3AZND

Crystal structure of human nucleosome core particle containing h4k91q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aznD00
5BNVB 3X1TC 2CV5D 1F66B 3A6NB 5B24D 1P3AC 3O62B 3UTBC 2HUEC 1M18B 3W99C 4H9QA 1P3PA 5F99D 3C1CA 3KWQA 1KX3D 5AVCC 3RELA 3X1SD 4WU8D 4WNNB 3REKB 3UT9A 2CWEA 3X1UD 3X1VA 5CP6C 4M6BA 3AN2A 1P3OC 2BYKB 3AZHA 1P3AB 3UTBB 3AYWA 5BS7C 1KX4D 1P3MD 1A7WA 4G92C 3AZLA 5CPIA 3W99B 5AVCB 5B2ID 4WV4B 4Z5TC 1P34A 2NQBC 5CPJC 5BNVA 1KX5D 4Z66C 1F66A 3MGRD 3A6NA 3O62A 4R8PB 5GT0D 1EQZC 1M18A 5B0YB 5GXQC 4G92B 5E5AA 3KXBD 3B6GD 1U35C 3AZKA 4WNNA 4Z5TB 3REKA 5CPKC 2PYOA 2NQBB 4X23C 3WAAC 5CPJB 4LD9A 1M19D 2YFVB 3LJAC 5G49B 2BYKA 1P3AA 4WU9C 3UTBA 3MNNA 2BYMA 1EQZB 3W99A 3REHC 1P3KC 3MGPD 1U35B 3W97C 5B1LD 3W98D 5AVCA 3WKJC 3AZED 4X23B 4J8VC 1P3BC 1WWSA 3LJAB 3W96C 3AFAC 1P3PD 2RVQC 4WU9B 3WA9C 4R8PA 5CHLB 5B0YA 5B0ZC 4YM6A 3REHB 3X1VD 4CAYB 1P3KB 3W97B 3B0BA 2FJ7A 1TZYC 3WKJB 5AV6D 4H9PB 2NQBA 5CPJA 4J8VB 1P3BB 5B31D 3AYWD 2YFVA 2NZDD 3AZLD 5CPID 3AZJC 5G49A 3AFAB 3MVDD 3KWQC 3WA9B 3RELC 4YS3C 5B1MD 3UT9C 5B0ZB 3UTAB 1U35A 5AVBC 4ZUXD 1F66D 3A6ND 3AN2C 1TZYB 1P3GD 3O62D 4X23A 4KGCA 1M1AC 5FUGB 1M18D 3LJAA 1P3IB 3AZJB 3LELD 3AV2A 4WZSB 4YS3B 4NFTA 3REKD 1P34C 3NQUB 3REHA 5B33D 4CAYA 1P3KA 5AVBB 3W97A 3X1TD 3MGQB 3REIB 1P3FC 3WKJA 4H9PA 5AV5C 1ID3C 4J8VA 1BH9B 3UTBD 1P3BA 1M1AB 3W99D 5E5AC 5BO0B 3C1BC 2YFWB 2F8ND 2JSSA 4J8WD 5JRGD 3AZKC 5B40D 3TU4A 2HIOA 5B0ZA 2PYOC 3UTAA 4LD9C 2AROD 5CP6D 1TZYA 1S32D 4E45A 1P3FB 1P3LD 4XUJD 1P3OD 5AV5B 3AZND 1TAFB 1ID3B 4J8UC 5FUGA 3MNNC 3AZGA 1P3IA 5E5AB 3AZJA 3C1BB 3VH5W 3R45B 3AZKB 4YS3A 5DNMC 4Z5TD 3NQUA 2PYOB 2NQBD 4H9OB 5CPJD 4NE5A 5AVBA 4LD9B 4Z66D 3MGQA 3REIA 4XZQC 1BH9A 4R8PC 4J8UB 1M1AA 3MNNB 2BYMB 1EQZD 5B0YC 4YM6C 5GXQD 5BO0A 2YFWA 3LZ1B 1HQ3B 1U35D 2FJ7C 3B0CW 1ZLAA 5DNMB 5CPKD 3MGSC 4KUDC 4X23D 3WAAD 5GSUC 1Q9CA 1P3FA 4XZQB 5AV5A 4WU9D 1TAFA 1ID3A 3WTPE 3V9RB 4YM6B 3REHD 3C1BA 3KSYA 3R45A 2FJ7B 1AOID 5AY8A 3AZFC 3WKJD 4KGCC 4H9OA 4DRBA 3MGSB 4KUDB 1P3BD 5GSUB 3W96D 3AFAD 2RVQD 4J8UA 3WTPC 3WA9D 3LZ0D 3AV2C 1BH8B 5B0ZD 3VH6T 3LZ1A 1HQ3A 4KHAB 3AZMC 1TZYD 5BNXB 5F99B 5DNMA 2F8NH 3AZFB 4KGCB 5B2IC 3X1SB 4XZQA 1KX5C 3C1CD 3KWQD 3WTPB 3RELD 3AV2B 3TU4C 2HIOC 3V9RA 4YS3D 3UT9D 5JA4A 5B31G 3UTAC 3AZMB 1P3MB 3AN2D 4CSRB 1JFIB 3AZHD 1B6WA 4J8XC 3MGSA 4KUDA 1M1AD 5B2IB 3AZGC 5GSUA 1P3IC 1KX5B 5B24A 1BH8A 3TU4B 2HIOB 1P34D 4KHAA 3MGQC 3REIC 5BNXA 5F99A 3MGPC 1P3FD 3AZFA 4J8XB 4H9RB 5B1LC 4E44A 1KX3A 1ID3D 3X1SA 3AZGB 3X1UA 5AV8C 5B32G 5E5AD 3C1BD 3WTPA 1ZLAC 3AZKD 2PYOD 4QLCC 3AZMA 1P3MA 4LD9D 4CSRA 3REJC 2F8NG 1JFIA 3MGPB 1P3AD 2F8NK 5B1LB 3W98B 3KUYC 5B2IA 4J8UD 3MNND 5AV8B 1KX5A 1R4VA 5AVCD 5AY8C 3AV1C 3MVDC 1ZLAB 4H9SA 3VH5A 1N1JA 4QLCB 5GT0A 5B2JC 5AV9C 5B1MC 3REJB 4XZQD 4J8XA 4H9RA 4NE6A 1F1EA 3KUYB 4R8PD 1P3GC 4EO5C 5AV6B 5B0YD 3VH6W 4YM6D 1BFMA 3LZ1C 1HQ3C 5B31B 1M19A 1B67A 2FJ7D 1ULYA 3LELC 5AY8B 3AV1B 3MVDB 5B2JB 5AV9B 4UUZB 5B1MB 5GSUD 4DRAA 3MGPA 5B32C 5B1LA 4ZUXB 5BT1C 3W98A 5C3IC 1P3GB 4EO5B 5AV8A 3AZEA 5DNNC 3AZIC 5GT3C 3LELB 3AZFD 4J8WC 4KGCD 4QLCA 5JRGC 3B6FC 5B40C 3LJAD 4JJNC 3REJA 5B33B 4Z2MH 5B32B 3X1TB 2CV5C 2AROC 3KUYA 1S32C 1P3LC 5B24C 3WTPD 4XUJC 3AV2D 5C3IB 5AV6A 3B0DC 5JA4B 3AZNC 5DNNB 2HUEB 1P3KD 5B31A 3AZIB 3AZMD 3W97D 5GT3B 3NQJB 2NZDA 5F99C 3AV1A 3MVDA 2F8NB 1KX3C 1H3OB 4J8WB 5JRGB 5B2JA 5AV9A 4J8VD 3X1SC 4UUZA 5B1MA 5B40B 3X1UC 4WU8C 4JJNB 4ZUXA 2CV5B 2AROB 5CP6B 1S32B 1P3LB 5B24B 4XUJB 1P3GA 3TU4D 1P3OB 2HIOD 3B0DB 1KU5A 3AZNB 3UTAD 1KX4C 1P3MC 3LELA 1KX3B 4J8XD 4WU8B 3AZGD 4H9NB 3X1UB 5B33A 1P3ID 3AZJD 5B32A 3X1TA 3MGRC 4Z66B 4H9SC 2IO5C 5DNNA 5GT0C 4HGAC 1KX4B 5AVBD 3AZIA 3NQJA 5GT3A 5GXQB 3MGQD 3REID 3KXBC 3B6GC 2F8NA 1H3OA 3VH5T 4AWLC 4J8WA 5JRGA 3B6FA 1AOIC 5B40A 4JJNA 5AV8D 4Z2MG 5CPKB 3WAAB 2CV5A 3MGRB 1M19C 2LY8A 2AROA 5CP6A 5KDMB 1HTAA 1S32A 1P3LA 4XUJA 1P3OA 1ZLAD 2IO5B 3AZNA 1N1JB 4QLCD 4HGAB 5BS7A 5GT0B 3LZ0C 3REJD 3KXBB 3B6GB 3W98C 5AV5D 4AWLB 3KUYD 4WU8A 1AOIB 3B0CT 4H9NA 4Z5TA 3AZEC 2L5AA 4Z66A 1M19B 1P3PC 4G91C 4ZBJC 3W96B 5AY8D 3AV1D 3C1CC 5B2JD 5AV9D 3LZ0B 1KX4A 1EQZA 5GXQA 3X1VC 3AZHC 5AV6C 5CPKA 3AZEB 3WAAA 3LZ1D 5B31C 1HQ3D 3MGRA 4NE3A 3AYWC 2NZDC 5KDMA 3AZLC 4H9QB 5CPIC 1P3PB 4G91B 4ZBJB 3VH6A 5DNMD 3C1CB 3KWQB 4WU9A 3RELB 3UT9B 3X1VB 3KXBA 3B6GA 4ZUXC 5B32D 1F66C 3A6NC 5BT1D 3AN2B 1AOIA 1WWIA 3B6FB 3AZHB 3O62C 5DNND 3AYWB 1M18C 3AZID 2NZDB 5GT3D 3AZLB 5CPIB 3W96A 3AFAA 3MGSD 3WA9A 4KUDD 3LZ0A 3B6FD 3REKC 1P34B 5B33C 4JJND
chains in the Genus database with same CATH superfamily
5BNVB 3X1TC 2CV5D 1F66B 3A6NB 5B24D 1P3AC 3O62B 3UTBC 2HUEC 3EPHA 1M18B 3W99C 4H9QA 1P3PA 5F99D 3C1CA 3KWQA 1KX3D 5AVCC 3RELA 3X1SD 4WU8D 4WNNB 3REKB 3UT9A 2CWEA 3X1UD 3X1VA 5CP6C 4M6BA 3AN2A 1P3OC 2BYKB 3AZHA 1P3AB 3UTBB 3AYWA 5BS7C 1KX4D 1P3MD 1A7WA 4G92C 3AZLA 5CPIA 3W99B 3H0RC 5AVCB 2Y2HA 4WV4B 5B2ID 4Z5TC 1P34A 2NQBC 5CPJC 5BNVA 1KX5D 4Z66C 1F66A 3MGRD 3A6NA 3O62A 4R8PB 5GT0D 1EQZC 1M18A 2W8SA 5B0YB 5GXQC 4G92B 5E5AA 3KXBD 3B6GD 1U35C 1W2EA 3AZKA 4WNNA 4Z5TB 3REKA 5CPKC 2PYOA 2NQBB 4X23C 3WAAC 5CPJB 4LD9A 1M19D 2YFVB 3LJAC 5G49B 2BYKA 1P3AA 4WU9C 3UTBA 3MNNA 2BYMA 1EQZB 3W99A 3REHC 1P3KC 3MGPD 1U35B 3W97C 5B1LD 3W98D 3AL0C 5AVCA 3WKJC 3AZED 4X23B 4J8VC 1P3BC 1WWSA 3LJAB 3W96C 3AFAC 1P3PD 2RVQC 4WU9B 3WA9C 4R8PA 5CHLB 5B0YA 5B0ZC 4YM6A 3REHB 3X1VD 4CAYB 1P3KB 3W97B 3B0BA 2FJ7A 1TZYC 3WKJB 5AV6D 4H9PB 2NQBA 5CPJA 4J8VB 1P3BB 5B31D 3AYWD 2YFVA 2NZDD 2XD5A 3AZLD 3AZJC 5G49A 3AFAB 5CPID 3H0LC 3MVDD 3KWQC 3WA9B 3RELC 4YS3C 5B1MD 3UT9C 5B0ZB 3UTAB 1U35A 5AVBC 4ZUXD 4UPKA 1F66D 3A6ND 3AN2C 1TZYB 1P3GD 2F2AC 4X23A 3O62D 1M1AC 4KGCA 5FUGB 1M18D 3LJAA 1P3IB 3AZJB 3LELD 3AV2A 1PZRA 4WZSB 4YS3B 4NFTA 3REKD 1P34C 3NQUB 3REHA 5B33D 4CAYA 1P3KA 5AVBB 3W97A 3X1TD 2JCHA 2UWXA 3MGQB 3REIB 1P3FC 3WKJA 4H9PA 5AV5C 1ID3C 4J8VA 1BH9B 3UTBD 2DQNC 1P3BA 1M1AB 3W99D 5E5AC 5BO0B 3C1BC 2YFWB 2F8ND 3EG5B 2JSSA 4J8WD 5JRGD 3AZKC 5B40D 3TU4A 2HIOA 5B0ZA 2PYOC 3UTAA 4LD9C 2AROD 5CP6D 1TZYA 1S32D 4E45A 1P3FB 1P3LD 4XUJD 1P3OD 5AV5B 3AZND 1TAFB 1ID3B 4J8UC 5FUGA 3MNNC 3AZGA 1P3IA 5E5AB 3AZJA 3C1BB 3VH5W 3R45B 3AZKB 4YS3A 5DNMC 4Z5TD 3NQUA 2PYOB 2NQBD 4H9OB 5CPJD 4NE5A 5AVBA 4LD9B 4Z66D 3MGQA 3REIA 3F6TA 4XZQC 2Y2QA 1BH9A 4R8PC 4J8UB 1M1AA 3MNNB 2BYMB 1EQZD 5B0YC 4YM6C 5GXQD 5BO0A 2YFWA 3LZ1B 1HQ3B 1U35D 2FJ7C 3B0CW 1ZLAA 5DNMB 4DQYB 5CPKD 3MGSC 4KUDC 4X23D 3WAAD 2J8PA 5GSUC 1Q9CA 1P3FA 2VQRA 4XZQB 5AV5A 4WU9D 1TAFA 1ID3A 3WTPE 3V9RB 4YM6B 3REHD 2DF4C 3C1BA 2Y2OA 3KSYA 3R45A 2FJ7B 1AOID 5AY8A 3AZFC 3WKJD 4KGCC 4H9OA 2G5IC 4DRBA 3MGSB 4KUDB 1P3BD 2FFFB 5GSUB 3W96D 3AFAD 2RVQD 4J8UA 3WTPC 3WA9D 3LZ0D 3AV2C 1BH8B 5B0ZD 3VH6T 3LZ1A 1HQ3A 4KHAB 3AZMC 1TZYD 5BNXB 5F99B 5DNMA 2F8NH 3AZFB 4KGCB 2ZY3A 5B2IC 3X1SB 4XZQA 1KX5C 3C1CD 3KWQD 3WTPB 3RELD 2XD1A 3AV2B 3TU4C 2ZY4A 2HIOC 3V9RA 4YS3D 3UT9D 5JA4A 5B31G 3UTAC 3AZMB 1P3MB 3AN2D 4CSRB 1JFIB 3AZHD 1B6WA 4J8XC 3MGSA 4KUDA 1M1AD 5B2IB 3AZGC 5GSUA 1P3IC 1KX5B 3FDDA 5B24A 1BH8A 3TU4B 2HIOB 1P34D 4KHAA 3MGQC 3REIC 5BNXA 5F99A 3MGPC 1P3FD 3KFUG 3AZFA 4J8XB 4H9RB 5B1LC 4E44A 1KX3A 1ID3D 3X1SA 3AZGB 4WJ3C 3X1UA 5AV8C 5B32G 5E5AD 3C1BD 3WTPA 3EPKA 1ZLAC 3AZKD 2PYOD 4QLCC 3AZMA 1P3MA 4LD9D 4CSRA 3REJC 2F8NG 1JFIA 3MGPB 1P3AD 2F8NK 2Y2GA 5B1LB 2RIQA 3W98B 3KUYC 5B2IA 4J8UD 3MNND 5AV8B 2Y2LA 1KX5A 2Y2KA 1R4VA 3IP4C 5AVCD 5AY8C 3AV1C 3MVDC 1ZLAB 4H9SA 3VH5A 1N1JA 5B2JC 5GT0A 5AV9C 4QLCB 5B1MC 3REJB 4XZQD 2G5HC 4J8XA 4H9RA 2ZY2A 4NE6A 3A1KA 1F1EA 3KUYB 4R8PD 1P3GC 4EO5C 5AV6B 5B0YD 3VH6W 4YM6D 1BFMA 3LZ1C 1HQ3C 5B31B 1M19A 1B67A 2FJ7D 1ULYA 3LELC 5AY8B 3AV1B 3MVDB 5B2JB 5AV9B 4UUZB 5B1MB 5GSUD 4DRAA 3MGPA 3EPJA 5B32C 5B1LA 4ZUXB 5BT1C 3W98A 5C3IC 1P3GB 4EO5B 5AV8A 3AZEA 5DNNC 2Y2NA 3AZIC 5GT3C 3LELB 3AZFD 4J8WC 4KGCD 4QLCA 5JRGC 3B6FC 5B40C 2ZY5A 3LJAD 4JJNC 3REJA 5B33B 4Z2MH 5B32B 3X1TB 2CV5C 2AROC 3A1IA 3KUYA 1S32C 1P3LC 5B24C 2Y2PA 4XUJC 3WTPD 3AV2D 5C3IB 5AV6A 3B0DC 2ZM5A 5JA4B 3AZNC 5DNNB 2HUEB 1P3KD 5B31A 3AZIB 3AZMD 3W97D 5GT3B 3NQJB 2NZDA 5F99C 3AV1A 3MVDA 2F8NB 1KX3C 1H3OB 4J8WB 5JRGB 5B2JA 5AV9A 4J8VD 3X1SC 4UUZA 5B1MA 5B40B 3X1UC 4WU8C 4JJNB 4ZUXA 2CV5B 2AROB 5CP6B 1S32B 1P3LB 5B24B 4XUJB 1P3GA 3TU4D 1P3OB 2HIOD 3B0DB 1KU5A 3AZNB 3UTAD 1KX4C 1P3MC 3LELA 1KX3B 4J8XD 4WU8B 3AZGD 4H9NB 3X1UB 5B33A 1P3ID 3AZJD 5B32A 3X1TA 3MGRC 4Z66B 2BG1A 4H9SC 2IO5C 5DNNA 5GT0C 4HGAC 1KX4B 5AVBD 3AZIA 3NQJA 5GT3A 1Z2CB 5GXQB 3MGQD 3REID 3KXBC 3B6GC 2F8NA 1H3OA 3VH5T 4AWLC 4J8WA 5JRGA 3B6FA 1AOIC 5B40A 4JJNA 5AV8D 4Z2MG 5CPKB 2Y2JA 3WAAB 2CV5A 3MGRB 1M19C 2LY8A 2AROA 5CP6A 5KDMB 1HTAA 1S32A 1P3LA 4XUJA 1P3OA 1ZLAD 2IO5B 3AZNA 1N1JB 4QLCD 4HGAB 5BS7A 5GT0B 3LZ0C 3REJD 3KXBB 3B6GB 3W98C 5AV5D 4AWLB 3KUYD 4WU8A 1AOIB 3P5JB 3B0CT 4H9NA 4Z5TA 3AZEC 2L5AA 4Z66A 1M19B 2Y2IA 3H0MC 1P3PC 4G91C 4ZBJC 3W96B 5AY8D 3AV1D 3C1CC 2Y2MA 5B2JD 5AV9D 3LZ0B 1KX4A 1EQZA 5GXQA 3X1VC 3AZHC 5AV6C 5CPKA 3AZEB 3EPLA 3WAAA 3LZ1D 5B31C 1HQ3D 3MGRA 4NE3A 3AYWC 2NZDC 5KDMA 3AZLC 2JE5A 4H9QB 5CPIC 1P3PB 4G91B 4ZBJB 3VH6A 5DNMD 3C1CB 3KWQB 4WU9A 3RELB 3UT9B 3X1VB 3KXBA 3B6GA 4ZUXC 5B32D 1F66C 3A6NC 5BT1D 3AN2B 1T3UA 1AOIA 1WWIA 3B6FB 3AZHB 3O62C 5DNND 3AYWB 1M18C 3AZID 2NZDB 5GT3D 3AZLB 5CPIB 3W96A 3AFAA 3MGSD 3WA9A 4KUDD 3LZ0A 3B6FD 3REKC 1P34B 5B33C 4JJND
chains in the Genus database with same CATH topology
5BNVB 3X1TC 2CV5D 1F66B 3A6NB 5B24D 1P3AC 3O62B 3UTBC 2HUEC 3EPHA 1M18B 3W99C 4H9QA 1P3PA 5F99D 3C1CA 3KWQA 1KX3D 5AVCC 3RELA 3X1SD 4WU8D 4WNNB 3REKB 3UT9A 2CWEA 3X1UD 3X1VA 5CP6C 4M6BA 3AN2A 1P3OC 2BYKB 3AZHA 1P3AB 3UTBB 3AYWA 5BS7C 1KX4D 1P3MD 1A7WA 4G92C 3AZLA 5CPIA 3W99B 3H0RC 5AVCB 2Y2HA 4WV4B 5B2ID 4Z5TC 1P34A 2NQBC 5CPJC 5BNVA 1KX5D 4Z66C 1F66A 3MGRD 3A6NA 3O62A 4R8PB 5GT0D 1EQZC 1M18A 2W8SA 5B0YB 5GXQC 4G92B 5E5AA 3KXBD 3B6GD 1U35C 1W2EA 3AZKA 4WNNA 4Z5TB 3REKA 5CPKC 2PYOA 2NQBB 4X23C 3WAAC 5CPJB 4LD9A 1M19D 2YFVB 3LJAC 5G49B 2BYKA 1P3AA 4WU9C 3UTBA 3MNNA 2BYMA 1EQZB 3W99A 3REHC 1P3KC 3MGPD 1U35B 3W97C 5B1LD 3W98D 3AL0C 5AVCA 3WKJC 3AZED 4X23B 4J8VC 1P3BC 1WWSA 3LJAB 3W96C 3AFAC 1P3PD 2RVQC 4WU9B 3WA9C 4R8PA 5CHLB 5B0YA 5B0ZC 4YM6A 3REHB 3X1VD 4CAYB 1P3KB 3W97B 3B0BA 2FJ7A 1TZYC 3WKJB 5AV6D 4H9PB 2NQBA 5CPJA 4J8VB 1P3BB 5B31D 3AYWD 2YFVA 2NZDD 2XD5A 3AZLD 3AZJC 5G49A 3AFAB 5CPID 3H0LC 3MVDD 3KWQC 3WA9B 3RELC 4YS3C 5B1MD 3UT9C 5B0ZB 3UTAB 1U35A 5AVBC 4ZUXD 4UPKA 1F66D 3A6ND 3AN2C 1TZYB 1P3GD 2F2AC 4X23A 3O62D 1M1AC 4KGCA 5FUGB 1M18D 3LJAA 1P3IB 3AZJB 3LELD 3AV2A 1PZRA 4WZSB 4YS3B 4NFTA 3REKD 1P34C 3NQUB 3REHA 5B33D 4CAYA 1P3KA 5AVBB 3W97A 3X1TD 2JCHA 2UWXA 3MGQB 3REIB 1P3FC 3WKJA 4H9PA 5AV5C 1ID3C 4J8VA 1BH9B 3UTBD 2DQNC 1P3BA 1M1AB 3W99D 5E5AC 5BO0B 3C1BC 2YFWB 2F8ND 3EG5B 2JSSA 4J8WD 5JRGD 3AZKC 5B40D 3TU4A 2HIOA 5B0ZA 2PYOC 3UTAA 4LD9C 2AROD 5CP6D 1TZYA 1S32D 4E45A 1P3FB 1P3LD 4XUJD 1P3OD 5AV5B 3AZND 1TAFB 1ID3B 4J8UC 5FUGA 3MNNC 3AZGA 1P3IA 5E5AB 3AZJA 3C1BB 3VH5W 3R45B 3AZKB 4YS3A 5DNMC 4Z5TD 3NQUA 2PYOB 2NQBD 4H9OB 5CPJD 4NE5A 5AVBA 4LD9B 4Z66D 3MGQA 3REIA 3F6TA 4XZQC 2Y2QA 1BH9A 4R8PC 4J8UB 1M1AA 3MNNB 2BYMB 1EQZD 5B0YC 4YM6C 5GXQD 5BO0A 2YFWA 3LZ1B 1HQ3B 1U35D 2FJ7C 3B0CW 1ZLAA 5DNMB 4DQYB 5CPKD 3MGSC 4KUDC 4X23D 3WAAD 2J8PA 5GSUC 1Q9CA 1P3FA 2VQRA 4XZQB 5AV5A 4WU9D 1TAFA 1ID3A 3WTPE 3V9RB 4YM6B 3REHD 2DF4C 3C1BA 2Y2OA 3KSYA 3R45A 2FJ7B 1AOID 5AY8A 3AZFC 3WKJD 4KGCC 4H9OA 2G5IC 4DRBA 3MGSB 4KUDB 1P3BD 2FFFB 5GSUB 3W96D 3AFAD 2RVQD 4J8UA 3WTPC 3WA9D 3LZ0D 3AV2C 1BH8B 5B0ZD 3VH6T 3LZ1A 1HQ3A 4KHAB 3AZMC 1TZYD 5BNXB 5F99B 5DNMA 2F8NH 3AZFB 4KGCB 2ZY3A 5B2IC 3X1SB 4XZQA 1KX5C 3C1CD 3KWQD 3WTPB 3RELD 2XD1A 3AV2B 3TU4C 2ZY4A 2HIOC 3V9RA 4YS3D 3UT9D 5JA4A 5B31G 3UTAC 3AZMB 1P3MB 3AN2D 4CSRB 1JFIB 3AZHD 1B6WA 4J8XC 3MGSA 4KUDA 1M1AD 5B2IB 3AZGC 5GSUA 1P3IC 1KX5B 3FDDA 5B24A 1BH8A 3TU4B 2HIOB 1P34D 4KHAA 3MGQC 3REIC 5BNXA 5F99A 3MGPC 1P3FD 3KFUG 3AZFA 4J8XB 4H9RB 5B1LC 4E44A 1KX3A 1ID3D 3X1SA 3AZGB 4WJ3C 3X1UA 5AV8C 5B32G 5E5AD 3C1BD 3WTPA 3EPKA 1ZLAC 3AZKD 2PYOD 4QLCC 3AZMA 1P3MA 4LD9D 4CSRA 3REJC 2F8NG 1JFIA 3MGPB 1P3AD 2F8NK 2Y2GA 5B1LB 2RIQA 3W98B 3KUYC 5B2IA 4J8UD 3MNND 5AV8B 2Y2LA 1KX5A 2Y2KA 1R4VA 3IP4C 5AVCD 5AY8C 3AV1C 3MVDC 1ZLAB 4H9SA 3VH5A 1N1JA 5B2JC 5GT0A 5AV9C 4QLCB 5B1MC 3REJB 4XZQD 2G5HC 4J8XA 4H9RA 2ZY2A 4NE6A 3A1KA 1F1EA 3KUYB 4R8PD 1P3GC 4EO5C 5AV6B 5B0YD 3VH6W 4YM6D 1BFMA 3LZ1C 1HQ3C 5B31B 1M19A 1B67A 2FJ7D 1ULYA 3LELC 5AY8B 3AV1B 3MVDB 5B2JB 5AV9B 4UUZB 5B1MB 5GSUD 4DRAA 3MGPA 3EPJA 5B32C 5B1LA 4ZUXB 5BT1C 3W98A 5C3IC 1P3GB 4EO5B 5AV8A 3AZEA 5DNNC 2Y2NA 3AZIC 5GT3C 3LELB 3AZFD 4J8WC 4KGCD 4QLCA 5JRGC 3B6FC 5B40C 2ZY5A 3LJAD 4JJNC 3REJA 5B33B 4Z2MH 5B32B 3X1TB 2CV5C 2AROC 3A1IA 3KUYA 1S32C 1P3LC 5B24C 2Y2PA 4XUJC 3WTPD 3AV2D 5C3IB 5AV6A 3B0DC 2ZM5A 5JA4B 3AZNC 5DNNB 2HUEB 1P3KD 5B31A 3AZIB 3AZMD 3W97D 5GT3B 3NQJB 2NZDA 5F99C 3AV1A 3MVDA 2F8NB 1KX3C 1H3OB 4J8WB 5JRGB 5B2JA 5AV9A 4J8VD 3X1SC 4UUZA 5B1MA 5B40B 3X1UC 4WU8C 4JJNB 4ZUXA 2CV5B 2AROB 5CP6B 1S32B 1P3LB 5B24B 4XUJB 1P3GA 3TU4D 1P3OB 2HIOD 3B0DB 1KU5A 3AZNB 3UTAD 1KX4C 1P3MC 3LELA 1KX3B 4J8XD 4WU8B 3AZGD 4H9NB 3X1UB 5B33A 1P3ID 3AZJD 5B32A 3X1TA 3MGRC 4Z66B 2BG1A 4H9SC 2IO5C 5DNNA 5GT0C 4HGAC 1KX4B 5AVBD 3AZIA 3NQJA 5GT3A 1Z2CB 5GXQB 3MGQD 3REID 3KXBC 3B6GC 2F8NA 1H3OA 3VH5T 4AWLC 4J8WA 5JRGA 3B6FA 1AOIC 5B40A 4JJNA 5AV8D 4Z2MG 5CPKB 2Y2JA 3WAAB 2CV5A 3MGRB 1M19C 2LY8A 2AROA 5CP6A 5KDMB 1HTAA 1S32A 1P3LA 4XUJA 1P3OA 1ZLAD 2IO5B 3AZNA 1N1JB 4QLCD 4HGAB 5BS7A 5GT0B 3LZ0C 3REJD 3KXBB 3B6GB 3W98C 5AV5D 4AWLB 3KUYD 4WU8A 1AOIB 3P5JB 3B0CT 4H9NA 4Z5TA 3AZEC 2L5AA 4Z66A 1M19B 2Y2IA 3H0MC 1P3PC 4G91C 4ZBJC 3W96B 5AY8D 3AV1D 3C1CC 2Y2MA 5B2JD 5AV9D 3LZ0B 1KX4A 1EQZA 5GXQA 3X1VC 3AZHC 5AV6C 5CPKA 3AZEB 3EPLA 3WAAA 3LZ1D 5B31C 1HQ3D 3MGRA 4NE3A 3AYWC 2NZDC 5KDMA 3AZLC 2JE5A 4H9QB 5CPIC 1P3PB 4G91B 4ZBJB 3VH6A 5DNMD 3C1CB 3KWQB 4WU9A 3RELB 3UT9B 3X1VB 3KXBA 3B6GA 4ZUXC 5B32D 1F66C 3A6NC 5BT1D 3AN2B 1T3UA 1AOIA 1WWIA 3B6FB 3AZHB 3O62C 5DNND 3AYWB 1M18C 3AZID 2NZDB 5GT3D 3AZLB 5CPIB 3W96A 3AFAA 3MGSD 3WA9A 4KUDD 3LZ0A 3B6FD 3REKC 1P34B 5B33C 4JJND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNV B;  3X1T C;  2CV5 D;  1F66 B;  3A6N B;  5B24 D;  1P3A C;  3O62 B;  3UTB C;  2HUE C;  1M18 B;  3W99 C;  4H9Q A;  1P3P A;  5F99 D;  3C1C A;  3KWQ A;  1KX3 D;  5AVC C;  3REL A;  3X1S D;  4WU8 D;  4WNN B;  3REK B;  3UT9 A;  2CWE A;  3X1U D;  3X1V A;  5CP6 C;  4M6B A;  3AN2 A;  1P3O C;  2BYK B;  3AZH A;  1P3A B;  3UTB B;  3AYW A;  5BS7 C;  1KX4 D;  1P3M D;  1A7W A;  4G92 C;  3AZL A;  5CPI A;  3W99 B;  5AVC B;  5B2I D;  4WV4 B;  4Z5T C;  1P34 A;  2NQB C;  5CPJ C;  5BNV A;  1KX5 D;  4Z66 C;  1F66 A;  3MGR D;  3A6N A;  3O62 A;  4R8P B;  5GT0 D;  1EQZ C;  1M18 A;  5B0Y B;  5GXQ C;  4G92 B;  5E5A A;  3KXB D;  3B6G D;  1U35 C;  3AZK A;  4WNN A;  4Z5T B;  3REK A;  5CPK C;  2PYO A;  2NQB B;  4X23 C;  3WAA C;  5CPJ B;  4LD9 A;  1M19 D;  2YFV B;  3LJA C;  5G49 B;  2BYK A;  1P3A A;  4WU9 C;  3UTB A;  3MNN A;  2BYM A;  1EQZ B;  3W99 A;  3REH C;  1P3K C;  3MGP D;  1U35 B;  3W97 C;  5B1L D;  3W98 D;  5AVC A;  3WKJ C;  3AZE D;  4X23 B;  4J8V C;  1P3B C;  1WWS A;  3LJA B;  3W96 C;  3AFA C;  1P3P D;  2RVQ C;  4WU9 B;  3WA9 C;  4R8P A;  5CHL B;  5B0Y A;  5B0Z C;  4YM6 A;  3REH B;  3X1V D;  4CAY B;  1P3K B;  3W97 B;  3B0B A;  2FJ7 A;  1TZY C;  3WKJ B;  5AV6 D;  4H9P B;  2NQB A;  5CPJ A;  4J8V B;  1P3B B;  5B31 D;  3AYW D;  2YFV A;  2NZD D;  3AZL D;  5CPI D;  3AZJ C;  5G49 A;  3AFA B;  3MVD D;  3KWQ C;  3WA9 B;  3REL C;  4YS3 C;  5B1M D;  3UT9 C;  5B0Z B;  3UTA B;  1U35 A;  5AVB C;  4ZUX D;  1F66 D;  3A6N D;  3AN2 C;  1TZY B;  1P3G D;  3O62 D;  4X23 A;  4KGC A;  1M1A C;  5FUG B;  1M18 D;  3LJA A;  1P3I B;  3AZJ B;  3LEL D;  3AV2 A;  4WZS B;  4YS3 B;  4NFT A;  3REK D;  1P34 C;  3NQU B;  3REH A;  5B33 D;  4CAY A;  1P3K A;  5AVB B;  3W97 A;  3X1T D;  3MGQ B;  3REI B;  1P3F C;  3WKJ A;  4H9P A;  5AV5 C;  1ID3 C;  4J8V A;  1BH9 B;  3UTB D;  1P3B A;  1M1A B;  3W99 D;  5E5A C;  5BO0 B;  3C1B C;  2YFW B;  2F8N D;  2JSS A;  4J8W D;  5JRG D;  3AZK C;  5B40 D;  3TU4 A;  2HIO A;  5B0Z A;  2PYO C;  3UTA A;  4LD9 C;  2ARO D;  5CP6 D;  1TZY A;  1S32 D;  4E45 A;  1P3F B;  1P3L D;  4XUJ D;  1P3O D;  5AV5 B;  3AZN D;  1TAF B;  1ID3 B;  4J8U C;  5FUG A;  3MNN C;  3AZG A;  1P3I A;  5E5A B;  3AZJ A;  3C1B B;  3VH5 W;  3R45 B;  3AZK B;  4YS3 A;  5DNM C;  4Z5T D;  3NQU A;  2PYO B;  2NQB D;  4H9O B;  5CPJ D;  4NE5 A;  5AVB A;  4LD9 B;  4Z66 D;  3MGQ A;  3REI A;  4XZQ C;  1BH9 A;  4R8P C;  4J8U B;  1M1A A;  3MNN B;  2BYM B;  1EQZ D;  5B0Y C;  4YM6 C;  5GXQ D;  5BO0 A;  2YFW A;  3LZ1 B;  1HQ3 B;  1U35 D;  2FJ7 C;  3B0C W;  1ZLA A;  5DNM B;  5CPK D;  3MGS C;  4KUD C;  4X23 D;  3WAA D;  5GSU C;  1Q9C A;  1P3F A;  4XZQ B;  5AV5 A;  4WU9 D;  1TAF A;  1ID3 A;  3WTP E;  3V9R B;  4YM6 B;  3REH D;  3C1B A;  3KSY A;  3R45 A;  2FJ7 B;  1AOI D;  5AY8 A;  3AZF C;  3WKJ D;  4KGC C;  4H9O A;  4DRB A;  3MGS B;  4KUD B;  1P3B D;  5GSU B;  3W96 D;  3AFA D;  2RVQ D;  4J8U A;  3WTP C;  3WA9 D;  3LZ0 D;  3AV2 C;  1BH8 B;  5B0Z D;  3VH6 T;  3LZ1 A;  1HQ3 A;  4KHA B;  3AZM C;  1TZY D;  5BNX B;  5F99 B;  5DNM A;  2F8N H;  3AZF B;  4KGC B;  5B2I C;  3X1S B;  4XZQ A;  1KX5 C;  3C1C D;  3KWQ D;  3WTP B;  3REL D;  3AV2 B;  3TU4 C;  2HIO C;  3V9R A;  4YS3 D;  3UT9 D;  5JA4 A;  5B31 G;  3UTA C;  3AZM B;  1P3M B;  3AN2 D;  4CSR B;  1JFI B;  3AZH D;  1B6W A;  4J8X C;  3MGS A;  4KUD A;  1M1A D;  5B2I B;  3AZG C;  5GSU A;  1P3I C;  1KX5 B;  5B24 A;  1BH8 A;  3TU4 B;  2HIO B;  1P34 D;  4KHA A;  3MGQ C;  3REI C;  5BNX A;  5F99 A;  3MGP C;  1P3F D;  3AZF A;  4J8X B;  4H9R B;  5B1L C;  4E44 A;  1KX3 A;  1ID3 D;  3X1S A;  3AZG B;  3X1U A;  5AV8 C;  5B32 G;  5E5A D;  3C1B D;  3WTP A;  1ZLA C;  3AZK D;  2PYO D;  4QLC C;  3AZM A;  1P3M A;  4LD9 D;  4CSR A;  3REJ C;  2F8N G;  1JFI A;  3MGP B;  1P3A D;  2F8N K;  5B1L B;  3W98 B;  3KUY C;  5B2I A;  4J8U D;  3MNN D;  5AV8 B;  1KX5 A;  1R4V A;  5AVC D;  5AY8 C;  3AV1 C;  3MVD C;  1ZLA B;  4H9S A;  3VH5 A;  1N1J A;  4QLC B;  5GT0 A;  5B2J C;  5AV9 C;  5B1M C;  3REJ B;  4XZQ D;  4J8X A;  4H9R A;  4NE6 A;  1F1E A;  3KUY B;  4R8P D;  1P3G C;  4EO5 C;  5AV6 B;  5B0Y D;  3VH6 W;  4YM6 D;  1BFM A;  3LZ1 C;  1HQ3 C;  5B31 B;  1M19 A;  1B67 A;  2FJ7 D;  1ULY A;  3LEL C;  5AY8 B;  3AV1 B;  3MVD B;  5B2J B;  5AV9 B;  4UUZ B;  5B1M B;  5GSU D;  4DRA A;  3MGP A;  5B32 C;  5B1L A;  4ZUX B;  5BT1 C;  3W98 A;  5C3I C;  1P3G B;  4EO5 B;  5AV8 A;  3AZE A;  5DNN C;  3AZI C;  5GT3 C;  3LEL B;  3AZF D;  4J8W C;  4KGC D;  4QLC A;  5JRG C;  3B6F C;  5B40 C;  3LJA D;  4JJN C;  3REJ A;  5B33 B;  4Z2M H;  5B32 B;  3X1T B;  2CV5 C;  2ARO C;  3KUY A;  1S32 C;  1P3L C;  5B24 C;  3WTP D;  4XUJ C;  3AV2 D;  5C3I B;  5AV6 A;  3B0D C;  5JA4 B;  3AZN C;  5DNN B;  2HUE B;  1P3K D;  5B31 A;  3AZI B;  3AZM D;  3W97 D;  5GT3 B;  3NQJ B;  2NZD A;  5F99 C;  3AV1 A;  3MVD A;  2F8N B;  1KX3 C;  1H3O B;  4J8W B;  5JRG B;  5B2J A;  5AV9 A;  4J8V D;  3X1S C;  4UUZ A;  5B1M A;  5B40 B;  3X1U C;  4WU8 C;  4JJN B;  4ZUX A;  2CV5 B;  2ARO B;  5CP6 B;  1S32 B;  1P3L B;  5B24 B;  4XUJ B;  1P3G A;  3TU4 D;  1P3O B;  2HIO D;  3B0D B;  1KU5 A;  3AZN B;  3UTA D;  1KX4 C;  1P3M C;  3LEL A;  1KX3 B;  4J8X D;  4WU8 B;  3AZG D;  4H9N B;  3X1U B;  5B33 A;  1P3I D;  3AZJ D;  5B32 A;  3X1T A;  3MGR C;  4Z66 B;  4H9S C;  2IO5 C;  5DNN A;  5GT0 C;  4HGA C;  1KX4 B;  5AVB D;  3AZI A;  3NQJ A;  5GT3 A;  5GXQ B;  3MGQ D;  3REI D;  3KXB C;  3B6G C;  2F8N A;  1H3O A;  3VH5 T;  4AWL C;  4J8W A;  5JRG A;  3B6F A;  1AOI C;  5B40 A;  4JJN A;  5AV8 D;  4Z2M G;  5CPK B;  3WAA B;  2CV5 A;  3MGR B;  1M19 C;  2LY8 A;  2ARO A;  5CP6 A;  5KDM B;  1HTA A;  1S32 A;  1P3L A;  4XUJ A;  1P3O A;  1ZLA D;  2IO5 B;  3AZN A;  1N1J B;  4QLC D;  4HGA B;  5BS7 A;  5GT0 B;  3LZ0 C;  3REJ D;  3KXB B;  3B6G B;  3W98 C;  5AV5 D;  4AWL B;  3KUY D;  4WU8 A;  1AOI B;  3B0C T;  4H9N A;  4Z5T A;  3AZE C;  2L5A A;  4Z66 A;  1M19 B;  1P3P C;  4G91 C;  4ZBJ C;  3W96 B;  5AY8 D;  3AV1 D;  3C1C C;  5B2J D;  5AV9 D;  3LZ0 B;  1KX4 A;  1EQZ A;  5GXQ A;  3X1V C;  3AZH C;  5AV6 C;  5CPK A;  3AZE B;  3WAA A;  3LZ1 D;  5B31 C;  1HQ3 D;  3MGR A;  4NE3 A;  3AYW C;  2NZD C;  5KDM A;  3AZL C;  4H9Q B;  5CPI C;  1P3P B;  4G91 B;  4ZBJ B;  3VH6 A;  5DNM D;  3C1C B;  3KWQ B;  4WU9 A;  3REL B;  3UT9 B;  3X1V B;  3KXB A;  3B6G A;  4ZUX C;  5B32 D;  1F66 C;  3A6N C;  5BT1 D;  3AN2 B;  1AOI A;  1WWI A;  3B6F B;  3AZH B;  3O62 C;  5DNN D;  3AYW B;  1M18 C;  3AZI D;  2NZD B;  5GT3 D;  3AZL B;  5CPI B;  3W96 A;  3AFA A;  3MGS D;  3WA9 A;  4KUD D;  3LZ0 A;  3B6F D;  3REK C;  1P34 B;  5B33 C;  4JJN D; 
#chains in the Genus database with same CATH topology
 5BNV B;  3X1T C;  2CV5 D;  1F66 B;  3A6N B;  5B24 D;  1P3A C;  3O62 B;  3UTB C;  2HUE C;  3EPH A;  1M18 B;  3W99 C;  4H9Q A;  1P3P A;  5F99 D;  3C1C A;  3KWQ A;  1KX3 D;  5AVC C;  3REL A;  3X1S D;  4WU8 D;  4WNN B;  3REK B;  3UT9 A;  2CWE A;  3X1U D;  3X1V A;  5CP6 C;  4M6B A;  3AN2 A;  1P3O C;  2BYK B;  3AZH A;  1P3A B;  3UTB B;  3AYW A;  5BS7 C;  1KX4 D;  1P3M D;  1A7W A;  4G92 C;  3AZL A;  5CPI A;  3W99 B;  3H0R C;  5AVC B;  2Y2H A;  4WV4 B;  5B2I D;  4Z5T C;  1P34 A;  2NQB C;  5CPJ C;  5BNV A;  1KX5 D;  4Z66 C;  1F66 A;  3MGR D;  3A6N A;  3O62 A;  4R8P B;  5GT0 D;  1EQZ C;  1M18 A;  2W8S A;  5B0Y B;  5GXQ C;  4G92 B;  5E5A A;  3KXB D;  3B6G D;  1U35 C;  1W2E A;  3AZK A;  4WNN A;  4Z5T B;  3REK A;  5CPK C;  2PYO A;  2NQB B;  4X23 C;  3WAA C;  5CPJ B;  4LD9 A;  1M19 D;  2YFV B;  3LJA C;  5G49 B;  2BYK A;  1P3A A;  4WU9 C;  3UTB A;  3MNN A;  2BYM A;  1EQZ B;  3W99 A;  3REH C;  1P3K C;  3MGP D;  1U35 B;  3W97 C;  5B1L D;  3W98 D;  3AL0 C;  5AVC A;  3WKJ C;  3AZE D;  4X23 B;  4J8V C;  1P3B C;  1WWS A;  3LJA B;  3W96 C;  3AFA C;  1P3P D;  2RVQ C;  4WU9 B;  3WA9 C;  4R8P A;  5CHL B;  5B0Y A;  5B0Z C;  4YM6 A;  3REH B;  3X1V D;  4CAY B;  1P3K B;  3W97 B;  3B0B A;  2FJ7 A;  1TZY C;  3WKJ B;  5AV6 D;  4H9P B;  2NQB A;  5CPJ A;  4J8V B;  1P3B B;  5B31 D;  3AYW D;  2YFV A;  2NZD D;  2XD5 A;  3AZL D;  3AZJ C;  5G49 A;  3AFA B;  5CPI D;  3H0L C;  3MVD D;  3KWQ C;  3WA9 B;  3REL C;  4YS3 C;  5B1M D;  3UT9 C;  5B0Z B;  3UTA B;  1U35 A;  5AVB C;  4ZUX D;  4UPK A;  1F66 D;  3A6N D;  3AN2 C;  1TZY B;  1P3G D;  2F2A C;  4X23 A;  3O62 D;  1M1A C;  4KGC A;  5FUG B;  1M18 D;  3LJA A;  1P3I B;  3AZJ B;  3LEL D;  3AV2 A;  1PZR A;  4WZS B;  4YS3 B;  4NFT A;  3REK D;  1P34 C;  3NQU B;  3REH A;  5B33 D;  4CAY A;  1P3K A;  5AVB B;  3W97 A;  3X1T D;  2JCH A;  2UWX A;  3MGQ B;  3REI B;  1P3F C;  3WKJ A;  4H9P A;  5AV5 C;  1ID3 C;  4J8V A;  1BH9 B;  3UTB D;  2DQN C;  1P3B A;  1M1A B;  3W99 D;  5E5A C;  5BO0 B;  3C1B C;  2YFW B;  2F8N D;  3EG5 B;  2JSS A;  4J8W D;  5JRG D;  3AZK C;  5B40 D;  3TU4 A;  2HIO A;  5B0Z A;  2PYO C;  3UTA A;  4LD9 C;  2ARO D;  5CP6 D;  1TZY A;  1S32 D;  4E45 A;  1P3F B;  1P3L D;  4XUJ D;  1P3O D;  5AV5 B;  3AZN D;  1TAF B;  1ID3 B;  4J8U C;  5FUG A;  3MNN C;  3AZG A;  1P3I A;  5E5A B;  3AZJ A;  3C1B B;  3VH5 W;  3R45 B;  3AZK B;  4YS3 A;  5DNM C;  4Z5T D;  3NQU A;  2PYO B;  2NQB D;  4H9O B;  5CPJ D;  4NE5 A;  5AVB A;  4LD9 B;  4Z66 D;  3MGQ A;  3REI A;  3F6T A;  4XZQ C;  2Y2Q A;  1BH9 A;  4R8P C;  4J8U B;  1M1A A;  3MNN B;  2BYM B;  1EQZ D;  5B0Y C;  4YM6 C;  5GXQ D;  5BO0 A;  2YFW A;  3LZ1 B;  1HQ3 B;  1U35 D;  2FJ7 C;  3B0C W;  1ZLA A;  5DNM B;  4DQY B;  5CPK D;  3MGS C;  4KUD C;  4X23 D;  3WAA D;  2J8P A;  5GSU C;  1Q9C A;  1P3F A;  2VQR A;  4XZQ B;  5AV5 A;  4WU9 D;  1TAF A;  1ID3 A;  3WTP E;  3V9R B;  4YM6 B;  3REH D;  2DF4 C;  3C1B A;  2Y2O A;  3KSY A;  3R45 A;  2FJ7 B;  1AOI D;  5AY8 A;  3AZF C;  3WKJ D;  4KGC C;  4H9O A;  2G5I C;  4DRB A;  3MGS B;  4KUD B;  1P3B D;  2FFF B;  5GSU B;  3W96 D;  3AFA D;  2RVQ D;  4J8U A;  3WTP C;  3WA9 D;  3LZ0 D;  3AV2 C;  1BH8 B;  5B0Z D;  3VH6 T;  3LZ1 A;  1HQ3 A;  4KHA B;  3AZM C;  1TZY D;  5BNX B;  5F99 B;  5DNM A;  2F8N H;  3AZF B;  4KGC B;  2ZY3 A;  5B2I C;  3X1S B;  4XZQ A;  1KX5 C;  3C1C D;  3KWQ D;  3WTP B;  3REL D;  2XD1 A;  3AV2 B;  3TU4 C;  2ZY4 A;  2HIO C;  3V9R A;  4YS3 D;  3UT9 D;  5JA4 A;  5B31 G;  3UTA C;  3AZM B;  1P3M B;  3AN2 D;  4CSR B;  1JFI B;  3AZH D;  1B6W A;  4J8X C;  3MGS A;  4KUD A;  1M1A D;  5B2I B;  3AZG C;  5GSU A;  1P3I C;  1KX5 B;  3FDD A;  5B24 A;  1BH8 A;  3TU4 B;  2HIO B;  1P34 D;  4KHA A;  3MGQ C;  3REI C;  5BNX A;  5F99 A;  3MGP C;  1P3F D;  3KFU G;  3AZF A;  4J8X B;  4H9R B;  5B1L C;  4E44 A;  1KX3 A;  1ID3 D;  3X1S A;  3AZG B;  4WJ3 C;  3X1U A;  5AV8 C;  5B32 G;  5E5A D;  3C1B D;  3WTP A;  3EPK A;  1ZLA C;  3AZK D;  2PYO D;  4QLC C;  3AZM A;  1P3M A;  4LD9 D;  4CSR A;  3REJ C;  2F8N G;  1JFI A;  3MGP B;  1P3A D;  2F8N K;  2Y2G A;  5B1L B;  2RIQ A;  3W98 B;  3KUY C;  5B2I A;  4J8U D;  3MNN D;  5AV8 B;  2Y2L A;  1KX5 A;  2Y2K A;  1R4V A;  3IP4 C;  5AVC D;  5AY8 C;  3AV1 C;  3MVD C;  1ZLA B;  4H9S A;  3VH5 A;  1N1J A;  5B2J C;  5GT0 A;  5AV9 C;  4QLC B;  5B1M C;  3REJ B;  4XZQ D;  2G5H C;  4J8X A;  4H9R A;  2ZY2 A;  4NE6 A;  3A1K A;  1F1E A;  3KUY B;  4R8P D;  1P3G C;  4EO5 C;  5AV6 B;  5B0Y D;  3VH6 W;  4YM6 D;  1BFM A;  3LZ1 C;  1HQ3 C;  5B31 B;  1M19 A;  1B67 A;  2FJ7 D;  1ULY A;  3LEL C;  5AY8 B;  3AV1 B;  3MVD B;  5B2J B;  5AV9 B;  4UUZ B;  5B1M B;  5GSU D;  4DRA A;  3MGP A;  3EPJ A;  5B32 C;  5B1L A;  4ZUX B;  5BT1 C;  3W98 A;  5C3I C;  1P3G B;  4EO5 B;  5AV8 A;  3AZE A;  5DNN C;  2Y2N A;  3AZI C;  5GT3 C;  3LEL B;  3AZF D;  4J8W C;  4KGC D;  4QLC A;  5JRG C;  3B6F C;  5B40 C;  2ZY5 A;  3LJA D;  4JJN C;  3REJ A;  5B33 B;  4Z2M H;  5B32 B;  3X1T B;  2CV5 C;  2ARO C;  3A1I A;  3KUY A;  1S32 C;  1P3L C;  5B24 C;  2Y2P A;  4XUJ C;  3WTP D;  3AV2 D;  5C3I B;  5AV6 A;  3B0D C;  2ZM5 A;  5JA4 B;  3AZN C;  5DNN B;  2HUE B;  1P3K D;  5B31 A;  3AZI B;  3AZM D;  3W97 D;  5GT3 B;  3NQJ B;  2NZD A;  5F99 C;  3AV1 A;  3MVD A;  2F8N B;  1KX3 C;  1H3O B;  4J8W B;  5JRG B;  5B2J A;  5AV9 A;  4J8V D;  3X1S C;  4UUZ A;  5B1M A;  5B40 B;  3X1U C;  4WU8 C;  4JJN B;  4ZUX A;  2CV5 B;  2ARO B;  5CP6 B;  1S32 B;  1P3L B;  5B24 B;  4XUJ B;  1P3G A;  3TU4 D;  1P3O B;  2HIO D;  3B0D B;  1KU5 A;  3AZN B;  3UTA D;  1KX4 C;  1P3M C;  3LEL A;  1KX3 B;  4J8X D;  4WU8 B;  3AZG D;  4H9N B;  3X1U B;  5B33 A;  1P3I D;  3AZJ D;  5B32 A;  3X1T A;  3MGR C;  4Z66 B;  2BG1 A;  4H9S C;  2IO5 C;  5DNN A;  5GT0 C;  4HGA C;  1KX4 B;  5AVB D;  3AZI A;  3NQJ A;  5GT3 A;  1Z2C B;  5GXQ B;  3MGQ D;  3REI D;  3KXB C;  3B6G C;  2F8N A;  1H3O A;  3VH5 T;  4AWL C;  4J8W A;  5JRG A;  3B6F A;  1AOI C;  5B40 A;  4JJN A;  5AV8 D;  4Z2M G;  5CPK B;  2Y2J A;  3WAA B;  2CV5 A;  3MGR B;  1M19 C;  2LY8 A;  2ARO A;  5CP6 A;  5KDM B;  1HTA A;  1S32 A;  1P3L A;  4XUJ A;  1P3O A;  1ZLA D;  2IO5 B;  3AZN A;  1N1J B;  4QLC D;  4HGA B;  5BS7 A;  5GT0 B;  3LZ0 C;  3REJ D;  3KXB B;  3B6G B;  3W98 C;  5AV5 D;  4AWL B;  3KUY D;  4WU8 A;  1AOI B;  3P5J B;  3B0C T;  4H9N A;  4Z5T A;  3AZE C;  2L5A A;  4Z66 A;  1M19 B;  2Y2I A;  3H0M C;  1P3P C;  4G91 C;  4ZBJ C;  3W96 B;  5AY8 D;  3AV1 D;  3C1C C;  2Y2M A;  5B2J D;  5AV9 D;  3LZ0 B;  1KX4 A;  1EQZ A;  5GXQ A;  3X1V C;  3AZH C;  5AV6 C;  5CPK A;  3AZE B;  3EPL A;  3WAA A;  3LZ1 D;  5B31 C;  1HQ3 D;  3MGR A;  4NE3 A;  3AYW C;  2NZD C;  5KDM A;  3AZL C;  2JE5 A;  4H9Q B;  5CPI C;  1P3P B;  4G91 B;  4ZBJ B;  3VH6 A;  5DNM D;  3C1C B;  3KWQ B;  4WU9 A;  3REL B;  3UT9 B;  3X1V B;  3KXB A;  3B6G A;  4ZUX C;  5B32 D;  1F66 C;  3A6N C;  5BT1 D;  3AN2 B;  1T3U A;  1AOI A;  1WWI A;  3B6F B;  3AZH B;  3O62 C;  5DNN D;  3AYW B;  1M18 C;  3AZI D;  2NZD B;  5GT3 D;  3AZL B;  5CPI B;  3W96 A;  3AFA A;  3MGS D;  3WA9 A;  4KUD D;  3LZ0 A;  3B6F D;  3REK C;  1P34 B;  5B33 C;  4JJN D; 
#chains in the Genus database with same CATH homology
 5BNV B;  3X1T C;  2CV5 D;  1F66 B;  3A6N B;  5B24 D;  1P3A C;  3O62 B;  3UTB C;  2HUE C;  3EPH A;  1M18 B;  3W99 C;  4H9Q A;  1P3P A;  5F99 D;  3C1C A;  3KWQ A;  1KX3 D;  5AVC C;  3REL A;  3X1S D;  4WU8 D;  4WNN B;  3REK B;  3UT9 A;  2CWE A;  3X1U D;  3X1V A;  5CP6 C;  4M6B A;  3AN2 A;  1P3O C;  2BYK B;  3AZH A;  1P3A B;  3UTB B;  3AYW A;  5BS7 C;  1KX4 D;  1P3M D;  1A7W A;  4G92 C;  3AZL A;  5CPI A;  3W99 B;  3H0R C;  5AVC B;  2Y2H A;  4WV4 B;  5B2I D;  4Z5T C;  1P34 A;  2NQB C;  5CPJ C;  5BNV A;  1KX5 D;  4Z66 C;  1F66 A;  3MGR D;  3A6N A;  3O62 A;  4R8P B;  5GT0 D;  1EQZ C;  1M18 A;  2W8S A;  5B0Y B;  5GXQ C;  4G92 B;  5E5A A;  3KXB D;  3B6G D;  1U35 C;  1W2E A;  3AZK A;  4WNN A;  4Z5T B;  3REK A;  5CPK C;  2PYO A;  2NQB B;  4X23 C;  3WAA C;  5CPJ B;  4LD9 A;  1M19 D;  2YFV B;  3LJA C;  5G49 B;  2BYK A;  1P3A A;  4WU9 C;  3UTB A;  3MNN A;  2BYM A;  1EQZ B;  3W99 A;  3REH C;  1P3K C;  3MGP D;  1U35 B;  3W97 C;  5B1L D;  3W98 D;  3AL0 C;  5AVC A;  3WKJ C;  3AZE D;  4X23 B;  4J8V C;  1P3B C;  1WWS A;  3LJA B;  3W96 C;  3AFA C;  1P3P D;  2RVQ C;  4WU9 B;  3WA9 C;  4R8P A;  5CHL B;  5B0Y A;  5B0Z C;  4YM6 A;  3REH B;  3X1V D;  4CAY B;  1P3K B;  3W97 B;  3B0B A;  2FJ7 A;  1TZY C;  3WKJ B;  5AV6 D;  4H9P B;  2NQB A;  5CPJ A;  4J8V B;  1P3B B;  5B31 D;  3AYW D;  2YFV A;  2NZD D;  2XD5 A;  3AZL D;  3AZJ C;  5G49 A;  3AFA B;  5CPI D;  3H0L C;  3MVD D;  3KWQ C;  3WA9 B;  3REL C;  4YS3 C;  5B1M D;  3UT9 C;  5B0Z B;  3UTA B;  1U35 A;  5AVB C;  4ZUX D;  4UPK A;  1F66 D;  3A6N D;  3AN2 C;  1TZY B;  1P3G D;  2F2A C;  4X23 A;  3O62 D;  1M1A C;  4KGC A;  5FUG B;  1M18 D;  3LJA A;  1P3I B;  3AZJ B;  3LEL D;  3AV2 A;  1PZR A;  4WZS B;  4YS3 B;  4NFT A;  3REK D;  1P34 C;  3NQU B;  3REH A;  5B33 D;  4CAY A;  1P3K A;  5AVB B;  3W97 A;  3X1T D;  2JCH A;  2UWX A;  3MGQ B;  3REI B;  1P3F C;  3WKJ A;  4H9P A;  5AV5 C;  1ID3 C;  4J8V A;  1BH9 B;  3UTB D;  2DQN C;  1P3B A;  1M1A B;  3W99 D;  5E5A C;  5BO0 B;  3C1B C;  2YFW B;  2F8N D;  3EG5 B;  2JSS A;  4J8W D;  5JRG D;  3AZK C;  5B40 D;  3TU4 A;  2HIO A;  5B0Z A;  2PYO C;  3UTA A;  4LD9 C;  2ARO D;  5CP6 D;  1TZY A;  1S32 D;  4E45 A;  1P3F B;  1P3L D;  4XUJ D;  1P3O D;  5AV5 B;  3AZN D;  1TAF B;  1ID3 B;  4J8U C;  5FUG A;  3MNN C;  3AZG A;  1P3I A;  5E5A B;  3AZJ A;  3C1B B;  3VH5 W;  3R45 B;  3AZK B;  4YS3 A;  5DNM C;  4Z5T D;  3NQU A;  2PYO B;  2NQB D;  4H9O B;  5CPJ D;  4NE5 A;  5AVB A;  4LD9 B;  4Z66 D;  3MGQ A;  3REI A;  3F6T A;  4XZQ C;  2Y2Q A;  1BH9 A;  4R8P C;  4J8U B;  1M1A A;  3MNN B;  2BYM B;  1EQZ D;  5B0Y C;  4YM6 C;  5GXQ D;  5BO0 A;  2YFW A;  3LZ1 B;  1HQ3 B;  1U35 D;  2FJ7 C;  3B0C W;  1ZLA A;  5DNM B;  4DQY B;  5CPK D;  3MGS C;  4KUD C;  4X23 D;  3WAA D;  2J8P A;  5GSU C;  1Q9C A;  1P3F A;  2VQR A;  4XZQ B;  5AV5 A;  4WU9 D;  1TAF A;  1ID3 A;  3WTP E;  3V9R B;  4YM6 B;  3REH D;  2DF4 C;  3C1B A;  2Y2O A;  3KSY A;  3R45 A;  2FJ7 B;  1AOI D;  5AY8 A;  3AZF C;  3WKJ D;  4KGC C;  4H9O A;  2G5I C;  4DRB A;  3MGS B;  4KUD B;  1P3B D;  2FFF B;  5GSU B;  3W96 D;  3AFA D;  2RVQ D;  4J8U A;  3WTP C;  3WA9 D;  3LZ0 D;  3AV2 C;  1BH8 B;  5B0Z D;  3VH6 T;  3LZ1 A;  1HQ3 A;  4KHA B;  3AZM C;  1TZY D;  5BNX B;  5F99 B;  5DNM A;  2F8N H;  3AZF B;  4KGC B;  2ZY3 A;  5B2I C;  3X1S B;  4XZQ A;  1KX5 C;  3C1C D;  3KWQ D;  3WTP B;  3REL D;  2XD1 A;  3AV2 B;  3TU4 C;  2ZY4 A;  2HIO C;  3V9R A;  4YS3 D;  3UT9 D;  5JA4 A;  5B31 G;  3UTA C;  3AZM B;  1P3M B;  3AN2 D;  4CSR B;  1JFI B;  3AZH D;  1B6W A;  4J8X C;  3MGS A;  4KUD A;  1M1A D;  5B2I B;  3AZG C;  5GSU A;  1P3I C;  1KX5 B;  3FDD A;  5B24 A;  1BH8 A;  3TU4 B;  2HIO B;  1P34 D;  4KHA A;  3MGQ C;  3REI C;  5BNX A;  5F99 A;  3MGP C;  1P3F D;  3KFU G;  3AZF A;  4J8X B;  4H9R B;  5B1L C;  4E44 A;  1KX3 A;  1ID3 D;  3X1S A;  3AZG B;  4WJ3 C;  3X1U A;  5AV8 C;  5B32 G;  5E5A D;  3C1B D;  3WTP A;  3EPK A;  1ZLA C;  3AZK D;  2PYO D;  4QLC C;  3AZM A;  1P3M A;  4LD9 D;  4CSR A;  3REJ C;  2F8N G;  1JFI A;  3MGP B;  1P3A D;  2F8N K;  2Y2G A;  5B1L B;  2RIQ A;  3W98 B;  3KUY C;  5B2I A;  4J8U D;  3MNN D;  5AV8 B;  2Y2L A;  1KX5 A;  2Y2K A;  1R4V A;  3IP4 C;  5AVC D;  5AY8 C;  3AV1 C;  3MVD C;  1ZLA B;  4H9S A;  3VH5 A;  1N1J A;  5B2J C;  5GT0 A;  5AV9 C;  4QLC B;  5B1M C;  3REJ B;  4XZQ D;  2G5H C;  4J8X A;  4H9R A;  2ZY2 A;  4NE6 A;  3A1K A;  1F1E A;  3KUY B;  4R8P D;  1P3G C;  4EO5 C;  5AV6 B;  5B0Y D;  3VH6 W;  4YM6 D;  1BFM A;  3LZ1 C;  1HQ3 C;  5B31 B;  1M19 A;  1B67 A;  2FJ7 D;  1ULY A;  3LEL C;  5AY8 B;  3AV1 B;  3MVD B;  5B2J B;  5AV9 B;  4UUZ B;  5B1M B;  5GSU D;  4DRA A;  3MGP A;  3EPJ A;  5B32 C;  5B1L A;  4ZUX B;  5BT1 C;  3W98 A;  5C3I C;  1P3G B;  4EO5 B;  5AV8 A;  3AZE A;  5DNN C;  2Y2N A;  3AZI C;  5GT3 C;  3LEL B;  3AZF D;  4J8W C;  4KGC D;  4QLC A;  5JRG C;  3B6F C;  5B40 C;  2ZY5 A;  3LJA D;  4JJN C;  3REJ A;  5B33 B;  4Z2M H;  5B32 B;  3X1T B;  2CV5 C;  2ARO C;  3A1I A;  3KUY A;  1S32 C;  1P3L C;  5B24 C;  2Y2P A;  4XUJ C;  3WTP D;  3AV2 D;  5C3I B;  5AV6 A;  3B0D C;  2ZM5 A;  5JA4 B;  3AZN C;  5DNN B;  2HUE B;  1P3K D;  5B31 A;  3AZI B;  3AZM D;  3W97 D;  5GT3 B;  3NQJ B;  2NZD A;  5F99 C;  3AV1 A;  3MVD A;  2F8N B;  1KX3 C;  1H3O B;  4J8W B;  5JRG B;  5B2J A;  5AV9 A;  4J8V D;  3X1S C;  4UUZ A;  5B1M A;  5B40 B;  3X1U C;  4WU8 C;  4JJN B;  4ZUX A;  2CV5 B;  2ARO B;  5CP6 B;  1S32 B;  1P3L B;  5B24 B;  4XUJ B;  1P3G A;  3TU4 D;  1P3O B;  2HIO D;  3B0D B;  1KU5 A;  3AZN B;  3UTA D;  1KX4 C;  1P3M C;  3LEL A;  1KX3 B;  4J8X D;  4WU8 B;  3AZG D;  4H9N B;  3X1U B;  5B33 A;  1P3I D;  3AZJ D;  5B32 A;  3X1T A;  3MGR C;  4Z66 B;  2BG1 A;  4H9S C;  2IO5 C;  5DNN A;  5GT0 C;  4HGA C;  1KX4 B;  5AVB D;  3AZI A;  3NQJ A;  5GT3 A;  1Z2C B;  5GXQ B;  3MGQ D;  3REI D;  3KXB C;  3B6G C;  2F8N A;  1H3O A;  3VH5 T;  4AWL C;  4J8W A;  5JRG A;  3B6F A;  1AOI C;  5B40 A;  4JJN A;  5AV8 D;  4Z2M G;  5CPK B;  2Y2J A;  3WAA B;  2CV5 A;  3MGR B;  1M19 C;  2LY8 A;  2ARO A;  5CP6 A;  5KDM B;  1HTA A;  1S32 A;  1P3L A;  4XUJ A;  1P3O A;  1ZLA D;  2IO5 B;  3AZN A;  1N1J B;  4QLC D;  4HGA B;  5BS7 A;  5GT0 B;  3LZ0 C;  3REJ D;  3KXB B;  3B6G B;  3W98 C;  5AV5 D;  4AWL B;  3KUY D;  4WU8 A;  1AOI B;  3P5J B;  3B0C T;  4H9N A;  4Z5T A;  3AZE C;  2L5A A;  4Z66 A;  1M19 B;  2Y2I A;  3H0M C;  1P3P C;  4G91 C;  4ZBJ C;  3W96 B;  5AY8 D;  3AV1 D;  3C1C C;  2Y2M A;  5B2J D;  5AV9 D;  3LZ0 B;  1KX4 A;  1EQZ A;  5GXQ A;  3X1V C;  3AZH C;  5AV6 C;  5CPK A;  3AZE B;  3EPL A;  3WAA A;  3LZ1 D;  5B31 C;  1HQ3 D;  3MGR A;  4NE3 A;  3AYW C;  2NZD C;  5KDM A;  3AZL C;  2JE5 A;  4H9Q B;  5CPI C;  1P3P B;  4G91 B;  4ZBJ B;  3VH6 A;  5DNM D;  3C1C B;  3KWQ B;  4WU9 A;  3REL B;  3UT9 B;  3X1V B;  3KXB A;  3B6G A;  4ZUX C;  5B32 D;  1F66 C;  3A6N C;  5BT1 D;  3AN2 B;  1T3U A;  1AOI A;  1WWI A;  3B6F B;  3AZH B;  3O62 C;  5DNN D;  3AYW B;  1M18 C;  3AZI D;  2NZD B;  5GT3 D;  3AZL B;  5CPI B;  3W96 A;  3AFA A;  3MGS D;  3WA9 A;  4KUD D;  3LZ0 A;  3B6F D;  3REK C;  1P34 B;  5B33 C;  4JJN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...