3WAAA

The nucleosome containing human h2a.z.2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3waaA00
1P34D 1F66A 4H9QB 2CV5C 4AWLC 2HIOD 4H9PB 1P3AA 4KGCD 3LELC 3WAAC 3A6NB 1P3ID 3AZNB 1WWSA 1HQ3D 3MGQD 3TU4B 5AV8C 1P3GD 5B2IC 1P3FA 5B0YD 3WA9C 5B24D 5B1MC 4J8WD 5E5AD 3MVDB 3LJAA 2CV5A 2F8NA 4WNNB 3AZMB 1P3OB 4UUZA 3KUYC 4HGAC 3LELA 3WAAA 3AZHC 5B31B 1KX3B 4QLCD 3AV1C 4NE3A 3LZ1C 5B32G 1S32B 2HUEB 5CPIC 3W99D 5AV8A 5B2IA 3WA9A 3REIB 5B1MA 5AVBD 1JFIA 3WKJD 1P3BC 3X1UB 4J8XB 3AZID 1U35C 5C3IB 1ID3C 1EQZD 1P34C 3W96B 3KUYA 2AROD 3AZHA 3KXBC 3AV1A 1ZLAB 3KSYA 1Q9CA 2HIOC 3LZ1A 4EO5C 5CPIA 1P3IC 4Z5TD 5GSUD 1HQ3C 2BYMA 3MGQC 1P3KD 1P3GC 4JJNB 5B0YC 1P3BA 5B24C 4J8WC 1U35A 5E5AC 1H3OB 3LZ0D 1P34A 3UTBB 3KXBA 3B0CT 2PYOD 3VH5W 3AFAD 2HIOA 5CP6D 1TAFB 4KGCA 1P3IA 4QLCC 5B33B 1HQ3A 3B0DB 3RELD 3MGQA 5B32C 3W99C 3V9RB 1P3GA 3REHB 5B0YA 4XZQB 4R8PD 5B24A 5AVBC 3C1CD 4J8WA 1AOIB 5E5AA 5AY8D 3WTPB 3VH5A 3AZIC 1EQZC 4J8UD 4YM6D 2AROC 3MGPB 4QLCA 1P3PB 3UT9B 5JRGB 5B32A 3W99A 4G91B 4Z5TC 5GSUC 5AVBA 3AZKB 5AV5D 4G92B 3AZGB 1F66D 3AZIA 4Z66D 1BH9A 3AZFB 1EQZA 3LZ0C 2FJ7B 2AROA 4NE5A 2PYOC 1F1EA 3AFAC 5CPKC 3C1BD 2NQBB 3AZJB 4Z5TA 3AV2B 5GSUA 3X1VD 4WU9D 3RELC 1P3KA 5GT0D 3LJAD 5CPJB 4R8PC 4KHAA 3C1CC 2YFVB 5B1LB 3LZ0A 2CWEA 5B0ZD 4H9OA 5DNMD 2PYOA 4CSRB 3AFAA 3KWQB 4J8UC 4YM6C 5CPKA 4H9NB 1KX4B 3RELA 5BNXB 3X1SB 4R8PA 3C1CA 5AV5C 1A7WA 5F99D 5AY8A 2JSSA 3AN2D 5G49B 2YFWA 4Z66C 4J8UA 4YM6A 5DNNB 1P3AB 3AZND 3C1BC 1P3BD 3X1VC 1P3FB 4WU9C 5AV5A 5JA4B 1U35D 1ID3D 5GT0C 3KXBD 4Z66A 4DRBA 3REKD 5B0ZC 2CV5B 2F8NB 5DNMC 3NQUA 3UTAB 4UUZB 5AV6D 2IO5C 5CHLB 3C1BA 5KDMB 3X1VA 3WA9B 5B2IB 4WU9A 5B1MB 5GT0A 1JFIB 5BNVA 5AV9B 4X23B 5F99C 3X1UD 3AN2C 5B0ZA 5DNMA 4ZUXB 3KUYB 2LY8A 4HGAB 3MNNB 1ZLAD 4WZSB 5B32D 1BH8A 3AZNC 5CPIB 3B0CW 4M6BA 2BYMB 3B6GD 4H9RA 3REJD 5F99A 3AN2A 4CAYB 1P34B 5GT3B 5B40D 3REKC 4H9PA 4KGCB 3AZNA 5FUGB 5B33D 5AV6C 3AZLD 4LD9D 1HQ3B 1S32C 2HUEC 1BFMA 3REHD 1P3GB 5B0YB 5B24B 1ID3A 4J8WB 5E5AB 3WTPD 3X1UC 4J8XC 3REKA 5CPKD 1ZLAC 1TZYB 5AV6A 1P3PD 2NZDB 3UT9D 1S32A 5JRGD 3W99B 5AVBB 3AZGD 3B6GC 4JJNC 3WKJB 3REJC 4WU8B 3X1UA 4J8XA 4ZBJC 3AZED 3AZFD 1KX5B 1EQZB 2FJ7D 1M1AD 2AROB 5B40C 1ZLAA 2NQBD 2RVQC 5B33C 1N1JB 3AZLC 3AV2D 3B0DC 4KUDD 5GSUB 4LD9C 4WV4B 3B6GA 1P3KB 3VH6T 3REHC 3REJA 4XZQC 4KHAB 3O62D 5B1LD 1H3OA 3WTPC 3LZ0B 1M18D 5B40A 3AFAB 5B2JD 5CP6B 3KWQD 3W98D 4XUJD 3W97B 5B33A 3AZLA 1P3PC 4YS3D 1P3MD 1KX4D 3UT9C 4LD9A 5JRGC 3RELB 3X1SD 3REHA 4G91C 3X1TD 4XZQA 1M19D 4NE6A 5AVCD 4G92C 3AZGC 5AY8B 4J8VD 3WTPA 3MGSB 3MGRD 5GXQB 1B6WA 3AZEC 2YFWB 3NQJA 3AZFC 2FJ7C 4J8UB 3B6FB 4YM6B 5DNND 1M1AC 3AYWB 1P3PA 3UT9A 5JRGA 2NQBC 3AV2C 4KUDC 3B0BA 5AV5B 3AZGA 1P3LD 5CPJC 1F66B 3O62C 3AZEA 5B1LC 3AZFA 4Z66B 2FJ7A 3UTAD 3WTPE 1M1AA 1M18C 3NQUB 3A6ND 5B2JC 3KWQC 3W98C 4XUJC 3TU4D 2NQBA 3C1BB 3AV2A 1KX4C 4YS3C 1P3MC 3X1VB 4KUDA 5BO0A 4WU9B 3X1SC 1ULYA 3MVDD 5CPJA 3R45A 3X1TC 3LJAB 1M19C 5AV9D 5BNVB 5AVCC 3O62A 5B1LA 4J8VC 4AWLB 3AZMD 1P3OD 5B0ZB 3MGRC 1M18A 5B31G 4ZUXD 3LELB 5B31D 1KX3D 3WAAB 1KU5A 5B2JA 3KWQA 3W98A 4XUJA 5DNNC 1S32D 5AV8B 3REID 4H9NA 1KX4A 4YS3A 1BH8B 1P3MA 3X1SA 3X1TA 1M19A 4H9RB 5AVCA 1B67A 1P3LC 4J8XD 4J8VA 3W96D 3AN2B 3MGRA 5GT3D 4H9SC 3AZHB 3AV1B 5DNNA 3LZ1B 3UTAC 3A6NC 2F8NH 2BYKA 3TU4C 4JJND 4NFTA 1P3BB 5JA4A 1P3LA 3MVDC 1U35B 1ID3B 2F8NK 5AV9C 4X23C 3UTBD 5BT1D 4H9QA 4H9SA 3KXBB 3AZMC 3REKB 2HIOB 3UTAA 1P3OC 4EO5B 3A6NA 4ZUXC 1P3IB 5B31C 1KX3C 2RVQD 3MNNC 1TZYD 5AV6B 2NZDD 3TU4A 3MGQB 5KDMA 3REIC 4XZQD 1AOID 3MVDA 5AV9A 4X23A 4WU8D 4WNNA 5C3IC 3W96C 3AZMA 1P3OA 1KX5D 3VH6W 5GT3C 4ZUXA 3MGPD 5B31A 1KX3A 4QLCB 3MNNA 4E44A 5B32B 4KGCC 3REIA 3AZKD 3B6GB 3REJB 3VH6A 3AZIB 3W96A 1BH9B 4ZBJB 3UTBC 4CAYA 5BT1C 5GT3A 5B40B 3W97D 3AZJD 5FUGA 4Z5TB 1TZYC 3AZLB 2NZDC 4LD9B 4JJNA 5CPJD 1AOIC 3WKJC 3UTBA 3MGSD 4H9OB 5GXQD 4WU8C 2PYOB 1KX5C 3NQJB 1TAFA 3MGPC 3B6FD 5CPKB 4Z2MG 3AYWD 1TZYA 2NZDA 3V9RA 1R4VA 4R8PB 3AZKC 3C1CB 1AOIA 3VH5T 1P3KC 3WKJA 4WU8A 1KX5A 3AZEB 3MGPA 1P3AD 1M1AB 5CP6C 3W97C 3AZJC 1N1JA 3AZKA 1P3FD 2L5AA 4KUDB 5BO0B 3R45B 3O62B 2F8NG 2CV5D 5AY8C 2F8ND 3MGSC 5GXQC 1WWIA 1M18B 3LELD 3WAAD 5CP6A 5B2JB 3B6FC 3W98B 3W97A 5BS7C 4XUJB 3AZJA 3AYWC 5AV8D 3WA9D 5B2ID 4YS3B 1P3MB 5B1MD 4Z2MH 5GT0B 4X23D 3X1TB 2YFVA 1M19B 5AVCB 4E45A 3MGSA 4J8VB 5DNMB 5GXQA 1HTAA 4CSRA 3MGRB 3KUYD 1F66C 3AZHD 3MNND 3AV1D 3B6FA 5BS7A 3LZ1D 2IO5B 1P3AC 3AYWA 5CPID 4DRAA 5BNXA 2BYKB 1P3FC 5F99B 1P3LB 5G49A 3LJAC
chains in the Genus database with same CATH superfamily
1P34D 1F66A 1Z2CB 4H9QB 2CV5C 4AWLC 2HIOD 4H9PB 3EPLA 1P3AA 4KGCD 3LELC 3WAAC 3A6NB 1P3ID 3AZNB 2UWXA 1WWSA 1HQ3D 3MGQD 3TU4B 5AV8C 1P3GD 5B2IC 1P3FA 5B0YD 3WA9C 5B24D 5B1MC 4J8WD 5E5AD 3MVDB 3LJAA 2CV5A 2F8NA 4WNNB 3AZMB 1P3OB 4UUZA 3KUYC 4HGAC 3LELA 3WAAA 3AZHC 5B31B 1KX3B 4QLCD 3AV1C 4NE3A 3LZ1C 5B32G 1S32B 2HUEB 5CPIC 3A1KA 3W99D 5AV8A 5B2IA 3WA9A 3REIB 3FDDA 5B1MA 5AVBD 1JFIA 3WKJD 1P3BC 3X1UB 4J8XB 3AZID 1U35C 5C3IB 1ID3C 1EQZD 1P34C 3W96B 3KUYA 2AROD 3AZHA 3KXBC 3AV1A 1ZLAB 3KSYA 1Q9CA 2HIOC 3LZ1A 4EO5C 2RIQA 5CPIA 1P3IC 4Z5TD 5GSUD 1HQ3C 2BYMA 3MGQC 1P3KD 1P3GC 4JJNB 5B0YC 1P3BA 5B24C 4J8WC 1U35A 5E5AC 1H3OB 3LZ0D 1P34A 3UTBB 3KXBA 2XD5A 3B0CT 2PYOD 3VH5W 3AFAD 2HIOA 5CP6D 1TAFB 4KGCA 1P3IA 4QLCC 5B33B 2G5HC 1HQ3A 3B0DB 3RELD 3MGQA 5B32C 3W99C 3V9RB 1P3GA 3REHB 5B0YA 4XZQB 4R8PD 5B24A 5AVBC 3C1CD 4J8WA 1AOIB 5E5AA 5AY8D 3WTPB 3VH5A 3AZIC 1EQZC 4J8UD 3AL0C 4YM6D 2AROC 3MGPB 4QLCA 2JE5A 1P3PB 3UT9B 5JRGB 5B32A 3W99A 4G91B 4Z5TC 5GSUC 5AVBA 3AZKB 5AV5D 4G92B 2ZM5A 3AZGB 1F66D 3AZIA 4Z66D 1BH9A 3AZFB 1EQZA 3LZ0C 2FJ7B 2AROA 4NE5A 2PYOC 1F1EA 3AFAC 5CPKC 3C1BD 2NQBB 3AZJB 4Z5TA 2JCHA 3AV2B 5GSUA 3X1VD 4WU9D 3RELC 1P3KA 5GT0D 3LJAD 5CPJB 4R8PC 4KHAA 3C1CC 2YFVB 5B1LB 3LZ0A 2CWEA 5B0ZD 3EPKA 4H9OA 5DNMD 2PYOA 4CSRB 3AFAA 2G5IC 3KWQB 4J8UC 4YM6C 3EPJA 5CPKA 4H9NB 1KX4B 3RELA 5BNXB 3X1SB 4R8PA 3C1CA 5AV5C 1A7WA 5F99D 5AY8A 2JSSA 3AN2D 5G49B 2YFWA 4Z66C 4J8UA 4YM6A 5DNNB 1P3AB 3AZND 3C1BC 1P3BD 2Y2NA 3X1VC 1P3FB 4WU9C 5AV5A 5JA4B 1U35D 1ID3D 5GT0C 3KXBD 4Z66A 4DRBA 3REKD 5B0ZC 2CV5B 2F8NB 5DNMC 3NQUA 3UTAB 2Y2JA 4UUZB 5AV6D 2IO5C 5CHLB 3C1BA 5KDMB 3X1VA 3WA9B 5B2IB 4WU9A 5B1MB 5GT0A 1JFIB 5BNVA 5AV9B 4X23B 5F99C 3X1UD 3AN2C 5B0ZA 5DNMA 4ZUXB 3KUYB 2LY8A 4HGAB 3MNNB 1ZLAD 4WZSB 5B32D 3H0MC 1BH8A 3AZNC 5CPIB 3B0CW 4M6BA 2BYMB 3B6GD 4H9RA 3REJD 5F99A 3AN2A 4CAYB 1P34B 5GT3B 5B40D 3REKC 4H9PA 4KGCB 3AZNA 5FUGB 5B33D 5AV6C 3AZLD 4LD9D 1HQ3B 1S32C 2HUEC 2BG1A 1BFMA 3REHD 1P3GB 5B0YB 5B24B 1ID3A 4J8WB 5E5AB 3H0RC 3WTPD 3X1UC 4J8XC 3REKA 2Y2IA 5CPKD 1ZLAC 1TZYB 5AV6A 2Y2QA 1P3PD 2NZDB 3UT9D 1S32A 5JRGD 3W99B 5AVBB 3AZGD 3H0LC 3B6GC 4JJNC 3WKJB 3REJC 4WU8B 3X1UA 4J8XA 4ZBJC 3AZED 2VQRA 3AZFD 1KX5B 1EQZB 2FJ7D 1M1AD 2AROB 5B40C 1ZLAA 2NQBD 2RVQC 5B33C 1N1JB 3AZLC 3AV2D 3B0DC 4KUDD 5GSUB 4LD9C 4WV4B 3B6GA 1P3KB 3VH6T 3REHC 3REJA 4XZQC 4KHAB 3O62D 5B1LD 1H3OA 3WTPC 3LZ0B 4WJ3C 1M18D 5B40A 2W8SA 3AFAB 5B2JD 5CP6B 3KWQD 3W98D 4XUJD 4DQYB 3W97B 3EPHA 5B33A 3AZLA 1P3PC 4YS3D 1P3MD 1KX4D 3UT9C 4LD9A 5JRGC 3RELB 3X1SD 3REHA 4G91C 4XZQA 3X1TD 1M19D 4NE6A 5AVCD 4G92C 3AZGC 2Y2OA 5AY8B 4J8VD 3WTPA 3MGSB 3MGRD 5GXQB 1B6WA 3AZEC 2YFWB 3NQJA 3AZFC 2FJ7C 4J8UB 3B6FB 4YM6B 5DNND 1M1AC 2Y2PA 3AYWB 1P3PA 3UT9A 5JRGA 2NQBC 3AV2C 4KUDC 3B0BA 5AV5B 3AZGA 1P3LD 5CPJC 1F66B 3O62C 3AZEA 3F6TA 5B1LC 3AZFA 4Z66B 2FJ7A 3UTAD 3WTPE 1M1AA 1M18C 3NQUB 3A6ND 2ZY4A 5B2JC 3KWQC 2ZY5A 4XUJC 3W98C 3TU4D 2NQBA 3C1BB 3AV2A 1KX4C 4YS3C 1P3MC 3X1VB 4KUDA 5BO0A 4WU9B 1T3UA 3X1SC 1ULYA 3MVDD 5CPJA 3R45A 3X1TC 3LJAB 1M19C 5AV9D 5BNVB 2DQNC 5AVCC 3O62A 5B1LA 4J8VC 4AWLB 3A1IA 2XD1A 3AZMD 5B0ZB 3MGRC 1P3OD 1M18A 5B31G 4ZUXD 3LELB 5B31D 1KX3D 3WAAB 1KU5A 5B2JA 3KWQA 3W98A 4XUJA 5DNNC 2Y2KA 1S32D 5AV8B 2DF4C 4H9NA 3REID 4YS3A 1BH8B 1P3MA 1KX4A 3X1SA 1PZRA 3X1TA 1M19A 5AVCA 4H9RB 1B67A 3IP4C 1P3LC 4J8XD 4J8VA 3W96D 3AN2B 3MGRA 5GT3D 4H9SC 3AZHB 3AV1B 5DNNA 3LZ1B 3UTAC 3A6NC 2F8NH 2BYKA 3TU4C 4JJND 4NFTA 1P3BB 5JA4A 1P3LA 3MVDC 1U35B 1ID3B 2F8NK 5AV9C 4X23C 3UTBD 2ZY2A 5BT1D 4H9QA 4H9SA 3KXBB 3AZMC 3REKB 2HIOB 3UTAA 1P3OC 4EO5B 3A6NA 2FFFB 4ZUXC 5B31C 1P3IB 2RVQD 1KX3C 3MNNC 1TZYD 5AV6B 2NZDD 3TU4A 3MGQB 5KDMA 3REIC 4XZQD 1AOID 3MVDA 2Y2LA 5AV9A 4X23A 4WU8D 4WNNA 2Y2HA 3W96C 5C3IC 3AZMA 1P3OA 1KX5D 3VH6W 5GT3C 4ZUXA 3MGPD 5B31A 1KX3A 4QLCB 3MNNA 2J8PA 4E44A 3P5JB 5B32B 4KGCC 3REIA 3AZKD 3B6GB 3REJB 3VH6A 3AZIB 3W96A 1BH9B 1W2EA 4ZBJB 3UTBC 4CAYA 5BT1C 5GT3A 5B40B 3W97D 3AZJD 5FUGA 4Z5TB 1TZYC 3AZLB 2NZDC 4LD9B 4JJNA 5CPJD 2ZY3A 1AOIC 3WKJC 3UTBA 3MGSD 4H9OB 5GXQD 4WU8C 2PYOB 1KX5C 3NQJB 1TAFA 3MGPC 3B6FD 5CPKB 4Z2MG 3AYWD 1TZYA 2NZDA 3V9RA 1R4VA 4R8PB 3AZKC 3C1CB 1AOIA 3VH5T 1P3KC 3WKJA 2Y2MA 4WU8A 1KX5A 3AZEB 3MGPA 1P3AD 1M1AB 5CP6C 3W97C 3AZJC 1N1JA 3AZKA 1P3FD 2L5AA 4KUDB 5BO0B 3EG5B 3R45B 3O62B 2F8NG 2CV5D 5AY8C 2F8ND 3MGSC 5GXQC 1WWIA 1M18B 4UPKA 3LELD 3WAAD 2F2AC 5CP6A 5B2JB 3B6FC 3W98B 3W97A 5BS7C 4XUJB 3AZJA 3AYWC 5AV8D 3WA9D 5B2ID 4YS3B 1P3MB 5B1MD 4Z2MH 5GT0B 4X23D 3X1TB 2YFVA 1M19B 5AVCB 4E45A 3KFUG 3MGSA 4J8VB 5DNMB 5GXQA 1HTAA 2Y2GA 4CSRA 3MGRB 3KUYD 1F66C 3AZHD 3MNND 3AV1D 3B6FA 5BS7A 3LZ1D 2IO5B 1P3AC 3AYWA 5CPID 4DRAA 5BNXA 2BYKB 1P3FC 5F99B 1P3LB 5G49A 3LJAC
chains in the Genus database with same CATH topology
1P34D 1F66A 1Z2CB 4H9QB 2CV5C 4AWLC 2HIOD 4H9PB 3EPLA 1P3AA 4KGCD 3LELC 3WAAC 3A6NB 1P3ID 3AZNB 2UWXA 1WWSA 1HQ3D 3MGQD 3TU4B 5AV8C 1P3GD 5B2IC 1P3FA 5B0YD 3WA9C 5B24D 5B1MC 4J8WD 5E5AD 3MVDB 3LJAA 2CV5A 2F8NA 4WNNB 3AZMB 1P3OB 4UUZA 3KUYC 4HGAC 3LELA 3WAAA 3AZHC 5B31B 1KX3B 4QLCD 3AV1C 4NE3A 3LZ1C 5B32G 1S32B 2HUEB 5CPIC 3A1KA 3W99D 5AV8A 5B2IA 3WA9A 3REIB 3FDDA 5B1MA 5AVBD 1JFIA 3WKJD 1P3BC 3X1UB 4J8XB 3AZID 1U35C 5C3IB 1ID3C 1EQZD 1P34C 3W96B 3KUYA 2AROD 3AZHA 3KXBC 3AV1A 1ZLAB 3KSYA 1Q9CA 2HIOC 3LZ1A 4EO5C 2RIQA 5CPIA 1P3IC 4Z5TD 5GSUD 1HQ3C 2BYMA 3MGQC 1P3KD 1P3GC 4JJNB 5B0YC 1P3BA 5B24C 4J8WC 1U35A 5E5AC 1H3OB 3LZ0D 1P34A 3UTBB 3KXBA 2XD5A 3B0CT 2PYOD 3VH5W 3AFAD 2HIOA 5CP6D 1TAFB 4KGCA 1P3IA 4QLCC 5B33B 2G5HC 1HQ3A 3B0DB 3RELD 3MGQA 5B32C 3W99C 3V9RB 1P3GA 3REHB 5B0YA 4XZQB 4R8PD 5B24A 5AVBC 3C1CD 4J8WA 1AOIB 5E5AA 5AY8D 3WTPB 3VH5A 3AZIC 1EQZC 4J8UD 3AL0C 4YM6D 2AROC 3MGPB 4QLCA 2JE5A 1P3PB 3UT9B 5JRGB 5B32A 3W99A 4G91B 4Z5TC 5GSUC 5AVBA 3AZKB 5AV5D 4G92B 2ZM5A 3AZGB 1F66D 3AZIA 4Z66D 1BH9A 3AZFB 1EQZA 3LZ0C 2FJ7B 2AROA 4NE5A 2PYOC 1F1EA 3AFAC 5CPKC 3C1BD 2NQBB 3AZJB 4Z5TA 2JCHA 3AV2B 5GSUA 3X1VD 4WU9D 3RELC 1P3KA 5GT0D 3LJAD 5CPJB 4R8PC 4KHAA 3C1CC 2YFVB 5B1LB 3LZ0A 2CWEA 5B0ZD 3EPKA 4H9OA 5DNMD 2PYOA 4CSRB 3AFAA 2G5IC 3KWQB 4J8UC 4YM6C 3EPJA 5CPKA 4H9NB 1KX4B 3RELA 5BNXB 3X1SB 4R8PA 3C1CA 5AV5C 1A7WA 5F99D 5AY8A 2JSSA 3AN2D 5G49B 2YFWA 4Z66C 4J8UA 4YM6A 5DNNB 1P3AB 3AZND 3C1BC 1P3BD 2Y2NA 3X1VC 1P3FB 4WU9C 5AV5A 5JA4B 1U35D 1ID3D 5GT0C 3KXBD 4Z66A 4DRBA 3REKD 5B0ZC 2CV5B 2F8NB 5DNMC 3NQUA 3UTAB 2Y2JA 4UUZB 5AV6D 2IO5C 5CHLB 3C1BA 5KDMB 3X1VA 3WA9B 5B2IB 4WU9A 5B1MB 5GT0A 1JFIB 5BNVA 5AV9B 4X23B 5F99C 3X1UD 3AN2C 5B0ZA 5DNMA 4ZUXB 3KUYB 2LY8A 4HGAB 3MNNB 1ZLAD 4WZSB 5B32D 3H0MC 1BH8A 3AZNC 5CPIB 3B0CW 4M6BA 2BYMB 3B6GD 4H9RA 3REJD 5F99A 3AN2A 4CAYB 1P34B 5GT3B 5B40D 3REKC 4H9PA 4KGCB 3AZNA 5FUGB 5B33D 5AV6C 3AZLD 4LD9D 1HQ3B 1S32C 2HUEC 2BG1A 1BFMA 3REHD 1P3GB 5B0YB 5B24B 1ID3A 4J8WB 5E5AB 3H0RC 3WTPD 3X1UC 4J8XC 3REKA 2Y2IA 5CPKD 1ZLAC 1TZYB 5AV6A 2Y2QA 1P3PD 2NZDB 3UT9D 1S32A 5JRGD 3W99B 5AVBB 3AZGD 3H0LC 3B6GC 4JJNC 3WKJB 3REJC 4WU8B 3X1UA 4J8XA 4ZBJC 3AZED 2VQRA 3AZFD 1KX5B 1EQZB 2FJ7D 1M1AD 2AROB 5B40C 1ZLAA 2NQBD 2RVQC 5B33C 1N1JB 3AZLC 3AV2D 3B0DC 4KUDD 5GSUB 4LD9C 4WV4B 3B6GA 1P3KB 3VH6T 3REHC 3REJA 4XZQC 4KHAB 3O62D 5B1LD 1H3OA 3WTPC 3LZ0B 4WJ3C 1M18D 5B40A 2W8SA 3AFAB 5B2JD 5CP6B 3KWQD 3W98D 4XUJD 4DQYB 3W97B 3EPHA 5B33A 3AZLA 1P3PC 4YS3D 1P3MD 1KX4D 3UT9C 4LD9A 5JRGC 3RELB 3X1SD 3REHA 4G91C 4XZQA 3X1TD 1M19D 4NE6A 5AVCD 4G92C 3AZGC 2Y2OA 5AY8B 4J8VD 3WTPA 3MGSB 3MGRD 5GXQB 1B6WA 3AZEC 2YFWB 3NQJA 3AZFC 2FJ7C 4J8UB 3B6FB 4YM6B 5DNND 1M1AC 2Y2PA 3AYWB 1P3PA 3UT9A 5JRGA 2NQBC 3AV2C 4KUDC 3B0BA 5AV5B 3AZGA 1P3LD 5CPJC 1F66B 3O62C 3AZEA 3F6TA 5B1LC 3AZFA 4Z66B 2FJ7A 3UTAD 3WTPE 1M1AA 1M18C 3NQUB 3A6ND 2ZY4A 5B2JC 3KWQC 2ZY5A 4XUJC 3W98C 3TU4D 2NQBA 3C1BB 3AV2A 1KX4C 4YS3C 1P3MC 3X1VB 4KUDA 5BO0A 4WU9B 1T3UA 3X1SC 1ULYA 3MVDD 5CPJA 3R45A 3X1TC 3LJAB 1M19C 5AV9D 5BNVB 2DQNC 5AVCC 3O62A 5B1LA 4J8VC 4AWLB 3A1IA 2XD1A 3AZMD 5B0ZB 3MGRC 1P3OD 1M18A 5B31G 4ZUXD 3LELB 5B31D 1KX3D 3WAAB 1KU5A 5B2JA 3KWQA 3W98A 4XUJA 5DNNC 2Y2KA 1S32D 5AV8B 2DF4C 4H9NA 3REID 4YS3A 1BH8B 1P3MA 1KX4A 3X1SA 1PZRA 3X1TA 1M19A 5AVCA 4H9RB 1B67A 3IP4C 1P3LC 4J8XD 4J8VA 3W96D 3AN2B 3MGRA 5GT3D 4H9SC 3AZHB 3AV1B 5DNNA 3LZ1B 3UTAC 3A6NC 2F8NH 2BYKA 3TU4C 4JJND 4NFTA 1P3BB 5JA4A 1P3LA 3MVDC 1U35B 1ID3B 2F8NK 5AV9C 4X23C 3UTBD 2ZY2A 5BT1D 4H9QA 4H9SA 3KXBB 3AZMC 3REKB 2HIOB 3UTAA 1P3OC 4EO5B 3A6NA 2FFFB 4ZUXC 5B31C 1P3IB 2RVQD 1KX3C 3MNNC 1TZYD 5AV6B 2NZDD 3TU4A 3MGQB 5KDMA 3REIC 4XZQD 1AOID 3MVDA 2Y2LA 5AV9A 4X23A 4WU8D 4WNNA 2Y2HA 3W96C 5C3IC 3AZMA 1P3OA 1KX5D 3VH6W 5GT3C 4ZUXA 3MGPD 5B31A 1KX3A 4QLCB 3MNNA 2J8PA 4E44A 3P5JB 5B32B 4KGCC 3REIA 3AZKD 3B6GB 3REJB 3VH6A 3AZIB 3W96A 1BH9B 1W2EA 4ZBJB 3UTBC 4CAYA 5BT1C 5GT3A 5B40B 3W97D 3AZJD 5FUGA 4Z5TB 1TZYC 3AZLB 2NZDC 4LD9B 4JJNA 5CPJD 2ZY3A 1AOIC 3WKJC 3UTBA 3MGSD 4H9OB 5GXQD 4WU8C 2PYOB 1KX5C 3NQJB 1TAFA 3MGPC 3B6FD 5CPKB 4Z2MG 3AYWD 1TZYA 2NZDA 3V9RA 1R4VA 4R8PB 3AZKC 3C1CB 1AOIA 3VH5T 1P3KC 3WKJA 2Y2MA 4WU8A 1KX5A 3AZEB 3MGPA 1P3AD 1M1AB 5CP6C 3W97C 3AZJC 1N1JA 3AZKA 1P3FD 2L5AA 4KUDB 5BO0B 3EG5B 3R45B 3O62B 2F8NG 2CV5D 5AY8C 2F8ND 3MGSC 5GXQC 1WWIA 1M18B 4UPKA 3LELD 3WAAD 2F2AC 5CP6A 5B2JB 3B6FC 3W98B 3W97A 5BS7C 4XUJB 3AZJA 3AYWC 5AV8D 3WA9D 5B2ID 4YS3B 1P3MB 5B1MD 4Z2MH 5GT0B 4X23D 3X1TB 2YFVA 1M19B 5AVCB 4E45A 3KFUG 3MGSA 4J8VB 5DNMB 5GXQA 1HTAA 2Y2GA 4CSRA 3MGRB 3KUYD 1F66C 3AZHD 3MNND 3AV1D 3B6FA 5BS7A 3LZ1D 2IO5B 1P3AC 3AYWA 5CPID 4DRAA 5BNXA 2BYKB 1P3FC 5F99B 1P3LB 5G49A 3LJAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 D;  1F66 A;  4H9Q B;  2CV5 C;  4AWL C;  2HIO D;  4H9P B;  1P3A A;  4KGC D;  3LEL C;  3WAA C;  3A6N B;  1P3I D;  3AZN B;  1WWS A;  1HQ3 D;  3MGQ D;  3TU4 B;  5AV8 C;  1P3G D;  5B2I C;  1P3F A;  5B0Y D;  3WA9 C;  5B24 D;  5B1M C;  4J8W D;  5E5A D;  3MVD B;  3LJA A;  2CV5 A;  2F8N A;  4WNN B;  3AZM B;  1P3O B;  4UUZ A;  3KUY C;  4HGA C;  3LEL A;  3WAA A;  3AZH C;  5B31 B;  1KX3 B;  4QLC D;  3AV1 C;  4NE3 A;  3LZ1 C;  5B32 G;  1S32 B;  2HUE B;  5CPI C;  3W99 D;  5AV8 A;  5B2I A;  3WA9 A;  3REI B;  5B1M A;  5AVB D;  1JFI A;  3WKJ D;  1P3B C;  3X1U B;  4J8X B;  3AZI D;  1U35 C;  5C3I B;  1ID3 C;  1EQZ D;  1P34 C;  3W96 B;  3KUY A;  2ARO D;  3AZH A;  3KXB C;  3AV1 A;  1ZLA B;  3KSY A;  1Q9C A;  2HIO C;  3LZ1 A;  4EO5 C;  5CPI A;  1P3I C;  4Z5T D;  5GSU D;  1HQ3 C;  2BYM A;  3MGQ C;  1P3K D;  1P3G C;  4JJN B;  5B0Y C;  1P3B A;  5B24 C;  4J8W C;  1U35 A;  5E5A C;  1H3O B;  3LZ0 D;  1P34 A;  3UTB B;  3KXB A;  3B0C T;  2PYO D;  3VH5 W;  3AFA D;  2HIO A;  5CP6 D;  1TAF B;  4KGC A;  1P3I A;  4QLC C;  5B33 B;  1HQ3 A;  3B0D B;  3REL D;  3MGQ A;  5B32 C;  3W99 C;  3V9R B;  1P3G A;  3REH B;  5B0Y A;  4XZQ B;  4R8P D;  5B24 A;  5AVB C;  3C1C D;  4J8W A;  1AOI B;  5E5A A;  5AY8 D;  3WTP B;  3VH5 A;  3AZI C;  1EQZ C;  4J8U D;  4YM6 D;  2ARO C;  3MGP B;  4QLC A;  1P3P B;  3UT9 B;  5JRG B;  5B32 A;  3W99 A;  4G91 B;  4Z5T C;  5GSU C;  5AVB A;  3AZK B;  5AV5 D;  4G92 B;  3AZG B;  1F66 D;  3AZI A;  4Z66 D;  1BH9 A;  3AZF B;  1EQZ A;  3LZ0 C;  2FJ7 B;  2ARO A;  4NE5 A;  2PYO C;  1F1E A;  3AFA C;  5CPK C;  3C1B D;  2NQB B;  3AZJ B;  4Z5T A;  3AV2 B;  5GSU A;  3X1V D;  4WU9 D;  3REL C;  1P3K A;  5GT0 D;  3LJA D;  5CPJ B;  4R8P C;  4KHA A;  3C1C C;  2YFV B;  5B1L B;  3LZ0 A;  2CWE A;  5B0Z D;  4H9O A;  5DNM D;  2PYO A;  4CSR B;  3AFA A;  3KWQ B;  4J8U C;  4YM6 C;  5CPK A;  4H9N B;  1KX4 B;  3REL A;  5BNX B;  3X1S B;  4R8P A;  3C1C A;  5AV5 C;  1A7W A;  5F99 D;  5AY8 A;  2JSS A;  3AN2 D;  5G49 B;  2YFW A;  4Z66 C;  4J8U A;  4YM6 A;  5DNN B;  1P3A B;  3AZN D;  3C1B C;  1P3B D;  3X1V C;  1P3F B;  4WU9 C;  5AV5 A;  5JA4 B;  1U35 D;  1ID3 D;  5GT0 C;  3KXB D;  4Z66 A;  4DRB A;  3REK D;  5B0Z C;  2CV5 B;  2F8N B;  5DNM C;  3NQU A;  3UTA B;  4UUZ B;  5AV6 D;  2IO5 C;  5CHL B;  3C1B A;  5KDM B;  3X1V A;  3WA9 B;  5B2I B;  4WU9 A;  5B1M B;  5GT0 A;  1JFI B;  5BNV A;  5AV9 B;  4X23 B;  5F99 C;  3X1U D;  3AN2 C;  5B0Z A;  5DNM A;  4ZUX B;  3KUY B;  2LY8 A;  4HGA B;  3MNN B;  1ZLA D;  4WZS B;  5B32 D;  1BH8 A;  3AZN C;  5CPI B;  3B0C W;  4M6B A;  2BYM B;  3B6G D;  4H9R A;  3REJ D;  5F99 A;  3AN2 A;  4CAY B;  1P34 B;  5GT3 B;  5B40 D;  3REK C;  4H9P A;  4KGC B;  3AZN A;  5FUG B;  5B33 D;  5AV6 C;  3AZL D;  4LD9 D;  1HQ3 B;  1S32 C;  2HUE C;  1BFM A;  3REH D;  1P3G B;  5B0Y B;  5B24 B;  1ID3 A;  4J8W B;  5E5A B;  3WTP D;  3X1U C;  4J8X C;  3REK A;  5CPK D;  1ZLA C;  1TZY B;  5AV6 A;  1P3P D;  2NZD B;  3UT9 D;  1S32 A;  5JRG D;  3W99 B;  5AVB B;  3AZG D;  3B6G C;  4JJN C;  3WKJ B;  3REJ C;  4WU8 B;  3X1U A;  4J8X A;  4ZBJ C;  3AZE D;  3AZF D;  1KX5 B;  1EQZ B;  2FJ7 D;  1M1A D;  2ARO B;  5B40 C;  1ZLA A;  2NQB D;  2RVQ C;  5B33 C;  1N1J B;  3AZL C;  3AV2 D;  3B0D C;  4KUD D;  5GSU B;  4LD9 C;  4WV4 B;  3B6G A;  1P3K B;  3VH6 T;  3REH C;  3REJ A;  4XZQ C;  4KHA B;  3O62 D;  5B1L D;  1H3O A;  3WTP C;  3LZ0 B;  1M18 D;  5B40 A;  3AFA B;  5B2J D;  5CP6 B;  3KWQ D;  3W98 D;  4XUJ D;  3W97 B;  5B33 A;  3AZL A;  1P3P C;  4YS3 D;  1P3M D;  1KX4 D;  3UT9 C;  4LD9 A;  5JRG C;  3REL B;  3X1S D;  3REH A;  4G91 C;  3X1T D;  4XZQ A;  1M19 D;  4NE6 A;  5AVC D;  4G92 C;  3AZG C;  5AY8 B;  4J8V D;  3WTP A;  3MGS B;  3MGR D;  5GXQ B;  1B6W A;  3AZE C;  2YFW B;  3NQJ A;  3AZF C;  2FJ7 C;  4J8U B;  3B6F B;  4YM6 B;  5DNN D;  1M1A C;  3AYW B;  1P3P A;  3UT9 A;  5JRG A;  2NQB C;  3AV2 C;  4KUD C;  3B0B A;  5AV5 B;  3AZG A;  1P3L D;  5CPJ C;  1F66 B;  3O62 C;  3AZE A;  5B1L C;  3AZF A;  4Z66 B;  2FJ7 A;  3UTA D;  3WTP E;  1M1A A;  1M18 C;  3NQU B;  3A6N D;  5B2J C;  3KWQ C;  3W98 C;  4XUJ C;  3TU4 D;  2NQB A;  3C1B B;  3AV2 A;  1KX4 C;  4YS3 C;  1P3M C;  3X1V B;  4KUD A;  5BO0 A;  4WU9 B;  3X1S C;  1ULY A;  3MVD D;  5CPJ A;  3R45 A;  3X1T C;  3LJA B;  1M19 C;  5AV9 D;  5BNV B;  5AVC C;  3O62 A;  5B1L A;  4J8V C;  4AWL B;  3AZM D;  1P3O D;  5B0Z B;  3MGR C;  1M18 A;  5B31 G;  4ZUX D;  3LEL B;  5B31 D;  1KX3 D;  3WAA B;  1KU5 A;  5B2J A;  3KWQ A;  3W98 A;  4XUJ A;  5DNN C;  1S32 D;  5AV8 B;  3REI D;  4H9N A;  1KX4 A;  4YS3 A;  1BH8 B;  1P3M A;  3X1S A;  3X1T A;  1M19 A;  4H9R B;  5AVC A;  1B67 A;  1P3L C;  4J8X D;  4J8V A;  3W96 D;  3AN2 B;  3MGR A;  5GT3 D;  4H9S C;  3AZH B;  3AV1 B;  5DNN A;  3LZ1 B;  3UTA C;  3A6N C;  2F8N H;  2BYK A;  3TU4 C;  4JJN D;  4NFT A;  1P3B B;  5JA4 A;  1P3L A;  3MVD C;  1U35 B;  1ID3 B;  2F8N K;  5AV9 C;  4X23 C;  3UTB D;  5BT1 D;  4H9Q A;  4H9S A;  3KXB B;  3AZM C;  3REK B;  2HIO B;  3UTA A;  1P3O C;  4EO5 B;  3A6N A;  4ZUX C;  1P3I B;  5B31 C;  1KX3 C;  2RVQ D;  3MNN C;  1TZY D;  5AV6 B;  2NZD D;  3TU4 A;  3MGQ B;  5KDM A;  3REI C;  4XZQ D;  1AOI D;  3MVD A;  5AV9 A;  4X23 A;  4WU8 D;  4WNN A;  5C3I C;  3W96 C;  3AZM A;  1P3O A;  1KX5 D;  3VH6 W;  5GT3 C;  4ZUX A;  3MGP D;  5B31 A;  1KX3 A;  4QLC B;  3MNN A;  4E44 A;  5B32 B;  4KGC C;  3REI A;  3AZK D;  3B6G B;  3REJ B;  3VH6 A;  3AZI B;  3W96 A;  1BH9 B;  4ZBJ B;  3UTB C;  4CAY A;  5BT1 C;  5GT3 A;  5B40 B;  3W97 D;  3AZJ D;  5FUG A;  4Z5T B;  1TZY C;  3AZL B;  2NZD C;  4LD9 B;  4JJN A;  5CPJ D;  1AOI C;  3WKJ C;  3UTB A;  3MGS D;  4H9O B;  5GXQ D;  4WU8 C;  2PYO B;  1KX5 C;  3NQJ B;  1TAF A;  3MGP C;  3B6F D;  5CPK B;  4Z2M G;  3AYW D;  1TZY A;  2NZD A;  3V9R A;  1R4V A;  4R8P B;  3AZK C;  3C1C B;  1AOI A;  3VH5 T;  1P3K C;  3WKJ A;  4WU8 A;  1KX5 A;  3AZE B;  3MGP A;  1P3A D;  1M1A B;  5CP6 C;  3W97 C;  3AZJ C;  1N1J A;  3AZK A;  1P3F D;  2L5A A;  4KUD B;  5BO0 B;  3R45 B;  3O62 B;  2F8N G;  2CV5 D;  5AY8 C;  2F8N D;  3MGS C;  5GXQ C;  1WWI A;  1M18 B;  3LEL D;  3WAA D;  5CP6 A;  5B2J B;  3B6F C;  3W98 B;  3W97 A;  5BS7 C;  4XUJ B;  3AZJ A;  3AYW C;  5AV8 D;  3WA9 D;  5B2I D;  4YS3 B;  1P3M B;  5B1M D;  4Z2M H;  5GT0 B;  4X23 D;  3X1T B;  2YFV A;  1M19 B;  5AVC B;  4E45 A;  3MGS A;  4J8V B;  5DNM B;  5GXQ A;  1HTA A;  4CSR A;  3MGR B;  3KUY D;  1F66 C;  3AZH D;  3MNN D;  3AV1 D;  3B6F A;  5BS7 A;  3LZ1 D;  2IO5 B;  1P3A C;  3AYW A;  5CPI D;  4DRA A;  5BNX A;  2BYK B;  1P3F C;  5F99 B;  1P3L B;  5G49 A;  3LJA C; 
#chains in the Genus database with same CATH topology
 1P34 D;  1F66 A;  1Z2C B;  4H9Q B;  2CV5 C;  4AWL C;  2HIO D;  4H9P B;  3EPL A;  1P3A A;  4KGC D;  3LEL C;  3WAA C;  3A6N B;  1P3I D;  3AZN B;  2UWX A;  1WWS A;  1HQ3 D;  3MGQ D;  3TU4 B;  5AV8 C;  1P3G D;  5B2I C;  1P3F A;  5B0Y D;  3WA9 C;  5B24 D;  5B1M C;  4J8W D;  5E5A D;  3MVD B;  3LJA A;  2CV5 A;  2F8N A;  4WNN B;  3AZM B;  1P3O B;  4UUZ A;  3KUY C;  4HGA C;  3LEL A;  3WAA A;  3AZH C;  5B31 B;  1KX3 B;  4QLC D;  3AV1 C;  4NE3 A;  3LZ1 C;  5B32 G;  1S32 B;  2HUE B;  5CPI C;  3A1K A;  3W99 D;  5AV8 A;  5B2I A;  3WA9 A;  3REI B;  3FDD A;  5B1M A;  5AVB D;  1JFI A;  3WKJ D;  1P3B C;  3X1U B;  4J8X B;  3AZI D;  1U35 C;  5C3I B;  1ID3 C;  1EQZ D;  1P34 C;  3W96 B;  3KUY A;  2ARO D;  3AZH A;  3KXB C;  3AV1 A;  1ZLA B;  3KSY A;  1Q9C A;  2HIO C;  3LZ1 A;  4EO5 C;  2RIQ A;  5CPI A;  1P3I C;  4Z5T D;  5GSU D;  1HQ3 C;  2BYM A;  3MGQ C;  1P3K D;  1P3G C;  4JJN B;  5B0Y C;  1P3B A;  5B24 C;  4J8W C;  1U35 A;  5E5A C;  1H3O B;  3LZ0 D;  1P34 A;  3UTB B;  3KXB A;  2XD5 A;  3B0C T;  2PYO D;  3VH5 W;  3AFA D;  2HIO A;  5CP6 D;  1TAF B;  4KGC A;  1P3I A;  4QLC C;  5B33 B;  2G5H C;  1HQ3 A;  3B0D B;  3REL D;  3MGQ A;  5B32 C;  3W99 C;  3V9R B;  1P3G A;  3REH B;  5B0Y A;  4XZQ B;  4R8P D;  5B24 A;  5AVB C;  3C1C D;  4J8W A;  1AOI B;  5E5A A;  5AY8 D;  3WTP B;  3VH5 A;  3AZI C;  1EQZ C;  4J8U D;  3AL0 C;  4YM6 D;  2ARO C;  3MGP B;  4QLC A;  2JE5 A;  1P3P B;  3UT9 B;  5JRG B;  5B32 A;  3W99 A;  4G91 B;  4Z5T C;  5GSU C;  5AVB A;  3AZK B;  5AV5 D;  4G92 B;  2ZM5 A;  3AZG B;  1F66 D;  3AZI A;  4Z66 D;  1BH9 A;  3AZF B;  1EQZ A;  3LZ0 C;  2FJ7 B;  2ARO A;  4NE5 A;  2PYO C;  1F1E A;  3AFA C;  5CPK C;  3C1B D;  2NQB B;  3AZJ B;  4Z5T A;  2JCH A;  3AV2 B;  5GSU A;  3X1V D;  4WU9 D;  3REL C;  1P3K A;  5GT0 D;  3LJA D;  5CPJ B;  4R8P C;  4KHA A;  3C1C C;  2YFV B;  5B1L B;  3LZ0 A;  2CWE A;  5B0Z D;  3EPK A;  4H9O A;  5DNM D;  2PYO A;  4CSR B;  3AFA A;  2G5I C;  3KWQ B;  4J8U C;  4YM6 C;  3EPJ A;  5CPK A;  4H9N B;  1KX4 B;  3REL A;  5BNX B;  3X1S B;  4R8P A;  3C1C A;  5AV5 C;  1A7W A;  5F99 D;  5AY8 A;  2JSS A;  3AN2 D;  5G49 B;  2YFW A;  4Z66 C;  4J8U A;  4YM6 A;  5DNN B;  1P3A B;  3AZN D;  3C1B C;  1P3B D;  2Y2N A;  3X1V C;  1P3F B;  4WU9 C;  5AV5 A;  5JA4 B;  1U35 D;  1ID3 D;  5GT0 C;  3KXB D;  4Z66 A;  4DRB A;  3REK D;  5B0Z C;  2CV5 B;  2F8N B;  5DNM C;  3NQU A;  3UTA B;  2Y2J A;  4UUZ B;  5AV6 D;  2IO5 C;  5CHL B;  3C1B A;  5KDM B;  3X1V A;  3WA9 B;  5B2I B;  4WU9 A;  5B1M B;  5GT0 A;  1JFI B;  5BNV A;  5AV9 B;  4X23 B;  5F99 C;  3X1U D;  3AN2 C;  5B0Z A;  5DNM A;  4ZUX B;  3KUY B;  2LY8 A;  4HGA B;  3MNN B;  1ZLA D;  4WZS B;  5B32 D;  3H0M C;  1BH8 A;  3AZN C;  5CPI B;  3B0C W;  4M6B A;  2BYM B;  3B6G D;  4H9R A;  3REJ D;  5F99 A;  3AN2 A;  4CAY B;  1P34 B;  5GT3 B;  5B40 D;  3REK C;  4H9P A;  4KGC B;  3AZN A;  5FUG B;  5B33 D;  5AV6 C;  3AZL D;  4LD9 D;  1HQ3 B;  1S32 C;  2HUE C;  2BG1 A;  1BFM A;  3REH D;  1P3G B;  5B0Y B;  5B24 B;  1ID3 A;  4J8W B;  5E5A B;  3H0R C;  3WTP D;  3X1U C;  4J8X C;  3REK A;  2Y2I A;  5CPK D;  1ZLA C;  1TZY B;  5AV6 A;  2Y2Q A;  1P3P D;  2NZD B;  3UT9 D;  1S32 A;  5JRG D;  3W99 B;  5AVB B;  3AZG D;  3H0L C;  3B6G C;  4JJN C;  3WKJ B;  3REJ C;  4WU8 B;  3X1U A;  4J8X A;  4ZBJ C;  3AZE D;  2VQR A;  3AZF D;  1KX5 B;  1EQZ B;  2FJ7 D;  1M1A D;  2ARO B;  5B40 C;  1ZLA A;  2NQB D;  2RVQ C;  5B33 C;  1N1J B;  3AZL C;  3AV2 D;  3B0D C;  4KUD D;  5GSU B;  4LD9 C;  4WV4 B;  3B6G A;  1P3K B;  3VH6 T;  3REH C;  3REJ A;  4XZQ C;  4KHA B;  3O62 D;  5B1L D;  1H3O A;  3WTP C;  3LZ0 B;  4WJ3 C;  1M18 D;  5B40 A;  2W8S A;  3AFA B;  5B2J D;  5CP6 B;  3KWQ D;  3W98 D;  4XUJ D;  4DQY B;  3W97 B;  3EPH A;  5B33 A;  3AZL A;  1P3P C;  4YS3 D;  1P3M D;  1KX4 D;  3UT9 C;  4LD9 A;  5JRG C;  3REL B;  3X1S D;  3REH A;  4G91 C;  4XZQ A;  3X1T D;  1M19 D;  4NE6 A;  5AVC D;  4G92 C;  3AZG C;  2Y2O A;  5AY8 B;  4J8V D;  3WTP A;  3MGS B;  3MGR D;  5GXQ B;  1B6W A;  3AZE C;  2YFW B;  3NQJ A;  3AZF C;  2FJ7 C;  4J8U B;  3B6F B;  4YM6 B;  5DNN D;  1M1A C;  2Y2P A;  3AYW B;  1P3P A;  3UT9 A;  5JRG A;  2NQB C;  3AV2 C;  4KUD C;  3B0B A;  5AV5 B;  3AZG A;  1P3L D;  5CPJ C;  1F66 B;  3O62 C;  3AZE A;  3F6T A;  5B1L C;  3AZF A;  4Z66 B;  2FJ7 A;  3UTA D;  3WTP E;  1M1A A;  1M18 C;  3NQU B;  3A6N D;  2ZY4 A;  5B2J C;  3KWQ C;  2ZY5 A;  4XUJ C;  3W98 C;  3TU4 D;  2NQB A;  3C1B B;  3AV2 A;  1KX4 C;  4YS3 C;  1P3M C;  3X1V B;  4KUD A;  5BO0 A;  4WU9 B;  1T3U A;  3X1S C;  1ULY A;  3MVD D;  5CPJ A;  3R45 A;  3X1T C;  3LJA B;  1M19 C;  5AV9 D;  5BNV B;  2DQN C;  5AVC C;  3O62 A;  5B1L A;  4J8V C;  4AWL B;  3A1I A;  2XD1 A;  3AZM D;  5B0Z B;  3MGR C;  1P3O D;  1M18 A;  5B31 G;  4ZUX D;  3LEL B;  5B31 D;  1KX3 D;  3WAA B;  1KU5 A;  5B2J A;  3KWQ A;  3W98 A;  4XUJ A;  5DNN C;  2Y2K A;  1S32 D;  5AV8 B;  2DF4 C;  4H9N A;  3REI D;  4YS3 A;  1BH8 B;  1P3M A;  1KX4 A;  3X1S A;  1PZR A;  3X1T A;  1M19 A;  5AVC A;  4H9R B;  1B67 A;  3IP4 C;  1P3L C;  4J8X D;  4J8V A;  3W96 D;  3AN2 B;  3MGR A;  5GT3 D;  4H9S C;  3AZH B;  3AV1 B;  5DNN A;  3LZ1 B;  3UTA C;  3A6N C;  2F8N H;  2BYK A;  3TU4 C;  4JJN D;  4NFT A;  1P3B B;  5JA4 A;  1P3L A;  3MVD C;  1U35 B;  1ID3 B;  2F8N K;  5AV9 C;  4X23 C;  3UTB D;  2ZY2 A;  5BT1 D;  4H9Q A;  4H9S A;  3KXB B;  3AZM C;  3REK B;  2HIO B;  3UTA A;  1P3O C;  4EO5 B;  3A6N A;  2FFF B;  4ZUX C;  5B31 C;  1P3I B;  2RVQ D;  1KX3 C;  3MNN C;  1TZY D;  5AV6 B;  2NZD D;  3TU4 A;  3MGQ B;  5KDM A;  3REI C;  4XZQ D;  1AOI D;  3MVD A;  2Y2L A;  5AV9 A;  4X23 A;  4WU8 D;  4WNN A;  2Y2H A;  3W96 C;  5C3I C;  3AZM A;  1P3O A;  1KX5 D;  3VH6 W;  5GT3 C;  4ZUX A;  3MGP D;  5B31 A;  1KX3 A;  4QLC B;  3MNN A;  2J8P A;  4E44 A;  3P5J B;  5B32 B;  4KGC C;  3REI A;  3AZK D;  3B6G B;  3REJ B;  3VH6 A;  3AZI B;  3W96 A;  1BH9 B;  1W2E A;  4ZBJ B;  3UTB C;  4CAY A;  5BT1 C;  5GT3 A;  5B40 B;  3W97 D;  3AZJ D;  5FUG A;  4Z5T B;  1TZY C;  3AZL B;  2NZD C;  4LD9 B;  4JJN A;  5CPJ D;  2ZY3 A;  1AOI C;  3WKJ C;  3UTB A;  3MGS D;  4H9O B;  5GXQ D;  4WU8 C;  2PYO B;  1KX5 C;  3NQJ B;  1TAF A;  3MGP C;  3B6F D;  5CPK B;  4Z2M G;  3AYW D;  1TZY A;  2NZD A;  3V9R A;  1R4V A;  4R8P B;  3AZK C;  3C1C B;  1AOI A;  3VH5 T;  1P3K C;  3WKJ A;  2Y2M A;  4WU8 A;  1KX5 A;  3AZE B;  3MGP A;  1P3A D;  1M1A B;  5CP6 C;  3W97 C;  3AZJ C;  1N1J A;  3AZK A;  1P3F D;  2L5A A;  4KUD B;  5BO0 B;  3EG5 B;  3R45 B;  3O62 B;  2F8N G;  2CV5 D;  5AY8 C;  2F8N D;  3MGS C;  5GXQ C;  1WWI A;  1M18 B;  4UPK A;  3LEL D;  3WAA D;  2F2A C;  5CP6 A;  5B2J B;  3B6F C;  3W98 B;  3W97 A;  5BS7 C;  4XUJ B;  3AZJ A;  3AYW C;  5AV8 D;  3WA9 D;  5B2I D;  4YS3 B;  1P3M B;  5B1M D;  4Z2M H;  5GT0 B;  4X23 D;  3X1T B;  2YFV A;  1M19 B;  5AVC B;  4E45 A;  3KFU G;  3MGS A;  4J8V B;  5DNM B;  5GXQ A;  1HTA A;  2Y2G A;  4CSR A;  3MGR B;  3KUY D;  1F66 C;  3AZH D;  3MNN D;  3AV1 D;  3B6F A;  5BS7 A;  3LZ1 D;  2IO5 B;  1P3A C;  3AYW A;  5CPI D;  4DRA A;  5BNX A;  2BYK B;  1P3F C;  5F99 B;  1P3L B;  5G49 A;  3LJA C; 
#chains in the Genus database with same CATH homology
 1P34 D;  1F66 A;  1Z2C B;  4H9Q B;  2CV5 C;  4AWL C;  2HIO D;  4H9P B;  3EPL A;  1P3A A;  4KGC D;  3LEL C;  3WAA C;  3A6N B;  1P3I D;  3AZN B;  2UWX A;  1WWS A;  1HQ3 D;  3MGQ D;  3TU4 B;  5AV8 C;  1P3G D;  5B2I C;  1P3F A;  5B0Y D;  3WA9 C;  5B24 D;  5B1M C;  4J8W D;  5E5A D;  3MVD B;  3LJA A;  2CV5 A;  2F8N A;  4WNN B;  3AZM B;  1P3O B;  4UUZ A;  3KUY C;  4HGA C;  3LEL A;  3WAA A;  3AZH C;  5B31 B;  1KX3 B;  4QLC D;  3AV1 C;  4NE3 A;  3LZ1 C;  5B32 G;  1S32 B;  2HUE B;  5CPI C;  3A1K A;  3W99 D;  5AV8 A;  5B2I A;  3WA9 A;  3REI B;  3FDD A;  5B1M A;  5AVB D;  1JFI A;  3WKJ D;  1P3B C;  3X1U B;  4J8X B;  3AZI D;  1U35 C;  5C3I B;  1ID3 C;  1EQZ D;  1P34 C;  3W96 B;  3KUY A;  2ARO D;  3AZH A;  3KXB C;  3AV1 A;  1ZLA B;  3KSY A;  1Q9C A;  2HIO C;  3LZ1 A;  4EO5 C;  2RIQ A;  5CPI A;  1P3I C;  4Z5T D;  5GSU D;  1HQ3 C;  2BYM A;  3MGQ C;  1P3K D;  1P3G C;  4JJN B;  5B0Y C;  1P3B A;  5B24 C;  4J8W C;  1U35 A;  5E5A C;  1H3O B;  3LZ0 D;  1P34 A;  3UTB B;  3KXB A;  2XD5 A;  3B0C T;  2PYO D;  3VH5 W;  3AFA D;  2HIO A;  5CP6 D;  1TAF B;  4KGC A;  1P3I A;  4QLC C;  5B33 B;  2G5H C;  1HQ3 A;  3B0D B;  3REL D;  3MGQ A;  5B32 C;  3W99 C;  3V9R B;  1P3G A;  3REH B;  5B0Y A;  4XZQ B;  4R8P D;  5B24 A;  5AVB C;  3C1C D;  4J8W A;  1AOI B;  5E5A A;  5AY8 D;  3WTP B;  3VH5 A;  3AZI C;  1EQZ C;  4J8U D;  3AL0 C;  4YM6 D;  2ARO C;  3MGP B;  4QLC A;  2JE5 A;  1P3P B;  3UT9 B;  5JRG B;  5B32 A;  3W99 A;  4G91 B;  4Z5T C;  5GSU C;  5AVB A;  3AZK B;  5AV5 D;  4G92 B;  2ZM5 A;  3AZG B;  1F66 D;  3AZI A;  4Z66 D;  1BH9 A;  3AZF B;  1EQZ A;  3LZ0 C;  2FJ7 B;  2ARO A;  4NE5 A;  2PYO C;  1F1E A;  3AFA C;  5CPK C;  3C1B D;  2NQB B;  3AZJ B;  4Z5T A;  2JCH A;  3AV2 B;  5GSU A;  3X1V D;  4WU9 D;  3REL C;  1P3K A;  5GT0 D;  3LJA D;  5CPJ B;  4R8P C;  4KHA A;  3C1C C;  2YFV B;  5B1L B;  3LZ0 A;  2CWE A;  5B0Z D;  3EPK A;  4H9O A;  5DNM D;  2PYO A;  4CSR B;  3AFA A;  2G5I C;  3KWQ B;  4J8U C;  4YM6 C;  3EPJ A;  5CPK A;  4H9N B;  1KX4 B;  3REL A;  5BNX B;  3X1S B;  4R8P A;  3C1C A;  5AV5 C;  1A7W A;  5F99 D;  5AY8 A;  2JSS A;  3AN2 D;  5G49 B;  2YFW A;  4Z66 C;  4J8U A;  4YM6 A;  5DNN B;  1P3A B;  3AZN D;  3C1B C;  1P3B D;  2Y2N A;  3X1V C;  1P3F B;  4WU9 C;  5AV5 A;  5JA4 B;  1U35 D;  1ID3 D;  5GT0 C;  3KXB D;  4Z66 A;  4DRB A;  3REK D;  5B0Z C;  2CV5 B;  2F8N B;  5DNM C;  3NQU A;  3UTA B;  2Y2J A;  4UUZ B;  5AV6 D;  2IO5 C;  5CHL B;  3C1B A;  5KDM B;  3X1V A;  3WA9 B;  5B2I B;  4WU9 A;  5B1M B;  5GT0 A;  1JFI B;  5BNV A;  5AV9 B;  4X23 B;  5F99 C;  3X1U D;  3AN2 C;  5B0Z A;  5DNM A;  4ZUX B;  3KUY B;  2LY8 A;  4HGA B;  3MNN B;  1ZLA D;  4WZS B;  5B32 D;  3H0M C;  1BH8 A;  3AZN C;  5CPI B;  3B0C W;  4M6B A;  2BYM B;  3B6G D;  4H9R A;  3REJ D;  5F99 A;  3AN2 A;  4CAY B;  1P34 B;  5GT3 B;  5B40 D;  3REK C;  4H9P A;  4KGC B;  3AZN A;  5FUG B;  5B33 D;  5AV6 C;  3AZL D;  4LD9 D;  1HQ3 B;  1S32 C;  2HUE C;  2BG1 A;  1BFM A;  3REH D;  1P3G B;  5B0Y B;  5B24 B;  1ID3 A;  4J8W B;  5E5A B;  3H0R C;  3WTP D;  3X1U C;  4J8X C;  3REK A;  2Y2I A;  5CPK D;  1ZLA C;  1TZY B;  5AV6 A;  2Y2Q A;  1P3P D;  2NZD B;  3UT9 D;  1S32 A;  5JRG D;  3W99 B;  5AVB B;  3AZG D;  3H0L C;  3B6G C;  4JJN C;  3WKJ B;  3REJ C;  4WU8 B;  3X1U A;  4J8X A;  4ZBJ C;  3AZE D;  2VQR A;  3AZF D;  1KX5 B;  1EQZ B;  2FJ7 D;  1M1A D;  2ARO B;  5B40 C;  1ZLA A;  2NQB D;  2RVQ C;  5B33 C;  1N1J B;  3AZL C;  3AV2 D;  3B0D C;  4KUD D;  5GSU B;  4LD9 C;  4WV4 B;  3B6G A;  1P3K B;  3VH6 T;  3REH C;  3REJ A;  4XZQ C;  4KHA B;  3O62 D;  5B1L D;  1H3O A;  3WTP C;  3LZ0 B;  4WJ3 C;  1M18 D;  5B40 A;  2W8S A;  3AFA B;  5B2J D;  5CP6 B;  3KWQ D;  3W98 D;  4XUJ D;  4DQY B;  3W97 B;  3EPH A;  5B33 A;  3AZL A;  1P3P C;  4YS3 D;  1P3M D;  1KX4 D;  3UT9 C;  4LD9 A;  5JRG C;  3REL B;  3X1S D;  3REH A;  4G91 C;  4XZQ A;  3X1T D;  1M19 D;  4NE6 A;  5AVC D;  4G92 C;  3AZG C;  2Y2O A;  5AY8 B;  4J8V D;  3WTP A;  3MGS B;  3MGR D;  5GXQ B;  1B6W A;  3AZE C;  2YFW B;  3NQJ A;  3AZF C;  2FJ7 C;  4J8U B;  3B6F B;  4YM6 B;  5DNN D;  1M1A C;  2Y2P A;  3AYW B;  1P3P A;  3UT9 A;  5JRG A;  2NQB C;  3AV2 C;  4KUD C;  3B0B A;  5AV5 B;  3AZG A;  1P3L D;  5CPJ C;  1F66 B;  3O62 C;  3AZE A;  3F6T A;  5B1L C;  3AZF A;  4Z66 B;  2FJ7 A;  3UTA D;  3WTP E;  1M1A A;  1M18 C;  3NQU B;  3A6N D;  2ZY4 A;  5B2J C;  3KWQ C;  2ZY5 A;  4XUJ C;  3W98 C;  3TU4 D;  2NQB A;  3C1B B;  3AV2 A;  1KX4 C;  4YS3 C;  1P3M C;  3X1V B;  4KUD A;  5BO0 A;  4WU9 B;  1T3U A;  3X1S C;  1ULY A;  3MVD D;  5CPJ A;  3R45 A;  3X1T C;  3LJA B;  1M19 C;  5AV9 D;  5BNV B;  2DQN C;  5AVC C;  3O62 A;  5B1L A;  4J8V C;  4AWL B;  3A1I A;  2XD1 A;  3AZM D;  5B0Z B;  3MGR C;  1P3O D;  1M18 A;  5B31 G;  4ZUX D;  3LEL B;  5B31 D;  1KX3 D;  3WAA B;  1KU5 A;  5B2J A;  3KWQ A;  3W98 A;  4XUJ A;  5DNN C;  2Y2K A;  1S32 D;  5AV8 B;  2DF4 C;  4H9N A;  3REI D;  4YS3 A;  1BH8 B;  1P3M A;  1KX4 A;  3X1S A;  1PZR A;  3X1T A;  1M19 A;  5AVC A;  4H9R B;  1B67 A;  3IP4 C;  1P3L C;  4J8X D;  4J8V A;  3W96 D;  3AN2 B;  3MGR A;  5GT3 D;  4H9S C;  3AZH B;  3AV1 B;  5DNN A;  3LZ1 B;  3UTA C;  3A6N C;  2F8N H;  2BYK A;  3TU4 C;  4JJN D;  4NFT A;  1P3B B;  5JA4 A;  1P3L A;  3MVD C;  1U35 B;  1ID3 B;  2F8N K;  5AV9 C;  4X23 C;  3UTB D;  2ZY2 A;  5BT1 D;  4H9Q A;  4H9S A;  3KXB B;  3AZM C;  3REK B;  2HIO B;  3UTA A;  1P3O C;  4EO5 B;  3A6N A;  2FFF B;  4ZUX C;  5B31 C;  1P3I B;  2RVQ D;  1KX3 C;  3MNN C;  1TZY D;  5AV6 B;  2NZD D;  3TU4 A;  3MGQ B;  5KDM A;  3REI C;  4XZQ D;  1AOI D;  3MVD A;  2Y2L A;  5AV9 A;  4X23 A;  4WU8 D;  4WNN A;  2Y2H A;  3W96 C;  5C3I C;  3AZM A;  1P3O A;  1KX5 D;  3VH6 W;  5GT3 C;  4ZUX A;  3MGP D;  5B31 A;  1KX3 A;  4QLC B;  3MNN A;  2J8P A;  4E44 A;  3P5J B;  5B32 B;  4KGC C;  3REI A;  3AZK D;  3B6G B;  3REJ B;  3VH6 A;  3AZI B;  3W96 A;  1BH9 B;  1W2E A;  4ZBJ B;  3UTB C;  4CAY A;  5BT1 C;  5GT3 A;  5B40 B;  3W97 D;  3AZJ D;  5FUG A;  4Z5T B;  1TZY C;  3AZL B;  2NZD C;  4LD9 B;  4JJN A;  5CPJ D;  2ZY3 A;  1AOI C;  3WKJ C;  3UTB A;  3MGS D;  4H9O B;  5GXQ D;  4WU8 C;  2PYO B;  1KX5 C;  3NQJ B;  1TAF A;  3MGP C;  3B6F D;  5CPK B;  4Z2M G;  3AYW D;  1TZY A;  2NZD A;  3V9R A;  1R4V A;  4R8P B;  3AZK C;  3C1C B;  1AOI A;  3VH5 T;  1P3K C;  3WKJ A;  2Y2M A;  4WU8 A;  1KX5 A;  3AZE B;  3MGP A;  1P3A D;  1M1A B;  5CP6 C;  3W97 C;  3AZJ C;  1N1J A;  3AZK A;  1P3F D;  2L5A A;  4KUD B;  5BO0 B;  3EG5 B;  3R45 B;  3O62 B;  2F8N G;  2CV5 D;  5AY8 C;  2F8N D;  3MGS C;  5GXQ C;  1WWI A;  1M18 B;  4UPK A;  3LEL D;  3WAA D;  2F2A C;  5CP6 A;  5B2J B;  3B6F C;  3W98 B;  3W97 A;  5BS7 C;  4XUJ B;  3AZJ A;  3AYW C;  5AV8 D;  3WA9 D;  5B2I D;  4YS3 B;  1P3M B;  5B1M D;  4Z2M H;  5GT0 B;  4X23 D;  3X1T B;  2YFV A;  1M19 B;  5AVC B;  4E45 A;  3KFU G;  3MGS A;  4J8V B;  5DNM B;  5GXQ A;  1HTA A;  2Y2G A;  4CSR A;  3MGR B;  3KUY D;  1F66 C;  3AZH D;  3MNN D;  3AV1 D;  3B6F A;  5BS7 A;  3LZ1 D;  2IO5 B;  1P3A C;  3AYW A;  5CPI D;  4DRA A;  5BNX A;  2BYK B;  1P3F C;  5F99 B;  1P3L B;  5G49 A;  3LJA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...