3AZND

Crystal structure of human nucleosome core particle containing h4k91q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aznD00
3WKJC 4KGCB 1H3OB 1BH8B 5GT3B 5BT1C 3AZHC 3B6FC 1KU5A 1U35D 4CAYB 2NZDD 3VH5A 3A6NC 5GXQA 3UTAD 5E5AD 3X1VB 3AZGC 1KX4C 5JA4B 1WWSA 3UTBC 3REJB 3W98C 1P3GA 5AV9C 5BS7A 5DNNC 3WKJD 1M18A 4H9QA 1U35B 4QLCD 2CV5A 1P34A 1HTAA 3AZMA 3W99D 3RELD 4ZBJB 3A6ND 3WKJB 3VH5T 4H9NA 3AZKA 3AZGD 4LD9C 1P3KA 1P3OA 5CPKA 4J8XB 3WA9D 2HIOD 3MGQA 4WU8C 1ZLAC 5GT0D 5JRGD 3MGPD 3A6NB 1AOIC 4H9QB 3B6GD 5DNMC 3AZGB 3REIC 2RVQD 3W96A 4JJND 5AV9B 2HIOB 3KWQD 2BYKB 5B2JA 5AV6A 3REKD 5AV5D 3MNNB 5AV8D 5B24C 1BH8A 1EQZC 3AZLC 4JJNB 5AV9D 5AVBB 5AV9A 5B33C 5B1MD 5KDMB 4X23D 2IO5B 1P34C 5AVCD 1ZLAB 1AOIB 1M19B 3LZ1D 5DNMB 5E5AA 4LD9A 1F66C 3LELC 5GSUA 3AZEA 5AVCB 4WU8A 3X1TB 1AOID 3LZ1B 3MNNC 1AOIA 1P3KB 1EQZB 2AROB 3AZLB 1HQ3C 5AVBC 3MGQB 1ULYA 4YM6B 3AN2D 5B2JC 5AV6C 2IO5C 5BO0B 1P34B 3AZIC 4XZQB 5BNXB 1P3KD 4G92B 3AZLD 3AZLA 4H9PB 3KXBC 5B32B 5AY8C 3VH6T 3X1TA 5B33A 4YM6D 3AN2B 5GXQD 4XZQD 4UUZA 5B2ID 4Z66D 5B2JD 5AV6D 1P3GD 2PYOC 3AZKC 5B32D 1A7WA 1P3KC 3REKA 4KUDD 2AROC 3WAAC 4E44A 4J8XA 3W97C 4J8UD 1F66A 3MGQC 5B32G 5BT1D 3KUYB 3AZHD 4YM6C 4Z66B 3C1BC 2BYMB 5AV6B 5B2JB 3B6FD 4KGCC 2YFWA 3AZIB 1B6WA 1P3LB 5GT3C 3WA9A 3KXBB 1BH9A 1HQ3A 3MVDB 1Q9CA 3X1UD 5B31B 1ID3B 3AN2C 1M18B 4Z5TC 3X1VC 3O62B 3AZID 4J8VC 4XZQA 1P3LD 2YFWB 1B67A 3REJC 3AZIA 5DNNB 2F8ND 5B1LC 3AZKB 3MVDD 1U35C 3WKJA 1M18D 2NZDC 3W97B 4DRBA 1P3PA 4H9RB 1JFIA 5B0ZA 5CPKB 4WV4B 4Z66C 4KHAA 5BNVA 2JSSA 3LELA 3LZ0D 3REID 4J8XC 5CPKD 5B0YD 1TZYC 1M18C 3NQUB 4Z5TB 4H9SA 3VH6W 4HGAB 3LZ0B 1H3OA 4LD9D 4H9RA 1JFIB 5AVBA 1P3MC 3AZJA 3REHD 3AYWA 3REHA 5CPKC 4JJNC 5B40A 3LELD 4WU9D 1F1EA 5CP6B 5B24D 1M19C 2HIOA 4G91C 3WTPA 3MGSA 2FJ7B 3LJAD 3AYWB 3LELB 3LZ0C 3W97A 3AZFC 5GSUD 3AZNC 4WU9B 5AVCC 1KX5A 5BO0A 3LZ1C 1TZYA 3AV2A 3B0CT 3V9RB 5B32A 3AZMD 4H9SC 1P3PD 3AFAC 3AYWD 3X1SB 4Z2MH 1M1AD 3W98D 5AY8D 3AN2A 5B1MA 3X1VA 3AZND 3AZFD 4J8VA 4XZQC 5JA4A 3UTAC 5CP6C 5FUGA 1P3IA 3AZEC 3X1SD 1M1AB 5CPIB 5AY8B 1HQ3D 3AV2B 5KDMA 4WZSB 3V9RA 4AWLB 3WAAD 3AZNB 3AZFB 4WU9C 3W96D 4Z66A 3C1BD 2PYOB 4E45A 5CPID 2FJ7A 1KX3B 3AFAB 3WAAB 4YS3A 3X1SC 4KUDA 3KUYC 3UTBA 3W96B 3KXBA 3C1BB 3W98A 4J8VD 1P3LC 3UTAB 3X1VD 3AFAD 3MGRB 3AFAA 3REJD 1M1AC 1P3MA 3MVDC 1WWIA 4NE6A 5B31C 1ID3C 2F8NK 5B0YA 3REKC 4QLCB 5G49A 3O62C 4J8VB 5AV8C 3W99B 4JJNA 4KGCD 3UTAA 5B40C 5B1LB 4H9PA 3C1BA 5CHLB 4KHAB 1KX3C 5AV5A 2NZDB 5BNXA 3X1UC 3AV1C 2F8NG 5E5AB 4J8XD 3WA9B 3W96C 1M19A 5B1LD 5GT0B 4NE5A 3A6NA 5G49B 1S32C 3MGRC 3AZNA 3AZFA 1KX4A 5CPJB 1P3BB 1P3MD 1P3FC 3RELB 1TZYB 3REKB 5AV5B 4HGAC 3B0BA 3W99C 5AV8B 5CPJD 1P3BD 1P3MB 5AVBD 1KX5D 1TZYD 5B31A 1ID3A 4QLCA 5JRGB 5B0YC 3MGPB 3AV1B 3B6GB 5CP6A 1P3FD 5E5AC 5AV8A 4Z2MG 1ZLAD 4J8UA 1ZLAA 1M19D 5DNMD 1KX5B 3KWQB 1TAFB 4EO5C 2RVQC 4WU9A 3REIA 3MNNA 3AV1D 1P3FB 3MNND 3AV1A 5GT0A 3X1TD 3AZJB 4G91B 2FJ7C 3AYWC 4YS3C 5B1MB 4KUDC 4X23B 1S32A 4NFTA 2L5AA 5BNVB 4ZUXC 4J8WB 3AZJD 1P34D 3W99A 1M1AA 4ZBJC 1R4VA 2LY8A 3KWQC 4J8WD 4R8PD 2NQBD 3WTPB 3MGSB 3LZ0A 5GXQB 3TU4C 3AZEB 2AROA 1EQZD 2AROD 5CPIC 5C3IB 4J8UC 1P3GB 3LZ1A 3AV2C 3MGQD 4AWLC 4R8PB 4KUDB 2NQBB 3WTPD 3MGSD 2CV5B 4KGCA 3WTPE 3AZED 5B2IA 2YFVA 4ZUXB 4J8WC 2F8NA 3NQJB 3MGRA 4CSRA 4XUJD 2CV5D 3RELA 2CWEA 3KXBD 5AY8A 5B2IB 4ZUXD 5BS7C 5DNNA 4ZUXA 5F99A 1N1JB 3TU4B 1BFMA 4XUJB 4CSRB 1KX4D 5C3IC 4J8UB 4WNNB 5B0ZC 2PYOA 5JRGA 3MGPA 3B6GA 3KSYA 4QLCC 3KUYD 3AZHB 4R8PC 3B6FB 2NQBC 3W97D 3WAAA 3B0CW 4M6BA 4H9OB 3LJAA 3TU4D 5B40B 1P3AC 1N1JA 5B31G 3TU4A 1KX4B 4NE3A 5CPIA 3X1UB 5B31D 1ID3D 5FUGB 3O62D 5GT3A 5B0ZD 3WA9C 5B40D 5GT0C 5B2IC 5DNND 2F8NB 4J8WA 4Z5TD 3AZKD 3NQUA 2HUEB 4Z5TA 4X23A 1S32B 5CPJC 4XUJC 1P3BC 3REJA 4LD9B 3REHC 3RELC 5B0ZB 1U35A 4WU8B 1KX3A 5AV5C 3X1UA 2NZDA 1P3AB 1S32D 2BYMA 1P3PC 3REIB 3KWQA 5JRGC 2HIOC 3VH6A 5B0YB 3MGPC 5F99B 4WU8D 3B6GC 3C1CA 4CAYA 3B0DC 3C1CD 1P3AD 5CP6D 1P3FA 2F8NH 3LJAC 1P3AA 5B24B 2YFVB 5GSUC 1KX5C 2HUEC 4EO5B 3R45A 3NQJA 5B33B 5F99D 3REHB 3C1CB 3AZMC 2BYKA 3AZJC 3UT9A 4YS3B 3UT9D 5B1MC 1P3PB 4X23C 5B33D 4H9NB 5CPJA 1P3BA 1P3OC 1F66B 5F99C 3X1TC 4YS3D 3B0DB 3VH5W 3UT9B 2FJ7D 4H9OA 3LJAB 1P3IB 4UUZB 5GSUB 1F66D 3AZHA 3B6FA 1HQ3B 4R8PA 2NQBA 3WTPC 3MGSC 5GXQC 1P3OD 3C1CC 3AZGA 3AZMB 5AVCA 3X1SA 5B24A 1P3ID 1P3GC 4G92C 1EQZA 2PYOD 3KUYA 4YM6A 1KX3D 5B32C 1TAFA 2CV5C 1P3LA 1P3OB 3UTBB 1BH9B 3MVDA 3W98B 4WNNA 3R45B 3UT9C 3AV2D 4XUJA 3O62A 3MGRD 1P3IC 5GT3D 3UTBD 5B1LA 4DRAA 5DNMA
chains in the Genus database with same CATH superfamily
3WKJC 4KGCB 1H3OB 1BH8B 5GT3B 5BT1C 3AZHC 3B6FC 1KU5A 1U35D 4CAYB 2NZDD 3VH5A 3A6NC 5GXQA 3UTAD 5E5AD 3X1VB 3H0MC 3AZGC 1KX4C 5JA4B 1WWSA 3UTBC 3REJB 3W98C 1P3GA 5AV9C 5BS7A 5DNNC 3WKJD 1M18A 4H9QA 1U35B 4QLCD 2CV5A 1P34A 1HTAA 3AZMA 3W99D 3RELD 4ZBJB 3A6ND 3WKJB 3VH5T 4H9NA 3AZKA 3AZGD 4LD9C 1P3KA 1P3OA 5CPKA 4J8XB 3WA9D 2HIOD 3MGQA 4WU8C 1ZLAC 5GT0D 5JRGD 3MGPD 3A6NB 1AOIC 4H9QB 3B6GD 5DNMC 3AZGB 3REIC 2RVQD 3W96A 4JJND 2BG1A 5AV9B 2HIOB 3KWQD 2BYKB 5B2JA 5AV6A 3REKD 5AV5D 3MNNB 5AV8D 5B24C 1BH8A 1EQZC 3AZLC 4JJNB 5AV9D 5AVBB 5AV9A 5B33C 2XD5A 5B1MD 5KDMB 4X23D 4DQYB 2IO5B 2Y2IA 1P34C 5AVCD 1ZLAB 2Y2LA 1AOIB 1M19B 2ZY2A 3LZ1D 5DNMB 5E5AA 4LD9A 1F66C 3LELC 5GSUA 3AZEA 5AVCB 4WU8A 3X1TB 1AOID 3LZ1B 3MNNC 1AOIA 1P3KB 1EQZB 2AROB 3AZLB 1HQ3C 5AVBC 3MGQB 1ULYA 4YM6B 3AN2D 5B2JC 5AV6C 2IO5C 5BO0B 1P34B 3AZIC 4XZQB 5BNXB 1P3KD 4G92B 3AZLD 2Y2MA 3AZLA 4H9PB 3KXBC 5B32B 5AY8C 3VH6T 3X1TA 5B33A 4YM6D 3AN2B 5GXQD 4XZQD 4UUZA 5B2ID 4Z66D 5B2JD 5AV6D 1P3GD 2PYOC 3AZKC 2Y2QA 5B32D 1A7WA 1P3KC 3REKA 4KUDD 2AROC 3WAAC 4E44A 4J8XA 3W97C 4J8UD 1F66A 3MGQC 2J8PA 5B32G 5BT1D 3KUYB 3AZHD 4YM6C 4Z66B 3C1BC 2BYMB 5AV6B 5B2JB 3B6FD 4KGCC 2YFWA 3AZIB 1B6WA 1P3LB 5GT3C 3WA9A 3KXBB 1BH9A 1HQ3A 3MVDB 1Q9CA 3X1UD 5B31B 1ID3B 3AN2C 1M18B 4Z5TC 3X1VC 3O62B 3AZID 4J8VC 4XZQA 1P3LD 2YFWB 1B67A 3REJC 3AZIA 2Y2PA 5DNNB 2F8ND 5B1LC 3AZKB 3MVDD 1U35C 3WKJA 1M18D 2NZDC 3W97B 4DRBA 1P3PA 4H9RB 1JFIA 5B0ZA 5CPKB 3P5JB 4WV4B 4Z66C 4KHAA 5BNVA 2JSSA 3LELA 3LZ0D 3REID 4J8XC 2ZY3A 5CPKD 5B0YD 1TZYC 1M18C 3FDDA 3NQUB 4Z5TB 4H9SA 3VH6W 4HGAB 3LZ0B 1H3OA 4LD9D 4H9RA 1JFIB 5AVBA 1P3MC 3AZJA 3REHD 2Y2OA 2ZM5A 3AYWA 2UWXA 3REHA 5CPKC 4JJNC 3AL0C 5B40A 1PZRA 4WJ3C 3LELD 4WU9D 1F1EA 5CP6B 5B24D 1M19C 2HIOA 4G91C 3WTPA 3MGSA 2FJ7B 3LJAD 3AYWB 3LELB 3LZ0C 3W97A 3AZFC 5GSUD 3AZNC 4WU9B 5AVCC 1KX5A 2ZY5A 5BO0A 3LZ1C 1TZYA 3AV2A 3B0CT 3V9RB 5B32A 3AZMD 4H9SC 1P3PD 3AFAC 3AYWD 3X1SB 4Z2MH 1M1AD 3W98D 2DQNC 5AY8D 2XD1A 3EPJA 3AN2A 5B1MA 3X1VA 3AZND 3AZFD 4J8VA 4XZQC 5JA4A 3UTAC 5CP6C 5FUGA 1P3IA 3AZEC 3H0LC 3X1SD 1M1AB 5CPIB 5AY8B 1HQ3D 3AV2B 5KDMA 4WZSB 3V9RA 4AWLB 3WAAD 2G5IC 3AZNB 3AZFB 4WU9C 3W96D 4Z66A 3C1BD 2PYOB 4E45A 5CPID 2FJ7A 1KX3B 3AFAB 3WAAB 4YS3A 3X1SC 4KUDA 3KUYC 3UTBA 3W96B 3KXBA 3C1BB 3W98A 4J8VD 1P3LC 3UTAB 3X1VD 3AFAD 3MGRB 3AFAA 3REJD 1M1AC 1P3MA 3MVDC 1WWIA 4NE6A 5B31C 1ID3C 2F8NK 5B0YA 3REKC 4QLCB 5G49A 3O62C 4J8VB 5AV8C 3W99B 4JJNA 4KGCD 3UTAA 5B40C 5B1LB 4H9PA 3C1BA 5CHLB 4KHAB 1KX3C 5AV5A 2NZDB 5BNXA 3X1UC 3AV1C 2F8NG 5E5AB 4J8XD 3WA9B 3W96C 3EPHA 1M19A 3IP4C 5B1LD 5GT0B 4NE5A 3A6NA 5G49B 1S32C 3MGRC 3AZNA 3AZFA 1KX4A 5CPJB 1P3BB 1P3MD 1P3FC 3RELB 1TZYB 2RIQA 3REKB 2Y2HA 5AV5B 4HGAC 3B0BA 3W99C 5AV8B 2DF4C 5CPJD 1P3BD 2Y2KA 1P3MB 5AVBD 1KX5D 1TZYD 2Y2GA 5B31A 1ID3A 4QLCA 5B0YC 5JRGB 3MGPB 3AV1B 3B6GB 5CP6A 1P3FD 5E5AC 5AV8A 4Z2MG 1ZLAD 4J8UA 1ZLAA 1M19D 5DNMD 1KX5B 2JE5A 3KWQB 2Y2JA 1TAFB 4EO5C 2RVQC 4WU9A 3REIA 3MNNA 3AV1D 1P3FB 3MNND 3AV1A 5GT0A 3X1TD 3AZJB 4G91B 2FJ7C 2Y2NA 3AYWC 4YS3C 5B1MB 4KUDC 4X23B 1S32A 4NFTA 2L5AA 5BNVB 4ZUXC 4J8WB 3AZJD 1P34D 3W99A 2F2AC 1M1AA 4ZBJC 1R4VA 3EPKA 2LY8A 3KWQC 4J8WD 4R8PD 2NQBD 3WTPB 3MGSB 3LZ0A 1Z2CB 5GXQB 3TU4C 3AZEB 2AROA 1EQZD 2AROD 5CPIC 5C3IB 4J8UC 1P3GB 3LZ1A 3AV2C 3MGQD 4AWLC 2VQRA 4R8PB 4KUDB 2NQBB 3WTPD 3MGSD 2CV5B 4KGCA 1T3UA 3WTPE 3AZED 5B2IA 2YFVA 4ZUXB 4J8WC 2F8NA 3NQJB 3MGRA 4CSRA 4XUJD 3EPLA 2CV5D 3RELA 2CWEA 3KXBD 5AY8A 5B2IB 4ZUXD 5BS7C 5DNNA 4ZUXA 5F99A 1N1JB 3TU4B 1BFMA 4XUJB 4CSRB 1KX4D 5C3IC 4J8UB 4WNNB 5B0ZC 2PYOA 5JRGA 3MGPA 3B6GA 3KSYA 4QLCC 3KUYD 3AZHB 4R8PC 3B6FB 2NQBC 3W97D 3WAAA 3B0CW 4M6BA 4H9OB 3LJAA 3TU4D 5B40B 1P3AC 1N1JA 5B31G 3TU4A 1KX4B 4UPKA 4NE3A 5CPIA 2G5HC 3X1UB 3KFUG 5B31D 1ID3D 5FUGB 3F6TA 3A1IA 3O62D 5GT3A 5B0ZD 3WA9C 5B40D 5GT0C 2FFFB 5B2IC 5DNND 2F8NB 4J8WA 4Z5TD 3AZKD 2HUEB 3NQUA 4Z5TA 4X23A 1S32B 5CPJC 4XUJC 1P3BC 3REJA 4LD9B 3REHC 3RELC 5B0ZB 1W2EA 2ZY4A 1U35A 4WU8B 1KX3A 5AV5C 3X1UA 2NZDA 1P3AB 1S32D 2BYMA 1P3PC 3REIB 3KWQA 5JRGC 2HIOC 3H0RC 3VH6A 5B0YB 5F99B 3MGPC 4WU8D 3C1CA 3B6GC 4CAYA 3B0DC 3C1CD 1P3AD 2JCHA 5CP6D 1P3FA 2F8NH 3LJAC 1P3AA 5B24B 2YFVB 5GSUC 1KX5C 2HUEC 4EO5B 3R45A 3NQJA 5B33B 5F99D 3REHB 3C1CB 3AZMC 2BYKA 3AZJC 3UT9A 4YS3B 3UT9D 5B1MC 1P3PB 4X23C 5B33D 4H9NB 5CPJA 1P3BA 1P3OC 1F66B 5F99C 3X1TC 4YS3D 3B0DB 3VH5W 3UT9B 2FJ7D 4H9OA 3LJAB 1P3IB 4UUZB 5GSUB 1F66D 3AZHA 3B6FA 1HQ3B 4R8PA 2NQBA 3WTPC 3MGSC 5GXQC 1P3OD 3C1CC 3AZGA 3AZMB 5AVCA 3X1SA 5B24A 3A1KA 1P3ID 1P3GC 4G92C 1EQZA 2PYOD 3KUYA 4YM6A 1KX3D 5B32C 1TAFA 2CV5C 1P3LA 1P3OB 3EG5B 3UTBB 1BH9B 3MVDA 3W98B 4WNNA 3R45B 3UT9C 3AV2D 4XUJA 3O62A 3MGRD 1P3IC 5GT3D 3UTBD 2W8SA 5B1LA 4DRAA 5DNMA
chains in the Genus database with same CATH topology
3WKJC 4KGCB 1H3OB 1BH8B 5GT3B 5BT1C 3AZHC 3B6FC 1KU5A 1U35D 4CAYB 2NZDD 3VH5A 3A6NC 5GXQA 3UTAD 5E5AD 3X1VB 3H0MC 3AZGC 1KX4C 5JA4B 1WWSA 3UTBC 3REJB 3W98C 1P3GA 5AV9C 5BS7A 5DNNC 3WKJD 1M18A 4H9QA 1U35B 4QLCD 2CV5A 1P34A 1HTAA 3AZMA 3W99D 3RELD 4ZBJB 3A6ND 3WKJB 3VH5T 4H9NA 3AZKA 3AZGD 4LD9C 1P3KA 1P3OA 5CPKA 4J8XB 3WA9D 2HIOD 3MGQA 4WU8C 1ZLAC 5GT0D 5JRGD 3MGPD 3A6NB 1AOIC 4H9QB 3B6GD 5DNMC 3AZGB 3REIC 2RVQD 3W96A 4JJND 2BG1A 5AV9B 2HIOB 3KWQD 2BYKB 5B2JA 5AV6A 3REKD 5AV5D 3MNNB 5AV8D 5B24C 1BH8A 1EQZC 3AZLC 4JJNB 5AV9D 5AVBB 5AV9A 5B33C 2XD5A 5B1MD 5KDMB 4X23D 4DQYB 2IO5B 2Y2IA 1P34C 5AVCD 1ZLAB 2Y2LA 1AOIB 1M19B 2ZY2A 3LZ1D 5DNMB 5E5AA 4LD9A 1F66C 3LELC 5GSUA 3AZEA 5AVCB 4WU8A 3X1TB 1AOID 3LZ1B 3MNNC 1AOIA 1P3KB 1EQZB 2AROB 3AZLB 1HQ3C 5AVBC 3MGQB 1ULYA 4YM6B 3AN2D 5B2JC 5AV6C 2IO5C 5BO0B 1P34B 3AZIC 4XZQB 5BNXB 1P3KD 4G92B 3AZLD 2Y2MA 3AZLA 4H9PB 3KXBC 5B32B 5AY8C 3VH6T 3X1TA 5B33A 4YM6D 3AN2B 5GXQD 4XZQD 4UUZA 5B2ID 4Z66D 5B2JD 5AV6D 1P3GD 2PYOC 3AZKC 2Y2QA 5B32D 1A7WA 1P3KC 3REKA 4KUDD 2AROC 3WAAC 4E44A 4J8XA 3W97C 4J8UD 1F66A 3MGQC 2J8PA 5B32G 5BT1D 3KUYB 3AZHD 4YM6C 4Z66B 3C1BC 2BYMB 5AV6B 5B2JB 3B6FD 4KGCC 2YFWA 3AZIB 1B6WA 1P3LB 5GT3C 3WA9A 3KXBB 1BH9A 1HQ3A 3MVDB 1Q9CA 3X1UD 5B31B 1ID3B 3AN2C 1M18B 4Z5TC 3X1VC 3O62B 3AZID 4J8VC 4XZQA 1P3LD 2YFWB 1B67A 3REJC 3AZIA 2Y2PA 5DNNB 2F8ND 5B1LC 3AZKB 3MVDD 1U35C 3WKJA 1M18D 2NZDC 3W97B 4DRBA 1P3PA 4H9RB 1JFIA 5B0ZA 5CPKB 3P5JB 4WV4B 4Z66C 4KHAA 5BNVA 2JSSA 3LELA 3LZ0D 3REID 4J8XC 2ZY3A 5CPKD 5B0YD 1TZYC 1M18C 3FDDA 3NQUB 4Z5TB 4H9SA 3VH6W 4HGAB 3LZ0B 1H3OA 4LD9D 4H9RA 1JFIB 5AVBA 1P3MC 3AZJA 3REHD 2Y2OA 2ZM5A 3AYWA 2UWXA 3REHA 5CPKC 4JJNC 3AL0C 5B40A 1PZRA 4WJ3C 3LELD 4WU9D 1F1EA 5CP6B 5B24D 1M19C 2HIOA 4G91C 3WTPA 3MGSA 2FJ7B 3LJAD 3AYWB 3LELB 3LZ0C 3W97A 3AZFC 5GSUD 3AZNC 4WU9B 5AVCC 1KX5A 2ZY5A 5BO0A 3LZ1C 1TZYA 3AV2A 3B0CT 3V9RB 5B32A 3AZMD 4H9SC 1P3PD 3AFAC 3AYWD 3X1SB 4Z2MH 1M1AD 3W98D 2DQNC 5AY8D 2XD1A 3EPJA 3AN2A 5B1MA 3X1VA 3AZND 3AZFD 4J8VA 4XZQC 5JA4A 3UTAC 5CP6C 5FUGA 1P3IA 3AZEC 3H0LC 3X1SD 1M1AB 5CPIB 5AY8B 1HQ3D 3AV2B 5KDMA 4WZSB 3V9RA 4AWLB 3WAAD 2G5IC 3AZNB 3AZFB 4WU9C 3W96D 4Z66A 3C1BD 2PYOB 4E45A 5CPID 2FJ7A 1KX3B 3AFAB 3WAAB 4YS3A 3X1SC 4KUDA 3KUYC 3UTBA 3W96B 3KXBA 3C1BB 3W98A 4J8VD 1P3LC 3UTAB 3X1VD 3AFAD 3MGRB 3AFAA 3REJD 1M1AC 1P3MA 3MVDC 1WWIA 4NE6A 5B31C 1ID3C 2F8NK 5B0YA 3REKC 4QLCB 5G49A 3O62C 4J8VB 5AV8C 3W99B 4JJNA 4KGCD 3UTAA 5B40C 5B1LB 4H9PA 3C1BA 5CHLB 4KHAB 1KX3C 5AV5A 2NZDB 5BNXA 3X1UC 3AV1C 2F8NG 5E5AB 4J8XD 3WA9B 3W96C 3EPHA 1M19A 3IP4C 5B1LD 5GT0B 4NE5A 3A6NA 5G49B 1S32C 3MGRC 3AZNA 3AZFA 1KX4A 5CPJB 1P3BB 1P3MD 1P3FC 3RELB 1TZYB 2RIQA 3REKB 2Y2HA 5AV5B 4HGAC 3B0BA 3W99C 5AV8B 2DF4C 5CPJD 1P3BD 2Y2KA 1P3MB 5AVBD 1KX5D 1TZYD 2Y2GA 5B31A 1ID3A 4QLCA 5B0YC 5JRGB 3MGPB 3AV1B 3B6GB 5CP6A 1P3FD 5E5AC 5AV8A 4Z2MG 1ZLAD 4J8UA 1ZLAA 1M19D 5DNMD 1KX5B 2JE5A 3KWQB 2Y2JA 1TAFB 4EO5C 2RVQC 4WU9A 3REIA 3MNNA 3AV1D 1P3FB 3MNND 3AV1A 5GT0A 3X1TD 3AZJB 4G91B 2FJ7C 2Y2NA 3AYWC 4YS3C 5B1MB 4KUDC 4X23B 1S32A 4NFTA 2L5AA 5BNVB 4ZUXC 4J8WB 3AZJD 1P34D 3W99A 2F2AC 1M1AA 4ZBJC 1R4VA 3EPKA 2LY8A 3KWQC 4J8WD 4R8PD 2NQBD 3WTPB 3MGSB 3LZ0A 1Z2CB 5GXQB 3TU4C 3AZEB 2AROA 1EQZD 2AROD 5CPIC 5C3IB 4J8UC 1P3GB 3LZ1A 3AV2C 3MGQD 4AWLC 2VQRA 4R8PB 4KUDB 2NQBB 3WTPD 3MGSD 2CV5B 4KGCA 1T3UA 3WTPE 3AZED 5B2IA 2YFVA 4ZUXB 4J8WC 2F8NA 3NQJB 3MGRA 4CSRA 4XUJD 3EPLA 2CV5D 3RELA 2CWEA 3KXBD 5AY8A 5B2IB 4ZUXD 5BS7C 5DNNA 4ZUXA 5F99A 1N1JB 3TU4B 1BFMA 4XUJB 4CSRB 1KX4D 5C3IC 4J8UB 4WNNB 5B0ZC 2PYOA 5JRGA 3MGPA 3B6GA 3KSYA 4QLCC 3KUYD 3AZHB 4R8PC 3B6FB 2NQBC 3W97D 3WAAA 3B0CW 4M6BA 4H9OB 3LJAA 3TU4D 5B40B 1P3AC 1N1JA 5B31G 3TU4A 1KX4B 4UPKA 4NE3A 5CPIA 2G5HC 3X1UB 3KFUG 5B31D 1ID3D 5FUGB 3F6TA 3A1IA 3O62D 5GT3A 5B0ZD 3WA9C 5B40D 5GT0C 2FFFB 5B2IC 5DNND 2F8NB 4J8WA 4Z5TD 3AZKD 2HUEB 3NQUA 4Z5TA 4X23A 1S32B 5CPJC 4XUJC 1P3BC 3REJA 4LD9B 3REHC 3RELC 5B0ZB 1W2EA 2ZY4A 1U35A 4WU8B 1KX3A 5AV5C 3X1UA 2NZDA 1P3AB 1S32D 2BYMA 1P3PC 3REIB 3KWQA 5JRGC 2HIOC 3H0RC 3VH6A 5B0YB 5F99B 3MGPC 4WU8D 3C1CA 3B6GC 4CAYA 3B0DC 3C1CD 1P3AD 2JCHA 5CP6D 1P3FA 2F8NH 3LJAC 1P3AA 5B24B 2YFVB 5GSUC 1KX5C 2HUEC 4EO5B 3R45A 3NQJA 5B33B 5F99D 3REHB 3C1CB 3AZMC 2BYKA 3AZJC 3UT9A 4YS3B 3UT9D 5B1MC 1P3PB 4X23C 5B33D 4H9NB 5CPJA 1P3BA 1P3OC 1F66B 5F99C 3X1TC 4YS3D 3B0DB 3VH5W 3UT9B 2FJ7D 4H9OA 3LJAB 1P3IB 4UUZB 5GSUB 1F66D 3AZHA 3B6FA 1HQ3B 4R8PA 2NQBA 3WTPC 3MGSC 5GXQC 1P3OD 3C1CC 3AZGA 3AZMB 5AVCA 3X1SA 5B24A 3A1KA 1P3ID 1P3GC 4G92C 1EQZA 2PYOD 3KUYA 4YM6A 1KX3D 5B32C 1TAFA 2CV5C 1P3LA 1P3OB 3EG5B 3UTBB 1BH9B 3MVDA 3W98B 4WNNA 3R45B 3UT9C 3AV2D 4XUJA 3O62A 3MGRD 1P3IC 5GT3D 3UTBD 2W8SA 5B1LA 4DRAA 5DNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ C;  4KGC B;  1H3O B;  1BH8 B;  5GT3 B;  5BT1 C;  3AZH C;  3B6F C;  1KU5 A;  1U35 D;  4CAY B;  2NZD D;  3VH5 A;  3A6N C;  5GXQ A;  3UTA D;  5E5A D;  3X1V B;  3AZG C;  1KX4 C;  5JA4 B;  1WWS A;  3UTB C;  3REJ B;  3W98 C;  1P3G A;  5AV9 C;  5BS7 A;  5DNN C;  3WKJ D;  1M18 A;  4H9Q A;  1U35 B;  4QLC D;  2CV5 A;  1P34 A;  1HTA A;  3AZM A;  3W99 D;  3REL D;  4ZBJ B;  3A6N D;  3WKJ B;  3VH5 T;  4H9N A;  3AZK A;  3AZG D;  4LD9 C;  1P3K A;  1P3O A;  5CPK A;  4J8X B;  3WA9 D;  2HIO D;  3MGQ A;  4WU8 C;  1ZLA C;  5GT0 D;  5JRG D;  3MGP D;  3A6N B;  1AOI C;  4H9Q B;  3B6G D;  5DNM C;  3AZG B;  3REI C;  2RVQ D;  3W96 A;  4JJN D;  5AV9 B;  2HIO B;  3KWQ D;  2BYK B;  5B2J A;  5AV6 A;  3REK D;  5AV5 D;  3MNN B;  5AV8 D;  5B24 C;  1BH8 A;  1EQZ C;  3AZL C;  4JJN B;  5AV9 D;  5AVB B;  5AV9 A;  5B33 C;  5B1M D;  5KDM B;  4X23 D;  2IO5 B;  1P34 C;  5AVC D;  1ZLA B;  1AOI B;  1M19 B;  3LZ1 D;  5DNM B;  5E5A A;  4LD9 A;  1F66 C;  3LEL C;  5GSU A;  3AZE A;  5AVC B;  4WU8 A;  3X1T B;  1AOI D;  3LZ1 B;  3MNN C;  1AOI A;  1P3K B;  1EQZ B;  2ARO B;  3AZL B;  1HQ3 C;  5AVB C;  3MGQ B;  1ULY A;  4YM6 B;  3AN2 D;  5B2J C;  5AV6 C;  2IO5 C;  5BO0 B;  1P34 B;  3AZI C;  4XZQ B;  5BNX B;  1P3K D;  4G92 B;  3AZL D;  3AZL A;  4H9P B;  3KXB C;  5B32 B;  5AY8 C;  3VH6 T;  3X1T A;  5B33 A;  4YM6 D;  3AN2 B;  5GXQ D;  4XZQ D;  4UUZ A;  5B2I D;  4Z66 D;  5B2J D;  5AV6 D;  1P3G D;  2PYO C;  3AZK C;  5B32 D;  1A7W A;  1P3K C;  3REK A;  4KUD D;  2ARO C;  3WAA C;  4E44 A;  4J8X A;  3W97 C;  4J8U D;  1F66 A;  3MGQ C;  5B32 G;  5BT1 D;  3KUY B;  3AZH D;  4YM6 C;  4Z66 B;  3C1B C;  2BYM B;  5AV6 B;  5B2J B;  3B6F D;  4KGC C;  2YFW A;  3AZI B;  1B6W A;  1P3L B;  5GT3 C;  3WA9 A;  3KXB B;  1BH9 A;  1HQ3 A;  3MVD B;  1Q9C A;  3X1U D;  5B31 B;  1ID3 B;  3AN2 C;  1M18 B;  4Z5T C;  3X1V C;  3O62 B;  3AZI D;  4J8V C;  4XZQ A;  1P3L D;  2YFW B;  1B67 A;  3REJ C;  3AZI A;  5DNN B;  2F8N D;  5B1L C;  3AZK B;  3MVD D;  1U35 C;  3WKJ A;  1M18 D;  2NZD C;  3W97 B;  4DRB A;  1P3P A;  4H9R B;  1JFI A;  5B0Z A;  5CPK B;  4WV4 B;  4Z66 C;  4KHA A;  5BNV A;  2JSS A;  3LEL A;  3LZ0 D;  3REI D;  4J8X C;  5CPK D;  5B0Y D;  1TZY C;  1M18 C;  3NQU B;  4Z5T B;  4H9S A;  3VH6 W;  4HGA B;  3LZ0 B;  1H3O A;  4LD9 D;  4H9R A;  1JFI B;  5AVB A;  1P3M C;  3AZJ A;  3REH D;  3AYW A;  3REH A;  5CPK C;  4JJN C;  5B40 A;  3LEL D;  4WU9 D;  1F1E A;  5CP6 B;  5B24 D;  1M19 C;  2HIO A;  4G91 C;  3WTP A;  3MGS A;  2FJ7 B;  3LJA D;  3AYW B;  3LEL B;  3LZ0 C;  3W97 A;  3AZF C;  5GSU D;  3AZN C;  4WU9 B;  5AVC C;  1KX5 A;  5BO0 A;  3LZ1 C;  1TZY A;  3AV2 A;  3B0C T;  3V9R B;  5B32 A;  3AZM D;  4H9S C;  1P3P D;  3AFA C;  3AYW D;  3X1S B;  4Z2M H;  1M1A D;  3W98 D;  5AY8 D;  3AN2 A;  5B1M A;  3X1V A;  3AZN D;  3AZF D;  4J8V A;  4XZQ C;  5JA4 A;  3UTA C;  5CP6 C;  5FUG A;  1P3I A;  3AZE C;  3X1S D;  1M1A B;  5CPI B;  5AY8 B;  1HQ3 D;  3AV2 B;  5KDM A;  4WZS B;  3V9R A;  4AWL B;  3WAA D;  3AZN B;  3AZF B;  4WU9 C;  3W96 D;  4Z66 A;  3C1B D;  2PYO B;  4E45 A;  5CPI D;  2FJ7 A;  1KX3 B;  3AFA B;  3WAA B;  4YS3 A;  3X1S C;  4KUD A;  3KUY C;  3UTB A;  3W96 B;  3KXB A;  3C1B B;  3W98 A;  4J8V D;  1P3L C;  3UTA B;  3X1V D;  3AFA D;  3MGR B;  3AFA A;  3REJ D;  1M1A C;  1P3M A;  3MVD C;  1WWI A;  4NE6 A;  5B31 C;  1ID3 C;  2F8N K;  5B0Y A;  3REK C;  4QLC B;  5G49 A;  3O62 C;  4J8V B;  5AV8 C;  3W99 B;  4JJN A;  4KGC D;  3UTA A;  5B40 C;  5B1L B;  4H9P A;  3C1B A;  5CHL B;  4KHA B;  1KX3 C;  5AV5 A;  2NZD B;  5BNX A;  3X1U C;  3AV1 C;  2F8N G;  5E5A B;  4J8X D;  3WA9 B;  3W96 C;  1M19 A;  5B1L D;  5GT0 B;  4NE5 A;  3A6N A;  5G49 B;  1S32 C;  3MGR C;  3AZN A;  3AZF A;  1KX4 A;  5CPJ B;  1P3B B;  1P3M D;  1P3F C;  3REL B;  1TZY B;  3REK B;  5AV5 B;  4HGA C;  3B0B A;  3W99 C;  5AV8 B;  5CPJ D;  1P3B D;  1P3M B;  5AVB D;  1KX5 D;  1TZY D;  5B31 A;  1ID3 A;  4QLC A;  5JRG B;  5B0Y C;  3MGP B;  3AV1 B;  3B6G B;  5CP6 A;  1P3F D;  5E5A C;  5AV8 A;  4Z2M G;  1ZLA D;  4J8U A;  1ZLA A;  1M19 D;  5DNM D;  1KX5 B;  3KWQ B;  1TAF B;  4EO5 C;  2RVQ C;  4WU9 A;  3REI A;  3MNN A;  3AV1 D;  1P3F B;  3MNN D;  3AV1 A;  5GT0 A;  3X1T D;  3AZJ B;  4G91 B;  2FJ7 C;  3AYW C;  4YS3 C;  5B1M B;  4KUD C;  4X23 B;  1S32 A;  4NFT A;  2L5A A;  5BNV B;  4ZUX C;  4J8W B;  3AZJ D;  1P34 D;  3W99 A;  1M1A A;  4ZBJ C;  1R4V A;  2LY8 A;  3KWQ C;  4J8W D;  4R8P D;  2NQB D;  3WTP B;  3MGS B;  3LZ0 A;  5GXQ B;  3TU4 C;  3AZE B;  2ARO A;  1EQZ D;  2ARO D;  5CPI C;  5C3I B;  4J8U C;  1P3G B;  3LZ1 A;  3AV2 C;  3MGQ D;  4AWL C;  4R8P B;  4KUD B;  2NQB B;  3WTP D;  3MGS D;  2CV5 B;  4KGC A;  3WTP E;  3AZE D;  5B2I A;  2YFV A;  4ZUX B;  4J8W C;  2F8N A;  3NQJ B;  3MGR A;  4CSR A;  4XUJ D;  2CV5 D;  3REL A;  2CWE A;  3KXB D;  5AY8 A;  5B2I B;  4ZUX D;  5BS7 C;  5DNN A;  4ZUX A;  5F99 A;  1N1J B;  3TU4 B;  1BFM A;  4XUJ B;  4CSR B;  1KX4 D;  5C3I C;  4J8U B;  4WNN B;  5B0Z C;  2PYO A;  5JRG A;  3MGP A;  3B6G A;  3KSY A;  4QLC C;  3KUY D;  3AZH B;  4R8P C;  3B6F B;  2NQB C;  3W97 D;  3WAA A;  3B0C W;  4M6B A;  4H9O B;  3LJA A;  3TU4 D;  5B40 B;  1P3A C;  1N1J A;  5B31 G;  3TU4 A;  1KX4 B;  4NE3 A;  5CPI A;  3X1U B;  5B31 D;  1ID3 D;  5FUG B;  3O62 D;  5GT3 A;  5B0Z D;  3WA9 C;  5B40 D;  5GT0 C;  5B2I C;  5DNN D;  2F8N B;  4J8W A;  4Z5T D;  3AZK D;  3NQU A;  2HUE B;  4Z5T A;  4X23 A;  1S32 B;  5CPJ C;  4XUJ C;  1P3B C;  3REJ A;  4LD9 B;  3REH C;  3REL C;  5B0Z B;  1U35 A;  4WU8 B;  1KX3 A;  5AV5 C;  3X1U A;  2NZD A;  1P3A B;  1S32 D;  2BYM A;  1P3P C;  3REI B;  3KWQ A;  5JRG C;  2HIO C;  3VH6 A;  5B0Y B;  3MGP C;  5F99 B;  4WU8 D;  3B6G C;  3C1C A;  4CAY A;  3B0D C;  3C1C D;  1P3A D;  5CP6 D;  1P3F A;  2F8N H;  3LJA C;  1P3A A;  5B24 B;  2YFV B;  5GSU C;  1KX5 C;  2HUE C;  4EO5 B;  3R45 A;  3NQJ A;  5B33 B;  5F99 D;  3REH B;  3C1C B;  3AZM C;  2BYK A;  3AZJ C;  3UT9 A;  4YS3 B;  3UT9 D;  5B1M C;  1P3P B;  4X23 C;  5B33 D;  4H9N B;  5CPJ A;  1P3B A;  1P3O C;  1F66 B;  5F99 C;  3X1T C;  4YS3 D;  3B0D B;  3VH5 W;  3UT9 B;  2FJ7 D;  4H9O A;  3LJA B;  1P3I B;  4UUZ B;  5GSU B;  1F66 D;  3AZH A;  3B6F A;  1HQ3 B;  4R8P A;  2NQB A;  3WTP C;  3MGS C;  5GXQ C;  1P3O D;  3C1C C;  3AZG A;  3AZM B;  5AVC A;  3X1S A;  5B24 A;  1P3I D;  1P3G C;  4G92 C;  1EQZ A;  2PYO D;  3KUY A;  4YM6 A;  1KX3 D;  5B32 C;  1TAF A;  2CV5 C;  1P3L A;  1P3O B;  3UTB B;  1BH9 B;  3MVD A;  3W98 B;  4WNN A;  3R45 B;  3UT9 C;  3AV2 D;  4XUJ A;  3O62 A;  3MGR D;  1P3I C;  5GT3 D;  3UTB D;  5B1L A;  4DRA A;  5DNM A; 
#chains in the Genus database with same CATH topology
 3WKJ C;  4KGC B;  1H3O B;  1BH8 B;  5GT3 B;  5BT1 C;  3AZH C;  3B6F C;  1KU5 A;  1U35 D;  4CAY B;  2NZD D;  3VH5 A;  3A6N C;  5GXQ A;  3UTA D;  5E5A D;  3X1V B;  3H0M C;  3AZG C;  1KX4 C;  5JA4 B;  1WWS A;  3UTB C;  3REJ B;  3W98 C;  1P3G A;  5AV9 C;  5BS7 A;  5DNN C;  3WKJ D;  1M18 A;  4H9Q A;  1U35 B;  4QLC D;  2CV5 A;  1P34 A;  1HTA A;  3AZM A;  3W99 D;  3REL D;  4ZBJ B;  3A6N D;  3WKJ B;  3VH5 T;  4H9N A;  3AZK A;  3AZG D;  4LD9 C;  1P3K A;  1P3O A;  5CPK A;  4J8X B;  3WA9 D;  2HIO D;  3MGQ A;  4WU8 C;  1ZLA C;  5GT0 D;  5JRG D;  3MGP D;  3A6N B;  1AOI C;  4H9Q B;  3B6G D;  5DNM C;  3AZG B;  3REI C;  2RVQ D;  3W96 A;  4JJN D;  2BG1 A;  5AV9 B;  2HIO B;  3KWQ D;  2BYK B;  5B2J A;  5AV6 A;  3REK D;  5AV5 D;  3MNN B;  5AV8 D;  5B24 C;  1BH8 A;  1EQZ C;  3AZL C;  4JJN B;  5AV9 D;  5AVB B;  5AV9 A;  5B33 C;  2XD5 A;  5B1M D;  5KDM B;  4X23 D;  4DQY B;  2IO5 B;  2Y2I A;  1P34 C;  5AVC D;  1ZLA B;  2Y2L A;  1AOI B;  1M19 B;  2ZY2 A;  3LZ1 D;  5DNM B;  5E5A A;  4LD9 A;  1F66 C;  3LEL C;  5GSU A;  3AZE A;  5AVC B;  4WU8 A;  3X1T B;  1AOI D;  3LZ1 B;  3MNN C;  1AOI A;  1P3K B;  1EQZ B;  2ARO B;  3AZL B;  1HQ3 C;  5AVB C;  3MGQ B;  1ULY A;  4YM6 B;  3AN2 D;  5B2J C;  5AV6 C;  2IO5 C;  5BO0 B;  1P34 B;  3AZI C;  4XZQ B;  5BNX B;  1P3K D;  4G92 B;  3AZL D;  2Y2M A;  3AZL A;  4H9P B;  3KXB C;  5B32 B;  5AY8 C;  3VH6 T;  3X1T A;  5B33 A;  4YM6 D;  3AN2 B;  5GXQ D;  4XZQ D;  4UUZ A;  5B2I D;  4Z66 D;  5B2J D;  5AV6 D;  1P3G D;  2PYO C;  3AZK C;  2Y2Q A;  5B32 D;  1A7W A;  1P3K C;  3REK A;  4KUD D;  2ARO C;  3WAA C;  4E44 A;  4J8X A;  3W97 C;  4J8U D;  1F66 A;  3MGQ C;  2J8P A;  5B32 G;  5BT1 D;  3KUY B;  3AZH D;  4YM6 C;  4Z66 B;  3C1B C;  2BYM B;  5AV6 B;  5B2J B;  3B6F D;  4KGC C;  2YFW A;  3AZI B;  1B6W A;  1P3L B;  5GT3 C;  3WA9 A;  3KXB B;  1BH9 A;  1HQ3 A;  3MVD B;  1Q9C A;  3X1U D;  5B31 B;  1ID3 B;  3AN2 C;  1M18 B;  4Z5T C;  3X1V C;  3O62 B;  3AZI D;  4J8V C;  4XZQ A;  1P3L D;  2YFW B;  1B67 A;  3REJ C;  3AZI A;  2Y2P A;  5DNN B;  2F8N D;  5B1L C;  3AZK B;  3MVD D;  1U35 C;  3WKJ A;  1M18 D;  2NZD C;  3W97 B;  4DRB A;  1P3P A;  4H9R B;  1JFI A;  5B0Z A;  5CPK B;  3P5J B;  4WV4 B;  4Z66 C;  4KHA A;  5BNV A;  2JSS A;  3LEL A;  3LZ0 D;  3REI D;  4J8X C;  2ZY3 A;  5CPK D;  5B0Y D;  1TZY C;  1M18 C;  3FDD A;  3NQU B;  4Z5T B;  4H9S A;  3VH6 W;  4HGA B;  3LZ0 B;  1H3O A;  4LD9 D;  4H9R A;  1JFI B;  5AVB A;  1P3M C;  3AZJ A;  3REH D;  2Y2O A;  2ZM5 A;  3AYW A;  2UWX A;  3REH A;  5CPK C;  4JJN C;  3AL0 C;  5B40 A;  1PZR A;  4WJ3 C;  3LEL D;  4WU9 D;  1F1E A;  5CP6 B;  5B24 D;  1M19 C;  2HIO A;  4G91 C;  3WTP A;  3MGS A;  2FJ7 B;  3LJA D;  3AYW B;  3LEL B;  3LZ0 C;  3W97 A;  3AZF C;  5GSU D;  3AZN C;  4WU9 B;  5AVC C;  1KX5 A;  2ZY5 A;  5BO0 A;  3LZ1 C;  1TZY A;  3AV2 A;  3B0C T;  3V9R B;  5B32 A;  3AZM D;  4H9S C;  1P3P D;  3AFA C;  3AYW D;  3X1S B;  4Z2M H;  1M1A D;  3W98 D;  2DQN C;  5AY8 D;  2XD1 A;  3EPJ A;  3AN2 A;  5B1M A;  3X1V A;  3AZN D;  3AZF D;  4J8V A;  4XZQ C;  5JA4 A;  3UTA C;  5CP6 C;  5FUG A;  1P3I A;  3AZE C;  3H0L C;  3X1S D;  1M1A B;  5CPI B;  5AY8 B;  1HQ3 D;  3AV2 B;  5KDM A;  4WZS B;  3V9R A;  4AWL B;  3WAA D;  2G5I C;  3AZN B;  3AZF B;  4WU9 C;  3W96 D;  4Z66 A;  3C1B D;  2PYO B;  4E45 A;  5CPI D;  2FJ7 A;  1KX3 B;  3AFA B;  3WAA B;  4YS3 A;  3X1S C;  4KUD A;  3KUY C;  3UTB A;  3W96 B;  3KXB A;  3C1B B;  3W98 A;  4J8V D;  1P3L C;  3UTA B;  3X1V D;  3AFA D;  3MGR B;  3AFA A;  3REJ D;  1M1A C;  1P3M A;  3MVD C;  1WWI A;  4NE6 A;  5B31 C;  1ID3 C;  2F8N K;  5B0Y A;  3REK C;  4QLC B;  5G49 A;  3O62 C;  4J8V B;  5AV8 C;  3W99 B;  4JJN A;  4KGC D;  3UTA A;  5B40 C;  5B1L B;  4H9P A;  3C1B A;  5CHL B;  4KHA B;  1KX3 C;  5AV5 A;  2NZD B;  5BNX A;  3X1U C;  3AV1 C;  2F8N G;  5E5A B;  4J8X D;  3WA9 B;  3W96 C;  3EPH A;  1M19 A;  3IP4 C;  5B1L D;  5GT0 B;  4NE5 A;  3A6N A;  5G49 B;  1S32 C;  3MGR C;  3AZN A;  3AZF A;  1KX4 A;  5CPJ B;  1P3B B;  1P3M D;  1P3F C;  3REL B;  1TZY B;  2RIQ A;  3REK B;  2Y2H A;  5AV5 B;  4HGA C;  3B0B A;  3W99 C;  5AV8 B;  2DF4 C;  5CPJ D;  1P3B D;  2Y2K A;  1P3M B;  5AVB D;  1KX5 D;  1TZY D;  2Y2G A;  5B31 A;  1ID3 A;  4QLC A;  5B0Y C;  5JRG B;  3MGP B;  3AV1 B;  3B6G B;  5CP6 A;  1P3F D;  5E5A C;  5AV8 A;  4Z2M G;  1ZLA D;  4J8U A;  1ZLA A;  1M19 D;  5DNM D;  1KX5 B;  2JE5 A;  3KWQ B;  2Y2J A;  1TAF B;  4EO5 C;  2RVQ C;  4WU9 A;  3REI A;  3MNN A;  3AV1 D;  1P3F B;  3MNN D;  3AV1 A;  5GT0 A;  3X1T D;  3AZJ B;  4G91 B;  2FJ7 C;  2Y2N A;  3AYW C;  4YS3 C;  5B1M B;  4KUD C;  4X23 B;  1S32 A;  4NFT A;  2L5A A;  5BNV B;  4ZUX C;  4J8W B;  3AZJ D;  1P34 D;  3W99 A;  2F2A C;  1M1A A;  4ZBJ C;  1R4V A;  3EPK A;  2LY8 A;  3KWQ C;  4J8W D;  4R8P D;  2NQB D;  3WTP B;  3MGS B;  3LZ0 A;  1Z2C B;  5GXQ B;  3TU4 C;  3AZE B;  2ARO A;  1EQZ D;  2ARO D;  5CPI C;  5C3I B;  4J8U C;  1P3G B;  3LZ1 A;  3AV2 C;  3MGQ D;  4AWL C;  2VQR A;  4R8P B;  4KUD B;  2NQB B;  3WTP D;  3MGS D;  2CV5 B;  4KGC A;  1T3U A;  3WTP E;  3AZE D;  5B2I A;  2YFV A;  4ZUX B;  4J8W C;  2F8N A;  3NQJ B;  3MGR A;  4CSR A;  4XUJ D;  3EPL A;  2CV5 D;  3REL A;  2CWE A;  3KXB D;  5AY8 A;  5B2I B;  4ZUX D;  5BS7 C;  5DNN A;  4ZUX A;  5F99 A;  1N1J B;  3TU4 B;  1BFM A;  4XUJ B;  4CSR B;  1KX4 D;  5C3I C;  4J8U B;  4WNN B;  5B0Z C;  2PYO A;  5JRG A;  3MGP A;  3B6G A;  3KSY A;  4QLC C;  3KUY D;  3AZH B;  4R8P C;  3B6F B;  2NQB C;  3W97 D;  3WAA A;  3B0C W;  4M6B A;  4H9O B;  3LJA A;  3TU4 D;  5B40 B;  1P3A C;  1N1J A;  5B31 G;  3TU4 A;  1KX4 B;  4UPK A;  4NE3 A;  5CPI A;  2G5H C;  3X1U B;  3KFU G;  5B31 D;  1ID3 D;  5FUG B;  3F6T A;  3A1I A;  3O62 D;  5GT3 A;  5B0Z D;  3WA9 C;  5B40 D;  5GT0 C;  2FFF B;  5B2I C;  5DNN D;  2F8N B;  4J8W A;  4Z5T D;  3AZK D;  2HUE B;  3NQU A;  4Z5T A;  4X23 A;  1S32 B;  5CPJ C;  4XUJ C;  1P3B C;  3REJ A;  4LD9 B;  3REH C;  3REL C;  5B0Z B;  1W2E A;  2ZY4 A;  1U35 A;  4WU8 B;  1KX3 A;  5AV5 C;  3X1U A;  2NZD A;  1P3A B;  1S32 D;  2BYM A;  1P3P C;  3REI B;  3KWQ A;  5JRG C;  2HIO C;  3H0R C;  3VH6 A;  5B0Y B;  5F99 B;  3MGP C;  4WU8 D;  3C1C A;  3B6G C;  4CAY A;  3B0D C;  3C1C D;  1P3A D;  2JCH A;  5CP6 D;  1P3F A;  2F8N H;  3LJA C;  1P3A A;  5B24 B;  2YFV B;  5GSU C;  1KX5 C;  2HUE C;  4EO5 B;  3R45 A;  3NQJ A;  5B33 B;  5F99 D;  3REH B;  3C1C B;  3AZM C;  2BYK A;  3AZJ C;  3UT9 A;  4YS3 B;  3UT9 D;  5B1M C;  1P3P B;  4X23 C;  5B33 D;  4H9N B;  5CPJ A;  1P3B A;  1P3O C;  1F66 B;  5F99 C;  3X1T C;  4YS3 D;  3B0D B;  3VH5 W;  3UT9 B;  2FJ7 D;  4H9O A;  3LJA B;  1P3I B;  4UUZ B;  5GSU B;  1F66 D;  3AZH A;  3B6F A;  1HQ3 B;  4R8P A;  2NQB A;  3WTP C;  3MGS C;  5GXQ C;  1P3O D;  3C1C C;  3AZG A;  3AZM B;  5AVC A;  3X1S A;  5B24 A;  3A1K A;  1P3I D;  1P3G C;  4G92 C;  1EQZ A;  2PYO D;  3KUY A;  4YM6 A;  1KX3 D;  5B32 C;  1TAF A;  2CV5 C;  1P3L A;  1P3O B;  3EG5 B;  3UTB B;  1BH9 B;  3MVD A;  3W98 B;  4WNN A;  3R45 B;  3UT9 C;  3AV2 D;  4XUJ A;  3O62 A;  3MGR D;  1P3I C;  5GT3 D;  3UTB D;  2W8S A;  5B1L A;  4DRA A;  5DNM A; 
#chains in the Genus database with same CATH homology
 3WKJ C;  4KGC B;  1H3O B;  1BH8 B;  5GT3 B;  5BT1 C;  3AZH C;  3B6F C;  1KU5 A;  1U35 D;  4CAY B;  2NZD D;  3VH5 A;  3A6N C;  5GXQ A;  3UTA D;  5E5A D;  3X1V B;  3H0M C;  3AZG C;  1KX4 C;  5JA4 B;  1WWS A;  3UTB C;  3REJ B;  3W98 C;  1P3G A;  5AV9 C;  5BS7 A;  5DNN C;  3WKJ D;  1M18 A;  4H9Q A;  1U35 B;  4QLC D;  2CV5 A;  1P34 A;  1HTA A;  3AZM A;  3W99 D;  3REL D;  4ZBJ B;  3A6N D;  3WKJ B;  3VH5 T;  4H9N A;  3AZK A;  3AZG D;  4LD9 C;  1P3K A;  1P3O A;  5CPK A;  4J8X B;  3WA9 D;  2HIO D;  3MGQ A;  4WU8 C;  1ZLA C;  5GT0 D;  5JRG D;  3MGP D;  3A6N B;  1AOI C;  4H9Q B;  3B6G D;  5DNM C;  3AZG B;  3REI C;  2RVQ D;  3W96 A;  4JJN D;  2BG1 A;  5AV9 B;  2HIO B;  3KWQ D;  2BYK B;  5B2J A;  5AV6 A;  3REK D;  5AV5 D;  3MNN B;  5AV8 D;  5B24 C;  1BH8 A;  1EQZ C;  3AZL C;  4JJN B;  5AV9 D;  5AVB B;  5AV9 A;  5B33 C;  2XD5 A;  5B1M D;  5KDM B;  4X23 D;  4DQY B;  2IO5 B;  2Y2I A;  1P34 C;  5AVC D;  1ZLA B;  2Y2L A;  1AOI B;  1M19 B;  2ZY2 A;  3LZ1 D;  5DNM B;  5E5A A;  4LD9 A;  1F66 C;  3LEL C;  5GSU A;  3AZE A;  5AVC B;  4WU8 A;  3X1T B;  1AOI D;  3LZ1 B;  3MNN C;  1AOI A;  1P3K B;  1EQZ B;  2ARO B;  3AZL B;  1HQ3 C;  5AVB C;  3MGQ B;  1ULY A;  4YM6 B;  3AN2 D;  5B2J C;  5AV6 C;  2IO5 C;  5BO0 B;  1P34 B;  3AZI C;  4XZQ B;  5BNX B;  1P3K D;  4G92 B;  3AZL D;  2Y2M A;  3AZL A;  4H9P B;  3KXB C;  5B32 B;  5AY8 C;  3VH6 T;  3X1T A;  5B33 A;  4YM6 D;  3AN2 B;  5GXQ D;  4XZQ D;  4UUZ A;  5B2I D;  4Z66 D;  5B2J D;  5AV6 D;  1P3G D;  2PYO C;  3AZK C;  2Y2Q A;  5B32 D;  1A7W A;  1P3K C;  3REK A;  4KUD D;  2ARO C;  3WAA C;  4E44 A;  4J8X A;  3W97 C;  4J8U D;  1F66 A;  3MGQ C;  2J8P A;  5B32 G;  5BT1 D;  3KUY B;  3AZH D;  4YM6 C;  4Z66 B;  3C1B C;  2BYM B;  5AV6 B;  5B2J B;  3B6F D;  4KGC C;  2YFW A;  3AZI B;  1B6W A;  1P3L B;  5GT3 C;  3WA9 A;  3KXB B;  1BH9 A;  1HQ3 A;  3MVD B;  1Q9C A;  3X1U D;  5B31 B;  1ID3 B;  3AN2 C;  1M18 B;  4Z5T C;  3X1V C;  3O62 B;  3AZI D;  4J8V C;  4XZQ A;  1P3L D;  2YFW B;  1B67 A;  3REJ C;  3AZI A;  2Y2P A;  5DNN B;  2F8N D;  5B1L C;  3AZK B;  3MVD D;  1U35 C;  3WKJ A;  1M18 D;  2NZD C;  3W97 B;  4DRB A;  1P3P A;  4H9R B;  1JFI A;  5B0Z A;  5CPK B;  3P5J B;  4WV4 B;  4Z66 C;  4KHA A;  5BNV A;  2JSS A;  3LEL A;  3LZ0 D;  3REI D;  4J8X C;  2ZY3 A;  5CPK D;  5B0Y D;  1TZY C;  1M18 C;  3FDD A;  3NQU B;  4Z5T B;  4H9S A;  3VH6 W;  4HGA B;  3LZ0 B;  1H3O A;  4LD9 D;  4H9R A;  1JFI B;  5AVB A;  1P3M C;  3AZJ A;  3REH D;  2Y2O A;  2ZM5 A;  3AYW A;  2UWX A;  3REH A;  5CPK C;  4JJN C;  3AL0 C;  5B40 A;  1PZR A;  4WJ3 C;  3LEL D;  4WU9 D;  1F1E A;  5CP6 B;  5B24 D;  1M19 C;  2HIO A;  4G91 C;  3WTP A;  3MGS A;  2FJ7 B;  3LJA D;  3AYW B;  3LEL B;  3LZ0 C;  3W97 A;  3AZF C;  5GSU D;  3AZN C;  4WU9 B;  5AVC C;  1KX5 A;  2ZY5 A;  5BO0 A;  3LZ1 C;  1TZY A;  3AV2 A;  3B0C T;  3V9R B;  5B32 A;  3AZM D;  4H9S C;  1P3P D;  3AFA C;  3AYW D;  3X1S B;  4Z2M H;  1M1A D;  3W98 D;  2DQN C;  5AY8 D;  2XD1 A;  3EPJ A;  3AN2 A;  5B1M A;  3X1V A;  3AZN D;  3AZF D;  4J8V A;  4XZQ C;  5JA4 A;  3UTA C;  5CP6 C;  5FUG A;  1P3I A;  3AZE C;  3H0L C;  3X1S D;  1M1A B;  5CPI B;  5AY8 B;  1HQ3 D;  3AV2 B;  5KDM A;  4WZS B;  3V9R A;  4AWL B;  3WAA D;  2G5I C;  3AZN B;  3AZF B;  4WU9 C;  3W96 D;  4Z66 A;  3C1B D;  2PYO B;  4E45 A;  5CPI D;  2FJ7 A;  1KX3 B;  3AFA B;  3WAA B;  4YS3 A;  3X1S C;  4KUD A;  3KUY C;  3UTB A;  3W96 B;  3KXB A;  3C1B B;  3W98 A;  4J8V D;  1P3L C;  3UTA B;  3X1V D;  3AFA D;  3MGR B;  3AFA A;  3REJ D;  1M1A C;  1P3M A;  3MVD C;  1WWI A;  4NE6 A;  5B31 C;  1ID3 C;  2F8N K;  5B0Y A;  3REK C;  4QLC B;  5G49 A;  3O62 C;  4J8V B;  5AV8 C;  3W99 B;  4JJN A;  4KGC D;  3UTA A;  5B40 C;  5B1L B;  4H9P A;  3C1B A;  5CHL B;  4KHA B;  1KX3 C;  5AV5 A;  2NZD B;  5BNX A;  3X1U C;  3AV1 C;  2F8N G;  5E5A B;  4J8X D;  3WA9 B;  3W96 C;  3EPH A;  1M19 A;  3IP4 C;  5B1L D;  5GT0 B;  4NE5 A;  3A6N A;  5G49 B;  1S32 C;  3MGR C;  3AZN A;  3AZF A;  1KX4 A;  5CPJ B;  1P3B B;  1P3M D;  1P3F C;  3REL B;  1TZY B;  2RIQ A;  3REK B;  2Y2H A;  5AV5 B;  4HGA C;  3B0B A;  3W99 C;  5AV8 B;  2DF4 C;  5CPJ D;  1P3B D;  2Y2K A;  1P3M B;  5AVB D;  1KX5 D;  1TZY D;  2Y2G A;  5B31 A;  1ID3 A;  4QLC A;  5B0Y C;  5JRG B;  3MGP B;  3AV1 B;  3B6G B;  5CP6 A;  1P3F D;  5E5A C;  5AV8 A;  4Z2M G;  1ZLA D;  4J8U A;  1ZLA A;  1M19 D;  5DNM D;  1KX5 B;  2JE5 A;  3KWQ B;  2Y2J A;  1TAF B;  4EO5 C;  2RVQ C;  4WU9 A;  3REI A;  3MNN A;  3AV1 D;  1P3F B;  3MNN D;  3AV1 A;  5GT0 A;  3X1T D;  3AZJ B;  4G91 B;  2FJ7 C;  2Y2N A;  3AYW C;  4YS3 C;  5B1M B;  4KUD C;  4X23 B;  1S32 A;  4NFT A;  2L5A A;  5BNV B;  4ZUX C;  4J8W B;  3AZJ D;  1P34 D;  3W99 A;  2F2A C;  1M1A A;  4ZBJ C;  1R4V A;  3EPK A;  2LY8 A;  3KWQ C;  4J8W D;  4R8P D;  2NQB D;  3WTP B;  3MGS B;  3LZ0 A;  1Z2C B;  5GXQ B;  3TU4 C;  3AZE B;  2ARO A;  1EQZ D;  2ARO D;  5CPI C;  5C3I B;  4J8U C;  1P3G B;  3LZ1 A;  3AV2 C;  3MGQ D;  4AWL C;  2VQR A;  4R8P B;  4KUD B;  2NQB B;  3WTP D;  3MGS D;  2CV5 B;  4KGC A;  1T3U A;  3WTP E;  3AZE D;  5B2I A;  2YFV A;  4ZUX B;  4J8W C;  2F8N A;  3NQJ B;  3MGR A;  4CSR A;  4XUJ D;  3EPL A;  2CV5 D;  3REL A;  2CWE A;  3KXB D;  5AY8 A;  5B2I B;  4ZUX D;  5BS7 C;  5DNN A;  4ZUX A;  5F99 A;  1N1J B;  3TU4 B;  1BFM A;  4XUJ B;  4CSR B;  1KX4 D;  5C3I C;  4J8U B;  4WNN B;  5B0Z C;  2PYO A;  5JRG A;  3MGP A;  3B6G A;  3KSY A;  4QLC C;  3KUY D;  3AZH B;  4R8P C;  3B6F B;  2NQB C;  3W97 D;  3WAA A;  3B0C W;  4M6B A;  4H9O B;  3LJA A;  3TU4 D;  5B40 B;  1P3A C;  1N1J A;  5B31 G;  3TU4 A;  1KX4 B;  4UPK A;  4NE3 A;  5CPI A;  2G5H C;  3X1U B;  3KFU G;  5B31 D;  1ID3 D;  5FUG B;  3F6T A;  3A1I A;  3O62 D;  5GT3 A;  5B0Z D;  3WA9 C;  5B40 D;  5GT0 C;  2FFF B;  5B2I C;  5DNN D;  2F8N B;  4J8W A;  4Z5T D;  3AZK D;  2HUE B;  3NQU A;  4Z5T A;  4X23 A;  1S32 B;  5CPJ C;  4XUJ C;  1P3B C;  3REJ A;  4LD9 B;  3REH C;  3REL C;  5B0Z B;  1W2E A;  2ZY4 A;  1U35 A;  4WU8 B;  1KX3 A;  5AV5 C;  3X1U A;  2NZD A;  1P3A B;  1S32 D;  2BYM A;  1P3P C;  3REI B;  3KWQ A;  5JRG C;  2HIO C;  3H0R C;  3VH6 A;  5B0Y B;  5F99 B;  3MGP C;  4WU8 D;  3C1C A;  3B6G C;  4CAY A;  3B0D C;  3C1C D;  1P3A D;  2JCH A;  5CP6 D;  1P3F A;  2F8N H;  3LJA C;  1P3A A;  5B24 B;  2YFV B;  5GSU C;  1KX5 C;  2HUE C;  4EO5 B;  3R45 A;  3NQJ A;  5B33 B;  5F99 D;  3REH B;  3C1C B;  3AZM C;  2BYK A;  3AZJ C;  3UT9 A;  4YS3 B;  3UT9 D;  5B1M C;  1P3P B;  4X23 C;  5B33 D;  4H9N B;  5CPJ A;  1P3B A;  1P3O C;  1F66 B;  5F99 C;  3X1T C;  4YS3 D;  3B0D B;  3VH5 W;  3UT9 B;  2FJ7 D;  4H9O A;  3LJA B;  1P3I B;  4UUZ B;  5GSU B;  1F66 D;  3AZH A;  3B6F A;  1HQ3 B;  4R8P A;  2NQB A;  3WTP C;  3MGS C;  5GXQ C;  1P3O D;  3C1C C;  3AZG A;  3AZM B;  5AVC A;  3X1S A;  5B24 A;  3A1K A;  1P3I D;  1P3G C;  4G92 C;  1EQZ A;  2PYO D;  3KUY A;  4YM6 A;  1KX3 D;  5B32 C;  1TAF A;  2CV5 C;  1P3L A;  1P3O B;  3EG5 B;  3UTB B;  1BH9 B;  3MVD A;  3W98 B;  4WNN A;  3R45 B;  3UT9 C;  3AV2 D;  4XUJ A;  3O62 A;  3MGR D;  1P3I C;  5GT3 D;  3UTB D;  2W8S A;  5B1L A;  4DRA A;  5DNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...