3O62B

Nucleosome core particle modified with a cisplatin 1,3-cis-{pt(nh3)2}2+-d(gptpg) intrastrand cross-link
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
b'RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Consequences of Cisplatin binding on nucleosome structure and dynamics.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 24
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3o62B00
3UTBC 2NQBA 4KUDC 3REJD 2BYMB 5GSUB 3KWQB 1M1AB 1B67A 4HGAC 2BYMA 5GSUA 5B33D 3KWQA 3WAAC 1P3OC 2YFWA 1M1AA 2F8ND 2JSSA 5AV9B 3UT9D 5BT1D 3TU4D 3AZHC 4YS3B 5AV9A 3REKC 1ZLAC 5E5AC 3MGPD 4M6BA 1ID3B 4YS3A 1P3MC 5B1MB 5GT3B 1P3BD 3W97B 1TZYC 4H9SA 3AZID 4CSRB 5B1MA 5GT3A 4H9RB 3MVDB 1WWIA 3W97A 4WU9D 1P3FC 2PYOB 2RVQD 3MGRB 3W96C 4CSRA 4H9RA 3MVDA 2PYOA 3MGRA 3LZ0D 4DRBA 3UTBB 4KUDB 5B24B 4J8VD 3RELC 2NZDD 3UTBA 4KUDA 3MGSB 4HGAB 3B6FC 3AFAD 3C1BD 1P3OB 3WAAB 1EQZB 3MGSA 5B32G 5AVCD 3AN2C 1U35D 1P3OA 3WAAA 5CP6C 2F8NH 3AZHB 1F66C 4XZQB 1R4VA 5CPJD 1ZLAB 5E5AB 3O62B 3AZHA 3X1TD 4XZQA 5GXQC 3AV1D 1ZLAA 5E5AA 5F99C 3O62A 2LY8A 1KX4D 1P3FB 1TZYA 3W99C 5B2ID 3WA9C 3W96B 1P3FA 1P3ID 3W96A 3AZMD 1H3OB 4X23C 4LD9C 5AY8D 5AVBD 5B0YC 3REHC 4WU8C 3RELB 4G91C 1H3OA 3AZLC 1P3AB 3B6GD 3RELA 3UTAB 5BS7C 4KGCD 4DRAA 3AN2B 1P3AA 3LZ1D 1KU5A 3B0CW 3AZJC 5DNMC 5B40D 2YFVB 5CP6B 3X1VD 3WKJB 5B32D 3AN2A 1P3KD 5JRGC 1KX5C 1BH8B 2HUEB 5CP6A 5AV8D 3X1UD 2AROC 5GXQB 1JFIA 5GXQA 5CPID 3W99B 3C1CC 3WA9B 3W98C 3W99A 3WA9A 5AV6D 1M18D 4JJNC 4LD9B 4E45A 4X23B 5B1LD 3MGQC 4WU8B 5B0YB 3REHB 4Z66C 1P34D 4G91B 4X23A 4LD9A 4WU8A 5B0YA 3REHA 4ZUXD 5B31C 3AZLA 2HIOB 1ID3C 3B0BA 5B0ZB 4R8PB 3AZEC 5C3IC 5DNMB 5GT0D 5B0ZA 4WNNB 5JRGB 4R8PA 4J8XB 5DNMA 5B33C 3A6NB 4WNNA 5JRGA 4J8XA 2NQBD 5DNNB 2AROA 2BYKB 5DNNA 5B24C 3C1CB 4YM6D 3W98B 3KWQD 5AV5D 3MGSC 1M1AD 3C1CA 1P3BC 3W98A 4JJNB 1EQZC 4J8WD 3MGQB 3KXBD 3LJAD 5AV9D 4JJNA 4Z66B 4Z5TC 3MGQA 4XZQC 3AV2D 5CPKC 1P3LB 5B31B 4Z66A 3LZ0C 3NQUB 3O62C 2FJ7D 3X1SD 5JA4B 5B1MD 3AZKD 5GT3D 5B31A 3W97D 3AZEB 3NQUA 5C3IB 1ID3A 5JA4A 3AYWC 1M19D 3AZEA 4QLCD 5B33B 2IO5B 1P3GD 1KX3C 3VH5A 5AVCC 5B33A 1U35C 3UT9B 3TU4B 3UTBD 5CPJC 3UT9A 3MGPB 3TU4A 1ULYA 5B24A 1P3AC 1P3BB 3AV1C 4AWLC 3MGPA 3UTAC 1P3OD 1P3BA 3KSYA 4NE5A 1HQ3D 5B2IC 1EQZA 3WKJC 3REIC 4Z5TB 3AZHD 5CPKB 4J8UC 2HUEC 3REKD 3LZ0B 4WV4B 5E5AD 1ZLAD 4Z5TA 1P3MD 5CPKA 1TZYD 5AVBC 3LZ0A 4J8VB 2NZDB 4Z2MG 3AZFC 3AYWB 1P3FD 3AZGD 5BNXB 3C1BB 2NZDA 1S32C 1KX3B 3AYWA 5AVCB 3KUYC 1U35B 3MNND 5BNXA 3C1BA 1KX3A 3LELC 3VH6T 3X1VC 5AVCA 1AOID 5B32C 1U35A 5CPJB 3VH6W 3RELD 4KHAB 3X1TB 5CPJA 4H9OB 3AV1B 5B2JD 3WTPC 4AWLB 3B6FD 3B0CT 2HIOC 4KHAA 3X1TA 4H9OA 5B0ZC 3AN2D 4R8PC 3AV1A 5B2IB 3UTAA 5CP6D 3REIB 2CV5C 4J8XC 1F66D 5B2IA 4J8UB 2YFVA 1M18C 3A6NC 3WKJA 3REIA 4XUJD 1HTAA 1BH8A 3AZMB 4J8UA 5DNNC 5AY8B 5AVBB 5F99D 5FUGB 3AZMA 3AZFB 5AY8A 5AVBA 3B6GB 4H9QB 5FUGA 1WWSA 1S32B 3AZFA 5KDMB 3KUYB 3B6GA 4H9QA 3LZ1B 1S32A 5B40B 3LELB 3X1VB 3KUYA 5GT0C 5B32B 4LD9D 4X23D 3LZ1A 3REHD 5B0YD 5B40A 5B31G 3LELA 3X1VA 4NE3A 4ZBJC 5B32A 1F1EA 3AZLD 3AZND 1P3LC 3WTPB 5CPIB 1BFMA 3WTPA 3REJC 3AZJD 2HIOA 1P3PD 4YM6C 5AV5C 2CV5B 5JRGD 1KX5D 5AV6B 2IO5C 1M18B 2CV5A 2AROD 1M18A 3A6NA 3LJAC 3UT9C 3V9RB 5BT1C 3TU4C 4ZUXB 3AV2C 5GSUD 3V9RA 3MGPC 3W98D 2BYKA 3AZKC 2F8NK 3AZIC 4Z2MH 5GT0B 4WU9C 3MGQD 4QLCC 2RVQC 3NQJB 5GT0A 4ZBJB 4Z66D 5BO0B 4YS3D 4G92C 5B31D 5BO0A 1ID3D 1P3LA 3REJB 3AZED 4J8VC 1N1JB 4YM6B 2NZDC 5AV5B 3MVDD 3REJA 2YFWB 2PYOD 1N1JA 3MGRD 5BNVB 4YM6A 3AFAC 3C1BC 5AV5A 2F8NB 4J8WB 3KXBB 5BNVA 1HQ3C 3LJAB 2F8NA 4J8WA 4KUDD 3KXBA 5B24D 3LJAA 3AV2B 2CWEA 4E44A 3X1TC 3X1SB 3MGSD 3AV2A 3AZKB 2FJ7B 3WTPE 3WAAD 3AZIB 1EQZD 3X1SA 1KX4C 2FJ7A 3AZKA 4WU9B 1M19B 4QLCB 4H9NB 3AZGC 3AZIA 1P3GB 4WU9A 4Z5TD 1P3IC 4XZQD 4G92B 1M19A 4QLCA 4H9NA 5CPKD 3MNNC 1P3GA 3O62D 4UUZB 1AOIC 3AZMC 5AY8C 5G49B 4UUZA 3AYWD 4J8VA 3B6GC 5G49A 5B2JC 3AFAB 3W96D 4KGCC 1KX3D 3LZ1C 1HQ3B 3AFAA 5B40C 1P3KC 1HQ3A 3REKB 5AV8C 4NFTA 3X1UC 4WZSB 4XUJC 1P3MB 1P3AD 4NE6A 1TZYB 4EO5C 3REKA 3UTAD 1P3MA 1KX4B 5CPIC 3AZGB 1KX4A 3WKJD 3REID 1P3IB 3AZGA 4J8UD 5AV6C 3MNNB 3B0DC 1P3IA 1AOIB 5GXQD 5B1LC 3MNNA 1P34C 1AOIA 3AZFD 3AZNC 3W99D 4ZUXC 3WA9D 5B2JB 3B6FB 4KGCB 1S32D 3KUYD 5B2JA 1B6WA 3B6FA 4KGCA 2L5AA 1P3PC 5KDMA 3LELD 1P3KB 4WU8D 1F66B 5AV8B 1BH9B 3X1UB 1JFIB 4XUJB 1P3KA 1F66A 2NQBC 4EO5B 5AV8A 1BH9A 3X1UA 3WTPD 4XUJA 2HIOD 5F99B 5B0ZD 3VH5T 5CHLB 4R8PD 5DNMD 5F99A 5GSUC 1A7WA 3KWQC 5CPIA 3VH5W 2CV5D 4J8XD 2F8NG 1M1AC 4H9PB 3A6ND 3B0DB 4H9PA 4J8WC 5B1LB 5AV6A 5DNND 3KXBC 5AV9C 1P34B 5B1LA 3AZLB 3AZNB 4YS3C 3C1CD 3VH6A 1P34A 4H9SC 3AZNA 3X1SC 2FJ7C 4ZUXA 5B1MC 1TAFB 5GT3C 1Q9CA 3W97C 3R45B 3AZJB 4CAYB 5BS7A 4JJND 1P3PB 1TAFA 3MVDC 1M19C 3R45A 2PYOC 3AZJA 4CAYA 1P3PA 3MGRC 1KX5B 1P3GC 2AROB 1P3LD 1KX5A 2NQBB 3NQJA
chains in the Genus database with same CATH superfamily
3F6TA 3UTBC 2NQBA 4KUDC 3REJD 3IP4C 2BYMB 5GSUB 3KWQB 1M1AB 2JCHA 1B67A 4HGAC 2BYMA 5GSUA 5B33D 3KWQA 3WAAC 1P3OC 2YFWA 1M1AA 2F8ND 2JE5A 2JSSA 5AV9B 3UT9D 3H0MC 5BT1D 3TU4D 3AZHC 4YS3B 5AV9A 3REKC 1ZLAC 5E5AC 3MGPD 4M6BA 1ID3B 4YS3A 1P3MC 5B1MB 5GT3B 1P3BD 3W97B 1TZYC 4H9SA 3AZID 4CSRB 5B1MA 5GT3A 4H9RB 3A1KA 3MVDB 1WWIA 3W97A 4WU9D 1P3FC 2PYOB 2RVQD 3MGRB 3W96C 4CSRA 4H9RA 3MVDA 2PYOA 3MGRA 3LZ0D 4DRBA 3UTBB 4KUDB 2Y2GA 5B24B 2Y2MA 4J8VD 3RELC 2NZDD 3UTBA 4KUDA 3MGSB 4HGAB 3B6FC 3AFAD 3C1BD 1P3OB 3WAAB 1EQZB 3MGSA 5B32G 5AVCD 3AN2C 1U35D 1P3OA 3WAAA 5CP6C 2F8NH 3AZHB 1F66C 4XZQB 1R4VA 5CPJD 1ZLAB 5E5AB 3O62B 3AZHA 3X1TD 4XZQA 5GXQC 3AV1D 1ZLAA 5E5AA 5F99C 3O62A 2LY8A 1KX4D 1P3FB 1TZYA 3W99C 5B2ID 3WA9C 3W96B 2Y2NA 1P3FA 1P3ID 3W96A 3AZMD 1H3OB 4X23C 4LD9C 5AY8D 5AVBD 5B0YC 3REHC 4WU8C 3RELB 1W2EA 1H3OA 4G91C 3AZLC 1P3AB 3B6GD 2XD1A 3RELA 3UTAB 5BS7C 4KGCD 4DRAA 3AN2B 1P3AA 2ZM5A 3LZ1D 1KU5A 3B0CW 3AZJC 5DNMC 5B40D 2YFVB 5CP6B 3X1VD 3WKJB 5B32D 3AN2A 1P3KD 5JRGC 1KX5C 1BH8B 2ZY2A 2HUEB 5CP6A 5AV8D 3X1UD 2AROC 5GXQB 2F2AC 1JFIA 5GXQA 5CPID 3W99B 3C1CC 3WA9B 3W98C 3W99A 3WA9A 5AV6D 1M18D 4JJNC 4LD9B 4E45A 4X23B 5B1LD 3MGQC 4WU8B 5B0YB 3REHB 2UWXA 4Z66C 1P34D 4G91B 4X23A 4LD9A 4WU8A 5B0YA 3REHA 4ZUXD 5B31C 3AZLA 2HIOB 1ID3C 3B0BA 5B0ZB 4R8PB 3AZEC 5C3IC 5DNMB 5GT0D 5B0ZA 4WNNB 5JRGB 4R8PA 4J8XB 5DNMA 5B33C 3A6NB 4WNNA 5JRGA 4J8XA 2NQBD 5DNNB 2AROA 2BYKB 5DNNA 5B24C 3C1CB 4YM6D 3W98B 3KWQD 5AV5D 3MGSC 1M1AD 3C1CA 1P3BC 2Y2JA 3W98A 4JJNB 1EQZC 4J8WD 3MGQB 3KXBD 3LJAD 5AV9D 4JJNA 4Z66B 4Z5TC 3MGQA 4XZQC 3AV2D 5CPKC 1P3LB 5B31B 4Z66A 3LZ0C 3NQUB 3O62C 2W8SA 3X1SD 5JA4B 2FJ7D 5B1MD 3AZKD 5GT3D 5B31A 3W97D 3AZEB 3NQUA 2Y2QA 5C3IB 1ID3A 5JA4A 3AYWC 1M19D 3AZEA 4QLCD 2Y2HA 5B33B 2IO5B 1P3GD 1KX3C 3VH5A 5AVCC 5B33A 1U35C 3UT9B 3TU4B 3UTBD 5CPJC 3UT9A 1Z2CB 3MGPB 3TU4A 1ULYA 5B24A 1PZRA 1P3AC 1P3BB 3AV1C 4AWLC 3MGPA 3UTAC 1P3OD 1P3BA 3KSYA 4NE5A 1HQ3D 5B2IC 1EQZA 3WKJC 3REIC 4Z5TB 3AZHD 5CPKB 4J8UC 2HUEC 2XD5A 3LZ0B 4WV4B 5E5AD 3REKD 1ZLAD 2Y2KA 4Z5TA 1P3MD 5CPKA 1TZYD 5AVBC 3LZ0A 4J8VB 2NZDB 4Z2MG 3AZFC 3AYWB 1P3FD 4DQYB 3AZGD 5BNXB 3C1BB 2NZDA 1S32C 1KX3B 3AYWA 5AVCB 3KUYC 1U35B 3MNND 5BNXA 3C1BA 1KX3A 3LELC 3VH6T 3X1VC 5AVCA 1AOID 5B32C 1U35A 2RIQA 5CPJB 3VH6W 3RELD 4KHAB 3X1TB 5CPJA 4H9OB 3AV1B 5B2JD 3WTPC 4AWLB 3B6FD 3B0CT 2HIOC 4KHAA 3X1TA 4H9OA 5B0ZC 3AN2D 4R8PC 3AV1A 5B2IB 3UTAA 5CP6D 3REIB 2G5IC 4J8XC 2CV5C 1F66D 5B2IA 4J8UB 2YFVA 1M18C 3A6NC 3WKJA 3REIA 4XUJD 1HTAA 1BH8A 3AZMB 4J8UA 5DNNC 5AY8B 5AVBB 3KFUG 2ZY3A 5F99D 5FUGB 3AZMA 3AZFB 5AY8A 5AVBA 3B6GB 4H9QB 5FUGA 1WWSA 1S32B 3AZFA 5KDMB 3KUYB 3B6GA 4H9QA 3LZ1B 1S32A 5B40B 3LELB 3X1VB 3KUYA 5GT0C 5B32B 4LD9D 4X23D 3LZ1A 3REHD 5B0YD 5B40A 2Y2PA 5B31G 3LELA 3X1VA 4NE3A 4ZBJC 5B32A 1F1EA 3AZLD 3AZND 1P3LC 3WTPB 5CPIB 1BFMA 3WTPA 3REJC 3AZJD 2HIOA 1P3PD 4YM6C 5AV5C 2CV5B 5JRGD 1KX5D 5AV6B 2IO5C 1M18B 2CV5A 2AROD 2Y2IA 1M18A 3A6NA 3LJAC 3UT9C 3V9RB 3EPJA 5BT1C 3TU4C 3EG5B 4ZUXB 3AV2C 5GSUD 3V9RA 2ZY5A 3MGPC 3W98D 2BYKA 3H0LC 4UPKA 3AZKC 2F8NK 3AZIC 4Z2MH 5GT0B 4WU9C 3MGQD 4QLCC 2RVQC 3NQJB 5GT0A 4ZBJB 4Z66D 5BO0B 4YS3D 4G92C 5B31D 5BO0A 1ID3D 1P3LA 3REJB 3AZED 4J8VC 1N1JB 4YM6B 2NZDC 5AV5B 3MVDD 3REJA 2YFWB 2PYOD 1N1JA 3MGRD 5BNVB 4YM6A 3AFAC 3C1BC 5AV5A 2VQRA 2F8NB 2DF4C 4J8WB 3KXBB 5BNVA 1HQ3C 3LJAB 2F8NA 4J8WA 4KUDD 3EPLA 3KXBA 5B24D 3LJAA 3AV2B 2CWEA 4E44A 3X1TC 3X1SB 3MGSD 3AV2A 3AZKB 3EPKA 2FJ7B 3WTPE 3WAAD 2DQNC 3AZIB 1EQZD 3X1SA 1KX4C 2FJ7A 3AZKA 4WU9B 1M19B 4QLCB 4H9NB 3AZGC 3AZIA 1P3GB 4WU9A 4Z5TD 1P3IC 4XZQD 4G92B 1M19A 4QLCA 4H9NA 5CPKD 3MNNC 1P3GA 3O62D 4UUZB 1AOIC 3AZMC 5AY8C 5G49B 4UUZA 2ZY4A 3AYWD 4J8VA 3B6GC 5G49A 5B2JC 3AFAB 3W96D 4KGCC 3H0RC 1KX3D 3LZ1C 1HQ3B 3AFAA 5B40C 1P3KC 1HQ3A 3REKB 5AV8C 4NFTA 3X1UC 4WJ3C 4WZSB 4XUJC 1P3MB 1P3AD 4NE6A 1T3UA 1TZYB 4EO5C 3REKA 3UTAD 3P5JB 1P3MA 1KX4B 5CPIC 3AZGB 1KX4A 3WKJD 3REID 1P3IB 3AZGA 4J8UD 5AV6C 3MNNB 3AL0C 3B0DC 1P3IA 1AOIB 5GXQD 5B1LC 3MNNA 1P34C 1AOIA 3A1IA 3AZFD 3AZNC 3W99D 4ZUXC 3WA9D 5B2JB 2G5HC 2BG1A 3B6FB 4KGCB 2Y2OA 1S32D 3KUYD 5B2JA 1B6WA 3B6FA 4KGCA 2L5AA 1P3PC 5KDMA 3LELD 3FDDA 1P3KB 4WU8D 1F66B 5AV8B 1BH9B 3X1UB 2FFFB 4XUJB 1P3KA 1JFIB 1F66A 2NQBC 4EO5B 5AV8A 1BH9A 3X1UA 3WTPD 4XUJA 2HIOD 5F99B 3EPHA 5B0ZD 3VH5T 5CHLB 4R8PD 5DNMD 5F99A 5GSUC 1A7WA 3KWQC 5CPIA 3VH5W 2CV5D 4J8XD 2F8NG 1M1AC 4H9PB 3A6ND 3B0DB 4H9PA 4J8WC 5B1LB 5AV6A 5DNND 3KXBC 5AV9C 1P34B 5B1LA 3AZLB 3AZNB 4YS3C 3C1CD 3VH6A 1P34A 4H9SC 3AZNA 3X1SC 2FJ7C 4ZUXA 5B1MC 1TAFB 5GT3C 1Q9CA 3W97C 3R45B 2J8PA 4CAYB 5BS7A 4JJND 3AZJB 1P3PB 1TAFA 3MVDC 2Y2LA 1M19C 3R45A 2PYOC 3AZJA 4CAYA 1P3PA 3MGRC 1KX5B 1P3GC 2AROB 1P3LD 1KX5A 2NQBB 3NQJA
chains in the Genus database with same CATH topology
3F6TA 3UTBC 2NQBA 4KUDC 3REJD 3IP4C 2BYMB 5GSUB 3KWQB 1M1AB 2JCHA 1B67A 4HGAC 2BYMA 5GSUA 5B33D 3KWQA 3WAAC 1P3OC 2YFWA 1M1AA 2F8ND 2JE5A 2JSSA 5AV9B 3UT9D 3H0MC 5BT1D 3TU4D 3AZHC 4YS3B 5AV9A 3REKC 1ZLAC 5E5AC 3MGPD 4M6BA 1ID3B 4YS3A 1P3MC 5B1MB 5GT3B 1P3BD 3W97B 1TZYC 4H9SA 3AZID 4CSRB 5B1MA 5GT3A 4H9RB 3A1KA 3MVDB 1WWIA 3W97A 4WU9D 1P3FC 2PYOB 2RVQD 3MGRB 3W96C 4CSRA 4H9RA 3MVDA 2PYOA 3MGRA 3LZ0D 4DRBA 3UTBB 4KUDB 2Y2GA 5B24B 2Y2MA 4J8VD 3RELC 2NZDD 3UTBA 4KUDA 3MGSB 4HGAB 3B6FC 3AFAD 3C1BD 1P3OB 3WAAB 1EQZB 3MGSA 5B32G 5AVCD 3AN2C 1U35D 1P3OA 3WAAA 5CP6C 2F8NH 3AZHB 1F66C 4XZQB 1R4VA 5CPJD 1ZLAB 5E5AB 3O62B 3AZHA 3X1TD 4XZQA 5GXQC 3AV1D 1ZLAA 5E5AA 5F99C 3O62A 2LY8A 1KX4D 1P3FB 1TZYA 3W99C 5B2ID 3WA9C 3W96B 2Y2NA 1P3FA 1P3ID 3W96A 3AZMD 1H3OB 4X23C 4LD9C 5AY8D 5AVBD 5B0YC 3REHC 4WU8C 3RELB 1W2EA 1H3OA 4G91C 3AZLC 1P3AB 3B6GD 2XD1A 3RELA 3UTAB 5BS7C 4KGCD 4DRAA 3AN2B 1P3AA 2ZM5A 3LZ1D 1KU5A 3B0CW 3AZJC 5DNMC 5B40D 2YFVB 5CP6B 3X1VD 3WKJB 5B32D 3AN2A 1P3KD 5JRGC 1KX5C 1BH8B 2ZY2A 2HUEB 5CP6A 5AV8D 3X1UD 2AROC 5GXQB 2F2AC 1JFIA 5GXQA 5CPID 3W99B 3C1CC 3WA9B 3W98C 3W99A 3WA9A 5AV6D 1M18D 4JJNC 4LD9B 4E45A 4X23B 5B1LD 3MGQC 4WU8B 5B0YB 3REHB 2UWXA 4Z66C 1P34D 4G91B 4X23A 4LD9A 4WU8A 5B0YA 3REHA 4ZUXD 5B31C 3AZLA 2HIOB 1ID3C 3B0BA 5B0ZB 4R8PB 3AZEC 5C3IC 5DNMB 5GT0D 5B0ZA 4WNNB 5JRGB 4R8PA 4J8XB 5DNMA 5B33C 3A6NB 4WNNA 5JRGA 4J8XA 2NQBD 5DNNB 2AROA 2BYKB 5DNNA 5B24C 3C1CB 4YM6D 3W98B 3KWQD 5AV5D 3MGSC 1M1AD 3C1CA 1P3BC 2Y2JA 3W98A 4JJNB 1EQZC 4J8WD 3MGQB 3KXBD 3LJAD 5AV9D 4JJNA 4Z66B 4Z5TC 3MGQA 4XZQC 3AV2D 5CPKC 1P3LB 5B31B 4Z66A 3LZ0C 3NQUB 3O62C 2W8SA 3X1SD 5JA4B 2FJ7D 5B1MD 3AZKD 5GT3D 5B31A 3W97D 3AZEB 3NQUA 2Y2QA 5C3IB 1ID3A 5JA4A 3AYWC 1M19D 3AZEA 4QLCD 2Y2HA 5B33B 2IO5B 1P3GD 1KX3C 3VH5A 5AVCC 5B33A 1U35C 3UT9B 3TU4B 3UTBD 5CPJC 3UT9A 1Z2CB 3MGPB 3TU4A 1ULYA 5B24A 1PZRA 1P3AC 1P3BB 3AV1C 4AWLC 3MGPA 3UTAC 1P3OD 1P3BA 3KSYA 4NE5A 1HQ3D 5B2IC 1EQZA 3WKJC 3REIC 4Z5TB 3AZHD 5CPKB 4J8UC 2HUEC 2XD5A 3LZ0B 4WV4B 5E5AD 3REKD 1ZLAD 2Y2KA 4Z5TA 1P3MD 5CPKA 1TZYD 5AVBC 3LZ0A 4J8VB 2NZDB 4Z2MG 3AZFC 3AYWB 1P3FD 4DQYB 3AZGD 5BNXB 3C1BB 2NZDA 1S32C 1KX3B 3AYWA 5AVCB 3KUYC 1U35B 3MNND 5BNXA 3C1BA 1KX3A 3LELC 3VH6T 3X1VC 5AVCA 1AOID 5B32C 1U35A 2RIQA 5CPJB 3VH6W 3RELD 4KHAB 3X1TB 5CPJA 4H9OB 3AV1B 5B2JD 3WTPC 4AWLB 3B6FD 3B0CT 2HIOC 4KHAA 3X1TA 4H9OA 5B0ZC 3AN2D 4R8PC 3AV1A 5B2IB 3UTAA 5CP6D 3REIB 2G5IC 4J8XC 2CV5C 1F66D 5B2IA 4J8UB 2YFVA 1M18C 3A6NC 3WKJA 3REIA 4XUJD 1HTAA 1BH8A 3AZMB 4J8UA 5DNNC 5AY8B 5AVBB 3KFUG 2ZY3A 5F99D 5FUGB 3AZMA 3AZFB 5AY8A 5AVBA 3B6GB 4H9QB 5FUGA 1WWSA 1S32B 3AZFA 5KDMB 3KUYB 3B6GA 4H9QA 3LZ1B 1S32A 5B40B 3LELB 3X1VB 3KUYA 5GT0C 5B32B 4LD9D 4X23D 3LZ1A 3REHD 5B0YD 5B40A 2Y2PA 5B31G 3LELA 3X1VA 4NE3A 4ZBJC 5B32A 1F1EA 3AZLD 3AZND 1P3LC 3WTPB 5CPIB 1BFMA 3WTPA 3REJC 3AZJD 2HIOA 1P3PD 4YM6C 5AV5C 2CV5B 5JRGD 1KX5D 5AV6B 2IO5C 1M18B 2CV5A 2AROD 2Y2IA 1M18A 3A6NA 3LJAC 3UT9C 3V9RB 3EPJA 5BT1C 3TU4C 3EG5B 4ZUXB 3AV2C 5GSUD 3V9RA 2ZY5A 3MGPC 3W98D 2BYKA 3H0LC 4UPKA 3AZKC 2F8NK 3AZIC 4Z2MH 5GT0B 4WU9C 3MGQD 4QLCC 2RVQC 3NQJB 5GT0A 4ZBJB 4Z66D 5BO0B 4YS3D 4G92C 5B31D 5BO0A 1ID3D 1P3LA 3REJB 3AZED 4J8VC 1N1JB 4YM6B 2NZDC 5AV5B 3MVDD 3REJA 2YFWB 2PYOD 1N1JA 3MGRD 5BNVB 4YM6A 3AFAC 3C1BC 5AV5A 2VQRA 2F8NB 2DF4C 4J8WB 3KXBB 5BNVA 1HQ3C 3LJAB 2F8NA 4J8WA 4KUDD 3EPLA 3KXBA 5B24D 3LJAA 3AV2B 2CWEA 4E44A 3X1TC 3X1SB 3MGSD 3AV2A 3AZKB 3EPKA 2FJ7B 3WTPE 3WAAD 2DQNC 3AZIB 1EQZD 3X1SA 1KX4C 2FJ7A 3AZKA 4WU9B 1M19B 4QLCB 4H9NB 3AZGC 3AZIA 1P3GB 4WU9A 4Z5TD 1P3IC 4XZQD 4G92B 1M19A 4QLCA 4H9NA 5CPKD 3MNNC 1P3GA 3O62D 4UUZB 1AOIC 3AZMC 5AY8C 5G49B 4UUZA 2ZY4A 3AYWD 4J8VA 3B6GC 5G49A 5B2JC 3AFAB 3W96D 4KGCC 3H0RC 1KX3D 3LZ1C 1HQ3B 3AFAA 5B40C 1P3KC 1HQ3A 3REKB 5AV8C 4NFTA 3X1UC 4WJ3C 4WZSB 4XUJC 1P3MB 1P3AD 4NE6A 1T3UA 1TZYB 4EO5C 3REKA 3UTAD 3P5JB 1P3MA 1KX4B 5CPIC 3AZGB 1KX4A 3WKJD 3REID 1P3IB 3AZGA 4J8UD 5AV6C 3MNNB 3AL0C 3B0DC 1P3IA 1AOIB 5GXQD 5B1LC 3MNNA 1P34C 1AOIA 3A1IA 3AZFD 3AZNC 3W99D 4ZUXC 3WA9D 5B2JB 2G5HC 2BG1A 3B6FB 4KGCB 2Y2OA 1S32D 3KUYD 5B2JA 1B6WA 3B6FA 4KGCA 2L5AA 1P3PC 5KDMA 3LELD 3FDDA 1P3KB 4WU8D 1F66B 5AV8B 1BH9B 3X1UB 2FFFB 4XUJB 1P3KA 1JFIB 1F66A 2NQBC 4EO5B 5AV8A 1BH9A 3X1UA 3WTPD 4XUJA 2HIOD 5F99B 3EPHA 5B0ZD 3VH5T 5CHLB 4R8PD 5DNMD 5F99A 5GSUC 1A7WA 3KWQC 5CPIA 3VH5W 2CV5D 4J8XD 2F8NG 1M1AC 4H9PB 3A6ND 3B0DB 4H9PA 4J8WC 5B1LB 5AV6A 5DNND 3KXBC 5AV9C 1P34B 5B1LA 3AZLB 3AZNB 4YS3C 3C1CD 3VH6A 1P34A 4H9SC 3AZNA 3X1SC 2FJ7C 4ZUXA 5B1MC 1TAFB 5GT3C 1Q9CA 3W97C 3R45B 2J8PA 4CAYB 5BS7A 4JJND 3AZJB 1P3PB 1TAFA 3MVDC 2Y2LA 1M19C 3R45A 2PYOC 3AZJA 4CAYA 1P3PA 3MGRC 1KX5B 1P3GC 2AROB 1P3LD 1KX5A 2NQBB 3NQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB C;  2NQB A;  4KUD C;  3REJ D;  2BYM B;  5GSU B;  3KWQ B;  1M1A B;  1B67 A;  4HGA C;  2BYM A;  5GSU A;  5B33 D;  3KWQ A;  3WAA C;  1P3O C;  2YFW A;  1M1A A;  2F8N D;  2JSS A;  5AV9 B;  3UT9 D;  5BT1 D;  3TU4 D;  3AZH C;  4YS3 B;  5AV9 A;  3REK C;  1ZLA C;  5E5A C;  3MGP D;  4M6B A;  1ID3 B;  4YS3 A;  1P3M C;  5B1M B;  5GT3 B;  1P3B D;  3W97 B;  1TZY C;  4H9S A;  3AZI D;  4CSR B;  5B1M A;  5GT3 A;  4H9R B;  3MVD B;  1WWI A;  3W97 A;  4WU9 D;  1P3F C;  2PYO B;  2RVQ D;  3MGR B;  3W96 C;  4CSR A;  4H9R A;  3MVD A;  2PYO A;  3MGR A;  3LZ0 D;  4DRB A;  3UTB B;  4KUD B;  5B24 B;  4J8V D;  3REL C;  2NZD D;  3UTB A;  4KUD A;  3MGS B;  4HGA B;  3B6F C;  3AFA D;  3C1B D;  1P3O B;  3WAA B;  1EQZ B;  3MGS A;  5B32 G;  5AVC D;  3AN2 C;  1U35 D;  1P3O A;  3WAA A;  5CP6 C;  2F8N H;  3AZH B;  1F66 C;  4XZQ B;  1R4V A;  5CPJ D;  1ZLA B;  5E5A B;  3O62 B;  3AZH A;  3X1T D;  4XZQ A;  5GXQ C;  3AV1 D;  1ZLA A;  5E5A A;  5F99 C;  3O62 A;  2LY8 A;  1KX4 D;  1P3F B;  1TZY A;  3W99 C;  5B2I D;  3WA9 C;  3W96 B;  1P3F A;  1P3I D;  3W96 A;  3AZM D;  1H3O B;  4X23 C;  4LD9 C;  5AY8 D;  5AVB D;  5B0Y C;  3REH C;  4WU8 C;  3REL B;  4G91 C;  1H3O A;  3AZL C;  1P3A B;  3B6G D;  3REL A;  3UTA B;  5BS7 C;  4KGC D;  4DRA A;  3AN2 B;  1P3A A;  3LZ1 D;  1KU5 A;  3B0C W;  3AZJ C;  5DNM C;  5B40 D;  2YFV B;  5CP6 B;  3X1V D;  3WKJ B;  5B32 D;  3AN2 A;  1P3K D;  5JRG C;  1KX5 C;  1BH8 B;  2HUE B;  5CP6 A;  5AV8 D;  3X1U D;  2ARO C;  5GXQ B;  1JFI A;  5GXQ A;  5CPI D;  3W99 B;  3C1C C;  3WA9 B;  3W98 C;  3W99 A;  3WA9 A;  5AV6 D;  1M18 D;  4JJN C;  4LD9 B;  4E45 A;  4X23 B;  5B1L D;  3MGQ C;  4WU8 B;  5B0Y B;  3REH B;  4Z66 C;  1P34 D;  4G91 B;  4X23 A;  4LD9 A;  4WU8 A;  5B0Y A;  3REH A;  4ZUX D;  5B31 C;  3AZL A;  2HIO B;  1ID3 C;  3B0B A;  5B0Z B;  4R8P B;  3AZE C;  5C3I C;  5DNM B;  5GT0 D;  5B0Z A;  4WNN B;  5JRG B;  4R8P A;  4J8X B;  5DNM A;  5B33 C;  3A6N B;  4WNN A;  5JRG A;  4J8X A;  2NQB D;  5DNN B;  2ARO A;  2BYK B;  5DNN A;  5B24 C;  3C1C B;  4YM6 D;  3W98 B;  3KWQ D;  5AV5 D;  3MGS C;  1M1A D;  3C1C A;  1P3B C;  3W98 A;  4JJN B;  1EQZ C;  4J8W D;  3MGQ B;  3KXB D;  3LJA D;  5AV9 D;  4JJN A;  4Z66 B;  4Z5T C;  3MGQ A;  4XZQ C;  3AV2 D;  5CPK C;  1P3L B;  5B31 B;  4Z66 A;  3LZ0 C;  3NQU B;  3O62 C;  2FJ7 D;  3X1S D;  5JA4 B;  5B1M D;  3AZK D;  5GT3 D;  5B31 A;  3W97 D;  3AZE B;  3NQU A;  5C3I B;  1ID3 A;  5JA4 A;  3AYW C;  1M19 D;  3AZE A;  4QLC D;  5B33 B;  2IO5 B;  1P3G D;  1KX3 C;  3VH5 A;  5AVC C;  5B33 A;  1U35 C;  3UT9 B;  3TU4 B;  3UTB D;  5CPJ C;  3UT9 A;  3MGP B;  3TU4 A;  1ULY A;  5B24 A;  1P3A C;  1P3B B;  3AV1 C;  4AWL C;  3MGP A;  3UTA C;  1P3O D;  1P3B A;  3KSY A;  4NE5 A;  1HQ3 D;  5B2I C;  1EQZ A;  3WKJ C;  3REI C;  4Z5T B;  3AZH D;  5CPK B;  4J8U C;  2HUE C;  3REK D;  3LZ0 B;  4WV4 B;  5E5A D;  1ZLA D;  4Z5T A;  1P3M D;  5CPK A;  1TZY D;  5AVB C;  3LZ0 A;  4J8V B;  2NZD B;  4Z2M G;  3AZF C;  3AYW B;  1P3F D;  3AZG D;  5BNX B;  3C1B B;  2NZD A;  1S32 C;  1KX3 B;  3AYW A;  5AVC B;  3KUY C;  1U35 B;  3MNN D;  5BNX A;  3C1B A;  1KX3 A;  3LEL C;  3VH6 T;  3X1V C;  5AVC A;  1AOI D;  5B32 C;  1U35 A;  5CPJ B;  3VH6 W;  3REL D;  4KHA B;  3X1T B;  5CPJ A;  4H9O B;  3AV1 B;  5B2J D;  3WTP C;  4AWL B;  3B6F D;  3B0C T;  2HIO C;  4KHA A;  3X1T A;  4H9O A;  5B0Z C;  3AN2 D;  4R8P C;  3AV1 A;  5B2I B;  3UTA A;  5CP6 D;  3REI B;  2CV5 C;  4J8X C;  1F66 D;  5B2I A;  4J8U B;  2YFV A;  1M18 C;  3A6N C;  3WKJ A;  3REI A;  4XUJ D;  1HTA A;  1BH8 A;  3AZM B;  4J8U A;  5DNN C;  5AY8 B;  5AVB B;  5F99 D;  5FUG B;  3AZM A;  3AZF B;  5AY8 A;  5AVB A;  3B6G B;  4H9Q B;  5FUG A;  1WWS A;  1S32 B;  3AZF A;  5KDM B;  3KUY B;  3B6G A;  4H9Q A;  3LZ1 B;  1S32 A;  5B40 B;  3LEL B;  3X1V B;  3KUY A;  5GT0 C;  5B32 B;  4LD9 D;  4X23 D;  3LZ1 A;  3REH D;  5B0Y D;  5B40 A;  5B31 G;  3LEL A;  3X1V A;  4NE3 A;  4ZBJ C;  5B32 A;  1F1E A;  3AZL D;  3AZN D;  1P3L C;  3WTP B;  5CPI B;  1BFM A;  3WTP A;  3REJ C;  3AZJ D;  2HIO A;  1P3P D;  4YM6 C;  5AV5 C;  2CV5 B;  5JRG D;  1KX5 D;  5AV6 B;  2IO5 C;  1M18 B;  2CV5 A;  2ARO D;  1M18 A;  3A6N A;  3LJA C;  3UT9 C;  3V9R B;  5BT1 C;  3TU4 C;  4ZUX B;  3AV2 C;  5GSU D;  3V9R A;  3MGP C;  3W98 D;  2BYK A;  3AZK C;  2F8N K;  3AZI C;  4Z2M H;  5GT0 B;  4WU9 C;  3MGQ D;  4QLC C;  2RVQ C;  3NQJ B;  5GT0 A;  4ZBJ B;  4Z66 D;  5BO0 B;  4YS3 D;  4G92 C;  5B31 D;  5BO0 A;  1ID3 D;  1P3L A;  3REJ B;  3AZE D;  4J8V C;  1N1J B;  4YM6 B;  2NZD C;  5AV5 B;  3MVD D;  3REJ A;  2YFW B;  2PYO D;  1N1J A;  3MGR D;  5BNV B;  4YM6 A;  3AFA C;  3C1B C;  5AV5 A;  2F8N B;  4J8W B;  3KXB B;  5BNV A;  1HQ3 C;  3LJA B;  2F8N A;  4J8W A;  4KUD D;  3KXB A;  5B24 D;  3LJA A;  3AV2 B;  2CWE A;  4E44 A;  3X1T C;  3X1S B;  3MGS D;  3AV2 A;  3AZK B;  2FJ7 B;  3WTP E;  3WAA D;  3AZI B;  1EQZ D;  3X1S A;  1KX4 C;  2FJ7 A;  3AZK A;  4WU9 B;  1M19 B;  4QLC B;  4H9N B;  3AZG C;  3AZI A;  1P3G B;  4WU9 A;  4Z5T D;  1P3I C;  4XZQ D;  4G92 B;  1M19 A;  4QLC A;  4H9N A;  5CPK D;  3MNN C;  1P3G A;  3O62 D;  4UUZ B;  1AOI C;  3AZM C;  5AY8 C;  5G49 B;  4UUZ A;  3AYW D;  4J8V A;  3B6G C;  5G49 A;  5B2J C;  3AFA B;  3W96 D;  4KGC C;  1KX3 D;  3LZ1 C;  1HQ3 B;  3AFA A;  5B40 C;  1P3K C;  1HQ3 A;  3REK B;  5AV8 C;  4NFT A;  3X1U C;  4WZS B;  4XUJ C;  1P3M B;  1P3A D;  4NE6 A;  1TZY B;  4EO5 C;  3REK A;  3UTA D;  1P3M A;  1KX4 B;  5CPI C;  3AZG B;  1KX4 A;  3WKJ D;  3REI D;  1P3I B;  3AZG A;  4J8U D;  5AV6 C;  3MNN B;  3B0D C;  1P3I A;  1AOI B;  5GXQ D;  5B1L C;  3MNN A;  1P34 C;  1AOI A;  3AZF D;  3AZN C;  3W99 D;  4ZUX C;  3WA9 D;  5B2J B;  3B6F B;  4KGC B;  1S32 D;  3KUY D;  5B2J A;  1B6W A;  3B6F A;  4KGC A;  2L5A A;  1P3P C;  5KDM A;  3LEL D;  1P3K B;  4WU8 D;  1F66 B;  5AV8 B;  1BH9 B;  3X1U B;  1JFI B;  4XUJ B;  1P3K A;  1F66 A;  2NQB C;  4EO5 B;  5AV8 A;  1BH9 A;  3X1U A;  3WTP D;  4XUJ A;  2HIO D;  5F99 B;  5B0Z D;  3VH5 T;  5CHL B;  4R8P D;  5DNM D;  5F99 A;  5GSU C;  1A7W A;  3KWQ C;  5CPI A;  3VH5 W;  2CV5 D;  4J8X D;  2F8N G;  1M1A C;  4H9P B;  3A6N D;  3B0D B;  4H9P A;  4J8W C;  5B1L B;  5AV6 A;  5DNN D;  3KXB C;  5AV9 C;  1P34 B;  5B1L A;  3AZL B;  3AZN B;  4YS3 C;  3C1C D;  3VH6 A;  1P34 A;  4H9S C;  3AZN A;  3X1S C;  2FJ7 C;  4ZUX A;  5B1M C;  1TAF B;  5GT3 C;  1Q9C A;  3W97 C;  3R45 B;  3AZJ B;  4CAY B;  5BS7 A;  4JJN D;  1P3P B;  1TAF A;  3MVD C;  1M19 C;  3R45 A;  2PYO C;  3AZJ A;  4CAY A;  1P3P A;  3MGR C;  1KX5 B;  1P3G C;  2ARO B;  1P3L D;  1KX5 A;  2NQB B;  3NQJ A; 
#chains in the Genus database with same CATH topology
 3F6T A;  3UTB C;  2NQB A;  4KUD C;  3REJ D;  3IP4 C;  2BYM B;  5GSU B;  3KWQ B;  1M1A B;  2JCH A;  1B67 A;  4HGA C;  2BYM A;  5GSU A;  5B33 D;  3KWQ A;  3WAA C;  1P3O C;  2YFW A;  1M1A A;  2F8N D;  2JE5 A;  2JSS A;  5AV9 B;  3UT9 D;  3H0M C;  5BT1 D;  3TU4 D;  3AZH C;  4YS3 B;  5AV9 A;  3REK C;  1ZLA C;  5E5A C;  3MGP D;  4M6B A;  1ID3 B;  4YS3 A;  1P3M C;  5B1M B;  5GT3 B;  1P3B D;  3W97 B;  1TZY C;  4H9S A;  3AZI D;  4CSR B;  5B1M A;  5GT3 A;  4H9R B;  3A1K A;  3MVD B;  1WWI A;  3W97 A;  4WU9 D;  1P3F C;  2PYO B;  2RVQ D;  3MGR B;  3W96 C;  4CSR A;  4H9R A;  3MVD A;  2PYO A;  3MGR A;  3LZ0 D;  4DRB A;  3UTB B;  4KUD B;  2Y2G A;  5B24 B;  2Y2M A;  4J8V D;  3REL C;  2NZD D;  3UTB A;  4KUD A;  3MGS B;  4HGA B;  3B6F C;  3AFA D;  3C1B D;  1P3O B;  3WAA B;  1EQZ B;  3MGS A;  5B32 G;  5AVC D;  3AN2 C;  1U35 D;  1P3O A;  3WAA A;  5CP6 C;  2F8N H;  3AZH B;  1F66 C;  4XZQ B;  1R4V A;  5CPJ D;  1ZLA B;  5E5A B;  3O62 B;  3AZH A;  3X1T D;  4XZQ A;  5GXQ C;  3AV1 D;  1ZLA A;  5E5A A;  5F99 C;  3O62 A;  2LY8 A;  1KX4 D;  1P3F B;  1TZY A;  3W99 C;  5B2I D;  3WA9 C;  3W96 B;  2Y2N A;  1P3F A;  1P3I D;  3W96 A;  3AZM D;  1H3O B;  4X23 C;  4LD9 C;  5AY8 D;  5AVB D;  5B0Y C;  3REH C;  4WU8 C;  3REL B;  1W2E A;  1H3O A;  4G91 C;  3AZL C;  1P3A B;  3B6G D;  2XD1 A;  3REL A;  3UTA B;  5BS7 C;  4KGC D;  4DRA A;  3AN2 B;  1P3A A;  2ZM5 A;  3LZ1 D;  1KU5 A;  3B0C W;  3AZJ C;  5DNM C;  5B40 D;  2YFV B;  5CP6 B;  3X1V D;  3WKJ B;  5B32 D;  3AN2 A;  1P3K D;  5JRG C;  1KX5 C;  1BH8 B;  2ZY2 A;  2HUE B;  5CP6 A;  5AV8 D;  3X1U D;  2ARO C;  5GXQ B;  2F2A C;  1JFI A;  5GXQ A;  5CPI D;  3W99 B;  3C1C C;  3WA9 B;  3W98 C;  3W99 A;  3WA9 A;  5AV6 D;  1M18 D;  4JJN C;  4LD9 B;  4E45 A;  4X23 B;  5B1L D;  3MGQ C;  4WU8 B;  5B0Y B;  3REH B;  2UWX A;  4Z66 C;  1P34 D;  4G91 B;  4X23 A;  4LD9 A;  4WU8 A;  5B0Y A;  3REH A;  4ZUX D;  5B31 C;  3AZL A;  2HIO B;  1ID3 C;  3B0B A;  5B0Z B;  4R8P B;  3AZE C;  5C3I C;  5DNM B;  5GT0 D;  5B0Z A;  4WNN B;  5JRG B;  4R8P A;  4J8X B;  5DNM A;  5B33 C;  3A6N B;  4WNN A;  5JRG A;  4J8X A;  2NQB D;  5DNN B;  2ARO A;  2BYK B;  5DNN A;  5B24 C;  3C1C B;  4YM6 D;  3W98 B;  3KWQ D;  5AV5 D;  3MGS C;  1M1A D;  3C1C A;  1P3B C;  2Y2J A;  3W98 A;  4JJN B;  1EQZ C;  4J8W D;  3MGQ B;  3KXB D;  3LJA D;  5AV9 D;  4JJN A;  4Z66 B;  4Z5T C;  3MGQ A;  4XZQ C;  3AV2 D;  5CPK C;  1P3L B;  5B31 B;  4Z66 A;  3LZ0 C;  3NQU B;  3O62 C;  2W8S A;  3X1S D;  5JA4 B;  2FJ7 D;  5B1M D;  3AZK D;  5GT3 D;  5B31 A;  3W97 D;  3AZE B;  3NQU A;  2Y2Q A;  5C3I B;  1ID3 A;  5JA4 A;  3AYW C;  1M19 D;  3AZE A;  4QLC D;  2Y2H A;  5B33 B;  2IO5 B;  1P3G D;  1KX3 C;  3VH5 A;  5AVC C;  5B33 A;  1U35 C;  3UT9 B;  3TU4 B;  3UTB D;  5CPJ C;  3UT9 A;  1Z2C B;  3MGP B;  3TU4 A;  1ULY A;  5B24 A;  1PZR A;  1P3A C;  1P3B B;  3AV1 C;  4AWL C;  3MGP A;  3UTA C;  1P3O D;  1P3B A;  3KSY A;  4NE5 A;  1HQ3 D;  5B2I C;  1EQZ A;  3WKJ C;  3REI C;  4Z5T B;  3AZH D;  5CPK B;  4J8U C;  2HUE C;  2XD5 A;  3LZ0 B;  4WV4 B;  5E5A D;  3REK D;  1ZLA D;  2Y2K A;  4Z5T A;  1P3M D;  5CPK A;  1TZY D;  5AVB C;  3LZ0 A;  4J8V B;  2NZD B;  4Z2M G;  3AZF C;  3AYW B;  1P3F D;  4DQY B;  3AZG D;  5BNX B;  3C1B B;  2NZD A;  1S32 C;  1KX3 B;  3AYW A;  5AVC B;  3KUY C;  1U35 B;  3MNN D;  5BNX A;  3C1B A;  1KX3 A;  3LEL C;  3VH6 T;  3X1V C;  5AVC A;  1AOI D;  5B32 C;  1U35 A;  2RIQ A;  5CPJ B;  3VH6 W;  3REL D;  4KHA B;  3X1T B;  5CPJ A;  4H9O B;  3AV1 B;  5B2J D;  3WTP C;  4AWL B;  3B6F D;  3B0C T;  2HIO C;  4KHA A;  3X1T A;  4H9O A;  5B0Z C;  3AN2 D;  4R8P C;  3AV1 A;  5B2I B;  3UTA A;  5CP6 D;  3REI B;  2G5I C;  4J8X C;  2CV5 C;  1F66 D;  5B2I A;  4J8U B;  2YFV A;  1M18 C;  3A6N C;  3WKJ A;  3REI A;  4XUJ D;  1HTA A;  1BH8 A;  3AZM B;  4J8U A;  5DNN C;  5AY8 B;  5AVB B;  3KFU G;  2ZY3 A;  5F99 D;  5FUG B;  3AZM A;  3AZF B;  5AY8 A;  5AVB A;  3B6G B;  4H9Q B;  5FUG A;  1WWS A;  1S32 B;  3AZF A;  5KDM B;  3KUY B;  3B6G A;  4H9Q A;  3LZ1 B;  1S32 A;  5B40 B;  3LEL B;  3X1V B;  3KUY A;  5GT0 C;  5B32 B;  4LD9 D;  4X23 D;  3LZ1 A;  3REH D;  5B0Y D;  5B40 A;  2Y2P A;  5B31 G;  3LEL A;  3X1V A;  4NE3 A;  4ZBJ C;  5B32 A;  1F1E A;  3AZL D;  3AZN D;  1P3L C;  3WTP B;  5CPI B;  1BFM A;  3WTP A;  3REJ C;  3AZJ D;  2HIO A;  1P3P D;  4YM6 C;  5AV5 C;  2CV5 B;  5JRG D;  1KX5 D;  5AV6 B;  2IO5 C;  1M18 B;  2CV5 A;  2ARO D;  2Y2I A;  1M18 A;  3A6N A;  3LJA C;  3UT9 C;  3V9R B;  3EPJ A;  5BT1 C;  3TU4 C;  3EG5 B;  4ZUX B;  3AV2 C;  5GSU D;  3V9R A;  2ZY5 A;  3MGP C;  3W98 D;  2BYK A;  3H0L C;  4UPK A;  3AZK C;  2F8N K;  3AZI C;  4Z2M H;  5GT0 B;  4WU9 C;  3MGQ D;  4QLC C;  2RVQ C;  3NQJ B;  5GT0 A;  4ZBJ B;  4Z66 D;  5BO0 B;  4YS3 D;  4G92 C;  5B31 D;  5BO0 A;  1ID3 D;  1P3L A;  3REJ B;  3AZE D;  4J8V C;  1N1J B;  4YM6 B;  2NZD C;  5AV5 B;  3MVD D;  3REJ A;  2YFW B;  2PYO D;  1N1J A;  3MGR D;  5BNV B;  4YM6 A;  3AFA C;  3C1B C;  5AV5 A;  2VQR A;  2F8N B;  2DF4 C;  4J8W B;  3KXB B;  5BNV A;  1HQ3 C;  3LJA B;  2F8N A;  4J8W A;  4KUD D;  3EPL A;  3KXB A;  5B24 D;  3LJA A;  3AV2 B;  2CWE A;  4E44 A;  3X1T C;  3X1S B;  3MGS D;  3AV2 A;  3AZK B;  3EPK A;  2FJ7 B;  3WTP E;  3WAA D;  2DQN C;  3AZI B;  1EQZ D;  3X1S A;  1KX4 C;  2FJ7 A;  3AZK A;  4WU9 B;  1M19 B;  4QLC B;  4H9N B;  3AZG C;  3AZI A;  1P3G B;  4WU9 A;  4Z5T D;  1P3I C;  4XZQ D;  4G92 B;  1M19 A;  4QLC A;  4H9N A;  5CPK D;  3MNN C;  1P3G A;  3O62 D;  4UUZ B;  1AOI C;  3AZM C;  5AY8 C;  5G49 B;  4UUZ A;  2ZY4 A;  3AYW D;  4J8V A;  3B6G C;  5G49 A;  5B2J C;  3AFA B;  3W96 D;  4KGC C;  3H0R C;  1KX3 D;  3LZ1 C;  1HQ3 B;  3AFA A;  5B40 C;  1P3K C;  1HQ3 A;  3REK B;  5AV8 C;  4NFT A;  3X1U C;  4WJ3 C;  4WZS B;  4XUJ C;  1P3M B;  1P3A D;  4NE6 A;  1T3U A;  1TZY B;  4EO5 C;  3REK A;  3UTA D;  3P5J B;  1P3M A;  1KX4 B;  5CPI C;  3AZG B;  1KX4 A;  3WKJ D;  3REI D;  1P3I B;  3AZG A;  4J8U D;  5AV6 C;  3MNN B;  3AL0 C;  3B0D C;  1P3I A;  1AOI B;  5GXQ D;  5B1L C;  3MNN A;  1P34 C;  1AOI A;  3A1I A;  3AZF D;  3AZN C;  3W99 D;  4ZUX C;  3WA9 D;  5B2J B;  2G5H C;  2BG1 A;  3B6F B;  4KGC B;  2Y2O A;  1S32 D;  3KUY D;  5B2J A;  1B6W A;  3B6F A;  4KGC A;  2L5A A;  1P3P C;  5KDM A;  3LEL D;  3FDD A;  1P3K B;  4WU8 D;  1F66 B;  5AV8 B;  1BH9 B;  3X1U B;  2FFF B;  4XUJ B;  1P3K A;  1JFI B;  1F66 A;  2NQB C;  4EO5 B;  5AV8 A;  1BH9 A;  3X1U A;  3WTP D;  4XUJ A;  2HIO D;  5F99 B;  3EPH A;  5B0Z D;  3VH5 T;  5CHL B;  4R8P D;  5DNM D;  5F99 A;  5GSU C;  1A7W A;  3KWQ C;  5CPI A;  3VH5 W;  2CV5 D;  4J8X D;  2F8N G;  1M1A C;  4H9P B;  3A6N D;  3B0D B;  4H9P A;  4J8W C;  5B1L B;  5AV6 A;  5DNN D;  3KXB C;  5AV9 C;  1P34 B;  5B1L A;  3AZL B;  3AZN B;  4YS3 C;  3C1C D;  3VH6 A;  1P34 A;  4H9S C;  3AZN A;  3X1S C;  2FJ7 C;  4ZUX A;  5B1M C;  1TAF B;  5GT3 C;  1Q9C A;  3W97 C;  3R45 B;  2J8P A;  4CAY B;  5BS7 A;  4JJN D;  3AZJ B;  1P3P B;  1TAF A;  3MVD C;  2Y2L A;  1M19 C;  3R45 A;  2PYO C;  3AZJ A;  4CAY A;  1P3P A;  3MGR C;  1KX5 B;  1P3G C;  2ARO B;  1P3L D;  1KX5 A;  2NQB B;  3NQJ A; 
#chains in the Genus database with same CATH homology
 3F6T A;  3UTB C;  2NQB A;  4KUD C;  3REJ D;  3IP4 C;  2BYM B;  5GSU B;  3KWQ B;  1M1A B;  2JCH A;  1B67 A;  4HGA C;  2BYM A;  5GSU A;  5B33 D;  3KWQ A;  3WAA C;  1P3O C;  2YFW A;  1M1A A;  2F8N D;  2JE5 A;  2JSS A;  5AV9 B;  3UT9 D;  3H0M C;  5BT1 D;  3TU4 D;  3AZH C;  4YS3 B;  5AV9 A;  3REK C;  1ZLA C;  5E5A C;  3MGP D;  4M6B A;  1ID3 B;  4YS3 A;  1P3M C;  5B1M B;  5GT3 B;  1P3B D;  3W97 B;  1TZY C;  4H9S A;  3AZI D;  4CSR B;  5B1M A;  5GT3 A;  4H9R B;  3A1K A;  3MVD B;  1WWI A;  3W97 A;  4WU9 D;  1P3F C;  2PYO B;  2RVQ D;  3MGR B;  3W96 C;  4CSR A;  4H9R A;  3MVD A;  2PYO A;  3MGR A;  3LZ0 D;  4DRB A;  3UTB B;  4KUD B;  2Y2G A;  5B24 B;  2Y2M A;  4J8V D;  3REL C;  2NZD D;  3UTB A;  4KUD A;  3MGS B;  4HGA B;  3B6F C;  3AFA D;  3C1B D;  1P3O B;  3WAA B;  1EQZ B;  3MGS A;  5B32 G;  5AVC D;  3AN2 C;  1U35 D;  1P3O A;  3WAA A;  5CP6 C;  2F8N H;  3AZH B;  1F66 C;  4XZQ B;  1R4V A;  5CPJ D;  1ZLA B;  5E5A B;  3O62 B;  3AZH A;  3X1T D;  4XZQ A;  5GXQ C;  3AV1 D;  1ZLA A;  5E5A A;  5F99 C;  3O62 A;  2LY8 A;  1KX4 D;  1P3F B;  1TZY A;  3W99 C;  5B2I D;  3WA9 C;  3W96 B;  2Y2N A;  1P3F A;  1P3I D;  3W96 A;  3AZM D;  1H3O B;  4X23 C;  4LD9 C;  5AY8 D;  5AVB D;  5B0Y C;  3REH C;  4WU8 C;  3REL B;  1W2E A;  1H3O A;  4G91 C;  3AZL C;  1P3A B;  3B6G D;  2XD1 A;  3REL A;  3UTA B;  5BS7 C;  4KGC D;  4DRA A;  3AN2 B;  1P3A A;  2ZM5 A;  3LZ1 D;  1KU5 A;  3B0C W;  3AZJ C;  5DNM C;  5B40 D;  2YFV B;  5CP6 B;  3X1V D;  3WKJ B;  5B32 D;  3AN2 A;  1P3K D;  5JRG C;  1KX5 C;  1BH8 B;  2ZY2 A;  2HUE B;  5CP6 A;  5AV8 D;  3X1U D;  2ARO C;  5GXQ B;  2F2A C;  1JFI A;  5GXQ A;  5CPI D;  3W99 B;  3C1C C;  3WA9 B;  3W98 C;  3W99 A;  3WA9 A;  5AV6 D;  1M18 D;  4JJN C;  4LD9 B;  4E45 A;  4X23 B;  5B1L D;  3MGQ C;  4WU8 B;  5B0Y B;  3REH B;  2UWX A;  4Z66 C;  1P34 D;  4G91 B;  4X23 A;  4LD9 A;  4WU8 A;  5B0Y A;  3REH A;  4ZUX D;  5B31 C;  3AZL A;  2HIO B;  1ID3 C;  3B0B A;  5B0Z B;  4R8P B;  3AZE C;  5C3I C;  5DNM B;  5GT0 D;  5B0Z A;  4WNN B;  5JRG B;  4R8P A;  4J8X B;  5DNM A;  5B33 C;  3A6N B;  4WNN A;  5JRG A;  4J8X A;  2NQB D;  5DNN B;  2ARO A;  2BYK B;  5DNN A;  5B24 C;  3C1C B;  4YM6 D;  3W98 B;  3KWQ D;  5AV5 D;  3MGS C;  1M1A D;  3C1C A;  1P3B C;  2Y2J A;  3W98 A;  4JJN B;  1EQZ C;  4J8W D;  3MGQ B;  3KXB D;  3LJA D;  5AV9 D;  4JJN A;  4Z66 B;  4Z5T C;  3MGQ A;  4XZQ C;  3AV2 D;  5CPK C;  1P3L B;  5B31 B;  4Z66 A;  3LZ0 C;  3NQU B;  3O62 C;  2W8S A;  3X1S D;  5JA4 B;  2FJ7 D;  5B1M D;  3AZK D;  5GT3 D;  5B31 A;  3W97 D;  3AZE B;  3NQU A;  2Y2Q A;  5C3I B;  1ID3 A;  5JA4 A;  3AYW C;  1M19 D;  3AZE A;  4QLC D;  2Y2H A;  5B33 B;  2IO5 B;  1P3G D;  1KX3 C;  3VH5 A;  5AVC C;  5B33 A;  1U35 C;  3UT9 B;  3TU4 B;  3UTB D;  5CPJ C;  3UT9 A;  1Z2C B;  3MGP B;  3TU4 A;  1ULY A;  5B24 A;  1PZR A;  1P3A C;  1P3B B;  3AV1 C;  4AWL C;  3MGP A;  3UTA C;  1P3O D;  1P3B A;  3KSY A;  4NE5 A;  1HQ3 D;  5B2I C;  1EQZ A;  3WKJ C;  3REI C;  4Z5T B;  3AZH D;  5CPK B;  4J8U C;  2HUE C;  2XD5 A;  3LZ0 B;  4WV4 B;  5E5A D;  3REK D;  1ZLA D;  2Y2K A;  4Z5T A;  1P3M D;  5CPK A;  1TZY D;  5AVB C;  3LZ0 A;  4J8V B;  2NZD B;  4Z2M G;  3AZF C;  3AYW B;  1P3F D;  4DQY B;  3AZG D;  5BNX B;  3C1B B;  2NZD A;  1S32 C;  1KX3 B;  3AYW A;  5AVC B;  3KUY C;  1U35 B;  3MNN D;  5BNX A;  3C1B A;  1KX3 A;  3LEL C;  3VH6 T;  3X1V C;  5AVC A;  1AOI D;  5B32 C;  1U35 A;  2RIQ A;  5CPJ B;  3VH6 W;  3REL D;  4KHA B;  3X1T B;  5CPJ A;  4H9O B;  3AV1 B;  5B2J D;  3WTP C;  4AWL B;  3B6F D;  3B0C T;  2HIO C;  4KHA A;  3X1T A;  4H9O A;  5B0Z C;  3AN2 D;  4R8P C;  3AV1 A;  5B2I B;  3UTA A;  5CP6 D;  3REI B;  2G5I C;  4J8X C;  2CV5 C;  1F66 D;  5B2I A;  4J8U B;  2YFV A;  1M18 C;  3A6N C;  3WKJ A;  3REI A;  4XUJ D;  1HTA A;  1BH8 A;  3AZM B;  4J8U A;  5DNN C;  5AY8 B;  5AVB B;  3KFU G;  2ZY3 A;  5F99 D;  5FUG B;  3AZM A;  3AZF B;  5AY8 A;  5AVB A;  3B6G B;  4H9Q B;  5FUG A;  1WWS A;  1S32 B;  3AZF A;  5KDM B;  3KUY B;  3B6G A;  4H9Q A;  3LZ1 B;  1S32 A;  5B40 B;  3LEL B;  3X1V B;  3KUY A;  5GT0 C;  5B32 B;  4LD9 D;  4X23 D;  3LZ1 A;  3REH D;  5B0Y D;  5B40 A;  2Y2P A;  5B31 G;  3LEL A;  3X1V A;  4NE3 A;  4ZBJ C;  5B32 A;  1F1E A;  3AZL D;  3AZN D;  1P3L C;  3WTP B;  5CPI B;  1BFM A;  3WTP A;  3REJ C;  3AZJ D;  2HIO A;  1P3P D;  4YM6 C;  5AV5 C;  2CV5 B;  5JRG D;  1KX5 D;  5AV6 B;  2IO5 C;  1M18 B;  2CV5 A;  2ARO D;  2Y2I A;  1M18 A;  3A6N A;  3LJA C;  3UT9 C;  3V9R B;  3EPJ A;  5BT1 C;  3TU4 C;  3EG5 B;  4ZUX B;  3AV2 C;  5GSU D;  3V9R A;  2ZY5 A;  3MGP C;  3W98 D;  2BYK A;  3H0L C;  4UPK A;  3AZK C;  2F8N K;  3AZI C;  4Z2M H;  5GT0 B;  4WU9 C;  3MGQ D;  4QLC C;  2RVQ C;  3NQJ B;  5GT0 A;  4ZBJ B;  4Z66 D;  5BO0 B;  4YS3 D;  4G92 C;  5B31 D;  5BO0 A;  1ID3 D;  1P3L A;  3REJ B;  3AZE D;  4J8V C;  1N1J B;  4YM6 B;  2NZD C;  5AV5 B;  3MVD D;  3REJ A;  2YFW B;  2PYO D;  1N1J A;  3MGR D;  5BNV B;  4YM6 A;  3AFA C;  3C1B C;  5AV5 A;  2VQR A;  2F8N B;  2DF4 C;  4J8W B;  3KXB B;  5BNV A;  1HQ3 C;  3LJA B;  2F8N A;  4J8W A;  4KUD D;  3EPL A;  3KXB A;  5B24 D;  3LJA A;  3AV2 B;  2CWE A;  4E44 A;  3X1T C;  3X1S B;  3MGS D;  3AV2 A;  3AZK B;  3EPK A;  2FJ7 B;  3WTP E;  3WAA D;  2DQN C;  3AZI B;  1EQZ D;  3X1S A;  1KX4 C;  2FJ7 A;  3AZK A;  4WU9 B;  1M19 B;  4QLC B;  4H9N B;  3AZG C;  3AZI A;  1P3G B;  4WU9 A;  4Z5T D;  1P3I C;  4XZQ D;  4G92 B;  1M19 A;  4QLC A;  4H9N A;  5CPK D;  3MNN C;  1P3G A;  3O62 D;  4UUZ B;  1AOI C;  3AZM C;  5AY8 C;  5G49 B;  4UUZ A;  2ZY4 A;  3AYW D;  4J8V A;  3B6G C;  5G49 A;  5B2J C;  3AFA B;  3W96 D;  4KGC C;  3H0R C;  1KX3 D;  3LZ1 C;  1HQ3 B;  3AFA A;  5B40 C;  1P3K C;  1HQ3 A;  3REK B;  5AV8 C;  4NFT A;  3X1U C;  4WJ3 C;  4WZS B;  4XUJ C;  1P3M B;  1P3A D;  4NE6 A;  1T3U A;  1TZY B;  4EO5 C;  3REK A;  3UTA D;  3P5J B;  1P3M A;  1KX4 B;  5CPI C;  3AZG B;  1KX4 A;  3WKJ D;  3REI D;  1P3I B;  3AZG A;  4J8U D;  5AV6 C;  3MNN B;  3AL0 C;  3B0D C;  1P3I A;  1AOI B;  5GXQ D;  5B1L C;  3MNN A;  1P34 C;  1AOI A;  3A1I A;  3AZF D;  3AZN C;  3W99 D;  4ZUX C;  3WA9 D;  5B2J B;  2G5H C;  2BG1 A;  3B6F B;  4KGC B;  2Y2O A;  1S32 D;  3KUY D;  5B2J A;  1B6W A;  3B6F A;  4KGC A;  2L5A A;  1P3P C;  5KDM A;  3LEL D;  3FDD A;  1P3K B;  4WU8 D;  1F66 B;  5AV8 B;  1BH9 B;  3X1U B;  2FFF B;  4XUJ B;  1P3K A;  1JFI B;  1F66 A;  2NQB C;  4EO5 B;  5AV8 A;  1BH9 A;  3X1U A;  3WTP D;  4XUJ A;  2HIO D;  5F99 B;  3EPH A;  5B0Z D;  3VH5 T;  5CHL B;  4R8P D;  5DNM D;  5F99 A;  5GSU C;  1A7W A;  3KWQ C;  5CPI A;  3VH5 W;  2CV5 D;  4J8X D;  2F8N G;  1M1A C;  4H9P B;  3A6N D;  3B0D B;  4H9P A;  4J8W C;  5B1L B;  5AV6 A;  5DNN D;  3KXB C;  5AV9 C;  1P34 B;  5B1L A;  3AZL B;  3AZN B;  4YS3 C;  3C1C D;  3VH6 A;  1P34 A;  4H9S C;  3AZN A;  3X1S C;  2FJ7 C;  4ZUX A;  5B1M C;  1TAF B;  5GT3 C;  1Q9C A;  3W97 C;  3R45 B;  2J8P A;  4CAY B;  5BS7 A;  4JJN D;  3AZJ B;  1P3P B;  1TAF A;  3MVD C;  2Y2L A;  1M19 C;  3R45 A;  2PYO C;  3AZJ A;  4CAY A;  1P3P A;  3MGR C;  1KX5 B;  1P3G C;  2ARO B;  1P3L D;  1KX5 A;  2NQB B;  3NQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...