3REKB

2.6 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with oxaliplatin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 25
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rekB00
3NQJA 5AVCD 5AVBB 1M1AC 1KX5A 3X1TD 4J8XB 4WU8C 5BT1C 3AZNA 1P34D 1M19B 5B1MB 2CWEA 5BNXA 3UTBA 4KUDA 2NZDC 3WA9C 2HUEC 3AZJA 4CAYB 3WKJC 4J8XD 1M1AD 5B33B 5GT0C 3KUYB 5KDMB 5BT1D 4WU8D 5B32B 5CHLB 4WNNB 4J8VB 5BO0A 2NZDD 4WU9C 5CPIB 2L5AA 3WA9D 2NQBC 3AZIB 4DRAA 3MGPC 3O62B 3WKJD 5CPJA 4X23B 3UT9A 3LJAB 5GT0D 1B67A 3AZLC 1ZLAA 5B1LA 5B2IB 3C1BC 3AZHA 5B24A 4Z5TA 5B0ZC 3AYWA 5FUGA 4J8UB 3AV2B 5GSUB 3B0DC 1TAFA 5CP6C 2FJ7A 4Z2MG 4WU9D 2NQBD 3MGPD 4DRBA 1AOIB 3MNNA 1P3PA 4JJNB 1EQZB 5AV8B 3TU4B 2IO5B 4Z2MH 3LELA 5AV5C 3AZLD 3X1UC 5B0ZD 3AZMA 5CP6D 3KXBC 1F66B 1P3FB 2PYOB 3NQJB 5B31C 5AV5D 1KX5B 3X1UD 3AZGC 3VH5A 5AV6C 3B0CW 3AZNB 3B6GA 3KXBD 5BNXB 3UTBB 3AZJB 2LY8A 3AZGD 5GT3A 4ZUXC 5AV6D 1A7WA 4H9OA 5E5AC 5BO0B 5G49A 3MGRC 5CPJB 3UT9B 1U35C 3W96A 5CPKA 3REKC 3AZKA 4ZUXD 1ZLAB 5B1LB 3AZHB 4UUZA 5B24B 3MGQA 4Z5TB 5FUGB 4ZBJC 5E5AD 5AV9A 1TAFB 2FJ7B 3WTPA 4M6BA 3X1SA 3MGRD 5F99A 3RELA 4Z66C 3MNNB 1P3PB 4YM6A 1U35D 1M18A 3AV1C 3REKD 3LELB 3AFAC 3REJA 3AZMB 3B0CT 2AROA 4XZQA 3AZEA 4Z66D 5BS7C 3AV1D 4LD9A 1P3GC 5B2JC 3LZ0A 5DNNA 4H9NB 3AFAD 1S32A 3B6GB 3C1CC 4XUJA 4KGCA 3KWQA 1P3AA 5B40C 1P3GD 4J8WC 5C3IC 5B2JD 3AZFA 3LZ1A 1WWSA 1P3IC 5GT3B 1KX3C 1P34C 3C1CD 1BFMA 3UTAC 4AWLC 4H9OB 5B40D 5G49B 5AVBC 5JRGA 4J8XC 4J8WD 5DNMA 3C1BA 4R8PB 1P3ID 3W96B 5CPKB 1M19C 1JFIA 5B1MC 1KX3D 3AZKB 1TZYA 4UUZB 3MGQB 3UTAD 5AV9B 5AVBD 3X1SB 5B33C 5F99B 3RELB 3KUYC 3WAAA 4YM6B 4YS3C 1M18B 5B32C 4QLCA 1M19D 4YS3B 5B1MD 4J8VC 3REJB 2HIOA 5CPIC 3AZIC 3O62C 3B0BA 5AY8A 4X23C 2AROB 3LJAC 4XZQB 5B31A 5B33D 1ULYA 3AZEB 3KUYD 4YS3D 5B2IC 5B32D 4H9RA 4LD9B 3LZ0B 4J8VD 4J8UC 3AV2C 5DNNB 5GSUC 3AN2A 1F1EA 5CPID 2JSSA 1S32B 3AZID 1AOIC 3O62D 1Q9CA 4X23D 3MVDA 4XUJB 4JJNC 3B6FA 3LJAD 3KWQB 1EQZC 5AV8C 3TU4C 2IO5C 1P3AB 3W98A 5B2ID 1P3LA 1P3BA 3MGSA 4HGAB 4ZUXA 3X1VA 2CV5A 4J8UD 3AV2D 5GSUD 3AZFB 3LZ1B 1KX4A 5BNVA 1AOID 1F66C 3KSYA 1HQ3A 5GXQA 4JJND 1P3FC 2PYOC 1EQZD 4H9QB 5AV8D 3TU4D 1KX5C 5DNMB 3AZNC 1JFIB 3REHA 1F66D 1TZYB 3UTBC 5B0YA 4WZSB 3AZJC 3WTPE 1P3FD 2PYOD 4KUDB 1KX5D 1P3KA 3WAAB 3AZND 4QLCB 2HIOB 4KUDD 3UTBD 3AZJD 3W99A 5CPJC 5AY8B 3A6NA 3UT9C 2F8NG 1P3OA 1ZLAC 3W97A 5B1LC 3AZHC 1KU5A 4H9RB 5B24C 4Z5TC 3AN2B 2F8NA 1P3MA 2FJ7C 4H9SA 3AYWB 1ID3A 5CPJD 3MNNC 3REIA 3MVDB 3UT9D 1P3PC 3B6FB 5AVCA 3X1TA 3LELC 1ZLAD 3W98B 5B1LD 1P3LB 1P3BB 3AZHD 3MGSB 1WWIA 5B24D 4Z5TD 1P34A 3X1VB 3AZMC 4NFTA 2CV5B 4H9PA 1KX4B 4KHAA 2FJ7D 5BNVB 5AVBA 3MNND 1P3PD 1HQ3B 5GXQB 4J8XA 1M1AA 4G91B 3LELD 3R45A 4WU8A 4E45A 3AZMD 3B6GC 2NZDA 4CSRA 3REHB 3WA9A 5B0YB 3WKJA 5GT0A 3VH6W 1P3KB 5GT3C 3B6GD 4WU9A 2NQBA 2YFWA 3MGPA 3W99B 1H3OA 3AZLA 4R8PC 3W96C 5GT3D 5CPKC 3AZKC 1P3OB 3W97B 5B0ZA 3MGQC 5CP6A 5AV9C 1BH8A 1P3MB 2F8NB 3X1SC 5F99C 1HTAA 3RELC 3WTPB 1ID3B 3REIB 4YM6C 1M18C 5AVCB 5AV5A 4EO5B 4R8PD 3W96D 3X1UA 5CPKD 3X1TB 3AZKD 3REJC 2PYOA 5B31G 3MGQD 3KXBA 4NE3A 5AV9D 4KHAB 2AROC 5JA4A 2F8NK 4XZQC 3X1SD 5F99D 3AZEC 3RELD 4YM6D 1M18D 4LD9C 1M1AB 3LZ0C 3AZGA 3R45B 5DNNC 3REJD 3VH6T 4WU8B 5AV6A 1S32C 3V9RA 2AROD 4XUJC 4KGCC 2NZDB 3KWQC 2BYKA 4CSRB 4XZQD 2HUEB 3WA9B 3AZED 1P3AC 4KGCB 3WKJB 4LD9D 4HGAC 3LZ0D 5GT0B 1ID3D 5DNND 3AZFC 3LZ1C 1S32D 5E5AA 4XUJD 4KGCD 3KWQD 4WU9B 4NE5A 2NQBB 2YFWB 3MGPB 3MGRA 1P3AD 5JRGC 2YFVA 1U35A 1H3OB 5JRGB 5DNMC 3AZFD 3REKA 3LZ1D 3AZLB 2BYMA 3C1BB 5B0ZB 1TZYC 3NQUA 5CP6B 3B0DB 4KUDC 1BH8B 5JRGD 4Z66A 3AV1A 1N1JA 3WAAC 5DNMD 3C1BD 4QLCC 5AV5B 3AFAA 3X1UB 2HIOC 1TZYD 3KXBB 5AY8C 3VH5W 5JA4B 5BS7A 4G92C 4H9NA 1P3GA 3WAAD 5B31B 5B2JA 4QLCD 4G92B 3AZGB 3AN2C 2HIOD 5AV6B 1B6WA 3AYWC 2F8NH 3C1CA 4NE6A 3V9RB 5AY8D 3B6FC 3MVDC 2BYKB 5B40A 5B31D 3W98C 1P3LC 4J8WA 1BH9A 1P3BC 3MGSC 3X1VC 2CV5C 1P3IA 3AN2D 1KX4C 1KX3A 4ZUXB 3AYWD 3UTAA 1HQ3C 5E5AB 5GXQC 3MVDD 3B6FD 4G91C 3MGRB 3W98D 4R8PA 1P3LD 1P3BD 2YFVB 3MGSD 1U35B 3X1VD 2CV5D 1M19A 1KX4D 5B1MA 3REKB 2BYMB 3REHC 5B32G 5B0YC 1HQ3D 3NQUB 4ZBJB 5GXQD 4CAYA 3VH5T 5B33A 4Z66B 3KUYA 5KDMA 4YS3A 1P3KC 3AV1B 5B32A 1N1JB 4WNNA 4J8VA 3AFAB 3REHD 5CPIA 3AZIA 5B0YD 3O62A 3VH6A 4X23A 3W99C 3LJAA 3A6NC 5B2IA 1P3KD 3A6NB 1P3GB 1P3OC 3W97C 4E44A 5B2JB 4J8UA 2RVQC 3AV2A 5GSUA 1R4VA 1P3MC 4H9SC 1AOIA 3C1CB 3W99D 4JJNA 1ID3C 3WTPC 3REIC 3A6ND 1EQZA 5AV8A 3TU4A 5AVCC 5B40B 4WV4B 4EO5C 3X1TC 1P3OD 3W97D 4J8WB 1BH9B 5C3IB 2RVQD 1P3IB 2F8ND 1P3MD 1KX3B 1P34B 1F66A 4H9QA 4H9PB 3UTAB 1P3FA 3WTPD 4AWLB 3REID
chains in the Genus database with same CATH superfamily
3NQJA 5AVCD 2Y2QA 5AVBB 1M1AC 1KX5A 3X1TD 4J8XB 2RIQA 4WU8C 5BT1C 3AZNA 1P34D 3P5JB 1M19B 5B1MB 2CWEA 5BNXA 3UTBA 4KUDA 2NZDC 3WA9C 2HUEC 3AZJA 4CAYB 3WKJC 4J8XD 1M1AD 2Y2PA 5B33B 5GT0C 3KUYB 5KDMB 5BT1D 4WU8D 5B32B 5CHLB 4WNNB 4J8VB 5BO0A 2Y2OA 2NZDD 4WU9C 5CPIB 2L5AA 3WA9D 2NQBC 3AZIB 4DRAA 3MGPC 3O62B 3WKJD 5CPJA 4X23B 3UT9A 3LJAB 5GT0D 1B67A 3AZLC 1ZLAA 3EPKA 5B1LA 5B2IB 2Y2MA 3C1BC 3AZHA 5B24A 4Z5TA 5B0ZC 3AYWA 5FUGA 4J8UB 3AV2B 5GSUB 3B0DC 1TAFA 5CP6C 2FJ7A 4Z2MG 4WU9D 2NQBD 3MGPD 4DRBA 1AOIB 2F2AC 3MNNA 1P3PA 2ZY3A 4JJNB 1EQZB 5AV8B 3TU4B 2IO5B 4Z2MH 3LELA 5AV5C 3AZLD 3X1UC 5B0ZD 3AZMA 5CP6D 3KXBC 1F66B 1P3FB 2PYOB 3NQJB 5B31C 5AV5D 1KX5B 3X1UD 3AZGC 3VH5A 5AV6C 3B0CW 3AZNB 3B6GA 3KXBD 2DQNC 5BNXB 3UTBB 3AZJB 2LY8A 3AZGD 5GT3A 4ZUXC 5AV6D 1A7WA 4H9OA 5E5AC 5BO0B 5G49A 3MGRC 5CPJB 3UT9B 1U35C 3W96A 5CPKA 3REKC 3AZKA 4ZUXD 1ZLAB 5B1LB 3AZHB 4UUZA 5B24B 3MGQA 4Z5TB 5FUGB 4ZBJC 2ZY5A 5E5AD 5AV9A 1TAFB 2FJ7B 3WTPA 4M6BA 3X1SA 3MGRD 5F99A 3RELA 4Z66C 3MNNB 1P3PB 4YM6A 1U35D 1M18A 3AV1C 3REKD 3LELB 3AFAC 3REJA 2Y2NA 3IP4C 3AZMB 3B0CT 2AROA 4XZQA 3AZEA 4Z66D 5BS7C 3AV1D 4LD9A 1P3GC 5B2JC 3LZ0A 5DNNA 4H9NB 3AFAD 1S32A 3B6GB 3C1CC 4XUJA 4KGCA 3KWQA 1P3AA 5B40C 1P3GD 4J8WC 5C3IC 5B2JD 3AZFA 3LZ1A 1WWSA 1P3IC 5GT3B 1KX3C 1P34C 3C1CD 1BFMA 3UTAC 2ZM5A 4AWLC 4H9OB 1W2EA 5B40D 5G49B 5AVBC 5JRGA 4J8XC 4J8WD 5DNMA 3C1BA 4R8PB 1P3ID 3W96B 5CPKB 1M19C 1JFIA 5B1MC 1KX3D 3AZKB 1TZYA 4UUZB 3MGQB 3UTAD 5AV9B 5AVBD 3X1SB 5B33C 5F99B 3RELB 3KUYC 3WAAA 4YM6B 4YS3C 1M18B 5B32C 4QLCA 1M19D 4YS3B 5B1MD 4J8VC 3REJB 2HIOA 5CPIC 3EPHA 3AZIC 3O62C 3B0BA 5AY8A 4X23C 2AROB 3LJAC 4XZQB 5B31A 5B33D 1ULYA 3AZEB 3KUYD 4YS3D 5B2IC 5B32D 4H9RA 4LD9B 3LZ0B 2Y2JA 4J8VD 4J8UC 5DNNB 5GSUC 3AV2C 3AN2A 1F1EA 5CPID 2JSSA 1S32B 3AZID 2ZY2A 3O62D 1AOIC 1Q9CA 4X23D 3MVDA 4XUJB 4JJNC 3B6FA 3LJAD 3KWQB 1EQZC 2ZY4A 5AV8C 3TU4C 2IO5C 1P3AB 4UPKA 3W98A 5B2ID 1P3LA 1P3BA 3MGSA 4HGAB 4ZUXA 3X1VA 2CV5A 4J8UD 3AV2D 5GSUD 3AZFB 3LZ1B 1KX4A 2W8SA 5BNVA 1AOID 1F66C 2Y2IA 3KSYA 1HQ3A 5GXQA 4JJND 1P3FC 2PYOC 1EQZD 4H9QB 5AV8D 3TU4D 1KX5C 5DNMB 3AZNC 2J8PA 3H0LC 1JFIB 3REHA 1F66D 1TZYB 3UTBC 5B0YA 4WZSB 3AZJC 3WTPE 1P3FD 2PYOD 4KUDB 4DQYB 1KX5D 1P3KA 3WAAB 3AZND 4QLCB 2HIOB 4KUDD 3UTBD 3AZJD 3W99A 2Y2KA 5CPJC 5AY8B 3A6NA 3UT9C 2F8NG 2UWXA 1P3OA 1ZLAC 3W97A 5B1LC 3AZHC 1KU5A 4H9RB 5B24C 4Z5TC 3AN2B 2F8NA 1P3MA 2Y2LA 2FJ7C 4H9SA 3AYWB 3EPJA 1ID3A 5CPJD 3MNNC 3REIA 3MVDB 3UT9D 1P3PC 3B6FB 5AVCA 3X1TA 3LELC 1ZLAD 3W98B 5B1LD 1P3LB 1P3BB 3AZHD 3MGSB 1WWIA 5B24D 4Z5TD 1P34A 3X1VB 3AZMC 4NFTA 2CV5B 4H9PA 1KX4B 4KHAA 2FJ7D 5BNVB 5AVBA 3MNND 1P3PD 1HQ3B 5GXQB 4J8XA 3H0RC 1M1AA 4G91B 3LELD 3R45A 4WU8A 4E45A 3AZMD 3B6GC 2NZDA 4CSRA 3REHB 3EPLA 3WA9A 5B0YB 3WKJA 5GT0A 3VH6W 1P3KB 5GT3C 2G5IC 3B6GD 4WU9A 2NQBA 2YFWA 3MGPA 3W99B 1H3OA 3AZLA 4R8PC 3W96C 5GT3D 5CPKC 3AZKC 1P3OB 2Y2GA 5B0ZA 3W97B 2XD1A 3MGQC 5CP6A 4WJ3C 5AV9C 1BH8A 1P3MB 2F8NB 3X1SC 5F99C 1HTAA 3RELC 3WTPB 1ID3B 3REIB 3KFUG 4YM6C 1M18C 5AVCB 5AV5A 4EO5B 4R8PD 3W96D 3X1UA 5CPKD 3X1TB 3AZKD 3REJC 2PYOA 5B31G 3MGQD 3KXBA 4NE3A 5AV9D 4KHAB 2AROC 5JA4A 2F8NK 4XZQC 3X1SD 5F99D 3AZEC 3RELD 4YM6D 1M18D 4LD9C 1M1AB 3LZ0C 3EG5B 3AZGA 3R45B 5DNNC 3REJD 3VH6T 4WU8B 5AV6A 1S32C 3V9RA 2AROD 4XUJC 4KGCC 2NZDB 3KWQC 2BYKA 4CSRB 4XZQD 2HUEB 3WA9B 3AZED 1P3AC 4KGCB 3WKJB 4LD9D 4HGAC 3LZ0D 5GT0B 1ID3D 5DNND 3AZFC 3LZ1C 1S32D 2VQRA 5E5AA 4XUJD 4KGCD 3KWQD 4WU9B 4NE5A 2XD5A 2NQBB 2YFWB 3MGPB 3MGRA 1P3AD 5JRGC 2YFVA 1U35A 1H3OB 5JRGB 5DNMC 2JE5A 3AZFD 3REKA 3LZ1D 3AZLB 2BYMA 3C1BB 5B0ZB 1TZYC 1PZRA 3NQUA 5CP6B 3B0DB 4KUDC 1BH8B 5JRGD 4Z66A 3AV1A 1N1JA 3WAAC 5DNMD 3C1BD 2DF4C 4QLCC 5AV5B 3AFAA 3X1UB 1T3UA 1TZYD 2HIOC 2JCHA 3KXBB 5AY8C 3VH5W 2FFFB 5JA4B 5BS7A 3AL0C 4G92C 4H9NA 1P3GA 3WAAD 5B31B 5B2JA 4QLCD 4G92B 3A1IA 2G5HC 3AZGB 3AN2C 2HIOD 5AV6B 1B6WA 3AYWC 2F8NH 3C1CA 4NE6A 3V9RB 5AY8D 3B6FC 3MVDC 2BYKB 5B40A 5B31D 3W98C 1P3LC 4J8WA 1BH9A 1P3BC 3MGSC 3X1VC 2CV5C 1P3IA 3AN2D 1KX4C 1KX3A 4ZUXB 3AYWD 3UTAA 1HQ3C 5E5AB 5GXQC 3MVDD 3B6FD 3F6TA 4G91C 3MGRB 3W98D 4R8PA 1P3LD 1P3BD 2YFVB 3H0MC 3MGSD 1U35B 3X1VD 2CV5D 1M19A 1KX4D 5B1MA 3REKB 2BYMB 3REHC 5B32G 5B0YC 1HQ3D 2BG1A 3NQUB 4ZBJB 5GXQD 4CAYA 3VH5T 5B33A 3FDDA 4Z66B 3KUYA 5KDMA 4YS3A 1P3KC 3AV1B 5B32A 1N1JB 4WNNA 4J8VA 3AFAB 3REHD 5CPIA 3AZIA 5B0YD 3O62A 3VH6A 4X23A 3W99C 3LJAA 3A6NC 3A1KA 5B2IA 1P3KD 3A6NB 1P3GB 1P3OC 3W97C 4E44A 5B2JB 4J8UA 2RVQC 3AV2A 5GSUA 1R4VA 1P3MC 1Z2CB 4H9SC 1AOIA 3C1CB 3W99D 4JJNA 1ID3C 3WTPC 3REIC 3A6ND 1EQZA 5AV8A 2Y2HA 3TU4A 5AVCC 5B40B 4WV4B 4EO5C 3X1TC 1P3OD 3W97D 4J8WB 1BH9B 5C3IB 2RVQD 1P3IB 2F8ND 1P3MD 1KX3B 1P34B 1F66A 4H9QA 4H9PB 3UTAB 1P3FA 3WTPD 4AWLB 3REID
chains in the Genus database with same CATH topology
3NQJA 5AVCD 2Y2QA 5AVBB 1M1AC 1KX5A 3X1TD 4J8XB 2RIQA 4WU8C 5BT1C 3AZNA 1P34D 3P5JB 1M19B 5B1MB 2CWEA 5BNXA 3UTBA 4KUDA 2NZDC 3WA9C 2HUEC 3AZJA 4CAYB 3WKJC 4J8XD 1M1AD 2Y2PA 5B33B 5GT0C 3KUYB 5KDMB 5BT1D 4WU8D 5B32B 5CHLB 4WNNB 4J8VB 5BO0A 2Y2OA 2NZDD 4WU9C 5CPIB 2L5AA 3WA9D 2NQBC 3AZIB 4DRAA 3MGPC 3O62B 3WKJD 5CPJA 4X23B 3UT9A 3LJAB 5GT0D 1B67A 3AZLC 1ZLAA 3EPKA 5B1LA 5B2IB 2Y2MA 3C1BC 3AZHA 5B24A 4Z5TA 5B0ZC 3AYWA 5FUGA 4J8UB 3AV2B 5GSUB 3B0DC 1TAFA 5CP6C 2FJ7A 4Z2MG 4WU9D 2NQBD 3MGPD 4DRBA 1AOIB 2F2AC 3MNNA 1P3PA 2ZY3A 4JJNB 1EQZB 5AV8B 3TU4B 2IO5B 4Z2MH 3LELA 5AV5C 3AZLD 3X1UC 5B0ZD 3AZMA 5CP6D 3KXBC 1F66B 1P3FB 2PYOB 3NQJB 5B31C 5AV5D 1KX5B 3X1UD 3AZGC 3VH5A 5AV6C 3B0CW 3AZNB 3B6GA 3KXBD 2DQNC 5BNXB 3UTBB 3AZJB 2LY8A 3AZGD 5GT3A 4ZUXC 5AV6D 1A7WA 4H9OA 5E5AC 5BO0B 5G49A 3MGRC 5CPJB 3UT9B 1U35C 3W96A 5CPKA 3REKC 3AZKA 4ZUXD 1ZLAB 5B1LB 3AZHB 4UUZA 5B24B 3MGQA 4Z5TB 5FUGB 4ZBJC 2ZY5A 5E5AD 5AV9A 1TAFB 2FJ7B 3WTPA 4M6BA 3X1SA 3MGRD 5F99A 3RELA 4Z66C 3MNNB 1P3PB 4YM6A 1U35D 1M18A 3AV1C 3REKD 3LELB 3AFAC 3REJA 2Y2NA 3IP4C 3AZMB 3B0CT 2AROA 4XZQA 3AZEA 4Z66D 5BS7C 3AV1D 4LD9A 1P3GC 5B2JC 3LZ0A 5DNNA 4H9NB 3AFAD 1S32A 3B6GB 3C1CC 4XUJA 4KGCA 3KWQA 1P3AA 5B40C 1P3GD 4J8WC 5C3IC 5B2JD 3AZFA 3LZ1A 1WWSA 1P3IC 5GT3B 1KX3C 1P34C 3C1CD 1BFMA 3UTAC 2ZM5A 4AWLC 4H9OB 1W2EA 5B40D 5G49B 5AVBC 5JRGA 4J8XC 4J8WD 5DNMA 3C1BA 4R8PB 1P3ID 3W96B 5CPKB 1M19C 1JFIA 5B1MC 1KX3D 3AZKB 1TZYA 4UUZB 3MGQB 3UTAD 5AV9B 5AVBD 3X1SB 5B33C 5F99B 3RELB 3KUYC 3WAAA 4YM6B 4YS3C 1M18B 5B32C 4QLCA 1M19D 4YS3B 5B1MD 4J8VC 3REJB 2HIOA 5CPIC 3EPHA 3AZIC 3O62C 3B0BA 5AY8A 4X23C 2AROB 3LJAC 4XZQB 5B31A 5B33D 1ULYA 3AZEB 3KUYD 4YS3D 5B2IC 5B32D 4H9RA 4LD9B 3LZ0B 2Y2JA 4J8VD 4J8UC 5DNNB 5GSUC 3AV2C 3AN2A 1F1EA 5CPID 2JSSA 1S32B 3AZID 2ZY2A 3O62D 1AOIC 1Q9CA 4X23D 3MVDA 4XUJB 4JJNC 3B6FA 3LJAD 3KWQB 1EQZC 2ZY4A 5AV8C 3TU4C 2IO5C 1P3AB 4UPKA 3W98A 5B2ID 1P3LA 1P3BA 3MGSA 4HGAB 4ZUXA 3X1VA 2CV5A 4J8UD 3AV2D 5GSUD 3AZFB 3LZ1B 1KX4A 2W8SA 5BNVA 1AOID 1F66C 2Y2IA 3KSYA 1HQ3A 5GXQA 4JJND 1P3FC 2PYOC 1EQZD 4H9QB 5AV8D 3TU4D 1KX5C 5DNMB 3AZNC 2J8PA 3H0LC 1JFIB 3REHA 1F66D 1TZYB 3UTBC 5B0YA 4WZSB 3AZJC 3WTPE 1P3FD 2PYOD 4KUDB 4DQYB 1KX5D 1P3KA 3WAAB 3AZND 4QLCB 2HIOB 4KUDD 3UTBD 3AZJD 3W99A 2Y2KA 5CPJC 5AY8B 3A6NA 3UT9C 2F8NG 2UWXA 1P3OA 1ZLAC 3W97A 5B1LC 3AZHC 1KU5A 4H9RB 5B24C 4Z5TC 3AN2B 2F8NA 1P3MA 2Y2LA 2FJ7C 4H9SA 3AYWB 3EPJA 1ID3A 5CPJD 3MNNC 3REIA 3MVDB 3UT9D 1P3PC 3B6FB 5AVCA 3X1TA 3LELC 1ZLAD 3W98B 5B1LD 1P3LB 1P3BB 3AZHD 3MGSB 1WWIA 5B24D 4Z5TD 1P34A 3X1VB 3AZMC 4NFTA 2CV5B 4H9PA 1KX4B 4KHAA 2FJ7D 5BNVB 5AVBA 3MNND 1P3PD 1HQ3B 5GXQB 4J8XA 3H0RC 1M1AA 4G91B 3LELD 3R45A 4WU8A 4E45A 3AZMD 3B6GC 2NZDA 4CSRA 3REHB 3EPLA 3WA9A 5B0YB 3WKJA 5GT0A 3VH6W 1P3KB 5GT3C 2G5IC 3B6GD 4WU9A 2NQBA 2YFWA 3MGPA 3W99B 1H3OA 3AZLA 4R8PC 3W96C 5GT3D 5CPKC 3AZKC 1P3OB 2Y2GA 5B0ZA 3W97B 2XD1A 3MGQC 5CP6A 4WJ3C 5AV9C 1BH8A 1P3MB 2F8NB 3X1SC 5F99C 1HTAA 3RELC 3WTPB 1ID3B 3REIB 3KFUG 4YM6C 1M18C 5AVCB 5AV5A 4EO5B 4R8PD 3W96D 3X1UA 5CPKD 3X1TB 3AZKD 3REJC 2PYOA 5B31G 3MGQD 3KXBA 4NE3A 5AV9D 4KHAB 2AROC 5JA4A 2F8NK 4XZQC 3X1SD 5F99D 3AZEC 3RELD 4YM6D 1M18D 4LD9C 1M1AB 3LZ0C 3EG5B 3AZGA 3R45B 5DNNC 3REJD 3VH6T 4WU8B 5AV6A 1S32C 3V9RA 2AROD 4XUJC 4KGCC 2NZDB 3KWQC 2BYKA 4CSRB 4XZQD 2HUEB 3WA9B 3AZED 1P3AC 4KGCB 3WKJB 4LD9D 4HGAC 3LZ0D 5GT0B 1ID3D 5DNND 3AZFC 3LZ1C 1S32D 2VQRA 5E5AA 4XUJD 4KGCD 3KWQD 4WU9B 4NE5A 2XD5A 2NQBB 2YFWB 3MGPB 3MGRA 1P3AD 5JRGC 2YFVA 1U35A 1H3OB 5JRGB 5DNMC 2JE5A 3AZFD 3REKA 3LZ1D 3AZLB 2BYMA 3C1BB 5B0ZB 1TZYC 1PZRA 3NQUA 5CP6B 3B0DB 4KUDC 1BH8B 5JRGD 4Z66A 3AV1A 1N1JA 3WAAC 5DNMD 3C1BD 2DF4C 4QLCC 5AV5B 3AFAA 3X1UB 1T3UA 1TZYD 2HIOC 2JCHA 3KXBB 5AY8C 3VH5W 2FFFB 5JA4B 5BS7A 3AL0C 4G92C 4H9NA 1P3GA 3WAAD 5B31B 5B2JA 4QLCD 4G92B 3A1IA 2G5HC 3AZGB 3AN2C 2HIOD 5AV6B 1B6WA 3AYWC 2F8NH 3C1CA 4NE6A 3V9RB 5AY8D 3B6FC 3MVDC 2BYKB 5B40A 5B31D 3W98C 1P3LC 4J8WA 1BH9A 1P3BC 3MGSC 3X1VC 2CV5C 1P3IA 3AN2D 1KX4C 1KX3A 4ZUXB 3AYWD 3UTAA 1HQ3C 5E5AB 5GXQC 3MVDD 3B6FD 3F6TA 4G91C 3MGRB 3W98D 4R8PA 1P3LD 1P3BD 2YFVB 3H0MC 3MGSD 1U35B 3X1VD 2CV5D 1M19A 1KX4D 5B1MA 3REKB 2BYMB 3REHC 5B32G 5B0YC 1HQ3D 2BG1A 3NQUB 4ZBJB 5GXQD 4CAYA 3VH5T 5B33A 3FDDA 4Z66B 3KUYA 5KDMA 4YS3A 1P3KC 3AV1B 5B32A 1N1JB 4WNNA 4J8VA 3AFAB 3REHD 5CPIA 3AZIA 5B0YD 3O62A 3VH6A 4X23A 3W99C 3LJAA 3A6NC 3A1KA 5B2IA 1P3KD 3A6NB 1P3GB 1P3OC 3W97C 4E44A 5B2JB 4J8UA 2RVQC 3AV2A 5GSUA 1R4VA 1P3MC 1Z2CB 4H9SC 1AOIA 3C1CB 3W99D 4JJNA 1ID3C 3WTPC 3REIC 3A6ND 1EQZA 5AV8A 2Y2HA 3TU4A 5AVCC 5B40B 4WV4B 4EO5C 3X1TC 1P3OD 3W97D 4J8WB 1BH9B 5C3IB 2RVQD 1P3IB 2F8ND 1P3MD 1KX3B 1P34B 1F66A 4H9QA 4H9PB 3UTAB 1P3FA 3WTPD 4AWLB 3REID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQJ A;  5AVC D;  5AVB B;  1M1A C;  1KX5 A;  3X1T D;  4J8X B;  4WU8 C;  5BT1 C;  3AZN A;  1P34 D;  1M19 B;  5B1M B;  2CWE A;  5BNX A;  3UTB A;  4KUD A;  2NZD C;  3WA9 C;  2HUE C;  3AZJ A;  4CAY B;  3WKJ C;  4J8X D;  1M1A D;  5B33 B;  5GT0 C;  3KUY B;  5KDM B;  5BT1 D;  4WU8 D;  5B32 B;  5CHL B;  4WNN B;  4J8V B;  5BO0 A;  2NZD D;  4WU9 C;  5CPI B;  2L5A A;  3WA9 D;  2NQB C;  3AZI B;  4DRA A;  3MGP C;  3O62 B;  3WKJ D;  5CPJ A;  4X23 B;  3UT9 A;  3LJA B;  5GT0 D;  1B67 A;  3AZL C;  1ZLA A;  5B1L A;  5B2I B;  3C1B C;  3AZH A;  5B24 A;  4Z5T A;  5B0Z C;  3AYW A;  5FUG A;  4J8U B;  3AV2 B;  5GSU B;  3B0D C;  1TAF A;  5CP6 C;  2FJ7 A;  4Z2M G;  4WU9 D;  2NQB D;  3MGP D;  4DRB A;  1AOI B;  3MNN A;  1P3P A;  4JJN B;  1EQZ B;  5AV8 B;  3TU4 B;  2IO5 B;  4Z2M H;  3LEL A;  5AV5 C;  3AZL D;  3X1U C;  5B0Z D;  3AZM A;  5CP6 D;  3KXB C;  1F66 B;  1P3F B;  2PYO B;  3NQJ B;  5B31 C;  5AV5 D;  1KX5 B;  3X1U D;  3AZG C;  3VH5 A;  5AV6 C;  3B0C W;  3AZN B;  3B6G A;  3KXB D;  5BNX B;  3UTB B;  3AZJ B;  2LY8 A;  3AZG D;  5GT3 A;  4ZUX C;  5AV6 D;  1A7W A;  4H9O A;  5E5A C;  5BO0 B;  5G49 A;  3MGR C;  5CPJ B;  3UT9 B;  1U35 C;  3W96 A;  5CPK A;  3REK C;  3AZK A;  4ZUX D;  1ZLA B;  5B1L B;  3AZH B;  4UUZ A;  5B24 B;  3MGQ A;  4Z5T B;  5FUG B;  4ZBJ C;  5E5A D;  5AV9 A;  1TAF B;  2FJ7 B;  3WTP A;  4M6B A;  3X1S A;  3MGR D;  5F99 A;  3REL A;  4Z66 C;  3MNN B;  1P3P B;  4YM6 A;  1U35 D;  1M18 A;  3AV1 C;  3REK D;  3LEL B;  3AFA C;  3REJ A;  3AZM B;  3B0C T;  2ARO A;  4XZQ A;  3AZE A;  4Z66 D;  5BS7 C;  3AV1 D;  4LD9 A;  1P3G C;  5B2J C;  3LZ0 A;  5DNN A;  4H9N B;  3AFA D;  1S32 A;  3B6G B;  3C1C C;  4XUJ A;  4KGC A;  3KWQ A;  1P3A A;  5B40 C;  1P3G D;  4J8W C;  5C3I C;  5B2J D;  3AZF A;  3LZ1 A;  1WWS A;  1P3I C;  5GT3 B;  1KX3 C;  1P34 C;  3C1C D;  1BFM A;  3UTA C;  4AWL C;  4H9O B;  5B40 D;  5G49 B;  5AVB C;  5JRG A;  4J8X C;  4J8W D;  5DNM A;  3C1B A;  4R8P B;  1P3I D;  3W96 B;  5CPK B;  1M19 C;  1JFI A;  5B1M C;  1KX3 D;  3AZK B;  1TZY A;  4UUZ B;  3MGQ B;  3UTA D;  5AV9 B;  5AVB D;  3X1S B;  5B33 C;  5F99 B;  3REL B;  3KUY C;  3WAA A;  4YM6 B;  4YS3 C;  1M18 B;  5B32 C;  4QLC A;  1M19 D;  4YS3 B;  5B1M D;  4J8V C;  3REJ B;  2HIO A;  5CPI C;  3AZI C;  3O62 C;  3B0B A;  5AY8 A;  4X23 C;  2ARO B;  3LJA C;  4XZQ B;  5B31 A;  5B33 D;  1ULY A;  3AZE B;  3KUY D;  4YS3 D;  5B2I C;  5B32 D;  4H9R A;  4LD9 B;  3LZ0 B;  4J8V D;  4J8U C;  3AV2 C;  5DNN B;  5GSU C;  3AN2 A;  1F1E A;  5CPI D;  2JSS A;  1S32 B;  3AZI D;  1AOI C;  3O62 D;  1Q9C A;  4X23 D;  3MVD A;  4XUJ B;  4JJN C;  3B6F A;  3LJA D;  3KWQ B;  1EQZ C;  5AV8 C;  3TU4 C;  2IO5 C;  1P3A B;  3W98 A;  5B2I D;  1P3L A;  1P3B A;  3MGS A;  4HGA B;  4ZUX A;  3X1V A;  2CV5 A;  4J8U D;  3AV2 D;  5GSU D;  3AZF B;  3LZ1 B;  1KX4 A;  5BNV A;  1AOI D;  1F66 C;  3KSY A;  1HQ3 A;  5GXQ A;  4JJN D;  1P3F C;  2PYO C;  1EQZ D;  4H9Q B;  5AV8 D;  3TU4 D;  1KX5 C;  5DNM B;  3AZN C;  1JFI B;  3REH A;  1F66 D;  1TZY B;  3UTB C;  5B0Y A;  4WZS B;  3AZJ C;  3WTP E;  1P3F D;  2PYO D;  4KUD B;  1KX5 D;  1P3K A;  3WAA B;  3AZN D;  4QLC B;  2HIO B;  4KUD D;  3UTB D;  3AZJ D;  3W99 A;  5CPJ C;  5AY8 B;  3A6N A;  3UT9 C;  2F8N G;  1P3O A;  1ZLA C;  3W97 A;  5B1L C;  3AZH C;  1KU5 A;  4H9R B;  5B24 C;  4Z5T C;  3AN2 B;  2F8N A;  1P3M A;  2FJ7 C;  4H9S A;  3AYW B;  1ID3 A;  5CPJ D;  3MNN C;  3REI A;  3MVD B;  3UT9 D;  1P3P C;  3B6F B;  5AVC A;  3X1T A;  3LEL C;  1ZLA D;  3W98 B;  5B1L D;  1P3L B;  1P3B B;  3AZH D;  3MGS B;  1WWI A;  5B24 D;  4Z5T D;  1P34 A;  3X1V B;  3AZM C;  4NFT A;  2CV5 B;  4H9P A;  1KX4 B;  4KHA A;  2FJ7 D;  5BNV B;  5AVB A;  3MNN D;  1P3P D;  1HQ3 B;  5GXQ B;  4J8X A;  1M1A A;  4G91 B;  3LEL D;  3R45 A;  4WU8 A;  4E45 A;  3AZM D;  3B6G C;  2NZD A;  4CSR A;  3REH B;  3WA9 A;  5B0Y B;  3WKJ A;  5GT0 A;  3VH6 W;  1P3K B;  5GT3 C;  3B6G D;  4WU9 A;  2NQB A;  2YFW A;  3MGP A;  3W99 B;  1H3O A;  3AZL A;  4R8P C;  3W96 C;  5GT3 D;  5CPK C;  3AZK C;  1P3O B;  3W97 B;  5B0Z A;  3MGQ C;  5CP6 A;  5AV9 C;  1BH8 A;  1P3M B;  2F8N B;  3X1S C;  5F99 C;  1HTA A;  3REL C;  3WTP B;  1ID3 B;  3REI B;  4YM6 C;  1M18 C;  5AVC B;  5AV5 A;  4EO5 B;  4R8P D;  3W96 D;  3X1U A;  5CPK D;  3X1T B;  3AZK D;  3REJ C;  2PYO A;  5B31 G;  3MGQ D;  3KXB A;  4NE3 A;  5AV9 D;  4KHA B;  2ARO C;  5JA4 A;  2F8N K;  4XZQ C;  3X1S D;  5F99 D;  3AZE C;  3REL D;  4YM6 D;  1M18 D;  4LD9 C;  1M1A B;  3LZ0 C;  3AZG A;  3R45 B;  5DNN C;  3REJ D;  3VH6 T;  4WU8 B;  5AV6 A;  1S32 C;  3V9R A;  2ARO D;  4XUJ C;  4KGC C;  2NZD B;  3KWQ C;  2BYK A;  4CSR B;  4XZQ D;  2HUE B;  3WA9 B;  3AZE D;  1P3A C;  4KGC B;  3WKJ B;  4LD9 D;  4HGA C;  3LZ0 D;  5GT0 B;  1ID3 D;  5DNN D;  3AZF C;  3LZ1 C;  1S32 D;  5E5A A;  4XUJ D;  4KGC D;  3KWQ D;  4WU9 B;  4NE5 A;  2NQB B;  2YFW B;  3MGP B;  3MGR A;  1P3A D;  5JRG C;  2YFV A;  1U35 A;  1H3O B;  5JRG B;  5DNM C;  3AZF D;  3REK A;  3LZ1 D;  3AZL B;  2BYM A;  3C1B B;  5B0Z B;  1TZY C;  3NQU A;  5CP6 B;  3B0D B;  4KUD C;  1BH8 B;  5JRG D;  4Z66 A;  3AV1 A;  1N1J A;  3WAA C;  5DNM D;  3C1B D;  4QLC C;  5AV5 B;  3AFA A;  3X1U B;  2HIO C;  1TZY D;  3KXB B;  5AY8 C;  3VH5 W;  5JA4 B;  5BS7 A;  4G92 C;  4H9N A;  1P3G A;  3WAA D;  5B31 B;  5B2J A;  4QLC D;  4G92 B;  3AZG B;  3AN2 C;  2HIO D;  5AV6 B;  1B6W A;  3AYW C;  2F8N H;  3C1C A;  4NE6 A;  3V9R B;  5AY8 D;  3B6F C;  3MVD C;  2BYK B;  5B40 A;  5B31 D;  3W98 C;  1P3L C;  4J8W A;  1BH9 A;  1P3B C;  3MGS C;  3X1V C;  2CV5 C;  1P3I A;  3AN2 D;  1KX4 C;  1KX3 A;  4ZUX B;  3AYW D;  3UTA A;  1HQ3 C;  5E5A B;  5GXQ C;  3MVD D;  3B6F D;  4G91 C;  3MGR B;  3W98 D;  4R8P A;  1P3L D;  1P3B D;  2YFV B;  3MGS D;  1U35 B;  3X1V D;  2CV5 D;  1M19 A;  1KX4 D;  5B1M A;  3REK B;  2BYM B;  3REH C;  5B32 G;  5B0Y C;  1HQ3 D;  3NQU B;  4ZBJ B;  5GXQ D;  4CAY A;  3VH5 T;  5B33 A;  4Z66 B;  3KUY A;  5KDM A;  4YS3 A;  1P3K C;  3AV1 B;  5B32 A;  1N1J B;  4WNN A;  4J8V A;  3AFA B;  3REH D;  5CPI A;  3AZI A;  5B0Y D;  3O62 A;  3VH6 A;  4X23 A;  3W99 C;  3LJA A;  3A6N C;  5B2I A;  1P3K D;  3A6N B;  1P3G B;  1P3O C;  3W97 C;  4E44 A;  5B2J B;  4J8U A;  2RVQ C;  3AV2 A;  5GSU A;  1R4V A;  1P3M C;  4H9S C;  1AOI A;  3C1C B;  3W99 D;  4JJN A;  1ID3 C;  3WTP C;  3REI C;  3A6N D;  1EQZ A;  5AV8 A;  3TU4 A;  5AVC C;  5B40 B;  4WV4 B;  4EO5 C;  3X1T C;  1P3O D;  3W97 D;  4J8W B;  1BH9 B;  5C3I B;  2RVQ D;  1P3I B;  2F8N D;  1P3M D;  1KX3 B;  1P34 B;  1F66 A;  4H9Q A;  4H9P B;  3UTA B;  1P3F A;  3WTP D;  4AWL B;  3REI D; 
#chains in the Genus database with same CATH topology
 3NQJ A;  5AVC D;  2Y2Q A;  5AVB B;  1M1A C;  1KX5 A;  3X1T D;  4J8X B;  2RIQ A;  4WU8 C;  5BT1 C;  3AZN A;  1P34 D;  3P5J B;  1M19 B;  5B1M B;  2CWE A;  5BNX A;  3UTB A;  4KUD A;  2NZD C;  3WA9 C;  2HUE C;  3AZJ A;  4CAY B;  3WKJ C;  4J8X D;  1M1A D;  2Y2P A;  5B33 B;  5GT0 C;  3KUY B;  5KDM B;  5BT1 D;  4WU8 D;  5B32 B;  5CHL B;  4WNN B;  4J8V B;  5BO0 A;  2Y2O A;  2NZD D;  4WU9 C;  5CPI B;  2L5A A;  3WA9 D;  2NQB C;  3AZI B;  4DRA A;  3MGP C;  3O62 B;  3WKJ D;  5CPJ A;  4X23 B;  3UT9 A;  3LJA B;  5GT0 D;  1B67 A;  3AZL C;  1ZLA A;  3EPK A;  5B1L A;  5B2I B;  2Y2M A;  3C1B C;  3AZH A;  5B24 A;  4Z5T A;  5B0Z C;  3AYW A;  5FUG A;  4J8U B;  3AV2 B;  5GSU B;  3B0D C;  1TAF A;  5CP6 C;  2FJ7 A;  4Z2M G;  4WU9 D;  2NQB D;  3MGP D;  4DRB A;  1AOI B;  2F2A C;  3MNN A;  1P3P A;  2ZY3 A;  4JJN B;  1EQZ B;  5AV8 B;  3TU4 B;  2IO5 B;  4Z2M H;  3LEL A;  5AV5 C;  3AZL D;  3X1U C;  5B0Z D;  3AZM A;  5CP6 D;  3KXB C;  1F66 B;  1P3F B;  2PYO B;  3NQJ B;  5B31 C;  5AV5 D;  1KX5 B;  3X1U D;  3AZG C;  3VH5 A;  5AV6 C;  3B0C W;  3AZN B;  3B6G A;  3KXB D;  2DQN C;  5BNX B;  3UTB B;  3AZJ B;  2LY8 A;  3AZG D;  5GT3 A;  4ZUX C;  5AV6 D;  1A7W A;  4H9O A;  5E5A C;  5BO0 B;  5G49 A;  3MGR C;  5CPJ B;  3UT9 B;  1U35 C;  3W96 A;  5CPK A;  3REK C;  3AZK A;  4ZUX D;  1ZLA B;  5B1L B;  3AZH B;  4UUZ A;  5B24 B;  3MGQ A;  4Z5T B;  5FUG B;  4ZBJ C;  2ZY5 A;  5E5A D;  5AV9 A;  1TAF B;  2FJ7 B;  3WTP A;  4M6B A;  3X1S A;  3MGR D;  5F99 A;  3REL A;  4Z66 C;  3MNN B;  1P3P B;  4YM6 A;  1U35 D;  1M18 A;  3AV1 C;  3REK D;  3LEL B;  3AFA C;  3REJ A;  2Y2N A;  3IP4 C;  3AZM B;  3B0C T;  2ARO A;  4XZQ A;  3AZE A;  4Z66 D;  5BS7 C;  3AV1 D;  4LD9 A;  1P3G C;  5B2J C;  3LZ0 A;  5DNN A;  4H9N B;  3AFA D;  1S32 A;  3B6G B;  3C1C C;  4XUJ A;  4KGC A;  3KWQ A;  1P3A A;  5B40 C;  1P3G D;  4J8W C;  5C3I C;  5B2J D;  3AZF A;  3LZ1 A;  1WWS A;  1P3I C;  5GT3 B;  1KX3 C;  1P34 C;  3C1C D;  1BFM A;  3UTA C;  2ZM5 A;  4AWL C;  4H9O B;  1W2E A;  5B40 D;  5G49 B;  5AVB C;  5JRG A;  4J8X C;  4J8W D;  5DNM A;  3C1B A;  4R8P B;  1P3I D;  3W96 B;  5CPK B;  1M19 C;  1JFI A;  5B1M C;  1KX3 D;  3AZK B;  1TZY A;  4UUZ B;  3MGQ B;  3UTA D;  5AV9 B;  5AVB D;  3X1S B;  5B33 C;  5F99 B;  3REL B;  3KUY C;  3WAA A;  4YM6 B;  4YS3 C;  1M18 B;  5B32 C;  4QLC A;  1M19 D;  4YS3 B;  5B1M D;  4J8V C;  3REJ B;  2HIO A;  5CPI C;  3EPH A;  3AZI C;  3O62 C;  3B0B A;  5AY8 A;  4X23 C;  2ARO B;  3LJA C;  4XZQ B;  5B31 A;  5B33 D;  1ULY A;  3AZE B;  3KUY D;  4YS3 D;  5B2I C;  5B32 D;  4H9R A;  4LD9 B;  3LZ0 B;  2Y2J A;  4J8V D;  4J8U C;  5DNN B;  5GSU C;  3AV2 C;  3AN2 A;  1F1E A;  5CPI D;  2JSS A;  1S32 B;  3AZI D;  2ZY2 A;  3O62 D;  1AOI C;  1Q9C A;  4X23 D;  3MVD A;  4XUJ B;  4JJN C;  3B6F A;  3LJA D;  3KWQ B;  1EQZ C;  2ZY4 A;  5AV8 C;  3TU4 C;  2IO5 C;  1P3A B;  4UPK A;  3W98 A;  5B2I D;  1P3L A;  1P3B A;  3MGS A;  4HGA B;  4ZUX A;  3X1V A;  2CV5 A;  4J8U D;  3AV2 D;  5GSU D;  3AZF B;  3LZ1 B;  1KX4 A;  2W8S A;  5BNV A;  1AOI D;  1F66 C;  2Y2I A;  3KSY A;  1HQ3 A;  5GXQ A;  4JJN D;  1P3F C;  2PYO C;  1EQZ D;  4H9Q B;  5AV8 D;  3TU4 D;  1KX5 C;  5DNM B;  3AZN C;  2J8P A;  3H0L C;  1JFI B;  3REH A;  1F66 D;  1TZY B;  3UTB C;  5B0Y A;  4WZS B;  3AZJ C;  3WTP E;  1P3F D;  2PYO D;  4KUD B;  4DQY B;  1KX5 D;  1P3K A;  3WAA B;  3AZN D;  4QLC B;  2HIO B;  4KUD D;  3UTB D;  3AZJ D;  3W99 A;  2Y2K A;  5CPJ C;  5AY8 B;  3A6N A;  3UT9 C;  2F8N G;  2UWX A;  1P3O A;  1ZLA C;  3W97 A;  5B1L C;  3AZH C;  1KU5 A;  4H9R B;  5B24 C;  4Z5T C;  3AN2 B;  2F8N A;  1P3M A;  2Y2L A;  2FJ7 C;  4H9S A;  3AYW B;  3EPJ A;  1ID3 A;  5CPJ D;  3MNN C;  3REI A;  3MVD B;  3UT9 D;  1P3P C;  3B6F B;  5AVC A;  3X1T A;  3LEL C;  1ZLA D;  3W98 B;  5B1L D;  1P3L B;  1P3B B;  3AZH D;  3MGS B;  1WWI A;  5B24 D;  4Z5T D;  1P34 A;  3X1V B;  3AZM C;  4NFT A;  2CV5 B;  4H9P A;  1KX4 B;  4KHA A;  2FJ7 D;  5BNV B;  5AVB A;  3MNN D;  1P3P D;  1HQ3 B;  5GXQ B;  4J8X A;  3H0R C;  1M1A A;  4G91 B;  3LEL D;  3R45 A;  4WU8 A;  4E45 A;  3AZM D;  3B6G C;  2NZD A;  4CSR A;  3REH B;  3EPL A;  3WA9 A;  5B0Y B;  3WKJ A;  5GT0 A;  3VH6 W;  1P3K B;  5GT3 C;  2G5I C;  3B6G D;  4WU9 A;  2NQB A;  2YFW A;  3MGP A;  3W99 B;  1H3O A;  3AZL A;  4R8P C;  3W96 C;  5GT3 D;  5CPK C;  3AZK C;  1P3O B;  2Y2G A;  5B0Z A;  3W97 B;  2XD1 A;  3MGQ C;  5CP6 A;  4WJ3 C;  5AV9 C;  1BH8 A;  1P3M B;  2F8N B;  3X1S C;  5F99 C;  1HTA A;  3REL C;  3WTP B;  1ID3 B;  3REI B;  3KFU G;  4YM6 C;  1M18 C;  5AVC B;  5AV5 A;  4EO5 B;  4R8P D;  3W96 D;  3X1U A;  5CPK D;  3X1T B;  3AZK D;  3REJ C;  2PYO A;  5B31 G;  3MGQ D;  3KXB A;  4NE3 A;  5AV9 D;  4KHA B;  2ARO C;  5JA4 A;  2F8N K;  4XZQ C;  3X1S D;  5F99 D;  3AZE C;  3REL D;  4YM6 D;  1M18 D;  4LD9 C;  1M1A B;  3LZ0 C;  3EG5 B;  3AZG A;  3R45 B;  5DNN C;  3REJ D;  3VH6 T;  4WU8 B;  5AV6 A;  1S32 C;  3V9R A;  2ARO D;  4XUJ C;  4KGC C;  2NZD B;  3KWQ C;  2BYK A;  4CSR B;  4XZQ D;  2HUE B;  3WA9 B;  3AZE D;  1P3A C;  4KGC B;  3WKJ B;  4LD9 D;  4HGA C;  3LZ0 D;  5GT0 B;  1ID3 D;  5DNN D;  3AZF C;  3LZ1 C;  1S32 D;  2VQR A;  5E5A A;  4XUJ D;  4KGC D;  3KWQ D;  4WU9 B;  4NE5 A;  2XD5 A;  2NQB B;  2YFW B;  3MGP B;  3MGR A;  1P3A D;  5JRG C;  2YFV A;  1U35 A;  1H3O B;  5JRG B;  5DNM C;  2JE5 A;  3AZF D;  3REK A;  3LZ1 D;  3AZL B;  2BYM A;  3C1B B;  5B0Z B;  1TZY C;  1PZR A;  3NQU A;  5CP6 B;  3B0D B;  4KUD C;  1BH8 B;  5JRG D;  4Z66 A;  3AV1 A;  1N1J A;  3WAA C;  5DNM D;  3C1B D;  2DF4 C;  4QLC C;  5AV5 B;  3AFA A;  3X1U B;  1T3U A;  1TZY D;  2HIO C;  2JCH A;  3KXB B;  5AY8 C;  3VH5 W;  2FFF B;  5JA4 B;  5BS7 A;  3AL0 C;  4G92 C;  4H9N A;  1P3G A;  3WAA D;  5B31 B;  5B2J A;  4QLC D;  4G92 B;  3A1I A;  2G5H C;  3AZG B;  3AN2 C;  2HIO D;  5AV6 B;  1B6W A;  3AYW C;  2F8N H;  3C1C A;  4NE6 A;  3V9R B;  5AY8 D;  3B6F C;  3MVD C;  2BYK B;  5B40 A;  5B31 D;  3W98 C;  1P3L C;  4J8W A;  1BH9 A;  1P3B C;  3MGS C;  3X1V C;  2CV5 C;  1P3I A;  3AN2 D;  1KX4 C;  1KX3 A;  4ZUX B;  3AYW D;  3UTA A;  1HQ3 C;  5E5A B;  5GXQ C;  3MVD D;  3B6F D;  3F6T A;  4G91 C;  3MGR B;  3W98 D;  4R8P A;  1P3L D;  1P3B D;  2YFV B;  3H0M C;  3MGS D;  1U35 B;  3X1V D;  2CV5 D;  1M19 A;  1KX4 D;  5B1M A;  3REK B;  2BYM B;  3REH C;  5B32 G;  5B0Y C;  1HQ3 D;  2BG1 A;  3NQU B;  4ZBJ B;  5GXQ D;  4CAY A;  3VH5 T;  5B33 A;  3FDD A;  4Z66 B;  3KUY A;  5KDM A;  4YS3 A;  1P3K C;  3AV1 B;  5B32 A;  1N1J B;  4WNN A;  4J8V A;  3AFA B;  3REH D;  5CPI A;  3AZI A;  5B0Y D;  3O62 A;  3VH6 A;  4X23 A;  3W99 C;  3LJA A;  3A6N C;  3A1K A;  5B2I A;  1P3K D;  3A6N B;  1P3G B;  1P3O C;  3W97 C;  4E44 A;  5B2J B;  4J8U A;  2RVQ C;  3AV2 A;  5GSU A;  1R4V A;  1P3M C;  1Z2C B;  4H9S C;  1AOI A;  3C1C B;  3W99 D;  4JJN A;  1ID3 C;  3WTP C;  3REI C;  3A6N D;  1EQZ A;  5AV8 A;  2Y2H A;  3TU4 A;  5AVC C;  5B40 B;  4WV4 B;  4EO5 C;  3X1T C;  1P3O D;  3W97 D;  4J8W B;  1BH9 B;  5C3I B;  2RVQ D;  1P3I B;  2F8N D;  1P3M D;  1KX3 B;  1P34 B;  1F66 A;  4H9Q A;  4H9P B;  3UTA B;  1P3F A;  3WTP D;  4AWL B;  3REI D; 
#chains in the Genus database with same CATH homology
 3NQJ A;  5AVC D;  2Y2Q A;  5AVB B;  1M1A C;  1KX5 A;  3X1T D;  4J8X B;  2RIQ A;  4WU8 C;  5BT1 C;  3AZN A;  1P34 D;  3P5J B;  1M19 B;  5B1M B;  2CWE A;  5BNX A;  3UTB A;  4KUD A;  2NZD C;  3WA9 C;  2HUE C;  3AZJ A;  4CAY B;  3WKJ C;  4J8X D;  1M1A D;  2Y2P A;  5B33 B;  5GT0 C;  3KUY B;  5KDM B;  5BT1 D;  4WU8 D;  5B32 B;  5CHL B;  4WNN B;  4J8V B;  5BO0 A;  2Y2O A;  2NZD D;  4WU9 C;  5CPI B;  2L5A A;  3WA9 D;  2NQB C;  3AZI B;  4DRA A;  3MGP C;  3O62 B;  3WKJ D;  5CPJ A;  4X23 B;  3UT9 A;  3LJA B;  5GT0 D;  1B67 A;  3AZL C;  1ZLA A;  3EPK A;  5B1L A;  5B2I B;  2Y2M A;  3C1B C;  3AZH A;  5B24 A;  4Z5T A;  5B0Z C;  3AYW A;  5FUG A;  4J8U B;  3AV2 B;  5GSU B;  3B0D C;  1TAF A;  5CP6 C;  2FJ7 A;  4Z2M G;  4WU9 D;  2NQB D;  3MGP D;  4DRB A;  1AOI B;  2F2A C;  3MNN A;  1P3P A;  2ZY3 A;  4JJN B;  1EQZ B;  5AV8 B;  3TU4 B;  2IO5 B;  4Z2M H;  3LEL A;  5AV5 C;  3AZL D;  3X1U C;  5B0Z D;  3AZM A;  5CP6 D;  3KXB C;  1F66 B;  1P3F B;  2PYO B;  3NQJ B;  5B31 C;  5AV5 D;  1KX5 B;  3X1U D;  3AZG C;  3VH5 A;  5AV6 C;  3B0C W;  3AZN B;  3B6G A;  3KXB D;  2DQN C;  5BNX B;  3UTB B;  3AZJ B;  2LY8 A;  3AZG D;  5GT3 A;  4ZUX C;  5AV6 D;  1A7W A;  4H9O A;  5E5A C;  5BO0 B;  5G49 A;  3MGR C;  5CPJ B;  3UT9 B;  1U35 C;  3W96 A;  5CPK A;  3REK C;  3AZK A;  4ZUX D;  1ZLA B;  5B1L B;  3AZH B;  4UUZ A;  5B24 B;  3MGQ A;  4Z5T B;  5FUG B;  4ZBJ C;  2ZY5 A;  5E5A D;  5AV9 A;  1TAF B;  2FJ7 B;  3WTP A;  4M6B A;  3X1S A;  3MGR D;  5F99 A;  3REL A;  4Z66 C;  3MNN B;  1P3P B;  4YM6 A;  1U35 D;  1M18 A;  3AV1 C;  3REK D;  3LEL B;  3AFA C;  3REJ A;  2Y2N A;  3IP4 C;  3AZM B;  3B0C T;  2ARO A;  4XZQ A;  3AZE A;  4Z66 D;  5BS7 C;  3AV1 D;  4LD9 A;  1P3G C;  5B2J C;  3LZ0 A;  5DNN A;  4H9N B;  3AFA D;  1S32 A;  3B6G B;  3C1C C;  4XUJ A;  4KGC A;  3KWQ A;  1P3A A;  5B40 C;  1P3G D;  4J8W C;  5C3I C;  5B2J D;  3AZF A;  3LZ1 A;  1WWS A;  1P3I C;  5GT3 B;  1KX3 C;  1P34 C;  3C1C D;  1BFM A;  3UTA C;  2ZM5 A;  4AWL C;  4H9O B;  1W2E A;  5B40 D;  5G49 B;  5AVB C;  5JRG A;  4J8X C;  4J8W D;  5DNM A;  3C1B A;  4R8P B;  1P3I D;  3W96 B;  5CPK B;  1M19 C;  1JFI A;  5B1M C;  1KX3 D;  3AZK B;  1TZY A;  4UUZ B;  3MGQ B;  3UTA D;  5AV9 B;  5AVB D;  3X1S B;  5B33 C;  5F99 B;  3REL B;  3KUY C;  3WAA A;  4YM6 B;  4YS3 C;  1M18 B;  5B32 C;  4QLC A;  1M19 D;  4YS3 B;  5B1M D;  4J8V C;  3REJ B;  2HIO A;  5CPI C;  3EPH A;  3AZI C;  3O62 C;  3B0B A;  5AY8 A;  4X23 C;  2ARO B;  3LJA C;  4XZQ B;  5B31 A;  5B33 D;  1ULY A;  3AZE B;  3KUY D;  4YS3 D;  5B2I C;  5B32 D;  4H9R A;  4LD9 B;  3LZ0 B;  2Y2J A;  4J8V D;  4J8U C;  5DNN B;  5GSU C;  3AV2 C;  3AN2 A;  1F1E A;  5CPI D;  2JSS A;  1S32 B;  3AZI D;  2ZY2 A;  3O62 D;  1AOI C;  1Q9C A;  4X23 D;  3MVD A;  4XUJ B;  4JJN C;  3B6F A;  3LJA D;  3KWQ B;  1EQZ C;  2ZY4 A;  5AV8 C;  3TU4 C;  2IO5 C;  1P3A B;  4UPK A;  3W98 A;  5B2I D;  1P3L A;  1P3B A;  3MGS A;  4HGA B;  4ZUX A;  3X1V A;  2CV5 A;  4J8U D;  3AV2 D;  5GSU D;  3AZF B;  3LZ1 B;  1KX4 A;  2W8S A;  5BNV A;  1AOI D;  1F66 C;  2Y2I A;  3KSY A;  1HQ3 A;  5GXQ A;  4JJN D;  1P3F C;  2PYO C;  1EQZ D;  4H9Q B;  5AV8 D;  3TU4 D;  1KX5 C;  5DNM B;  3AZN C;  2J8P A;  3H0L C;  1JFI B;  3REH A;  1F66 D;  1TZY B;  3UTB C;  5B0Y A;  4WZS B;  3AZJ C;  3WTP E;  1P3F D;  2PYO D;  4KUD B;  4DQY B;  1KX5 D;  1P3K A;  3WAA B;  3AZN D;  4QLC B;  2HIO B;  4KUD D;  3UTB D;  3AZJ D;  3W99 A;  2Y2K A;  5CPJ C;  5AY8 B;  3A6N A;  3UT9 C;  2F8N G;  2UWX A;  1P3O A;  1ZLA C;  3W97 A;  5B1L C;  3AZH C;  1KU5 A;  4H9R B;  5B24 C;  4Z5T C;  3AN2 B;  2F8N A;  1P3M A;  2Y2L A;  2FJ7 C;  4H9S A;  3AYW B;  3EPJ A;  1ID3 A;  5CPJ D;  3MNN C;  3REI A;  3MVD B;  3UT9 D;  1P3P C;  3B6F B;  5AVC A;  3X1T A;  3LEL C;  1ZLA D;  3W98 B;  5B1L D;  1P3L B;  1P3B B;  3AZH D;  3MGS B;  1WWI A;  5B24 D;  4Z5T D;  1P34 A;  3X1V B;  3AZM C;  4NFT A;  2CV5 B;  4H9P A;  1KX4 B;  4KHA A;  2FJ7 D;  5BNV B;  5AVB A;  3MNN D;  1P3P D;  1HQ3 B;  5GXQ B;  4J8X A;  3H0R C;  1M1A A;  4G91 B;  3LEL D;  3R45 A;  4WU8 A;  4E45 A;  3AZM D;  3B6G C;  2NZD A;  4CSR A;  3REH B;  3EPL A;  3WA9 A;  5B0Y B;  3WKJ A;  5GT0 A;  3VH6 W;  1P3K B;  5GT3 C;  2G5I C;  3B6G D;  4WU9 A;  2NQB A;  2YFW A;  3MGP A;  3W99 B;  1H3O A;  3AZL A;  4R8P C;  3W96 C;  5GT3 D;  5CPK C;  3AZK C;  1P3O B;  2Y2G A;  5B0Z A;  3W97 B;  2XD1 A;  3MGQ C;  5CP6 A;  4WJ3 C;  5AV9 C;  1BH8 A;  1P3M B;  2F8N B;  3X1S C;  5F99 C;  1HTA A;  3REL C;  3WTP B;  1ID3 B;  3REI B;  3KFU G;  4YM6 C;  1M18 C;  5AVC B;  5AV5 A;  4EO5 B;  4R8P D;  3W96 D;  3X1U A;  5CPK D;  3X1T B;  3AZK D;  3REJ C;  2PYO A;  5B31 G;  3MGQ D;  3KXB A;  4NE3 A;  5AV9 D;  4KHA B;  2ARO C;  5JA4 A;  2F8N K;  4XZQ C;  3X1S D;  5F99 D;  3AZE C;  3REL D;  4YM6 D;  1M18 D;  4LD9 C;  1M1A B;  3LZ0 C;  3EG5 B;  3AZG A;  3R45 B;  5DNN C;  3REJ D;  3VH6 T;  4WU8 B;  5AV6 A;  1S32 C;  3V9R A;  2ARO D;  4XUJ C;  4KGC C;  2NZD B;  3KWQ C;  2BYK A;  4CSR B;  4XZQ D;  2HUE B;  3WA9 B;  3AZE D;  1P3A C;  4KGC B;  3WKJ B;  4LD9 D;  4HGA C;  3LZ0 D;  5GT0 B;  1ID3 D;  5DNN D;  3AZF C;  3LZ1 C;  1S32 D;  2VQR A;  5E5A A;  4XUJ D;  4KGC D;  3KWQ D;  4WU9 B;  4NE5 A;  2XD5 A;  2NQB B;  2YFW B;  3MGP B;  3MGR A;  1P3A D;  5JRG C;  2YFV A;  1U35 A;  1H3O B;  5JRG B;  5DNM C;  2JE5 A;  3AZF D;  3REK A;  3LZ1 D;  3AZL B;  2BYM A;  3C1B B;  5B0Z B;  1TZY C;  1PZR A;  3NQU A;  5CP6 B;  3B0D B;  4KUD C;  1BH8 B;  5JRG D;  4Z66 A;  3AV1 A;  1N1J A;  3WAA C;  5DNM D;  3C1B D;  2DF4 C;  4QLC C;  5AV5 B;  3AFA A;  3X1U B;  1T3U A;  1TZY D;  2HIO C;  2JCH A;  3KXB B;  5AY8 C;  3VH5 W;  2FFF B;  5JA4 B;  5BS7 A;  3AL0 C;  4G92 C;  4H9N A;  1P3G A;  3WAA D;  5B31 B;  5B2J A;  4QLC D;  4G92 B;  3A1I A;  2G5H C;  3AZG B;  3AN2 C;  2HIO D;  5AV6 B;  1B6W A;  3AYW C;  2F8N H;  3C1C A;  4NE6 A;  3V9R B;  5AY8 D;  3B6F C;  3MVD C;  2BYK B;  5B40 A;  5B31 D;  3W98 C;  1P3L C;  4J8W A;  1BH9 A;  1P3B C;  3MGS C;  3X1V C;  2CV5 C;  1P3I A;  3AN2 D;  1KX4 C;  1KX3 A;  4ZUX B;  3AYW D;  3UTA A;  1HQ3 C;  5E5A B;  5GXQ C;  3MVD D;  3B6F D;  3F6T A;  4G91 C;  3MGR B;  3W98 D;  4R8P A;  1P3L D;  1P3B D;  2YFV B;  3H0M C;  3MGS D;  1U35 B;  3X1V D;  2CV5 D;  1M19 A;  1KX4 D;  5B1M A;  3REK B;  2BYM B;  3REH C;  5B32 G;  5B0Y C;  1HQ3 D;  2BG1 A;  3NQU B;  4ZBJ B;  5GXQ D;  4CAY A;  3VH5 T;  5B33 A;  3FDD A;  4Z66 B;  3KUY A;  5KDM A;  4YS3 A;  1P3K C;  3AV1 B;  5B32 A;  1N1J B;  4WNN A;  4J8V A;  3AFA B;  3REH D;  5CPI A;  3AZI A;  5B0Y D;  3O62 A;  3VH6 A;  4X23 A;  3W99 C;  3LJA A;  3A6N C;  3A1K A;  5B2I A;  1P3K D;  3A6N B;  1P3G B;  1P3O C;  3W97 C;  4E44 A;  5B2J B;  4J8U A;  2RVQ C;  3AV2 A;  5GSU A;  1R4V A;  1P3M C;  1Z2C B;  4H9S C;  1AOI A;  3C1C B;  3W99 D;  4JJN A;  1ID3 C;  3WTP C;  3REI C;  3A6N D;  1EQZ A;  5AV8 A;  2Y2H A;  3TU4 A;  5AVC C;  5B40 B;  4WV4 B;  4EO5 C;  3X1T C;  1P3O D;  3W97 D;  4J8W B;  1BH9 B;  5C3I B;  2RVQ D;  1P3I B;  2F8N D;  1P3M D;  1KX3 B;  1P34 B;  1F66 A;  4H9Q A;  4H9P B;  3UTA B;  1P3F A;  3WTP D;  4AWL B;  3REI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...