B0YD 3A1KA 1F1EA 5B32A 5B32C 3AZKA 3AZKC 3AZJB 1JFIA 1M19D 2PYOB 3O62D 3B6FD 3UTBD 1H3OA 3WA9D 4JJND 4XUJD 3C1BD 1S32B 5F99C 5F99A 3AL0C 4Z2MG 1F66A 5AV6B 4J8XD 1F66C 5B1LC 5B1LA 2NZDC 2NZDA 3AZGC 3AZGA 2FFFB 1HQ3C 1HQ3A 3TU4B 1M18B 2L5AA 2CV5A 2CV5C 1P3BC 4KGCC 4KGCA 3AN2C 1ID3D 3KWQC 3KWQA 3KXBC 3KXBA 3MVDC 3MVDA 1TZYD 3AZFB 5GSUD 5GXQD 5BO0A 1ZLAA 1P3KC 1P3KA 5AV9A 5C3IB 2IO5B 3A6NC 3A6NA 4CSRB 3WTPB 5E5AB 3H0RC 1U35C 3AZJD 1BH9B 1KX5B 2PYOD 5B2IB 5AV5B 3C1CC 3C1CA 3AFAB 4UUZB 5AV8C 5BNVB 5AV8A 4G91B 3W96B 5GT0B 3NQJA 2ZY5A 3WAAB 4J8VC 4J8VA 2J8PA 3AV2B 1KX3B 2Y2JA 3X1UA 3X1UC 1HTAA 5DNMC 5DNMA 3TU4D 5CPKC 1M18D 3AZMB 5CPJC 5CPJA 5B0ZC 5B0ZA 5B24B 1P3FC 1P3FA 4WNNA 4H9PB 2YFVB 1S32A 5AV6A 3AZFD 4H9RA 1P34B 5BNXA 2F8NH 3X1VA 3REJB 4R8PA 4KHAA 2Y2KA 5CP6C 5CP6A 5E5AD 4ZBJC 2Y2IA 3W99C 4WU9A 3W99A 4ZUXB 3B0DB 1KX5D 5B2ID 5JRGD 5AV5D 5FUGB 1P3AB 3AFAD 3MGPA 5B40C 5B40A 4NE6A 3W96D 5G49A 5CPIC 5CPIA 1W2EA 3AV2D 5BT1D 3LELB 1KX3D 3W98B 3MGQC 3AZMD 3WTPA 3UT9C 3UT9A 3P5JB 3O62B 4J8WA 4J8WC 2UWXA 5B24D 4H9OB 5GT0A 2BYKA 3MGRA 5KDMB 3LZ0B 3MGRC 1P34D 2F8NB 3WAAA 2HIOC 2HIOA 3REJD 2AROC 2RVQD 2ZM5A 5AY8B 4Z5TC 3AV1C 3AV1A 4ZUXD 1AOIC 3LJAC 3LJAA 2FJ7C 3X1TB 2BYMA 3AZHD 1P3AD 4Z66C 4Z66A 4NE3A 4LD9C 4LD9A 5DNNC 5DNNA 4J8UA 4J8UC 3LELD 3KUYC 3KUYA 3MNNB 1WWSA 3W98D 2JE5A 3AYWC 3AYWA 3W97B 1P3AC 3H0MC 5B32D 1U35B 3AZLB 5AVBB 5B1MB 5AVCC 5AVCA 3AZEA 3EPLA 3V9RB 3UTAB 4WU8B 1Q9CA 4X23C 4X23A 1R4VA 4CAYB 3LZ0D 2F8ND 5B1LD 3AZGD 4H9NB 3AZNB 3AZIC 3AZIA 2ZY3A 3MGSB 5B0YC 5B0YA 5BS7C 5BS7A 1PZRA 5CPKB 1KX4B 2HUEC 4NE5A 5AY8D 1M1AB 2G5HC 3EPHA 3VH5W 1P3BD 1M19C 1M19A 3X1TD 3VH5A 3O62A 3B6FC 3B6FA 3AN2D 4AWLC 3UTBA 3UTBC 1N1JB 3WA9C 4JJNC 4XUJC 4XUJA 3C1BA 3C1BC 4JJNA 3RELB 3WA9A 4J8XC 4J8XA 3REKB 1P3OB 1ZLAC 2Y2QA 5AV9C 4WJ3C 3LZ1B 4HGAB 1BH8A 3MNND 1P3LB 3REIB 4EO5B 3W97D 5B31B 3REHB 1U35D 5B33B 3AZLD 5JRGB 5AVBD 4QLCB 1ID3A 1ID3C 5B1MD 3X1SB 4YM6B 3UTAD 4WU8D 1TZYC 1TZYA 5GSUC 3VH5T 5GXQC 5GSUA 5GXQA 5GT3B 1P3PB 2NQBB 3AZND 4DRAA 2ZY2A 2ZY4A 3MGSD 1P3GB 1P3IB 1KX4D 5CPKD 1M1AD 3AZJC 2Y2HA 2YFWB 3AZJA 1P3MB 3B6GB 4Z2MH 2PYOC 2PYOA 3RELD 1S32C 5AV6C 1P3OD 3REKD 2RIQA 3R45B 3X1VC 3LZ1D 4G92C 4R8PC 1P3LD 4H9NA 4YS3B 3REID 3TU4C 3TU4A 1M18C 1M18A 3WKJB 4WU9C 5B2JB 5B31D 3NQUB 3REHD 3IP4C 5B33D 4Z5TB 4QLCD 3AZHB 4WZSB 3X1SD 3MGPC 4YM6D 4XZQB 1N1JA 3AZFC 3AZFA 3H0LC 4KUDB 5GT3D 5CPID 5C3IC 1P3PD 2NQBD 2IO5C 3EG5B 1EQZB 4H9QB 1P3GD 1TAFB 4CSRA 3WTPC 1P3ID 5E5AC 5E5AA 3MGQD 1P3MD 3B6GD 5B32B 1BH9A 3AZKB 1KX5A 1KX5C 5B2IC 5B2IA 5AV5C 5AV5A 1JFIB 3AFAC 3AFAA 1KU5A 2XD5A 4UUZA 4DRBA 5BNVA 1H3OB 3W96C 3W96A 5CHLB 5GT0C 5F99B 1F66B 3WAAC 5B1LB 3AV2C 3AV2A 5BT1C 1KX3C 1KX3A 3AZGB 2DQNC 2NZDB 4YS3D 1HQ3B 2AROD 3AZMC 3AZMA 3WKJD 1Z2CB 5B2JD 2CV5B 1P3BB 4Z5TD 4KGCB 1AOID 5B24C 5B24A 3AN2B 2FJ7D 3KSYA 3KWQB 3KXBB 4H9PA 2YFVA 4XZQD 2XD1A 3MVDB 4KUDD 5BO0B 1P34C 1P34A 1P3KB 1EQZD 3REJC 3REJA 3F6TA 2RVQC 2BG1A 3A6NB 3FDDA 4ZUXC 4ZUXA 3AZKD 2Y2LA 3AZHA 3AZEC 5FUGA 1P3AA 3C1CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULY A;  5AV8 B;  5F99 D;  1F66 D;  3NQJ B;  2NZD D;  3LEL C;  3LEL A;  4J8V B;  4H9Q A;  3X1U B;  3W98 C;  3W98 A;  1HQ3 D;  5DNM B;  2CV5 D;  5CPJ B;  3B0C W;  3O62 C;  4KGC D;  5B0Z B;  4H9O A;  3KWQ D;  3KXB D;  1P3F B;  4WNN B;  3MVD D;  5B32 G;  2F8N K;  5KDM A;  3LZ0 A;  3LZ0 C;  1ZLA D;  4H9R B;  1P3K D;  2F8N A;  5AV9 D;  5BNX B;  3X1V B;  4G92 B;  4R8P B;  4KHA B;  3A6N D;  5CP6 B;  5AY8 C;  5AY8 A;  4ZBJ B;  2F8N G;  4WU9 B;  1P3B A;  3W99 B;  3X1T C;  3X1T A;  3AN2 A;  3C1C D;  3MGP B;  5B40 B;  5AV8 D;  5G49 B;  5CPI B;  3B0C T;  4J8V D;  3MNN C;  3MNN A;  3X1U D;  3VH6 W;  5DNM D;  3VH6 A;  5JA4 B;  1B6W A;  3MGQ B;  1WWI A;  3W97 C;  3W97 A;  3UT9 B;  5CPJ D;  4WV4 B;  3AZL C;  3AZL A;  5AVB C;  5AVB A;  1U35 A;  5B0Z D;  5B1M C;  5B1M A;  4J8W B;  1P3F D;  3V9R A;  3UTA C;  3UTA A;  4WU8 A;  4WU8 C;  1S32 D;  1A7W A;  5AV6 D;  4CAY A;  2BYK B;  3MGR B;  3X1V D;  3AZN C;  3AZN A;  2HIO B;  4R8P D;  2ARO B;  3MGS A;  4E45 A;  3MGS C;  1KX4 C;  1KX4 A;  5CPK A;  5CP6 D;  1M1A C;  1M1A A;  4WU9 D;  3W99 D;  3AV1 B;  1AOI B;  3LJA B;  2FJ7 B;  2BYM B;  3VH6 T;  3REL C;  4Z66 B;  3REL A;  3MGP D;  5B40 D;  1P3O C;  1P3O A;  3REK C;  3REK A;  4LD9 B;  3LZ1 C;  4HGA C;  5DNN B;  3LZ1 A;  4J8U B;  1P3L C;  1P3L A;  3KUY B;  3REI C;  3REI A;  2LY8 A;  4EO5 C;  3WTP D;  3UT9 D;  3AYW B;  5B31 C;  5B31 A;  3REH A;  3REH C;  4M6B A;  5B33 A;  4QLC C;  4QLC A;  5JRG C;  5JRG A;  5B33 C;  3X1S C;  3X1S A;  4J8W D;  4YM6 C;  4YM6 A;  5AVC B;  3AZE B;  4G91 C;  5B31 G;  5GT3 C;  5GT3 A;  5GT0 D;  4X23 B;  3WAA D;  3MGR D;  1P3P C;  1P3P A;  2NQB A;  2NQB C;  2HIO D;  3AZI B;  1P3G C;  1P3G A;  3WTP E;  1P3I A;  1P3I C;  5JA4 A;  5B0Y B;  4H9S C;  4H9S A;  3MGQ A;  2YFW A;  2HUE B;  1P3M C;  1P3M A;  3B6G A;  3B6G C;  3AV1 D;  3LJA D;  1M19 B;  2JSS A;  3B6F B;  4Z66 D;  4AWL B;  3UTB B;  1BFM A;  3WA9 B;  4JJN B;  4XUJ B;  3C1B B;  4J8X B;  2CWE A;  1ZLA B;  4LD9 D;  3B0B A;  3R45 A;  5DNN D;  5AV9 B;  4J8U D;  3KUY D;  4YS3 C;  4YS3 A;  1BH8 B;  3WKJ C;  2ARO A;  3WKJ A;  5B2J C;  5B2J A;  3AYW D;  3B0D C;  3NQU A;  3AZH C;  4Z5T A;  1AOI A;  1ID3 B;  2FJ7 A;  3AZE D;  4XZQ C;  4XZQ A;  5AVC D;  1B67 A;  4E44 A;  4KUD C;  4KUD A;  1TZY B;  4X23 D;  5GSU B;  5GXQ B;  1EQZ C;  1EQZ A;  3AZI D;  1TAF A;  4NFT A;  5B0Y D;  1F1E A;  5B32 A;  5B32 C;  3AZK A;  3AZK C;  3AZJ B;  1JFI A;  1M19 D;  2PYO B;  3O62 D;  3B6F D;  3UTB D;  1H3O A;  3WA9 D;  4JJN D;  4XUJ D;  3C1B D;  1S32 B;  5F99 C;  5F99 A;  4Z2M G;  1F66 A;  5AV6 B;  4J8X D;  1F66 C;  5B1L C;  5B1L A;  2NZD C;  2NZD A;  3AZG C;  3AZG A;  1HQ3 C;  1HQ3 A;  3TU4 B;  1M18 B;  2L5A A;  2CV5 A;  2CV5 C;  1P3B C;  4KGC C;  4KGC A;  3AN2 C;  1ID3 D;  3KWQ C;  3KWQ A;  3KXB C;  3KXB A;  3MVD C;  3MVD A;  1TZY D;  3AZF B;  5GSU D;  5GXQ D;  5BO0 A;  1ZLA A;  1P3K C;  1P3K A;  5AV9 A;  5C3I B;  2IO5 B;  3A6N C;  3A6N A;  4CSR B;  3WTP B;  5E5A B;  1U35 C;  3AZJ D;  1BH9 B;  1KX5 B;  2PYO D;  5B2I B;  5AV5 B;  3C1C C;  3C1C A;  3AFA B;  4UUZ B;  5AV8 C;  5BNV B;  5AV8 A;  4G91 B;  3W96 B;  5GT0 B;  3NQJ A;  3WAA B;  4J8V C;  4J8V A;  3AV2 B;  1KX3 B;  3X1U C;  3X1U A;  1HTA A;  5DNM C;  5DNM A;  3TU4 D;  5CPK C;  1M18 D;  3AZM B;  5CPJ C;  5CPJ A;  5B0Z C;  5B0Z A;  5B24 B;  1P3F C;  1P3F A;  4WNN A;  4H9P B;  2YFV B;  1S32 A;  5AV6 A;  3AZF D;  4H9R A;  1P34 B;  5BNX A;  2F8N H;  3X1V A;  3REJ B;  4R8P A;  4KHA A;  5CP6 C;  5CP6 A;  5E5A D;  4ZBJ C;  3W99 C;  4WU9 A;  3W99 A;  4ZUX B;  3B0D B;  1KX5 D;  5B2I D;  5JRG D;  5AV5 D;  5FUG B;  1P3A B;  3AFA D;  3MGP A;  5B40 C;  5B40 A;  4NE6 A;  3W96 D;  5G49 A;  5CPI C;  5CPI A;  3AV2 D;  5BT1 D;  3LEL B;  1KX3 D;  3W98 B;  3MGQ C;  3AZM D;  3WTP A;  3UT9 C;  3UT9 A;  3O62 B;  4J8W A;  4J8W C;  5B24 D;  4H9O B;  5GT0 A;  2BYK A;  3MGR A;  5KDM B;  3LZ0 B;  3MGR C;  1P34 D;  2F8N B;  3WAA A;  2HIO C;  2HIO A;  3REJ D;  2ARO C;  2RVQ D;  5AY8 B;  4Z5T C;  3AV1 C;  3AV1 A;  4ZUX D;  1AOI C;  3LJA C;  3LJA A;  2FJ7 C;  3X1T B;  2BYM A;  3AZH D;  1P3A D;  4Z66 C;  4Z66 A;  4NE3 A;  4LD9 C;  4LD9 A;  5DNN C;  5DNN A;  4J8U A;  4J8U C;  3LEL D;  3KUY C;  3KUY A;  3MNN B;  1WWS A;  3W98 D;  3AYW C;  3AYW A;  3W97 B;  1P3A C;  5B32 D;  1U35 B;  3AZL B;  5AVB B;  5B1M B;  5AVC C;  5AVC A;  3AZE A;  3V9R B;  3UTA B;  4WU8 B;  1Q9C A;  4X23 C;  4X23 A;  1R4V A;  4CAY B;  3LZ0 D;  2F8N D;  5B1L D;  3AZG D;  4H9N B;  3AZN B;  3AZI C;  3AZI A;  3MGS B;  5B0Y C;  5B0Y A;  5BS7 C;  5BS7 A;  1KX4 B;  5CPK B;  2HUE C;  4NE5 A;  5AY8 D;  1M1A B;  3VH5 W;  1P3B D;  1M19 C;  1M19 A;  3X1T D;  3VH5 A;  3O62 A;  3B6F C;  3B6F A;  3AN2 D;  4AWL C;  3UTB A;  3UTB C;  1N1J B;  3WA9 C;  4JJN C;  4XUJ C;  4XUJ A;  3C1B A;  3C1B C;  4JJN A;  3REL B;  3WA9 A;  4J8X C;  4J8X A;  3REK B;  1P3O B;  1ZLA C;  5AV9 C;  3LZ1 B;  4HGA B;  1BH8 A;  3MNN D;  1P3L B;  3REI B;  4EO5 B;  3W97 D;  5B31 B;  3REH B;  1U35 D;  5B33 B;  3AZL D;  5JRG B;  5AVB D;  4QLC B;  1ID3 A;  1ID3 C;  5B1M D;  3X1S B;  4YM6 B;  3UTA D;  4WU8 D;  1TZY C;  1TZY A;  5GSU C;  3VH5 T;  5GXQ C;  5GSU A;  5GXQ A;  5GT3 B;  1P3P B;  2NQB B;  3AZN D;  4DRA A;  3MGS D;  1P3G B;  1P3I B;  1KX4 D;  5CPK D;  1M1A D;  3AZJ C;  2YFW B;  3AZJ A;  1P3M B;  3B6G B;  4Z2M H;  2PYO C;  2PYO A;  3REL D;  1S32 C;  5AV6 C;  1P3O D;  3REK D;  3X1V C;  3R45 B;  3LZ1 D;  4G92 C;  4R8P C;  1P3L D;  4H9N A;  4YS3 B;  3REI D;  3TU4 C;  3TU4 A;  1M18 C;  1M18 A;  3WKJ B;  4WU9 C;  5B2J B;  5B31 D;  3NQU B;  3REH D;  5B33 D;  4Z5T B;  4QLC D;  3AZH B;  4WZS B;  3X1S D;  3MGP C;  4YM6 D;  4XZQ B;  1N1J A;  3AZF C;  3AZF A;  4KUD B;  5GT3 D;  5CPI D;  5C3I C;  1P3P D;  2NQB D;  2IO5 C;  1EQZ B;  4H9Q B;  1P3G D;  1TAF B;  4CSR A;  3WTP C;  1P3I D;  5E5A C;  5E5A A;  3MGQ D;  1P3M D;  3B6G D;  5B32 B;  1BH9 A;  3AZK B;  1KX5 A;  1KX5 C;  5B2I C;  5B2I A;  5AV5 C;  5AV5 A;  1JFI B;  3AFA C;  3AFA A;  1KU5 A;  4UUZ A;  4DRB A;  5BNV A;  1H3O B;  3W96 C;  3W96 A;  5CHL B;  5GT0 C;  5F99 B;  1F66 B;  3WAA C;  5B1L B;  3AV2 C;  3AV2 A;  5BT1 C;  1KX3 C;  1KX3 A;  3AZG B;  2NZD B;  4YS3 D;  1HQ3 B;  2ARO D;  3AZM C;  3AZM A;  3WKJ D;  5B2J D;  2CV5 B;  1P3B B;  4Z5T D;  4KGC B;  1AOI D;  5B24 C;  5B24 A;  3AN2 B;  2FJ7 D;  3KSY A;  3KWQ B;  3KXB B;  4H9P A;  2YFV A;  4XZQ D;  3MVD B;  4KUD D;  5BO0 B;  1P34 C;  1P34 A;  1P3K B;  1EQZ D;  3REJ C;  3REJ A;  2RVQ C;  3A6N B;  4ZUX C;  4ZUX A;  3AZK D;  3AZH A;  3AZE C;  5FUG A;  1P3A A;  3C1C B; 
#chains in the Genus database with same CATH topology
 1ULY A;  5AV8 B;  5F99 D;  1F66 D;  3NQJ B;  2Y2N A;  2NZD D;  3LEL C;  3LEL A;  4J8V B;  4H9Q A;  3X1U B;  3W98 C;  3W98 A;  2Y2O A;  1HQ3 D;  5DNM B;  2CV5 D;  5CPJ B;  3KFU G;  3B0C W;  3O62 C;  4KGC D;  5B0Z B;  4H9O A;  3KWQ D;  3KXB D;  1P3F B;  4WNN B;  3MVD D;  5B32 G;  2G5I C;  2F8N K;  5KDM A;  3LZ0 A;  3LZ0 C;  1ZLA D;  4H9R B;  3A1I A;  1P3K D;  2F8N A;  5AV9 D;  5BNX B;  3X1V B;  4G92 B;  4R8P B;  4KHA B;  2DF4 C;  3A6N D;  5CP6 B;  5AY8 C;  5AY8 A;  4ZBJ B;  2Y2P A;  2F8N G;  4WU9 B;  1P3B A;  3W99 B;  3X1T C;  3X1T A;  3AN2 A;  3C1C D;  2F2A C;  3MGP B;  5B40 B;  5AV8 D;  5G49 B;  5CPI B;  3B0C T;  4J8V D;  3MNN C;  3MNN A;  3X1U D;  3VH6 W;  5DNM D;  3VH6 A;  5JA4 B;  1B6W A;  3MGQ B;  1WWI A;  3W97 C;  3W97 A;  3UT9 B;  5CPJ D;  4WV4 B;  3AZL C;  3AZL A;  5AVB C;  5AVB A;  1U35 A;  5B0Z D;  5B1M C;  5B1M A;  4J8W B;  1P3F D;  3V9R A;  3UTA C;  3UTA A;  4WU8 A;  4WU8 C;  1S32 D;  1A7W A;  5AV6 D;  4CAY A;  2BYK B;  3MGR B;  3X1V D;  3AZN C;  3AZN A;  2HIO B;  4R8P D;  2ARO B;  3MGS A;  4E45 A;  3MGS C;  1KX4 C;  1KX4 A;  5CPK A;  5CP6 D;  1M1A C;  1M1A A;  4WU9 D;  3W99 D;  3AV1 B;  1AOI B;  3LJA B;  2FJ7 B;  2BYM B;  3VH6 T;  3REL C;  4Z66 B;  3REL A;  3MGP D;  5B40 D;  1P3O C;  1P3O A;  3REK C;  3REK A;  4LD9 B;  3LZ1 C;  4HGA C;  5DNN B;  3LZ1 A;  4J8U B;  1P3L C;  1P3L A;  3KUY B;  3REI C;  3REI A;  2LY8 A;  4EO5 C;  3WTP D;  3UT9 D;  3AYW B;  5B31 C;  5B31 A;  3REH A;  3REH C;  4M6B A;  5B33 A;  4QLC C;  4QLC A;  5JRG C;  5JRG A;  5B33 C;  3EPJ A;  3X1S C;  3X1S A;  4J8W D;  4YM6 C;  4YM6 A;  5AVC B;  3AZE B;  4G91 C;  5B31 G;  5GT3 C;  5GT3 A;  5GT0 D;  4X23 B;  3WAA D;  3MGR D;  1P3P C;  1P3P A;  2NQB A;  2NQB C;  2HIO D;  2VQR A;  3AZI B;  1P3G C;  1P3G A;  3WTP E;  1P3I A;  4DQY B;  1P3I C;  5JA4 A;  5B0Y B;  4H9S C;  4H9S A;  3MGQ A;  3EPK A;  2YFW A;  2HUE B;  1P3M C;  1P3M A;  3B6G A;  2W8S A;  3B6G C;  3AV1 D;  3LJA D;  1M19 B;  2JSS A;  3B6F B;  4Z66 D;  4AWL B;  3UTB B;  1BFM A;  3WA9 B;  4JJN B;  4XUJ B;  3C1B B;  1T3U A;  4J8X B;  2CWE A;  1ZLA B;  4LD9 D;  3B0B A;  3R45 A;  5DNN D;  5AV9 B;  4J8U D;  2Y2M A;  3KUY D;  4YS3 C;  4YS3 A;  1BH8 B;  3WKJ C;  2ARO A;  3WKJ A;  2Y2G A;  5B2J C;  5B2J A;  3AYW D;  3B0D C;  3NQU A;  3AZH C;  4Z5T A;  1AOI A;  1ID3 B;  2FJ7 A;  3AZE D;  4XZQ C;  4XZQ A;  5AVC D;  2JCH A;  1B67 A;  4E44 A;  4KUD C;  4UPK A;  4KUD A;  1TZY B;  4X23 D;  5GSU B;  5GXQ B;  1EQZ C;  1EQZ A;  3AZI D;  1TAF A;  4NFT A;  5B0Y D;  3A1K A;  1F1E A;  5B32 A;  5B32 C;  3AZK A;  3AZK C;  3AZJ B;  1JFI A;  1M19 D;  2PYO B;  3O62 D;  3B6F D;  3UTB D;  1H3O A;  3WA9 D;  4JJN D;  4XUJ D;  3C1B D;  1S32 B;  5F99 C;  5F99 A;  3AL0 C;  4Z2M G;  1F66 A;  5AV6 B;  4J8X D;  1F66 C;  5B1L C;  5B1L A;  2NZD C;  2NZD A;  3AZG C;  3AZG A;  2FFF B;  1HQ3 C;  1HQ3 A;  3TU4 B;  1M18 B;  2L5A A;  2CV5 A;  2CV5 C;  1P3B C;  4KGC C;  4KGC A;  3AN2 C;  1ID3 D;  3KWQ C;  3KWQ A;  3KXB C;  3KXB A;  3MVD C;  3MVD A;  1TZY D;  3AZF B;  5GSU D;  5GXQ D;  5BO0 A;  1ZLA A;  1P3K C;  1P3K A;  5AV9 A;  5C3I B;  2IO5 B;  3A6N C;  3A6N A;  4CSR B;  3WTP B;  5E5A B;  3H0R C;  1U35 C;  3AZJ D;  1BH9 B;  1KX5 B;  2PYO D;  5B2I B;  5AV5 B;  3C1C C;  3C1C A;  3AFA B;  4UUZ B;  5AV8 C;  5BNV B;  5AV8 A;  4G91 B;  3W96 B;  5GT0 B;  3NQJ A;  2ZY5 A;  3WAA B;  4J8V C;  4J8V A;  2J8P A;  3AV2 B;  1KX3 B;  2Y2J A;  3X1U A;  3X1U C;  1HTA A;  5DNM C;  5DNM A;  3TU4 D;  5CPK C;  1M18 D;  3AZM B;  5CPJ C;  5CPJ A;  5B0Z C;  5B0Z A;  5B24 B;  1P3F C;  1P3F A;  4WNN A;  4H9P B;  2YFV B;  1S32 A;  5AV6 A;  3AZF D;  4H9R A;  1P34 B;  5BNX A;  2F8N H;  3X1V A;  3REJ B;  4R8P A;  4KHA A;  2Y2K A;  5CP6 C;  5CP6 A;  5E5A D;  4ZBJ C;  2Y2I A;  3W99 C;  4WU9 A;  3W99 A;  4ZUX B;  3B0D B;  1KX5 D;  5B2I D;  5JRG D;  5AV5 D;  5FUG B;  1P3A B;  3AFA D;  3MGP A;  5B40 C;  5B40 A;  4NE6 A;  3W96 D;  5G49 A;  5CPI C;  5CPI A;  1W2E A;  3AV2 D;  5BT1 D;  3LEL B;  1KX3 D;  3W98 B;  3MGQ C;  3AZM D;  3WTP A;  3UT9 C;  3UT9 A;  3P5J B;  3O62 B;  4J8W A;  4J8W C;  2UWX A;  5B24 D;  4H9O B;  5GT0 A;  2BYK A;  3MGR A;  5KDM B;  3LZ0 B;  3MGR C;  1P34 D;  2F8N B;  3WAA A;  2HIO C;  2HIO A;  3REJ D;  2ARO C;  2RVQ D;  2ZM5 A;  5AY8 B;  4Z5T C;  3AV1 C;  3AV1 A;  4ZUX D;  1AOI C;  3LJA C;  3LJA A;  2FJ7 C;  3X1T B;  2BYM A;  3AZH D;  1P3A D;  4Z66 C;  4Z66 A;  4NE3 A;  4LD9 C;  4LD9 A;  5DNN C;  5DNN A;  4J8U A;  4J8U C;  3LEL D;  3KUY C;  3KUY A;  3MNN B;  1WWS A;  3W98 D;  2JE5 A;  3AYW C;  3AYW A;  3W97 B;  1P3A C;  3H0M C;  5B32 D;  1U35 B;  3AZL B;  5AVB B;  5B1M B;  5AVC C;  5AVC A;  3AZE A;  3EPL A;  3V9R B;  3UTA B;  4WU8 B;  1Q9C A;  4X23 C;  4X23 A;  1R4V A;  4CAY B;  3LZ0 D;  2F8N D;  5B1L D;  3AZG D;  4H9N B;  3AZN B;  3AZI C;  3AZI A;  2ZY3 A;  3MGS B;  5B0Y C;  5B0Y A;  5BS7 C;  5BS7 A;  1PZR A;  5CPK B;  1KX4 B;  2HUE C;  4NE5 A;  5AY8 D;  1M1A B;  2G5H C;  3EPH A;  3VH5 W;  1P3B D;  1M19 C;  1M19 A;  3X1T D;  3VH5 A;  3O62 A;  3B6F C;  3B6F A;  3AN2 D;  4AWL C;  3UTB A;  3UTB C;  1N1J B;  3WA9 C;  4JJN C;  4XUJ C;  4XUJ A;  3C1B A;  3C1B C;  4JJN A;  3REL B;  3WA9 A;  4J8X C;  4J8X A;  3REK B;  1P3O B;  1ZLA C;  2Y2Q A;  5AV9 C;  4WJ3 C;  3LZ1 B;  4HGA B;  1BH8 A;  3MNN D;  1P3L B;  3REI B;  4EO5 B;  3W97 D;  5B31 B;  3REH B;  1U35 D;  5B33 B;  3AZL D;  5JRG B;  5AVB D;  4QLC B;  1ID3 A;  1ID3 C;  5B1M D;  3X1S B;  4YM6 B;  3UTA D;  4WU8 D;  1TZY C;  1TZY A;  5GSU C;  3VH5 T;  5GXQ C;  5GSU A;  5GXQ A;  5GT3 B;  1P3P B;  2NQB B;  3AZN D;  4DRA A;  2ZY2 A;  2ZY4 A;  3MGS D;  1P3G B;  1P3I B;  1KX4 D;  5CPK D;  1M1A D;  3AZJ C;  2Y2H A;  2YFW B;  3AZJ A;  1P3M B;  3B6G B;  4Z2M H;  2PYO C;  2PYO A;  3REL D;  1S32 C;  5AV6 C;  1P3O D;  3REK D;  2RIQ A;  3R45 B;  3X1V C;  3LZ1 D;  4G92 C;  4R8P C;  1P3L D;  4H9N A;  4YS3 B;  3REI D;  3TU4 C;  3TU4 A;  1M18 C;  1M18 A;  3WKJ B;  4WU9 C;  5B2J B;  5B31 D;  3NQU B;  3REH D;  3IP4 C;  5B33 D;  4Z5T B;  4QLC D;  3AZH B;  4WZS B;  3X1S D;  3MGP C;  4YM6 D;  4XZQ B;  1N1J A;  3AZF C;  3AZF A;  3H0L C;  4KUD B;  5GT3 D;  5CPI D;  5C3I C;  1P3P D;  2NQB D;  2IO5 C;  3EG5 B;  1EQZ B;  4H9Q B;  1P3G D;  1TAF B;  4CSR A;  3WTP C;  1P3I D;  5E5A C;  5E5A A;  3MGQ D;  1P3M D;  3B6G D;  5B32 B;  1BH9 A;  3AZK B;  1KX5 A;  1KX5 C;  5B2I C;  5B2I A;  5AV5 C;  5AV5 A;  1JFI B;  3AFA C;  3AFA A;  1KU5 A;  2XD5 A;  4UUZ A;  4DRB A;  5BNV A;  1H3O B;  3W96 C;  3W96 A;  5CHL B;  5GT0 C;  5F99 B;  1F66 B;  3WAA C;  5B1L B;  3AV2 C;  3AV2 A;  5BT1 C;  1KX3 C;  1KX3 A;  3AZG B;  2DQN C;  2NZD B;  4YS3 D;  1HQ3 B;  2ARO D;  3AZM C;  3AZM A;  3WKJ D;  1Z2C B;  5B2J D;  2CV5 B;  1P3B B;  4Z5T D;  4KGC B;  1AOI D;  5B24 C;  5B24 A;  3AN2 B;  2FJ7 D;  3KSY A;  3KWQ B;  3KXB B;  4H9P A;  2YFV A;  4XZQ D;  2XD1 A;  3MVD B;  4KUD D;  5BO0 B;  1P34 C;  1P34 A;  1P3K B;  1EQZ D;  3REJ C;  3REJ A;  3F6T A;  2RVQ C;  2BG1 A;  3A6N B;  3FDD A;  4ZUX C;  4ZUX A;  3AZK D;  2Y2L A;  3AZH A;  3AZE C;  5FUG A;  1P3A A;  3C1C B; 
#chains in the Genus database with same CATH homology
 1ULY A;  5AV8 B;  5F99 D;  1F66 D;  3NQJ B;  2Y2N A;  2NZD D;  3LEL C;  3LEL A;  4J8V B;  4H9Q A;  3X1U B;  3W98 C;  3W98 A;  2Y2O A;  1HQ3 D;  5DNM B;  2CV5 D;  5CPJ B;  3KFU G;  3B0C W;  3O62 C;  4KGC D;  5B0Z B;  4H9O A;  3KWQ D;  3KXB D;  1P3F B;  4WNN B;  3MVD D;  5B32 G;  2G5I C;  2F8N K;  5KDM A;  3LZ0 A;  3LZ0 C;  1ZLA D;  4H9R B;  3A1I A;  1P3K D;  2F8N A;  5AV9 D;  5BNX B;  3X1V B;  4G92 B;  4R8P B;  4KHA B;  2DF4 C;  3A6N D;  5CP6 B;  5AY8 C;  5AY8 A;  4ZBJ B;  2Y2P A;  2F8N G;  4WU9 B;  1P3B A;  3W99 B;  3X1T C;  3X1T A;  3AN2 A;  3C1C D;  2F2A C;  3MGP B;  5B40 B;  5AV8 D;  5G49 B;  5CPI B;  3B0C T;  4J8V D;  3MNN C;  3MNN A;  3X1U D;  3VH6 W;  5DNM D;  3VH6 A;  5JA4 B;  1B6W A;  3MGQ B;  1WWI A;  3W97 C;  3W97 A;  3UT9 B;  5CPJ D;  4WV4 B;  3AZL C;  3AZL A;  5AVB C;  5AVB A;  1U35 A;  5B0Z D;  5B1M C;  5B1M A;  4J8W B;  1P3F D;  3V9R A;  3UTA C;  3UTA A;  4WU8 A;  4WU8 C;  1S32 D;  1A7W A;  5AV6 D;  4CAY A;  2BYK B;  3MGR B;  3X1V D;  3AZN C;  3AZN A;  2HIO B;  4R8P D;  2ARO B;  3MGS A;  4E45 A;  3MGS C;  1KX4 C;  1KX4 A;  5CPK A;  5CP6 D;  1M1A C;  1M1A A;  4WU9 D;  3W99 D;  3AV1 B;  1AOI B;  3LJA B;  2FJ7 B;  2BYM B;  3VH6 T;  3REL C;  4Z66 B;  3REL A;  3MGP D;  5B40 D;  1P3O C;  1P3O A;  3REK C;  3REK A;  4LD9 B;  3LZ1 C;  4HGA C;  5DNN B;  3LZ1 A;  4J8U B;  1P3L C;  1P3L A;  3KUY B;  3REI C;  3REI A;  2LY8 A;  4EO5 C;  3WTP D;  3UT9 D;  3AYW B;  5B31 C;  5B31 A;  3REH A;  3REH C;  4M6B A;  5B33 A;  4QLC C;  4QLC A;  5JRG C;  5JRG A;  5B33 C;  3EPJ A;  3X1S C;  3X1S A;  4J8W D;  4YM6 C;  4YM6 A;  5AVC B;  3AZE B;  4G91 C;  5B31 G;  5GT3 C;  5GT3 A;  5GT0 D;  4X23 B;  3WAA D;  3MGR D;  1P3P C;  1P3P A;  2NQB A;  2NQB C;  2HIO D;  2VQR A;  3AZI B;  1P3G C;  1P3G A;  3WTP E;  1P3I A;  4DQY B;  1P3I C;  5JA4 A;  5B0Y B;  4H9S C;  4H9S A;  3MGQ A;  3EPK A;  2YFW A;  2HUE B;  1P3M C;  1P3M A;  3B6G A;  2W8S A;  3B6G C;  3AV1 D;  3LJA D;  1M19 B;  2JSS A;  3B6F B;  4Z66 D;  4AWL B;  3UTB B;  1BFM A;  3WA9 B;  4JJN B;  4XUJ B;  3C1B B;  1T3U A;  4J8X B;  2CWE A;  1ZLA B;  4LD9 D;  3B0B A;  3R45 A;  5DNN D;  5AV9 B;  4J8U D;  2Y2M A;  3KUY D;  4YS3 C;  4YS3 A;  1BH8 B;  3WKJ C;  2ARO A;  3WKJ A;  2Y2G A;  5B2J C;  5B2J A;  3AYW D;  3B0D C;  3NQU A;  3AZH C;  4Z5T A;  1AOI A;  1ID3 B;  2FJ7 A;  3AZE D;  4XZQ C;  4XZQ A;  5AVC D;  2JCH A;  1B67 A;  4E44 A;  4KUD C;  4UPK A;  4KUD A;  1TZY B;  4X23 D;  5GSU B;  5GXQ B;  1EQZ C;  1EQZ A;  3AZI D;  1TAF A;  4NFT A;  5B0Y D;  3A1K A;  1F1E A;  5B32 A;  5B32 C;  3AZK A;  3AZK C;  3AZJ B;  1JFI A;  1M19 D;  2PYO B;  3O62 D;  3B6F D;  3UTB D;  1H3O A;  3WA9 D;  4JJN D;  4XUJ D;  3C1B D;  1S32 B;  5F99 C;  5F99 A;  3AL0 C;  4Z2M G;  1F66 A;  5AV6 B;  4J8X D;  1F66 C;  5B1L C;  5B1L A;  2NZD C;  2NZD A;  3AZG C;  3AZG A;  2FFF B;  1HQ3 C;  1HQ3 A;  3TU4 B;  1M18 B;  2L5A A;  2CV5 A;  2CV5 C;  1P3B C;  4KGC C;  4KGC A;  3AN2 C;  1ID3 D;  3KWQ C;  3KWQ A;  3KXB C;  3KXB A;  3MVD C;  3MVD A;  1TZY D;  3AZF B;  5GSU D;  5GXQ D;  5BO0 A;  1ZLA A;  1P3K C;  1P3K A;  5AV9 A;  5C3I B;  2IO5 B;  3A6N C;  3A6N A;  4CSR B;  3WTP B;  5E5A B;  3H0R C;  1U35 C;  3AZJ D;  1BH9 B;  1KX5 B;  2PYO D;  5B2I B;  5AV5 B;  3C1C C;  3C1C A;  3AFA B;  4UUZ B;  5AV8 C;  5BNV B;  5AV8 A;  4G91 B;  3W96 B;  5GT0 B;  3NQJ A;  2ZY5 A;  3WAA B;  4J8V C;  4J8V A;  2J8P A;  3AV2 B;  1KX3 B;  2Y2J A;  3X1U A;  3X1U C;  1HTA A;  5DNM C;  5DNM A;  3TU4 D;  5CPK C;  1M18 D;  3AZM B;  5CPJ C;  5CPJ A;  5B0Z C;  5B0Z A;  5B24 B;  1P3F C;  1P3F A;  4WNN A;  4H9P B;  2YFV B;  1S32 A;  5AV6 A;  3AZF D;  4H9R A;  1P34 B;  5BNX A;  2F8N H;  3X1V A;  3REJ B;  4R8P A;  4KHA A;  2Y2K A;  5CP6 C;  5CP6 A;  5E5A D;  4ZBJ C;  2Y2I A;  3W99 C;  4WU9 A;  3W99 A;  4ZUX B;  3B0D B;  1KX5 D;  5B2I D;  5JRG D;  5AV5 D;  5FUG B;  1P3A B;  3AFA D;  3MGP A;  5B40 C;  5B40 A;  4NE6 A;  3W96 D;  5G49 A;  5CPI C;  5CPI A;  1W2E A;  3AV2 D;  5BT1 D;  3LEL B;  1KX3 D;  3W98 B;  3MGQ C;  3AZM D;  3WTP A;  3UT9 C;  3UT9 A;  3P5J B;  3O62 B;  4J8W A;  4J8W C;  2UWX A;  5B24 D;  4H9O B;  5GT0 A;  2BYK A;  3MGR A;  5KDM B;  3LZ0 B;  3MGR C;  1P34 D;  2F8N B;  3WAA A;  2HIO C;  2HIO A;  3REJ D;  2ARO C;  2RVQ D;  2ZM5 A;  5AY8 B;  4Z5T C;  3AV1 C;  3AV1 A;  4ZUX D;  1AOI C;  3LJA C;  3LJA A;  2FJ7 C;  3X1T B;  2BYM A;  3AZH D;  1P3A D;  4Z66 C;  4Z66 A;  4NE3 A;  4LD9 C;  4LD9 A;  5DNN C;  5DNN A;  4J8U A;  4J8U C;  3LEL D;  3KUY C;  3KUY A;  3MNN B;  1WWS A;  3W98 D;  2JE5 A;  3AYW C;  3AYW A;  3W97 B;  1P3A C;  3H0M C;  5B32 D;  1U35 B;  3AZL B;  5AVB B;  5B1M B;  5AVC C;  5AVC A;  3AZE A;  3EPL A;  3V9R B;  3UTA B;  4WU8 B;  1Q9C A;  4X23 C;  4X23 A;  1R4V A;  4CAY B;  3LZ0 D;  2F8N D;  5B1L D;  3AZG D;  4H9N B;  3AZN B;  3AZI C;  3AZI A;  2ZY3 A;  3MGS B;  5B0Y C;  5B0Y A;  5BS7 C;  5BS7 A;  1PZR A;  5CPK B;  1KX4 B;  2HUE C;  4NE5 A;  5AY8 D;  1M1A B;  2G5H C;  3EPH A;  3VH5 W;  1P3B D;  1M19 C;  1M19 A;  3X1T D;  3VH5 A;  3O62 A;  3B6F C;  3B6F A;  3AN2 D;  4AWL C;  3UTB A;  3UTB C;  1N1J B;  3WA9 C;  4JJN C;  4XUJ C;  4XUJ A;  3C1B A;  3C1B C;  4JJN A;  3REL B;  3WA9 A;  4J8X C;  4J8X A;  3REK B;  1P3O B;  1ZLA C;  2Y2Q A;  5AV9 C;  4WJ3 C;  3LZ1 B;  4HGA B;  1BH8 A;  3MNN D;  1P3L B;  3REI B;  4EO5 B;  3W97 D;  5B31 B;  3REH B;  1U35 D;  5B33 B;  3AZL D;  5JRG B;  5AVB D;  4QLC B;  1ID3 A;  1ID3 C;  5B1M D;  3X1S B;  4YM6 B;  3UTA D;  4WU8 D;  1TZY C;  1TZY A;  5GSU C;  3VH5 T;  5GXQ C;  5GSU A;  5GXQ A;  5GT3 B;  1P3P B;  2NQB B;  3AZN D;  4DRA A;  2ZY2 A;  2ZY4 A;  3MGS D;  1P3G B;  1P3I B;  1KX4 D;  5CPK D;  1M1A D;  3AZJ C;  2Y2H A;  2YFW B;  3AZJ A;  1P3M B;  3B6G B;  4Z2M H;  2PYO C;  2PYO A;  3REL D;  1S32 C;  5AV6 C;  1P3O D;  3REK D;  2RIQ A;  3R45 B;  3X1V C;  3LZ1 D;  4G92 C;  4R8P C;  1P3L D;  4H9N A;  4YS3 B;  3REI D;  3TU4 C;  3TU4 A;  1M18 C;  1M18 A;  3WKJ B;  4WU9 C;  5B2J B;  5B31 D;  3NQU B;  3REH D;  3IP4 C;  5B33 D;  4Z5T B;  4QLC D;  3AZH B;  4WZS B;  3X1S D;  3MGP C;  4YM6 D;  4XZQ B;  1N1J A;  3AZF C;  3AZF A;  3H0L C;  4KUD B;  5GT3 D;  5CPI D;  5C3I C;  1P3P D;  2NQB D;  2IO5 C;  3EG5 B;  1EQZ B;  4H9Q B;  1P3G D;  1TAF B;  4CSR A;  3WTP C;  1P3I D;  5E5A C;  5E5A A;  3MGQ D;  1P3M D;  3B6G D;  5B32 B;  1BH9 A;  3AZK B;  1KX5 A;  1KX5 C;  5B2I C;  5B2I A;  5AV5 C;  5AV5 A;  1JFI B;  3AFA C;  3AFA A;  1KU5 A;  2XD5 A;  4UUZ A;  4DRB A;  5BNV A;  1H3O B;  3W96 C;  3W96 A;  5CHL B;  5GT0 C;  5F99 B;  1F66 B;  3WAA C;  5B1L B;  3AV2 C;  3AV2 A;  5BT1 C;  1KX3 C;  1KX3 A;  3AZG B;  2DQN C;  2NZD B;  4YS3 D;  1HQ3 B;  2ARO D;  3AZM C;  3AZM A;  3WKJ D;  1Z2C B;  5B2J D;  2CV5 B;  1P3B B;  4Z5T D;  4KGC B;  1AOI D;  5B24 C;  5B24 A;  3AN2 B;  2FJ7 D;  3KSY A;  3KWQ B;  3KXB B;  4H9P A;  2YFV A;  4XZQ D;  2XD1 A;  3MVD B;  4KUD D;  5BO0 B;  1P34 C;  1P34 A;  1P3K B;  1EQZ D;  3REJ C;  3REJ A;  3F6T A;  2RVQ C;  2BG1 A;  3A6N B;  3FDD A;  4ZUX C;  4ZUX A;  3AZK D;  2Y2L A;  3AZH A;  3AZE C;  5FUG A;  1P3A A;  3C1C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...