3AZND

Crystal structure of human nucleosome core particle containing h4k91q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aznD00
5DNMA 2CV5A 5DNND 2BYKA 3B6FD 2FJ7C 4EO5C 5DNNB 4WU9D 2NZDD 5B33A 4J8XB 5KDMB 3MGQA 4JJNB 1F66C 3AZJA 4YS3D 4YS3B 5AV8A 3LZ0D 4ZUXD 2LY8A 3AZHA 3MGPD 5GT3A 5CP6B 1AOIC 1ID3A 2JSSA 5CPKA 4NE5A 4LD9A 4KUDD 3WA9D 1P3MA 3B0BA 3WAAC 5JRGB 4J8VA 2F8NA 4JJND 2IO5B 4X23D 3A6NB 3REJB 1P3OA 3UTBB 5GT0A 1AOID 1HTAA 3MGPC 3MGSB 5GXQD 3LZ0C 1M19D 5AY8B 3LZ1B 4YS3C 1P3AA 5B1LD 3LJAB 5B1MC 4HGAC 2FJ7B 2FJ7D 1N1JA 2F8NG 3AZFD 3KWQB 3B6GB 4R8PC 3UTBA 3REJA 5GT0B 3W99D 5GSUC 3UTAD 1P3IC 5AV5B 3AV1A 5B24B 3W97A 3NQUA 4YM6C 4J8WB 4YM6B 5B32G 5CPIB 2CV5C 3WKJB 3REHB 5CP6A 4QLCD 4QLCB 2YFVB 3AZKB 4R8PD 4J8UC 5B32B 1P3BA 3MGQC 1F66A 5AVBD 5AV8B 3AZJC 1M1AB 5AV8C 3AZJB 1P34C 1M18B 5B1MD 5CPIA 3B6FB 3WKJA 5GT3C 4KGCB 3REID 3REIB 3AZGC 5E5AD 1BH8A 3MNNB 4LD9C 1HQ3B 3X1SA 5AV6B 4H9PB 5AV6C 2HIOA 5AVBB 1M1AD 4J8VC 3AZEC 1ZLAD 3AZLD 4G91B 2PYOB 5F99C 4H9SA 1U35C 3W99B 5B2IC 3MNNA 4UUZA 3AN2B 1P3AC 5B40D 5B40B 3A6ND 4X23B 5B1MA 3R45A 1ZLAC 5AV6D 1TAFB 3WTPB 1P3BD 5GXQB 4Z2MH 4R8PA 3UTBC 1KX5D 5CP6D 5GSUA 1S32B 3AV1C 3W97C 1P34D 3V9RB 4YM6A 3TU4B 3AV2D 3C1BB 4Z5TD 5GT3B 3MGSD 1TZYB 4J8UD 2BYMB 5CP6C 5BT1D 4WV4B 1AOIB 5G49A 3UTBD 3R45B 1M18D 4J8UA 1P3BC 3UT9B 3LELD 4M6BA 3AZNC 4XZQD 4H9NA 5B31G 1P3LB 4CAYB 4J8WD 3RELB 1P34A 5CPIC 2CV5B 3WKJC 3AZGA 2CWEA 5BNVB 5B32C 1M19A 3C1CA 3AYWD 3X1SC 3B0CW 5AV6A 2HIOC 5B24D 5B0ZB 1P3OD 3AZEA 3B0DC 4ZBJC 1S32C 2F8ND 4H9SC 5F99A 4AWLB 1U35A 2NQBC 4H9QA 5B2IA 3MNNC 4WU8C 3VH5W 3KWQC 4G92C 1ID3D 3B6GC 2HUEC 4J8XC 4WNNA 1P3FB 1ZLAA 4JJNC 5AY8D 3AN2D 3AZMC 2NZDA 4DRBA 3WAAB 1U35B 5AV9D 5B0ZC 5JRGD 2CV5D 2PYOA 4WU8D 5AVBA 3AZIA 2HIOB 2L5AA 4H9RA 3UT9D 1P3ID 4WU9C 4KGCC 3B6FC 3AZGB 3KUYB 5B2JB 1P3GD 5B0YC 3AZNA 4CAYA 4H9NB 3TU4D 3AV2B 3W96D 3MVDD 4HGAB 1P3PC 2HUEB 1TZYC 5C3IB 1KX4D 5CPJC 5B32A 3WTPD 4WU8B 1P3BB 4G91C 1M19C 3AZFA 3C1CC 4J8WC 3TU4A 3V9RA 4XZQC 4XZQB 1P3GA 5GSUB 2AROD 2IO5C 5AV5C 5CPJD 1S32A 1KX4C 5FUGA 2NQBA 1TZYD 1P3PD 3AZID 1TAFA 4WU8A 3X1UC 3C1BD 4Z66C 3KWQA 3B6GA 4DRAA 2PYOD 3VH6W 5B0YD 1KX3B 4J8XA 5BO0A 3KUYC 4NE3A 5KDMA 4JJNA 1KX5C 1BH9A 3KXBA 3REKA 1P3MD 3VH6T 1KX5B 3WA9A 1HQ3D 3AN2A 4KUDA 5CPKD 3AZMA 4CSRA 2NZDC 5AY8A 4H9RB 4XUJA 5B0ZA 5BNXB 5AV9C 5B0ZD 4XUJD 2PYOC 3AZHD 3AYWB 3AZMD 5AV8D 4J8VB 5AVBC 3AZIC 1HQ3A 4KUDB 5B2ID 5C3IC 3MGQD 5F99D 4WU9A 4KGCA 3NQJA 3B6FA 3AZED 2AROB 1BH9B 3KXBB 3REKB 1ULYA 5B0YA 5AVCC 3LZ0B 3AZHB 4WNNB 2BYMA 4Z2MG 1P3PA 1TZYA 3X1VB 5E5AC 2NQBD 4KHAA 5JA4B 3MGQB 5CPJA 2YFVA 5FUGB 2AROA 2NQBB 3AFAA 3AZFC 3MGRC 3X1TA 4J8WA 3TU4C 4NFTA 4XZQA 3AYWC 1P3GC 5B32D 3WTPA 3AZEB 5AV5A 3AV1B 5BS7C 1EQZD 1KX4A 1R4VA 1P3IB 1M19B 4Z5TA 3X1UA 4Z66A 4YM6D 3AV2A 3AZMB 3O62D 2F8NH 3AZND 3LELC 5GSUD 3UTAC 3AZNB 3KUYA 1KX5A 5B2JA 5BT1C 3KXBC 3REKC 3WAAD 3WA9C 3UT9A 1P3LA 4NE6A 3AZIB 3AN2C 4KUDC 3REHC 5AY8C 3AZKC 4XUJC 1KX4B 5B1LC 3A6NA 3MGPB 5JRGA 2F8NB 5AV9A 1KX3D 4E45A 4LD9B 3LZ1D 5GXQC 1HQ3C 5E5AB 1JFIA 4KHAB 3X1VA 5JA4A 5CPJB 1M1AA 1BFMA 3X1SD 5AVCA 2YFWB 3W98D 1JFIB 5E5AA 3LELB 2BYKB 1U35D 5F99B 3KSYA 5B31B 5B31D 5B2IB 2AROC 3AFAC 4ZUXC 3MGRA 3RELD 3X1TC 5B24A 4UUZB 1F66D 3C1CD 3AYWA 1P3FD 3WTPC 4XUJB 1P3KB 3AZGD 5BS7A 1H3OA 3VH6A 3O62B 1N1JB 5BNVA 4Z5TC 3MGRB 3MGRD 3RELA 1WWSA 3AV2C 3W97D 5B31A 3AV1D 3LELA 2RVQC 3UTAA 1M18A 1P3FC 5B2JC 1F66B 3MGSA 3UT9C 1P3LC 3REHA 3AZKA 1P3KD 3A6NC 5B1LA 5JRGC 4H9OA 3W99C 1P3AD 1ID3B 5GXQA 3X1VC 4X23A 3LJAC 3AZLB 5B40A 1B67A 1M1AC 5B1MB 1P3LD 3LZ1C 1P34B 4G92B 4WU9B 1KX3C 3KUYD 3MNND 3VH5A 5GT3D 3AZKD 3O62A 3VH5T 3AZLA 4Z5TB 1P3KA 3REHD 4Z66D 3C1BC 4ZUXA 3X1UD 2HIOD 5B24C 3AZJD 4CSRB 3B0CT 3REIA 5CPID 3WKJD 3AFAB 5DNMD 3X1TB 3X1TD 3RELC 5CPKB 3AFAD 4WZSB 5AVCB 1EQZB 1WWIA 5B31C 1EQZC 1ZLAB 1M18C 1P3FA 3MVDC 4QLCA 3W96C 4EO5B 5DNNC 5B0YB 5CHLB 3MGSC 3NQJB 4KGCD 4AWLC 3W99A 3REJD 3W98A 3C1CB 5AVCD 5DNMC 3X1VD 1Q9CA 2FJ7A 4X23C 3LJAA 1BH8B 5B33C 2F8NK 5B40C 3MVDB 3WA9B 3LZ1A 3W96B 1P3AB 3KXBD 3X1UB 3REKD 2YFWA 3AZHC 1KX3A 5BO0B 4Z66B 5G49B 4J8XD 5GT0D 4J8UB 1AOIA 1P3KC 3O62C 3AZLC 3KWQD 1ID3C 3B6GD 4J8VD 3C1BA 5CPKC 1P3MB 4LD9D 1P3MC 3WAAA 1S32D 5B2JD 3LJAD 5B1LB 1P3GB 2NZDB 4H9OB 3NQUB 4R8PB 1P3OC 3REIC 3W97B 4E44A 5GT0C 5AV9B 3AZFB 3MGPA 3LZ0A 1P3PB 4YS3A 1EQZA 5B33D 1F1EA 5AV5D 3WTPE 1A7WA 3UTAB 3MVDA 4QLCC 1KU5A 5B33B 3W96A 5DNNA 4H9QB 5DNMB 3REJC 1H3OB 3B0DB 4ZBJB 2RVQD 1P3IA 5BNXA 3W98B 4ZUXB 4H9PA 1P3OB 3W98C 1B6WA 3X1SB
chains in the Genus database with same CATH superfamily
5DNMA 2CV5A 5DNND 2BYKA 3B6FD 2FJ7C 4EO5C 5DNNB 4WU9D 2NZDD 5B33A 4J8XB 5KDMB 3MGQA 4JJNB 1F66C 3AZJA 4YS3D 4YS3B 5AV8A 3LZ0D 4ZUXD 2LY8A 3AZHA 3MGPD 5GT3A 5CP6B 1AOIC 2XD1A 1ID3A 2JSSA 5CPKA 4NE5A 2Y2HA 4LD9A 4KUDD 3WA9D 2DF4C 1P3MA 3B0BA 3WAAC 5JRGB 4J8VA 2F8NA 4JJND 2IO5B 4X23D 2JE5A 3A6NB 3REJB 1P3OA 3UTBB 2Y2LA 5GT0A 1AOID 1HTAA 3MGPC 3MGSB 5GXQD 3LZ0C 1M19D 5AY8B 3LZ1B 3P5JB 4YS3C 1P3AA 5B1LD 3H0RC 5B1MC 4HGAC 3LJAB 2FJ7B 2FJ7D 1N1JA 2F8NG 3KFUG 3AZFD 3KWQB 3B6GB 4R8PC 3UTBA 2G5IC 3REJA 5GT0B 3W99D 5GSUC 3UTAD 1P3IC 5AV5B 3AV1A 5B24B 3W97A 3NQUA 4YM6C 4J8WB 4YM6B 5B32G 5CPIB 2CV5C 3WKJB 3REHB 5CP6A 4QLCD 4QLCB 2YFVB 3AZKB 4R8PD 3H0MC 2W8SA 5B32B 4J8UC 1P3BA 3MGQC 3EPLA 5AVBD 5AV8B 3AZJC 1M1AB 1F66A 5AV8C 3AZJB 2BG1A 3AL0C 1P34C 1M18B 5B1MD 5CPIA 3B6FB 3WKJA 5GT3C 4KGCB 3REID 3REIB 3AZGC 5E5AD 1BH8A 3MNNB 4LD9C 1HQ3B 3X1SA 5AV6B 3EPHA 4H9PB 5AV6C 2HIOA 5AVBB 1M1AD 4J8VC 3AZEC 1ZLAD 3AZLD 4G91B 2PYOB 5F99C 4H9SA 1U35C 3W99B 5B2IC 3MNNA 4UUZA 3AN2B 3F6TA 1P3AC 3EG5B 4UPKA 5B40D 5B40B 3A6ND 4X23B 5B1MA 3R45A 1ZLAC 5AV6D 1TAFB 3WTPB 1P3BD 5GXQB 4Z2MH 4R8PA 3UTBC 1KX5D 5CP6D 5GSUA 1S32B 3AV1C 3W97C 1P34D 3V9RB 4YM6A 3TU4B 3AV2D 3C1BB 4Z5TD 4WJ3C 5GT3B 3MGSD 1TZYB 4J8UD 2BYMB 5CP6C 5BT1D 4WV4B 1AOIB 5G49A 3UTBD 3R45B 1M18D 4J8UA 1P3BC 3UT9B 3LELD 4M6BA 3AZNC 4XZQD 4H9NA 5B31G 1P3LB 4CAYB 4J8WD 3RELB 1P34A 3IP4C 5CPIC 2CV5B 3WKJC 3AZGA 2CWEA 5BNVB 5B32C 1M19A 3C1CA 3AYWD 3X1SC 3B0CW 5AV6A 2HIOC 5B24D 5B0ZB 1P3OD 3AZEA 3B0DC 4ZBJC 1S32C 2F8ND 4H9SC 5F99A 4AWLB 1U35A 2NQBC 4H9QA 5B2IA 3MNNC 4WU8C 3VH5W 3KWQC 4G92C 1ID3D 3B6GC 2HUEC 4J8XC 4WNNA 1P3FB 2JCHA 1ZLAA 4JJNC 5AY8D 3AN2D 2RIQA 3AZMC 2NZDA 4DRBA 3WAAB 1U35B 5AV9D 5B0ZC 5JRGD 2XD5A 2CV5D 2PYOA 4WU8D 5AVBA 3AZIA 2HIOB 2L5AA 4H9RA 3UT9D 1P3ID 2DQNC 4WU9C 4KGCC 3B6FC 3AZGB 3KUYB 5B2JB 1P3GD 5B0YC 3AZNA 4CAYA 4H9NB 3TU4D 3AV2B 3W96D 3MVDD 3A1IA 4HGAB 1P3PC 2HUEB 1TZYC 5C3IB 1KX4D 5CPJC 2FFFB 5B32A 3WTPD 2Y2GA 4WU8B 4G91C 1P3BB 1M19C 3AZFA 3C1CC 4J8WC 3TU4A 3V9RA 4XZQC 4XZQB 1P3GA 5GSUB 2AROD 2IO5C 5AV5C 5CPJD 1S32A 1KX4C 5FUGA 2NQBA 1TZYD 1P3PD 3AZID 1TAFA 4WU8A 3X1UC 3C1BD 4Z66C 3EPJA 3KWQA 3B6GA 4DRAA 2PYOD 3VH6W 5B0YD 1KX3B 4J8XA 5BO0A 3KUYC 4NE3A 5KDMA 4JJNA 1KX5C 1BH9A 3KXBA 3REKA 1P3MD 3VH6T 3FDDA 1KX5B 1PZRA 3WA9A 1HQ3D 3AN2A 4KUDA 5CPKD 2Y2QA 3AZMA 4CSRA 2NZDC 5AY8A 4H9RB 4XUJA 5B0ZA 5BNXB 5AV9C 5B0ZD 4XUJD 2PYOC 3AZHD 3AYWB 3AZMD 5AV8D 4J8VB 5AVBC 3AZIC 1HQ3A 4KUDB 5B2ID 5C3IC 3MGQD 5F99D 4WU9A 4KGCA 3NQJA 3B6FA 3AZED 2AROB 1BH9B 3KXBB 3REKB 1ULYA 5B0YA 5AVCC 3LZ0B 3AZHB 4WNNB 2BYMA 2ZY4A 4Z2MG 1P3PA 1TZYA 3X1VB 5E5AC 2NQBD 4KHAA 5JA4B 3MGQB 5CPJA 2YFVA 5FUGB 2AROA 2NQBB 3AFAA 3AZFC 3MGRC 3X1TA 1W2EA 4J8WA 3TU4C 4NFTA 4XZQA 3AYWC 1P3GC 5B32D 3WTPA 3AZEB 2Y2NA 5AV5A 3AV1B 5BS7C 1EQZD 1KX4A 1R4VA 1P3IB 1M19B 4Z5TA 2J8PA 3X1UA 4Z66A 4YM6D 3AV2A 3AZMB 3O62D 2F8NH 3AZND 1T3UA 3LELC 5GSUD 3UTAC 3AZNB 3KUYA 1KX5A 5B2JA 5BT1C 3KXBC 3REKC 3WAAD 3WA9C 3UT9A 1P3LA 4NE6A 3AZIB 3AN2C 4KUDC 3REHC 5AY8C 3AZKC 4XUJC 1KX4B 5B1LC 3A6NA 3MGPB 5JRGA 2F8NB 5AV9A 1KX3D 2Y2JA 2Y2MA 4E45A 2Y2OA 3LZ1D 4LD9B 2ZM5A 5GXQC 1HQ3C 5E5AB 1JFIA 4KHAB 3X1VA 5JA4A 5CPJB 1M1AA 1BFMA 3X1SD 5AVCA 2VQRA 2YFWB 3W98D 1JFIB 5E5AA 3LELB 2BYKB 1U35D 5F99B 3KSYA 5B31B 5B31D 5B2IB 2AROC 3AFAC 4ZUXC 3MGRA 3RELD 3X1TC 5B24A 4UUZB 1F66D 3C1CD 2Y2KA 3AYWA 1P3FD 3WTPC 4XUJB 1P3KB 3AZGD 5BS7A 1H3OA 3VH6A 3O62B 1N1JB 5BNVA 2Y2IA 4Z5TC 3MGRB 3H0LC 3MGRD 3RELA 1WWSA 3AV2C 3W97D 5B31A 3AV1D 3LELA 2RVQC 3UTAA 1M18A 1P3FC 5B2JC 1F66B 3MGSA 3UT9C 1P3LC 3REHA 3AZKA 1P3KD 5B1LA 3A6NC 5JRGC 4H9OA 3W99C 1P3AD 1ID3B 5GXQA 3X1VC 4X23A 3LJAC 3AZLB 5B40A 1B67A 1M1AC 5B1MB 1P3LD 3LZ1C 1P34B 2Y2PA 4G92B 4WU9B 1KX3C 3KUYD 3MNND 3VH5A 5GT3D 3AZKD 3O62A 3VH5T 3AZLA 4Z5TB 1P3KA 3REHD 4Z66D 3C1BC 4ZUXA 3X1UD 2HIOD 5B24C 3AZJD 3A1KA 4CSRB 3B0CT 3REIA 5CPID 3WKJD 3AFAB 5DNMD 3X1TB 3X1TD 3RELC 5CPKB 3AFAD 4WZSB 5AVCB 1EQZB 1WWIA 5B31C 1EQZC 1ZLAB 1Z2CB 1M18C 1P3FA 3MVDC 4QLCA 3W96C 4EO5B 5DNNC 5B0YB 5CHLB 3MGSC 3NQJB 4KGCD 4AWLC 3W99A 3REJD 2ZY3A 3W98A 2F2AC 3C1CB 5AVCD 5DNMC 3EPKA 3X1VD 1Q9CA 2FJ7A 4X23C 3LJAA 1BH8B 5B33C 2F8NK 5B40C 3MVDB 3WA9B 3LZ1A 3W96B 1P3AB 3KXBD 3X1UB 3REKD 2YFWA 3AZHC 1KX3A 5BO0B 4Z66B 5G49B 2UWXA 4J8XD 5GT0D 4J8UB 1AOIA 1P3KC 3O62C 3AZLC 3KWQD 1ID3C 3B6GD 4J8VD 3C1BA 5CPKC 2ZY2A 1P3MB 4LD9D 1P3MC 3WAAA 1S32D 5B2JD 3LJAD 5B1LB 1P3GB 2NZDB 2G5HC 4H9OB 3NQUB 4R8PB 1P3OC 4DQYB 3REIC 3W97B 4E44A 5GT0C 5AV9B 3AZFB 3MGPA 3LZ0A 1P3PB 4YS3A 1EQZA 5B33D 1F1EA 5AV5D 3WTPE 1A7WA 3UTAB 2ZY5A 3MVDA 4QLCC 1KU5A 5B33B 3W96A 5DNNA 4H9QB 5DNMB 3REJC 1H3OB 3B0DB 4ZBJB 2RVQD 1P3IA 5BNXA 3W98B 4ZUXB 4H9PA 1P3OB 3W98C 1B6WA 3X1SB
chains in the Genus database with same CATH topology
5DNMA 2CV5A 5DNND 2BYKA 3B6FD 2FJ7C 4EO5C 5DNNB 4WU9D 2NZDD 5B33A 4J8XB 5KDMB 3MGQA 4JJNB 1F66C 3AZJA 4YS3D 4YS3B 5AV8A 3LZ0D 4ZUXD 2LY8A 3AZHA 3MGPD 5GT3A 5CP6B 1AOIC 2XD1A 1ID3A 2JSSA 5CPKA 4NE5A 2Y2HA 4LD9A 4KUDD 3WA9D 2DF4C 1P3MA 3B0BA 3WAAC 5JRGB 4J8VA 2F8NA 4JJND 2IO5B 4X23D 2JE5A 3A6NB 3REJB 1P3OA 3UTBB 2Y2LA 5GT0A 1AOID 1HTAA 3MGPC 3MGSB 5GXQD 3LZ0C 1M19D 5AY8B 3LZ1B 3P5JB 4YS3C 1P3AA 5B1LD 3H0RC 5B1MC 4HGAC 3LJAB 2FJ7B 2FJ7D 1N1JA 2F8NG 3KFUG 3AZFD 3KWQB 3B6GB 4R8PC 3UTBA 2G5IC 3REJA 5GT0B 3W99D 5GSUC 3UTAD 1P3IC 5AV5B 3AV1A 5B24B 3W97A 3NQUA 4YM6C 4J8WB 4YM6B 5B32G 5CPIB 2CV5C 3WKJB 3REHB 5CP6A 4QLCD 4QLCB 2YFVB 3AZKB 4R8PD 3H0MC 2W8SA 5B32B 4J8UC 1P3BA 3MGQC 3EPLA 5AVBD 5AV8B 3AZJC 1M1AB 1F66A 5AV8C 3AZJB 2BG1A 3AL0C 1P34C 1M18B 5B1MD 5CPIA 3B6FB 3WKJA 5GT3C 4KGCB 3REID 3REIB 3AZGC 5E5AD 1BH8A 3MNNB 4LD9C 1HQ3B 3X1SA 5AV6B 3EPHA 4H9PB 5AV6C 2HIOA 5AVBB 1M1AD 4J8VC 3AZEC 1ZLAD 3AZLD 4G91B 2PYOB 5F99C 4H9SA 1U35C 3W99B 5B2IC 3MNNA 4UUZA 3AN2B 3F6TA 1P3AC 3EG5B 4UPKA 5B40D 5B40B 3A6ND 4X23B 5B1MA 3R45A 1ZLAC 5AV6D 1TAFB 3WTPB 1P3BD 5GXQB 4Z2MH 4R8PA 3UTBC 1KX5D 5CP6D 5GSUA 1S32B 3AV1C 3W97C 1P34D 3V9RB 4YM6A 3TU4B 3AV2D 3C1BB 4Z5TD 4WJ3C 5GT3B 3MGSD 1TZYB 4J8UD 2BYMB 5CP6C 5BT1D 4WV4B 1AOIB 5G49A 3UTBD 3R45B 1M18D 4J8UA 1P3BC 3UT9B 3LELD 4M6BA 3AZNC 4XZQD 4H9NA 5B31G 1P3LB 4CAYB 4J8WD 3RELB 1P34A 3IP4C 5CPIC 2CV5B 3WKJC 3AZGA 2CWEA 5BNVB 5B32C 1M19A 3C1CA 3AYWD 3X1SC 3B0CW 5AV6A 2HIOC 5B24D 5B0ZB 1P3OD 3AZEA 3B0DC 4ZBJC 1S32C 2F8ND 4H9SC 5F99A 4AWLB 1U35A 2NQBC 4H9QA 5B2IA 3MNNC 4WU8C 3VH5W 3KWQC 4G92C 1ID3D 3B6GC 2HUEC 4J8XC 4WNNA 1P3FB 2JCHA 1ZLAA 4JJNC 5AY8D 3AN2D 2RIQA 3AZMC 2NZDA 4DRBA 3WAAB 1U35B 5AV9D 5B0ZC 5JRGD 2XD5A 2CV5D 2PYOA 4WU8D 5AVBA 3AZIA 2HIOB 2L5AA 4H9RA 3UT9D 1P3ID 2DQNC 4WU9C 4KGCC 3B6FC 3AZGB 3KUYB 5B2JB 1P3GD 5B0YC 3AZNA 4CAYA 4H9NB 3TU4D 3AV2B 3W96D 3MVDD 3A1IA 4HGAB 1P3PC 2HUEB 1TZYC 5C3IB 1KX4D 5CPJC 2FFFB 5B32A 3WTPD 2Y2GA 4WU8B 4G91C 1P3BB 1M19C 3AZFA 3C1CC 4J8WC 3TU4A 3V9RA 4XZQC 4XZQB 1P3GA 5GSUB 2AROD 2IO5C 5AV5C 5CPJD 1S32A 1KX4C 5FUGA 2NQBA 1TZYD 1P3PD 3AZID 1TAFA 4WU8A 3X1UC 3C1BD 4Z66C 3EPJA 3KWQA 3B6GA 4DRAA 2PYOD 3VH6W 5B0YD 1KX3B 4J8XA 5BO0A 3KUYC 4NE3A 5KDMA 4JJNA 1KX5C 1BH9A 3KXBA 3REKA 1P3MD 3VH6T 3FDDA 1KX5B 1PZRA 3WA9A 1HQ3D 3AN2A 4KUDA 5CPKD 2Y2QA 3AZMA 4CSRA 2NZDC 5AY8A 4H9RB 4XUJA 5B0ZA 5BNXB 5AV9C 5B0ZD 4XUJD 2PYOC 3AZHD 3AYWB 3AZMD 5AV8D 4J8VB 5AVBC 3AZIC 1HQ3A 4KUDB 5B2ID 5C3IC 3MGQD 5F99D 4WU9A 4KGCA 3NQJA 3B6FA 3AZED 2AROB 1BH9B 3KXBB 3REKB 1ULYA 5B0YA 5AVCC 3LZ0B 3AZHB 4WNNB 2BYMA 2ZY4A 4Z2MG 1P3PA 1TZYA 3X1VB 5E5AC 2NQBD 4KHAA 5JA4B 3MGQB 5CPJA 2YFVA 5FUGB 2AROA 2NQBB 3AFAA 3AZFC 3MGRC 3X1TA 1W2EA 4J8WA 3TU4C 4NFTA 4XZQA 3AYWC 1P3GC 5B32D 3WTPA 3AZEB 2Y2NA 5AV5A 3AV1B 5BS7C 1EQZD 1KX4A 1R4VA 1P3IB 1M19B 4Z5TA 2J8PA 3X1UA 4Z66A 4YM6D 3AV2A 3AZMB 3O62D 2F8NH 3AZND 1T3UA 3LELC 5GSUD 3UTAC 3AZNB 3KUYA 1KX5A 5B2JA 5BT1C 3KXBC 3REKC 3WAAD 3WA9C 3UT9A 1P3LA 4NE6A 3AZIB 3AN2C 4KUDC 3REHC 5AY8C 3AZKC 4XUJC 1KX4B 5B1LC 3A6NA 3MGPB 5JRGA 2F8NB 5AV9A 1KX3D 2Y2JA 2Y2MA 4E45A 2Y2OA 3LZ1D 4LD9B 2ZM5A 5GXQC 1HQ3C 5E5AB 1JFIA 4KHAB 3X1VA 5JA4A 5CPJB 1M1AA 1BFMA 3X1SD 5AVCA 2VQRA 2YFWB 3W98D 1JFIB 5E5AA 3LELB 2BYKB 1U35D 5F99B 3KSYA 5B31B 5B31D 5B2IB 2AROC 3AFAC 4ZUXC 3MGRA 3RELD 3X1TC 5B24A 4UUZB 1F66D 3C1CD 2Y2KA 3AYWA 1P3FD 3WTPC 4XUJB 1P3KB 3AZGD 5BS7A 1H3OA 3VH6A 3O62B 1N1JB 5BNVA 2Y2IA 4Z5TC 3MGRB 3H0LC 3MGRD 3RELA 1WWSA 3AV2C 3W97D 5B31A 3AV1D 3LELA 2RVQC 3UTAA 1M18A 1P3FC 5B2JC 1F66B 3MGSA 3UT9C 1P3LC 3REHA 3AZKA 1P3KD 5B1LA 3A6NC 5JRGC 4H9OA 3W99C 1P3AD 1ID3B 5GXQA 3X1VC 4X23A 3LJAC 3AZLB 5B40A 1B67A 1M1AC 5B1MB 1P3LD 3LZ1C 1P34B 2Y2PA 4G92B 4WU9B 1KX3C 3KUYD 3MNND 3VH5A 5GT3D 3AZKD 3O62A 3VH5T 3AZLA 4Z5TB 1P3KA 3REHD 4Z66D 3C1BC 4ZUXA 3X1UD 2HIOD 5B24C 3AZJD 3A1KA 4CSRB 3B0CT 3REIA 5CPID 3WKJD 3AFAB 5DNMD 3X1TB 3X1TD 3RELC 5CPKB 3AFAD 4WZSB 5AVCB 1EQZB 1WWIA 5B31C 1EQZC 1ZLAB 1Z2CB 1M18C 1P3FA 3MVDC 4QLCA 3W96C 4EO5B 5DNNC 5B0YB 5CHLB 3MGSC 3NQJB 4KGCD 4AWLC 3W99A 3REJD 2ZY3A 3W98A 2F2AC 3C1CB 5AVCD 5DNMC 3EPKA 3X1VD 1Q9CA 2FJ7A 4X23C 3LJAA 1BH8B 5B33C 2F8NK 5B40C 3MVDB 3WA9B 3LZ1A 3W96B 1P3AB 3KXBD 3X1UB 3REKD 2YFWA 3AZHC 1KX3A 5BO0B 4Z66B 5G49B 2UWXA 4J8XD 5GT0D 4J8UB 1AOIA 1P3KC 3O62C 3AZLC 3KWQD 1ID3C 3B6GD 4J8VD 3C1BA 5CPKC 2ZY2A 1P3MB 4LD9D 1P3MC 3WAAA 1S32D 5B2JD 3LJAD 5B1LB 1P3GB 2NZDB 2G5HC 4H9OB 3NQUB 4R8PB 1P3OC 4DQYB 3REIC 3W97B 4E44A 5GT0C 5AV9B 3AZFB 3MGPA 3LZ0A 1P3PB 4YS3A 1EQZA 5B33D 1F1EA 5AV5D 3WTPE 1A7WA 3UTAB 2ZY5A 3MVDA 4QLCC 1KU5A 5B33B 3W96A 5DNNA 4H9QB 5DNMB 3REJC 1H3OB 3B0DB 4ZBJB 2RVQD 1P3IA 5BNXA 3W98B 4ZUXB 4H9PA 1P3OB 3W98C 1B6WA 3X1SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM A;  2CV5 A;  5DNN D;  2BYK A;  3B6F D;  2FJ7 C;  4EO5 C;  5DNN B;  4WU9 D;  2NZD D;  5B33 A;  4J8X B;  5KDM B;  3MGQ A;  4JJN B;  1F66 C;  3AZJ A;  4YS3 D;  4YS3 B;  5AV8 A;  3LZ0 D;  4ZUX D;  2LY8 A;  3AZH A;  3MGP D;  5GT3 A;  5CP6 B;  1AOI C;  1ID3 A;  2JSS A;  5CPK A;  4NE5 A;  4LD9 A;  4KUD D;  3WA9 D;  1P3M A;  3B0B A;  3WAA C;  5JRG B;  4J8V A;  2F8N A;  4JJN D;  2IO5 B;  4X23 D;  3A6N B;  3REJ B;  1P3O A;  3UTB B;  5GT0 A;  1AOI D;  1HTA A;  3MGP C;  3MGS B;  5GXQ D;  3LZ0 C;  1M19 D;  5AY8 B;  3LZ1 B;  4YS3 C;  1P3A A;  5B1L D;  3LJA B;  5B1M C;  4HGA C;  2FJ7 B;  2FJ7 D;  1N1J A;  2F8N G;  3AZF D;  3KWQ B;  3B6G B;  4R8P C;  3UTB A;  3REJ A;  5GT0 B;  3W99 D;  5GSU C;  3UTA D;  1P3I C;  5AV5 B;  3AV1 A;  5B24 B;  3W97 A;  3NQU A;  4YM6 C;  4J8W B;  4YM6 B;  5B32 G;  5CPI B;  2CV5 C;  3WKJ B;  3REH B;  5CP6 A;  4QLC D;  4QLC B;  2YFV B;  3AZK B;  4R8P D;  4J8U C;  5B32 B;  1P3B A;  3MGQ C;  1F66 A;  5AVB D;  5AV8 B;  3AZJ C;  1M1A B;  5AV8 C;  3AZJ B;  1P34 C;  1M18 B;  5B1M D;  5CPI A;  3B6F B;  3WKJ A;  5GT3 C;  4KGC B;  3REI D;  3REI B;  3AZG C;  5E5A D;  1BH8 A;  3MNN B;  4LD9 C;  1HQ3 B;  3X1S A;  5AV6 B;  4H9P B;  5AV6 C;  2HIO A;  5AVB B;  1M1A D;  4J8V C;  3AZE C;  1ZLA D;  3AZL D;  4G91 B;  2PYO B;  5F99 C;  4H9S A;  1U35 C;  3W99 B;  5B2I C;  3MNN A;  4UUZ A;  3AN2 B;  1P3A C;  5B40 D;  5B40 B;  3A6N D;  4X23 B;  5B1M A;  3R45 A;  1ZLA C;  5AV6 D;  1TAF B;  3WTP B;  1P3B D;  5GXQ B;  4Z2M H;  4R8P A;  3UTB C;  1KX5 D;  5CP6 D;  5GSU A;  1S32 B;  3AV1 C;  3W97 C;  1P34 D;  3V9R B;  4YM6 A;  3TU4 B;  3AV2 D;  3C1B B;  4Z5T D;  5GT3 B;  3MGS D;  1TZY B;  4J8U D;  2BYM B;  5CP6 C;  5BT1 D;  4WV4 B;  1AOI B;  5G49 A;  3UTB D;  3R45 B;  1M18 D;  4J8U A;  1P3B C;  3UT9 B;  3LEL D;  4M6B A;  3AZN C;  4XZQ D;  4H9N A;  5B31 G;  1P3L B;  4CAY B;  4J8W D;  3REL B;  1P34 A;  5CPI C;  2CV5 B;  3WKJ C;  3AZG A;  2CWE A;  5BNV B;  5B32 C;  1M19 A;  3C1C A;  3AYW D;  3X1S C;  3B0C W;  5AV6 A;  2HIO C;  5B24 D;  5B0Z B;  1P3O D;  3AZE A;  3B0D C;  4ZBJ C;  1S32 C;  2F8N D;  4H9S C;  5F99 A;  4AWL B;  1U35 A;  2NQB C;  4H9Q A;  5B2I A;  3MNN C;  4WU8 C;  3VH5 W;  3KWQ C;  4G92 C;  1ID3 D;  3B6G C;  2HUE C;  4J8X C;  4WNN A;  1P3F B;  1ZLA A;  4JJN C;  5AY8 D;  3AN2 D;  3AZM C;  2NZD A;  4DRB A;  3WAA B;  1U35 B;  5AV9 D;  5B0Z C;  5JRG D;  2CV5 D;  2PYO A;  4WU8 D;  5AVB A;  3AZI A;  2HIO B;  2L5A A;  4H9R A;  3UT9 D;  1P3I D;  4WU9 C;  4KGC C;  3B6F C;  3AZG B;  3KUY B;  5B2J B;  1P3G D;  5B0Y C;  3AZN A;  4CAY A;  4H9N B;  3TU4 D;  3AV2 B;  3W96 D;  3MVD D;  4HGA B;  1P3P C;  2HUE B;  1TZY C;  5C3I B;  1KX4 D;  5CPJ C;  5B32 A;  3WTP D;  4WU8 B;  1P3B B;  4G91 C;  1M19 C;  3AZF A;  3C1C C;  4J8W C;  3TU4 A;  3V9R A;  4XZQ C;  4XZQ B;  1P3G A;  5GSU B;  2ARO D;  2IO5 C;  5AV5 C;  5CPJ D;  1S32 A;  1KX4 C;  5FUG A;  2NQB A;  1TZY D;  1P3P D;  3AZI D;  1TAF A;  4WU8 A;  3X1U C;  3C1B D;  4Z66 C;  3KWQ A;  3B6G A;  4DRA A;  2PYO D;  3VH6 W;  5B0Y D;  1KX3 B;  4J8X A;  5BO0 A;  3KUY C;  4NE3 A;  5KDM A;  4JJN A;  1KX5 C;  1BH9 A;  3KXB A;  3REK A;  1P3M D;  3VH6 T;  1KX5 B;  3WA9 A;  1HQ3 D;  3AN2 A;  4KUD A;  5CPK D;  3AZM A;  4CSR A;  2NZD C;  5AY8 A;  4H9R B;  4XUJ A;  5B0Z A;  5BNX B;  5AV9 C;  5B0Z D;  4XUJ D;  2PYO C;  3AZH D;  3AYW B;  3AZM D;  5AV8 D;  4J8V B;  5AVB C;  3AZI C;  1HQ3 A;  4KUD B;  5B2I D;  5C3I C;  3MGQ D;  5F99 D;  4WU9 A;  4KGC A;  3NQJ A;  3B6F A;  3AZE D;  2ARO B;  1BH9 B;  3KXB B;  3REK B;  1ULY A;  5B0Y A;  5AVC C;  3LZ0 B;  3AZH B;  4WNN B;  2BYM A;  4Z2M G;  1P3P A;  1TZY A;  3X1V B;  5E5A C;  2NQB D;  4KHA A;  5JA4 B;  3MGQ B;  5CPJ A;  2YFV A;  5FUG B;  2ARO A;  2NQB B;  3AFA A;  3AZF C;  3MGR C;  3X1T A;  4J8W A;  3TU4 C;  4NFT A;  4XZQ A;  3AYW C;  1P3G C;  5B32 D;  3WTP A;  3AZE B;  5AV5 A;  3AV1 B;  5BS7 C;  1EQZ D;  1KX4 A;  1R4V A;  1P3I B;  1M19 B;  4Z5T A;  3X1U A;  4Z66 A;  4YM6 D;  3AV2 A;  3AZM B;  3O62 D;  2F8N H;  3AZN D;  3LEL C;  5GSU D;  3UTA C;  3AZN B;  3KUY A;  1KX5 A;  5B2J A;  5BT1 C;  3KXB C;  3REK C;  3WAA D;  3WA9 C;  3UT9 A;  1P3L A;  4NE6 A;  3AZI B;  3AN2 C;  4KUD C;  3REH C;  5AY8 C;  3AZK C;  4XUJ C;  1KX4 B;  5B1L C;  3A6N A;  3MGP B;  5JRG A;  2F8N B;  5AV9 A;  1KX3 D;  4E45 A;  4LD9 B;  3LZ1 D;  5GXQ C;  1HQ3 C;  5E5A B;  1JFI A;  4KHA B;  3X1V A;  5JA4 A;  5CPJ B;  1M1A A;  1BFM A;  3X1S D;  5AVC A;  2YFW B;  3W98 D;  1JFI B;  5E5A A;  3LEL B;  2BYK B;  1U35 D;  5F99 B;  3KSY A;  5B31 B;  5B31 D;  5B2I B;  2ARO C;  3AFA C;  4ZUX C;  3MGR A;  3REL D;  3X1T C;  5B24 A;  4UUZ B;  1F66 D;  3C1C D;  3AYW A;  1P3F D;  3WTP C;  4XUJ B;  1P3K B;  3AZG D;  5BS7 A;  1H3O A;  3VH6 A;  3O62 B;  1N1J B;  5BNV A;  4Z5T C;  3MGR B;  3MGR D;  3REL A;  1WWS A;  3AV2 C;  3W97 D;  5B31 A;  3AV1 D;  3LEL A;  2RVQ C;  3UTA A;  1M18 A;  1P3F C;  5B2J C;  1F66 B;  3MGS A;  3UT9 C;  1P3L C;  3REH A;  3AZK A;  1P3K D;  3A6N C;  5B1L A;  5JRG C;  4H9O A;  3W99 C;  1P3A D;  1ID3 B;  5GXQ A;  3X1V C;  4X23 A;  3LJA C;  3AZL B;  5B40 A;  1B67 A;  1M1A C;  5B1M B;  1P3L D;  3LZ1 C;  1P34 B;  4G92 B;  4WU9 B;  1KX3 C;  3KUY D;  3MNN D;  3VH5 A;  5GT3 D;  3AZK D;  3O62 A;  3VH5 T;  3AZL A;  4Z5T B;  1P3K A;  3REH D;  4Z66 D;  3C1B C;  4ZUX A;  3X1U D;  2HIO D;  5B24 C;  3AZJ D;  4CSR B;  3B0C T;  3REI A;  5CPI D;  3WKJ D;  3AFA B;  5DNM D;  3X1T B;  3X1T D;  3REL C;  5CPK B;  3AFA D;  4WZS B;  5AVC B;  1EQZ B;  1WWI A;  5B31 C;  1EQZ C;  1ZLA B;  1M18 C;  1P3F A;  3MVD C;  4QLC A;  3W96 C;  4EO5 B;  5DNN C;  5B0Y B;  5CHL B;  3MGS C;  3NQJ B;  4KGC D;  4AWL C;  3W99 A;  3REJ D;  3W98 A;  3C1C B;  5AVC D;  5DNM C;  3X1V D;  1Q9C A;  2FJ7 A;  4X23 C;  3LJA A;  1BH8 B;  5B33 C;  2F8N K;  5B40 C;  3MVD B;  3WA9 B;  3LZ1 A;  3W96 B;  1P3A B;  3KXB D;  3X1U B;  3REK D;  2YFW A;  3AZH C;  1KX3 A;  5BO0 B;  4Z66 B;  5G49 B;  4J8X D;  5GT0 D;  4J8U B;  1AOI A;  1P3K C;  3O62 C;  3AZL C;  3KWQ D;  1ID3 C;  3B6G D;  4J8V D;  3C1B A;  5CPK C;  1P3M B;  4LD9 D;  1P3M C;  3WAA A;  1S32 D;  5B2J D;  3LJA D;  5B1L B;  1P3G B;  2NZD B;  4H9O B;  3NQU B;  4R8P B;  1P3O C;  3REI C;  3W97 B;  4E44 A;  5GT0 C;  5AV9 B;  3AZF B;  3MGP A;  3LZ0 A;  1P3P B;  4YS3 A;  1EQZ A;  5B33 D;  1F1E A;  5AV5 D;  3WTP E;  1A7W A;  3UTA B;  3MVD A;  4QLC C;  1KU5 A;  5B33 B;  3W96 A;  5DNN A;  4H9Q B;  5DNM B;  3REJ C;  1H3O B;  3B0D B;  4ZBJ B;  2RVQ D;  1P3I A;  5BNX A;  3W98 B;  4ZUX B;  4H9P A;  1P3O B;  3W98 C;  1B6W A;  3X1S B; 
#chains in the Genus database with same CATH topology
 5DNM A;  2CV5 A;  5DNN D;  2BYK A;  3B6F D;  2FJ7 C;  4EO5 C;  5DNN B;  4WU9 D;  2NZD D;  5B33 A;  4J8X B;  5KDM B;  3MGQ A;  4JJN B;  1F66 C;  3AZJ A;  4YS3 D;  4YS3 B;  5AV8 A;  3LZ0 D;  4ZUX D;  2LY8 A;  3AZH A;  3MGP D;  5GT3 A;  5CP6 B;  1AOI C;  2XD1 A;  1ID3 A;  2JSS A;  5CPK A;  4NE5 A;  2Y2H A;  4LD9 A;  4KUD D;  3WA9 D;  2DF4 C;  1P3M A;  3B0B A;  3WAA C;  5JRG B;  4J8V A;  2F8N A;  4JJN D;  2IO5 B;  4X23 D;  2JE5 A;  3A6N B;  3REJ B;  1P3O A;  3UTB B;  2Y2L A;  5GT0 A;  1AOI D;  1HTA A;  3MGP C;  3MGS B;  5GXQ D;  3LZ0 C;  1M19 D;  5AY8 B;  3LZ1 B;  3P5J B;  4YS3 C;  1P3A A;  5B1L D;  3H0R C;  5B1M C;  4HGA C;  3LJA B;  2FJ7 B;  2FJ7 D;  1N1J A;  2F8N G;  3KFU G;  3AZF D;  3KWQ B;  3B6G B;  4R8P C;  3UTB A;  2G5I C;  3REJ A;  5GT0 B;  3W99 D;  5GSU C;  3UTA D;  1P3I C;  5AV5 B;  3AV1 A;  5B24 B;  3W97 A;  3NQU A;  4YM6 C;  4J8W B;  4YM6 B;  5B32 G;  5CPI B;  2CV5 C;  3WKJ B;  3REH B;  5CP6 A;  4QLC D;  4QLC B;  2YFV B;  3AZK B;  4R8P D;  3H0M C;  2W8S A;  5B32 B;  4J8U C;  1P3B A;  3MGQ C;  3EPL A;  5AVB D;  5AV8 B;  3AZJ C;  1M1A B;  1F66 A;  5AV8 C;  3AZJ B;  2BG1 A;  3AL0 C;  1P34 C;  1M18 B;  5B1M D;  5CPI A;  3B6F B;  3WKJ A;  5GT3 C;  4KGC B;  3REI D;  3REI B;  3AZG C;  5E5A D;  1BH8 A;  3MNN B;  4LD9 C;  1HQ3 B;  3X1S A;  5AV6 B;  3EPH A;  4H9P B;  5AV6 C;  2HIO A;  5AVB B;  1M1A D;  4J8V C;  3AZE C;  1ZLA D;  3AZL D;  4G91 B;  2PYO B;  5F99 C;  4H9S A;  1U35 C;  3W99 B;  5B2I C;  3MNN A;  4UUZ A;  3AN2 B;  3F6T A;  1P3A C;  3EG5 B;  4UPK A;  5B40 D;  5B40 B;  3A6N D;  4X23 B;  5B1M A;  3R45 A;  1ZLA C;  5AV6 D;  1TAF B;  3WTP B;  1P3B D;  5GXQ B;  4Z2M H;  4R8P A;  3UTB C;  1KX5 D;  5CP6 D;  5GSU A;  1S32 B;  3AV1 C;  3W97 C;  1P34 D;  3V9R B;  4YM6 A;  3TU4 B;  3AV2 D;  3C1B B;  4Z5T D;  4WJ3 C;  5GT3 B;  3MGS D;  1TZY B;  4J8U D;  2BYM B;  5CP6 C;  5BT1 D;  4WV4 B;  1AOI B;  5G49 A;  3UTB D;  3R45 B;  1M18 D;  4J8U A;  1P3B C;  3UT9 B;  3LEL D;  4M6B A;  3AZN C;  4XZQ D;  4H9N A;  5B31 G;  1P3L B;  4CAY B;  4J8W D;  3REL B;  1P34 A;  3IP4 C;  5CPI C;  2CV5 B;  3WKJ C;  3AZG A;  2CWE A;  5BNV B;  5B32 C;  1M19 A;  3C1C A;  3AYW D;  3X1S C;  3B0C W;  5AV6 A;  2HIO C;  5B24 D;  5B0Z B;  1P3O D;  3AZE A;  3B0D C;  4ZBJ C;  1S32 C;  2F8N D;  4H9S C;  5F99 A;  4AWL B;  1U35 A;  2NQB C;  4H9Q A;  5B2I A;  3MNN C;  4WU8 C;  3VH5 W;  3KWQ C;  4G92 C;  1ID3 D;  3B6G C;  2HUE C;  4J8X C;  4WNN A;  1P3F B;  2JCH A;  1ZLA A;  4JJN C;  5AY8 D;  3AN2 D;  2RIQ A;  3AZM C;  2NZD A;  4DRB A;  3WAA B;  1U35 B;  5AV9 D;  5B0Z C;  5JRG D;  2XD5 A;  2CV5 D;  2PYO A;  4WU8 D;  5AVB A;  3AZI A;  2HIO B;  2L5A A;  4H9R A;  3UT9 D;  1P3I D;  2DQN C;  4WU9 C;  4KGC C;  3B6F C;  3AZG B;  3KUY B;  5B2J B;  1P3G D;  5B0Y C;  3AZN A;  4CAY A;  4H9N B;  3TU4 D;  3AV2 B;  3W96 D;  3MVD D;  3A1I A;  4HGA B;  1P3P C;  2HUE B;  1TZY C;  5C3I B;  1KX4 D;  5CPJ C;  2FFF B;  5B32 A;  3WTP D;  2Y2G A;  4WU8 B;  4G91 C;  1P3B B;  1M19 C;  3AZF A;  3C1C C;  4J8W C;  3TU4 A;  3V9R A;  4XZQ C;  4XZQ B;  1P3G A;  5GSU B;  2ARO D;  2IO5 C;  5AV5 C;  5CPJ D;  1S32 A;  1KX4 C;  5FUG A;  2NQB A;  1TZY D;  1P3P D;  3AZI D;  1TAF A;  4WU8 A;  3X1U C;  3C1B D;  4Z66 C;  3EPJ A;  3KWQ A;  3B6G A;  4DRA A;  2PYO D;  3VH6 W;  5B0Y D;  1KX3 B;  4J8X A;  5BO0 A;  3KUY C;  4NE3 A;  5KDM A;  4JJN A;  1KX5 C;  1BH9 A;  3KXB A;  3REK A;  1P3M D;  3VH6 T;  3FDD A;  1KX5 B;  1PZR A;  3WA9 A;  1HQ3 D;  3AN2 A;  4KUD A;  5CPK D;  2Y2Q A;  3AZM A;  4CSR A;  2NZD C;  5AY8 A;  4H9R B;  4XUJ A;  5B0Z A;  5BNX B;  5AV9 C;  5B0Z D;  4XUJ D;  2PYO C;  3AZH D;  3AYW B;  3AZM D;  5AV8 D;  4J8V B;  5AVB C;  3AZI C;  1HQ3 A;  4KUD B;  5B2I D;  5C3I C;  3MGQ D;  5F99 D;  4WU9 A;  4KGC A;  3NQJ A;  3B6F A;  3AZE D;  2ARO B;  1BH9 B;  3KXB B;  3REK B;  1ULY A;  5B0Y A;  5AVC C;  3LZ0 B;  3AZH B;  4WNN B;  2BYM A;  2ZY4 A;  4Z2M G;  1P3P A;  1TZY A;  3X1V B;  5E5A C;  2NQB D;  4KHA A;  5JA4 B;  3MGQ B;  5CPJ A;  2YFV A;  5FUG B;  2ARO A;  2NQB B;  3AFA A;  3AZF C;  3MGR C;  3X1T A;  1W2E A;  4J8W A;  3TU4 C;  4NFT A;  4XZQ A;  3AYW C;  1P3G C;  5B32 D;  3WTP A;  3AZE B;  2Y2N A;  5AV5 A;  3AV1 B;  5BS7 C;  1EQZ D;  1KX4 A;  1R4V A;  1P3I B;  1M19 B;  4Z5T A;  2J8P A;  3X1U A;  4Z66 A;  4YM6 D;  3AV2 A;  3AZM B;  3O62 D;  2F8N H;  3AZN D;  1T3U A;  3LEL C;  5GSU D;  3UTA C;  3AZN B;  3KUY A;  1KX5 A;  5B2J A;  5BT1 C;  3KXB C;  3REK C;  3WAA D;  3WA9 C;  3UT9 A;  1P3L A;  4NE6 A;  3AZI B;  3AN2 C;  4KUD C;  3REH C;  5AY8 C;  3AZK C;  4XUJ C;  1KX4 B;  5B1L C;  3A6N A;  3MGP B;  5JRG A;  2F8N B;  5AV9 A;  1KX3 D;  2Y2J A;  2Y2M A;  4E45 A;  2Y2O A;  3LZ1 D;  4LD9 B;  2ZM5 A;  5GXQ C;  1HQ3 C;  5E5A B;  1JFI A;  4KHA B;  3X1V A;  5JA4 A;  5CPJ B;  1M1A A;  1BFM A;  3X1S D;  5AVC A;  2VQR A;  2YFW B;  3W98 D;  1JFI B;  5E5A A;  3LEL B;  2BYK B;  1U35 D;  5F99 B;  3KSY A;  5B31 B;  5B31 D;  5B2I B;  2ARO C;  3AFA C;  4ZUX C;  3MGR A;  3REL D;  3X1T C;  5B24 A;  4UUZ B;  1F66 D;  3C1C D;  2Y2K A;  3AYW A;  1P3F D;  3WTP C;  4XUJ B;  1P3K B;  3AZG D;  5BS7 A;  1H3O A;  3VH6 A;  3O62 B;  1N1J B;  5BNV A;  2Y2I A;  4Z5T C;  3MGR B;  3H0L C;  3MGR D;  3REL A;  1WWS A;  3AV2 C;  3W97 D;  5B31 A;  3AV1 D;  3LEL A;  2RVQ C;  3UTA A;  1M18 A;  1P3F C;  5B2J C;  1F66 B;  3MGS A;  3UT9 C;  1P3L C;  3REH A;  3AZK A;  1P3K D;  5B1L A;  3A6N C;  5JRG C;  4H9O A;  3W99 C;  1P3A D;  1ID3 B;  5GXQ A;  3X1V C;  4X23 A;  3LJA C;  3AZL B;  5B40 A;  1B67 A;  1M1A C;  5B1M B;  1P3L D;  3LZ1 C;  1P34 B;  2Y2P A;  4G92 B;  4WU9 B;  1KX3 C;  3KUY D;  3MNN D;  3VH5 A;  5GT3 D;  3AZK D;  3O62 A;  3VH5 T;  3AZL A;  4Z5T B;  1P3K A;  3REH D;  4Z66 D;  3C1B C;  4ZUX A;  3X1U D;  2HIO D;  5B24 C;  3AZJ D;  3A1K A;  4CSR B;  3B0C T;  3REI A;  5CPI D;  3WKJ D;  3AFA B;  5DNM D;  3X1T B;  3X1T D;  3REL C;  5CPK B;  3AFA D;  4WZS B;  5AVC B;  1EQZ B;  1WWI A;  5B31 C;  1EQZ C;  1ZLA B;  1Z2C B;  1M18 C;  1P3F A;  3MVD C;  4QLC A;  3W96 C;  4EO5 B;  5DNN C;  5B0Y B;  5CHL B;  3MGS C;  3NQJ B;  4KGC D;  4AWL C;  3W99 A;  3REJ D;  2ZY3 A;  3W98 A;  2F2A C;  3C1C B;  5AVC D;  5DNM C;  3EPK A;  3X1V D;  1Q9C A;  2FJ7 A;  4X23 C;  3LJA A;  1BH8 B;  5B33 C;  2F8N K;  5B40 C;  3MVD B;  3WA9 B;  3LZ1 A;  3W96 B;  1P3A B;  3KXB D;  3X1U B;  3REK D;  2YFW A;  3AZH C;  1KX3 A;  5BO0 B;  4Z66 B;  5G49 B;  2UWX A;  4J8X D;  5GT0 D;  4J8U B;  1AOI A;  1P3K C;  3O62 C;  3AZL C;  3KWQ D;  1ID3 C;  3B6G D;  4J8V D;  3C1B A;  5CPK C;  2ZY2 A;  1P3M B;  4LD9 D;  1P3M C;  3WAA A;  1S32 D;  5B2J D;  3LJA D;  5B1L B;  1P3G B;  2NZD B;  2G5H C;  4H9O B;  3NQU B;  4R8P B;  1P3O C;  4DQY B;  3REI C;  3W97 B;  4E44 A;  5GT0 C;  5AV9 B;  3AZF B;  3MGP A;  3LZ0 A;  1P3P B;  4YS3 A;  1EQZ A;  5B33 D;  1F1E A;  5AV5 D;  3WTP E;  1A7W A;  3UTA B;  2ZY5 A;  3MVD A;  4QLC C;  1KU5 A;  5B33 B;  3W96 A;  5DNN A;  4H9Q B;  5DNM B;  3REJ C;  1H3O B;  3B0D B;  4ZBJ B;  2RVQ D;  1P3I A;  5BNX A;  3W98 B;  4ZUX B;  4H9P A;  1P3O B;  3W98 C;  1B6W A;  3X1S B; 
#chains in the Genus database with same CATH homology
 5DNM A;  2CV5 A;  5DNN D;  2BYK A;  3B6F D;  2FJ7 C;  4EO5 C;  5DNN B;  4WU9 D;  2NZD D;  5B33 A;  4J8X B;  5KDM B;  3MGQ A;  4JJN B;  1F66 C;  3AZJ A;  4YS3 D;  4YS3 B;  5AV8 A;  3LZ0 D;  4ZUX D;  2LY8 A;  3AZH A;  3MGP D;  5GT3 A;  5CP6 B;  1AOI C;  2XD1 A;  1ID3 A;  2JSS A;  5CPK A;  4NE5 A;  2Y2H A;  4LD9 A;  4KUD D;  3WA9 D;  2DF4 C;  1P3M A;  3B0B A;  3WAA C;  5JRG B;  4J8V A;  2F8N A;  4JJN D;  2IO5 B;  4X23 D;  2JE5 A;  3A6N B;  3REJ B;  1P3O A;  3UTB B;  2Y2L A;  5GT0 A;  1AOI D;  1HTA A;  3MGP C;  3MGS B;  5GXQ D;  3LZ0 C;  1M19 D;  5AY8 B;  3LZ1 B;  3P5J B;  4YS3 C;  1P3A A;  5B1L D;  3H0R C;  5B1M C;  4HGA C;  3LJA B;  2FJ7 B;  2FJ7 D;  1N1J A;  2F8N G;  3KFU G;  3AZF D;  3KWQ B;  3B6G B;  4R8P C;  3UTB A;  2G5I C;  3REJ A;  5GT0 B;  3W99 D;  5GSU C;  3UTA D;  1P3I C;  5AV5 B;  3AV1 A;  5B24 B;  3W97 A;  3NQU A;  4YM6 C;  4J8W B;  4YM6 B;  5B32 G;  5CPI B;  2CV5 C;  3WKJ B;  3REH B;  5CP6 A;  4QLC D;  4QLC B;  2YFV B;  3AZK B;  4R8P D;  3H0M C;  2W8S A;  5B32 B;  4J8U C;  1P3B A;  3MGQ C;  3EPL A;  5AVB D;  5AV8 B;  3AZJ C;  1M1A B;  1F66 A;  5AV8 C;  3AZJ B;  2BG1 A;  3AL0 C;  1P34 C;  1M18 B;  5B1M D;  5CPI A;  3B6F B;  3WKJ A;  5GT3 C;  4KGC B;  3REI D;  3REI B;  3AZG C;  5E5A D;  1BH8 A;  3MNN B;  4LD9 C;  1HQ3 B;  3X1S A;  5AV6 B;  3EPH A;  4H9P B;  5AV6 C;  2HIO A;  5AVB B;  1M1A D;  4J8V C;  3AZE C;  1ZLA D;  3AZL D;  4G91 B;  2PYO B;  5F99 C;  4H9S A;  1U35 C;  3W99 B;  5B2I C;  3MNN A;  4UUZ A;  3AN2 B;  3F6T A;  1P3A C;  3EG5 B;  4UPK A;  5B40 D;  5B40 B;  3A6N D;  4X23 B;  5B1M A;  3R45 A;  1ZLA C;  5AV6 D;  1TAF B;  3WTP B;  1P3B D;  5GXQ B;  4Z2M H;  4R8P A;  3UTB C;  1KX5 D;  5CP6 D;  5GSU A;  1S32 B;  3AV1 C;  3W97 C;  1P34 D;  3V9R B;  4YM6 A;  3TU4 B;  3AV2 D;  3C1B B;  4Z5T D;  4WJ3 C;  5GT3 B;  3MGS D;  1TZY B;  4J8U D;  2BYM B;  5CP6 C;  5BT1 D;  4WV4 B;  1AOI B;  5G49 A;  3UTB D;  3R45 B;  1M18 D;  4J8U A;  1P3B C;  3UT9 B;  3LEL D;  4M6B A;  3AZN C;  4XZQ D;  4H9N A;  5B31 G;  1P3L B;  4CAY B;  4J8W D;  3REL B;  1P34 A;  3IP4 C;  5CPI C;  2CV5 B;  3WKJ C;  3AZG A;  2CWE A;  5BNV B;  5B32 C;  1M19 A;  3C1C A;  3AYW D;  3X1S C;  3B0C W;  5AV6 A;  2HIO C;  5B24 D;  5B0Z B;  1P3O D;  3AZE A;  3B0D C;  4ZBJ C;  1S32 C;  2F8N D;  4H9S C;  5F99 A;  4AWL B;  1U35 A;  2NQB C;  4H9Q A;  5B2I A;  3MNN C;  4WU8 C;  3VH5 W;  3KWQ C;  4G92 C;  1ID3 D;  3B6G C;  2HUE C;  4J8X C;  4WNN A;  1P3F B;  2JCH A;  1ZLA A;  4JJN C;  5AY8 D;  3AN2 D;  2RIQ A;  3AZM C;  2NZD A;  4DRB A;  3WAA B;  1U35 B;  5AV9 D;  5B0Z C;  5JRG D;  2XD5 A;  2CV5 D;  2PYO A;  4WU8 D;  5AVB A;  3AZI A;  2HIO B;  2L5A A;  4H9R A;  3UT9 D;  1P3I D;  2DQN C;  4WU9 C;  4KGC C;  3B6F C;  3AZG B;  3KUY B;  5B2J B;  1P3G D;  5B0Y C;  3AZN A;  4CAY A;  4H9N B;  3TU4 D;  3AV2 B;  3W96 D;  3MVD D;  3A1I A;  4HGA B;  1P3P C;  2HUE B;  1TZY C;  5C3I B;  1KX4 D;  5CPJ C;  2FFF B;  5B32 A;  3WTP D;  2Y2G A;  4WU8 B;  4G91 C;  1P3B B;  1M19 C;  3AZF A;  3C1C C;  4J8W C;  3TU4 A;  3V9R A;  4XZQ C;  4XZQ B;  1P3G A;  5GSU B;  2ARO D;  2IO5 C;  5AV5 C;  5CPJ D;  1S32 A;  1KX4 C;  5FUG A;  2NQB A;  1TZY D;  1P3P D;  3AZI D;  1TAF A;  4WU8 A;  3X1U C;  3C1B D;  4Z66 C;  3EPJ A;  3KWQ A;  3B6G A;  4DRA A;  2PYO D;  3VH6 W;  5B0Y D;  1KX3 B;  4J8X A;  5BO0 A;  3KUY C;  4NE3 A;  5KDM A;  4JJN A;  1KX5 C;  1BH9 A;  3KXB A;  3REK A;  1P3M D;  3VH6 T;  3FDD A;  1KX5 B;  1PZR A;  3WA9 A;  1HQ3 D;  3AN2 A;  4KUD A;  5CPK D;  2Y2Q A;  3AZM A;  4CSR A;  2NZD C;  5AY8 A;  4H9R B;  4XUJ A;  5B0Z A;  5BNX B;  5AV9 C;  5B0Z D;  4XUJ D;  2PYO C;  3AZH D;  3AYW B;  3AZM D;  5AV8 D;  4J8V B;  5AVB C;  3AZI C;  1HQ3 A;  4KUD B;  5B2I D;  5C3I C;  3MGQ D;  5F99 D;  4WU9 A;  4KGC A;  3NQJ A;  3B6F A;  3AZE D;  2ARO B;  1BH9 B;  3KXB B;  3REK B;  1ULY A;  5B0Y A;  5AVC C;  3LZ0 B;  3AZH B;  4WNN B;  2BYM A;  2ZY4 A;  4Z2M G;  1P3P A;  1TZY A;  3X1V B;  5E5A C;  2NQB D;  4KHA A;  5JA4 B;  3MGQ B;  5CPJ A;  2YFV A;  5FUG B;  2ARO A;  2NQB B;  3AFA A;  3AZF C;  3MGR C;  3X1T A;  1W2E A;  4J8W A;  3TU4 C;  4NFT A;  4XZQ A;  3AYW C;  1P3G C;  5B32 D;  3WTP A;  3AZE B;  2Y2N A;  5AV5 A;  3AV1 B;  5BS7 C;  1EQZ D;  1KX4 A;  1R4V A;  1P3I B;  1M19 B;  4Z5T A;  2J8P A;  3X1U A;  4Z66 A;  4YM6 D;  3AV2 A;  3AZM B;  3O62 D;  2F8N H;  3AZN D;  1T3U A;  3LEL C;  5GSU D;  3UTA C;  3AZN B;  3KUY A;  1KX5 A;  5B2J A;  5BT1 C;  3KXB C;  3REK C;  3WAA D;  3WA9 C;  3UT9 A;  1P3L A;  4NE6 A;  3AZI B;  3AN2 C;  4KUD C;  3REH C;  5AY8 C;  3AZK C;  4XUJ C;  1KX4 B;  5B1L C;  3A6N A;  3MGP B;  5JRG A;  2F8N B;  5AV9 A;  1KX3 D;  2Y2J A;  2Y2M A;  4E45 A;  2Y2O A;  3LZ1 D;  4LD9 B;  2ZM5 A;  5GXQ C;  1HQ3 C;  5E5A B;  1JFI A;  4KHA B;  3X1V A;  5JA4 A;  5CPJ B;  1M1A A;  1BFM A;  3X1S D;  5AVC A;  2VQR A;  2YFW B;  3W98 D;  1JFI B;  5E5A A;  3LEL B;  2BYK B;  1U35 D;  5F99 B;  3KSY A;  5B31 B;  5B31 D;  5B2I B;  2ARO C;  3AFA C;  4ZUX C;  3MGR A;  3REL D;  3X1T C;  5B24 A;  4UUZ B;  1F66 D;  3C1C D;  2Y2K A;  3AYW A;  1P3F D;  3WTP C;  4XUJ B;  1P3K B;  3AZG D;  5BS7 A;  1H3O A;  3VH6 A;  3O62 B;  1N1J B;  5BNV A;  2Y2I A;  4Z5T C;  3MGR B;  3H0L C;  3MGR D;  3REL A;  1WWS A;  3AV2 C;  3W97 D;  5B31 A;  3AV1 D;  3LEL A;  2RVQ C;  3UTA A;  1M18 A;  1P3F C;  5B2J C;  1F66 B;  3MGS A;  3UT9 C;  1P3L C;  3REH A;  3AZK A;  1P3K D;  5B1L A;  3A6N C;  5JRG C;  4H9O A;  3W99 C;  1P3A D;  1ID3 B;  5GXQ A;  3X1V C;  4X23 A;  3LJA C;  3AZL B;  5B40 A;  1B67 A;  1M1A C;  5B1M B;  1P3L D;  3LZ1 C;  1P34 B;  2Y2P A;  4G92 B;  4WU9 B;  1KX3 C;  3KUY D;  3MNN D;  3VH5 A;  5GT3 D;  3AZK D;  3O62 A;  3VH5 T;  3AZL A;  4Z5T B;  1P3K A;  3REH D;  4Z66 D;  3C1B C;  4ZUX A;  3X1U D;  2HIO D;  5B24 C;  3AZJ D;  3A1K A;  4CSR B;  3B0C T;  3REI A;  5CPI D;  3WKJ D;  3AFA B;  5DNM D;  3X1T B;  3X1T D;  3REL C;  5CPK B;  3AFA D;  4WZS B;  5AVC B;  1EQZ B;  1WWI A;  5B31 C;  1EQZ C;  1ZLA B;  1Z2C B;  1M18 C;  1P3F A;  3MVD C;  4QLC A;  3W96 C;  4EO5 B;  5DNN C;  5B0Y B;  5CHL B;  3MGS C;  3NQJ B;  4KGC D;  4AWL C;  3W99 A;  3REJ D;  2ZY3 A;  3W98 A;  2F2A C;  3C1C B;  5AVC D;  5DNM C;  3EPK A;  3X1V D;  1Q9C A;  2FJ7 A;  4X23 C;  3LJA A;  1BH8 B;  5B33 C;  2F8N K;  5B40 C;  3MVD B;  3WA9 B;  3LZ1 A;  3W96 B;  1P3A B;  3KXB D;  3X1U B;  3REK D;  2YFW A;  3AZH C;  1KX3 A;  5BO0 B;  4Z66 B;  5G49 B;  2UWX A;  4J8X D;  5GT0 D;  4J8U B;  1AOI A;  1P3K C;  3O62 C;  3AZL C;  3KWQ D;  1ID3 C;  3B6G D;  4J8V D;  3C1B A;  5CPK C;  2ZY2 A;  1P3M B;  4LD9 D;  1P3M C;  3WAA A;  1S32 D;  5B2J D;  3LJA D;  5B1L B;  1P3G B;  2NZD B;  2G5H C;  4H9O B;  3NQU B;  4R8P B;  1P3O C;  4DQY B;  3REI C;  3W97 B;  4E44 A;  5GT0 C;  5AV9 B;  3AZF B;  3MGP A;  3LZ0 A;  1P3P B;  4YS3 A;  1EQZ A;  5B33 D;  1F1E A;  5AV5 D;  3WTP E;  1A7W A;  3UTA B;  2ZY5 A;  3MVD A;  4QLC C;  1KU5 A;  5B33 B;  3W96 A;  5DNN A;  4H9Q B;  5DNM B;  3REJ C;  1H3O B;  3B0D B;  4ZBJ B;  2RVQ D;  1P3I A;  5BNX A;  3W98 B;  4ZUX B;  4H9P A;  1P3O B;  3W98 C;  1B6W A;  3X1S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...