3O62B

Nucleosome core particle modified with a cisplatin 1,3-cis-{pt(nh3)2}2+-d(gptpg) intrastrand cross-link
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Consequences of Cisplatin binding on nucleosome structure and dynamics.
pubmed doi rcsb
source organism Xenopus laevis
total genus 24
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3o62B00
1M19D 1WWSA 4KHAA 4J8UB 5E5AA 5B24D 3REJD 3AZLB 5B33C 4ZUXB 4QLCD 3KSYA 3UTBC 4KUDC 3AZFB 1P3IC 3AZED 4G92C 5GT0C 3O62D 1P3MB 3B6FC 2HIOA 4AWLB 3W97D 3KWQD 5B40C 3RELA 2F8NK 4J8VA 1A7WA 4HGAC 5CPKB 5CPJC 1P3AC 1P3FB 3AZHC 1F66B 1HQ3C 3KXBD 4WV4B 3REHA 5AVCD 2NZDB 3AV2B 5C3IB 4Z5TB 4E44A 5KDMA 5B24C 5B33A 3REJC 3REKB 4QLCC 5B0ZB 2PYOD 3UTBA 5GSUD 4KUDA 2RVQC 5E5AB 4H9RB 1P3BC 5GT0A 4UUZB 3O62C 3B6FA 4H9OA 3KUYB 3W97C 3LZ0D 3KWQC 1P3KC 1EQZC 5GT3B 2HIOB 4LD9D 4J8UD 3AZLD 5CPJA 4ZUXD 1P3AA 3AZHA 4J8VB 1HQ3A 3W96D 1S32B 4E45A 3VH6W 5AVCC 2CV5D 1P34D 1M19A 5DNMD 1P3MD 5B24A 3REJA 4QLCA 2HUEC 5GSUC 4YM6B 4DRAA 1P3BA 3O62A 3AZJB 2FJ7D 3VH5T 5CPKD 3UTBB 1P3PD 4KUDB 5CP6C 3W97A 1P3IB 3KWQA 4G92B 3LZ0C 5GT0B 1P3KA 1EQZA 1F66D 3B6FB 3AV2D 4LD9C 1KX3B 5B1LD 4Z5TD 5B40B 3X1UC 3REKD 4ZUXC 4H9SC 3REIB 1AOIB 2BYMA 1R4VA 3W96C 5AVCA 2CV5C 1P34C 4HGAB 4M6BA 5AV6D 5CPJB 5DNMC 1P3AB 1P3MC 3UTAC 3AZHB 1HQ3B 3KUYD 3NQJB 2PYOA 5GSUA 3W99D 5GT3D 5B24B 1JFIA 1F1EA 2JSSA 4EO5B 3B0CT 2FJ7C 4Z2MH 3W98B 5AV5B 5CPKC 5CP6A 1P3PC 4J8VD 1P3BB 3LZ0A 5CPIC 2AROB 1F66C 1S32D 2NQBB 3O62B 3A6NB 1B6WA 4JJND 4LD9A 3W97B 5B1LC 3KWQB 1P3KB 1EQZB 4ZUXA 4H9SA 3R45B 4H9QA 4Z66C 3W96A 3AV1C 5BNVB 4YM6D 4X23D 2CV5A 1P34A 4R8PB 5DNMA 5AV6C 3AZJD 3AZMB 1P3MA 1KX5C 3UTAA 2BYMB 4XZQB 5AVCB 3KUYC 1P3ID 2F8NB 5GT0D 3W99C 3B6FD 5GT3C 1KX3D 2FJ7A 3UT9C 5CPKA 2HUEB 1P3PA 5B40D 1AOID 3REID 3MNND 5CPIA 1F66A 3B0DB 1S32C 4JJNC 5CP6B 5F99D 5B1LA 3AZID 4ZBJC 4Z66A 3VH5W 4LD9B 4YM6C 4X23C 1ZLAD 4H9RA 5BS7C 5AV6A 1KX5A 3X1UB 4UUZA 3AZJC 1KU5A 4H9QB 3W98D 5AV5D 3W96B 5BO0A 2RVQD 3KUYA 2CV5B 1P34B 2NQBD 1P3BD 2AROD 5DNMB 3W99A 3A6ND 5GT3A 3UTAB 4J8XC 1KX3C 3UT9A 2YFVA 1P3KD 1EQZD 5DNND 1AOIC 3REIC 3MNNC 3MVDC 1S32A 2FJ7B 4R8PD 3AZGB 4JJNA 1P3PB 3AZMD 5F99C 1M18D 1KX4C 2F8NG 5CPIB 4G91C 4XZQD 3X1TC 3AZIC 4WZSB 3B0CW 2F8ND 4YM6A 4X23A 5B1LB 1ZLAC 5BS7A 3TU4B 3AZJA 4EO5C 4Z66B 3W98C 5AV5C 3AV1B 1P3IA 2NQBC 2AROC 5AV6B 1KX5B 3A6NC 4KGCD 5CP6D 4J8XA 5BO0B 1KX3A 4J8WB 1BH9B 3B0BA 5DNNC 5B40A 3REIA 1AOIA 3W99B 3MNNA 3MVDA 3UT9B 2YFVB 4R8PC 3X1UD 5F99A 3AZMC 1KX4A 1M18C 3X1TA 3LELD 4XZQC 3NQJA 3AZIA 3AYWB 4CSRA 4JJNB 1U35C 3UTAD 1ZLAA 3B6GB 4WNNB 4ZBJB 3AFAB 3W98A 5AV5A 4X23B 2NQBA 2AROA 3B0DC 3A6NA 3AZGD 4KGCC 5BNXB 5CPID 5DNNA 2L5AA 3R45A 5G49B 5BNVA 4J8XB 4R8PA 3AZMA 3TU4D 1M18A 4Z66D 3MNNB 3MVDB 3AV1D 4XZQA 3LELC 3WAAD 1P3OB 2F8NA 1U35A 1KX5D 5F99B 1KX4B 4G91B 3X1TB 3AZIB 4J8WD 4DRBA 4CSRB 1ZLAB 3WTPB 3UT9D 4KGCA 3AZGC 1ID3C 4NE3A 3X1SB 3AYWD 3B6GD 5DNNB 4NE5A 3X1UA 3TU4C 3AFAD 3LELA 3WAAC 3REKA 1M1AC 1M18B 3LZ1B 3MGSD 3V9RA 3X1VB 4J8WC 1U35B 4WU8C 3WKJD 1P3GC 4J8XD 2BYKA 3AZGA 5B2IC 1ID3A 4YS3D 3MVDD 5CHLB 3AYWC 4WU9B 5JA4B 1P3OD 4KGCB 1KX4D 3X1TD 3B6GC 3TU4A 3AFAC 5FUGA 4H9PA 3AV1A 2YFWB 3NQUA 3WAAA 3WTPD 5B2JB 3AZKD 3LELB 3MGSC 4J8WA 1N1JA 3X1SD 4WU8A 1BH9A 3WKJC 3RELC 1BFMA 5GXQD 1P3LB 5B1MD 3V9RB 5B2IA 5JRGD 4YS3C 2BYKB 5AY8C 4XUJC 3AYWA 3AN2B 3REHC 1P3OC 5AV8C 1ID3B 3LJAB 3WA9C 3LZ1D 3B6GA 4WNNA 3X1VD 3AFAA 1TAFA 5AV9B 5B31G 1U35D 3AZNB 2CWEA 2IO5C 3WTPC 5B31D 4CAYA 3MGQC 5FUGB 3C1BC 4H9PB 3MGSA 3C1CD 3AZKC 3WAAB 3NQUB 1BH8B 5BNXA 5B32C 3X1SC 1M1AB 4WU9D 3WKJA 5G49A 3MGPC 5GXQC 5B1MC 1N1JB 4WU8B 5B0YD 5AVBC 1P3GB 4YS3A 5JRGC 3VH6A 5AY8A 4XUJA 1P3OA 5B2IB 1WWIA 5B2JD 5AV8A 1M19C 3WA9A 4NFTA 3LZ1C 3X1VC 3MGRD 4KHAB 3WTPA 3AZEC 1P3LD 5B31C 3MGQA 1TAFB 3C1BA 3AZKA 4Z2MG 3C1CC 3X1SA 5B32A 4CAYB 1TZYD 3AN2D 4WU9C 3MGPA 5GXQA 3MGSB 5B1MA 3LJAD 1ID3D 3WKJB 5AVBA 5B0YC 5AV9D 3RELB 5JRGA 3AZND 3KXBC 3AZFD 5B2JC 2F8NH 4YS3B 3LZ1A 5AY8B 4XUJB 3X1VA 3REHB 2PYOC 5AV8B 3MGRC 1M1AD 3WA9B 3AZEA 5B31A 5KDMB 1P3LC 5B33B 4H9NB 4WU8D 3C1CA 1P3GD 2IO5B 1P3FD 4WU9A 5JA4A 1TZYC 3MGQB 3AN2C 3C1BB 5B2ID 3AZKB 2NZDD 4H9OB 3LJAC 4J8UC 5B32B 5B0YA 3AZLC 5AV9C 5B0ZD 3MGPB 5GXQB 3AZNC 5B1MB 3KXBA 2YFWA 3AZFC 1ULYA 5E5AD 5B2JA 5AVBB 1HTAA 5JRGB 4AWLC 3MGRA 1M19B 1Q9CA 1P3LA 2HIOD 3REJB 4QLCB 3RELD 3AZEB 5B31B 1P3FC 1H3OA 1TZYA 3AN2A 4H9NA 3C1CB 3LJAA 3AV2C 2NZDC 5C3IC 4J8UA 4Z5TC 5AY8D 4XUJD 3AZLA 2LY8A 3REHD 3VH5A 5AV9A 5BT1D 3REKC 5B0ZC 3AZNA 5AV8D 3WA9D 3AZFA 4NE6A 5E5AC 5B33D 5B0YB 3UTBD 4KUDD 3KXBB 1BH8A 1M1AA 3MGQD 3C1BD 5B32G 2HIOC 3VH6T 2PYOB 5B32D 3MGRB 3WTPE 5GSUB 1P3GA 3MGPD 1P3FA 4J8VC 1JFIB 2NZDA 5CPJD 3AV2A 5AVBD 1P3AD 4Z5TA 3AZHD 1B67A 1H3OB 1HQ3D 3LZ0B 1TZYB 5B0ZA 5BT1C
chains in the Genus database with same CATH superfamily
2ZY3A 1M19D 1WWSA 4KHAA 4J8UB 5E5AA 5B24D 3REJD 3AZLB 5B33C 4ZUXB 4QLCD 3KSYA 3UTBC 4KUDC 3AZFB 2G5IC 1P3IC 3AZED 4G92C 5GT0C 3O62D 1P3MB 3B6FC 2HIOA 4AWLB 3W97D 3KWQD 5B40C 3RELA 2F8NK 4J8VA 1A7WA 2ZY4A 4HGAC 5CPKB 5CPJC 1P3AC 1P3FB 3AZHC 1F66B 1HQ3C 3KXBD 4WV4B 3REHA 5AVCD 2NZDB 3AV2B 5C3IB 4Z5TB 4E44A 5KDMA 5B24C 5B33A 3REJC 3REKB 4QLCC 5B0ZB 2PYOD 3UTBA 5GSUD 4KUDA 2RVQC 5E5AB 4H9RB 1P3BC 5GT0A 4UUZB 3O62C 3B6FA 4H9OA 3EPKA 3KUYB 3W97C 4DQYB 3LZ0D 3KWQC 1P3KC 1EQZC 5GT3B 2RIQA 2HIOB 4LD9D 4J8UD 3AZLD 5CPJA 4ZUXD 1P3AA 3AZHA 4J8VB 1HQ3A 3W96D 1S32B 4E45A 3VH6W 5AVCC 2CV5D 1P34D 1M19A 5DNMD 1P3MD 5B24A 3REJA 4QLCA 2HUEC 5GSUC 4YM6B 2Y2LA 4DRAA 1P3BA 3H0MC 3O62A 3AZJB 2FJ7D 3VH5T 5CPKD 3UTBB 1P3PD 4KUDB 5CP6C 3W97A 1P3IB 2Y2MA 3KWQA 4G92B 3LZ0C 5GT0B 1P3KA 1EQZA 1F66D 2Y2HA 3B6FB 3AV2D 4LD9C 1KX3B 5B1LD 4Z5TD 5B40B 3X1UC 3REKD 4ZUXC 4H9SC 3REIB 1AOIB 2BYMA 1R4VA 3W96C 3AL0C 5AVCA 2CV5C 1P34C 4HGAB 4M6BA 5AV6D 5CPJB 5DNMC 1P3AB 1P3MC 3UTAC 3AZHB 1HQ3B 3KUYD 3NQJB 2PYOA 5GSUA 3W99D 5GT3D 5B24B 1JFIA 1F1EA 2JSSA 4EO5B 3B0CT 2FJ7C 4Z2MH 3W98B 5AV5B 5CPKC 5CP6A 1P3PC 4J8VD 1P3BB 3LZ0A 5CPIC 2AROB 1F66C 1S32D 2NQBB 3O62B 3A6NB 1B6WA 4JJND 4LD9A 3W97B 5B1LC 3KWQB 1P3KB 1EQZB 4ZUXA 4H9SA 3A1KA 3R45B 4H9QA 4Z66C 3W96A 3AV1C 5BNVB 4YM6D 4X23D 2CV5A 1P34A 4R8PB 5DNMA 2XD1A 5AV6C 3AZJD 3AZMB 2JCHA 3UTAA 1P3MA 2BYMB 1KX5C 4XZQB 5AVCB 3KUYC 1P3ID 2F8NB 5GT0D 3W99C 3B6FD 5GT3C 1KX3D 2FJ7A 2ZM5A 3UT9C 5CPKA 2HUEB 1P3PA 5B40D 1AOID 3REID 3MNND 5CPIA 1F66A 3B0DB 1S32C 4JJNC 5CP6B 3EPJA 5F99D 5B1LA 3AZID 2W8SA 4ZBJC 4Z66A 3VH5W 4LD9B 4YM6C 4X23C 1ZLAD 4H9RA 5BS7C 5AV6A 1KX5A 3X1UB 4UUZA 3AZJC 1KU5A 4H9QB 3W98D 5AV5D 3W96B 5BO0A 2RVQD 3KUYA 2CV5B 1P34B 2NQBD 1P3BD 2AROD 5DNMB 3W99A 3A6ND 5GT3A 3UTAB 4J8XC 1KX3C 3UT9A 2YFVA 1P3KD 2VQRA 2Y2KA 5DNND 1EQZD 1AOIC 3REIC 3MNNC 3H0RC 3MVDC 1S32A 2UWXA 2FJ7B 4R8PD 3AZGB 4JJNA 1P3PB 3AZMD 5F99C 1M18D 1KX4C 2F8NG 5CPIB 4G91C 4XZQD 3X1TC 3AZIC 4WZSB 3B0CW 2F8ND 4YM6A 4X23A 5B1LB 2G5HC 1ZLAC 5BS7A 3TU4B 3AZJA 4EO5C 4Z66B 3W98C 5AV5C 3AV1B 1P3IA 2NQBC 2AROC 5AV6B 1KX5B 3A6NC 4KGCD 5CP6D 4J8XA 5BO0B 1KX3A 4J8WB 1BH9B 3B0BA 5DNNC 5B40A 3REIA 1AOIA 3W99B 3MNNA 3MVDA 3UT9B 2YFVB 4R8PC 3X1UD 5F99A 3AZMC 1KX4A 1M18C 3X1TA 3LELD 4XZQC 3NQJA 3AZIA 3AYWB 4CSRA 4JJNB 1U35C 2Y2IA 3UTAD 1ZLAA 3B6GB 4WNNB 4ZBJB 3AFAB 3W98A 1W2EA 5AV5A 4X23B 2NQBA 2AROA 3B0DC 3A6NA 2Y2QA 3AZGD 4KGCC 3IP4C 5BNXB 5CPID 4WJ3C 5DNNA 2L5AA 3R45A 5G49B 5BNVA 4J8XB 2JE5A 4R8PA 3AZMA 2ZY5A 3TU4D 1M18A 4Z66D 3MNNB 3MVDB 3AV1D 4XZQA 3LELC 3WAAD 2Y2OA 1P3OB 2F8NA 1U35A 1KX5D 5F99B 1T3UA 1KX4B 4G91B 3X1TB 3AZIB 4J8WD 4DRBA 4CSRB 2F2AC 1ZLAB 3WTPB 3UT9D 4KGCA 3AZGC 1ID3C 4NE3A 3X1SB 3AYWD 1PZRA 3B6GD 5DNNB 4NE5A 3X1UA 3TU4C 3AFAD 3LELA 2Y2NA 3WAAC 2Y2PA 3REKA 1M1AC 1M18B 3LZ1B 3MGSD 3V9RA 3X1VB 4J8WC 1U35B 4WU8C 3WKJD 1P3GC 4J8XD 2BYKA 3AZGA 1Z2CB 5B2IC 1ID3A 4YS3D 3MVDD 5CHLB 3AYWC 4WU9B 5JA4B 1P3OD 4KGCB 1KX4D 3X1TD 3B6GC 3TU4A 3AFAC 5FUGA 4H9PA 3AV1A 2YFWB 3NQUA 3WAAA 3WTPD 5B2JB 2DF4C 3AZKD 3LELB 3MGSC 2BG1A 4J8WA 1N1JA 3H0LC 3X1SD 4WU8A 1BH9A 3WKJC 3RELC 1BFMA 5GXQD 1P3LB 5B1MD 3EPLA 3V9RB 5B2IA 5JRGD 4YS3C 2BYKB 5AY8C 4XUJC 3AYWA 3AN2B 3REHC 1P3OC 5AV8C 1ID3B 3LJAB 3WA9C 3LZ1D 3B6GA 4WNNA 3X1VD 3AFAA 1TAFA 5AV9B 4UPKA 5B31G 1U35D 3AZNB 2CWEA 3P5JB 2IO5C 3A1IA 5B31D 3WTPC 4CAYA 3MGQC 5FUGB 3C1BC 4H9PB 3MGSA 3C1CD 3AZKC 3F6TA 3WAAB 3NQUB 1BH8B 5BNXA 5B32C 2Y2JA 3X1SC 1M1AB 4WU9D 3WKJA 5G49A 3MGPC 5GXQC 5B1MC 1N1JB 4WU8B 3EPHA 5B0YD 5AVBC 1P3GB 4YS3A 5JRGC 3VH6A 5AY8A 4XUJA 1P3OA 5B2IB 5B2JD 1WWIA 5AV8A 1M19C 3WA9A 4NFTA 3LZ1C 3X1VC 2DQNC 3MGRD 4KHAB 3WTPA 3AZEC 1P3LD 5B31C 3FDDA 3MGQA 1TAFB 3C1BA 3AZKA 4Z2MG 3C1CC 3X1SA 5B32A 2J8PA 1TZYD 4CAYB 3AN2D 4WU9C 3MGPA 5GXQA 3MGSB 5B1MA 3LJAD 1ID3D 3WKJB 2XD5A 5AVBA 5B0YC 5AV9D 3RELB 5JRGA 3AZND 3KXBC 3AZFD 5B2JC 2F8NH 4YS3B 3LZ1A 5AY8B 4XUJB 3X1VA 3REHB 2PYOC 5AV8B 3MGRC 1M1AD 3WA9B 3AZEA 5B31A 5KDMB 1P3LC 5B33B 4H9NB 4WU8D 3C1CA 1P3GD 2IO5B 1P3FD 4WU9A 5JA4A 1TZYC 3MGQB 3AN2C 3C1BB 5B2ID 3AZKB 2NZDD 4H9OB 3LJAC 4J8UC 5B32B 5B0YA 3AZLC 5AV9C 5B0ZD 3MGPB 5GXQB 3AZNC 5B1MB 3KXBA 2YFWA 3AZFC 1ULYA 5E5AD 2Y2GA 5B2JA 5AVBB 1HTAA 5JRGB 4AWLC 3MGRA 1M19B 3KFUG 1Q9CA 1P3LA 2HIOD 3REJB 4QLCB 3RELD 3AZEB 5B31B 1P3FC 1H3OA 1TZYA 3AN2A 4H9NA 3C1CB 3LJAA 3AV2C 2NZDC 5C3IC 4J8UA 4Z5TC 5AY8D 4XUJD 3AZLA 2LY8A 3REHD 3VH5A 5AV9A 5BT1D 3REKC 5B0ZC 3AZNA 5AV8D 2ZY2A 3WA9D 3AZFA 4NE6A 5E5AC 5B33D 5B0YB 3EG5B 3UTBD 4KUDD 3KXBB 1BH8A 2FFFB 1M1AA 3MGQD 3C1BD 5B32G 2HIOC 3VH6T 2PYOB 5B32D 3MGRB 3WTPE 5GSUB 1P3GA 3MGPD 1P3FA 4J8VC 1JFIB 2NZDA 5CPJD 3AV2A 5AVBD 1P3AD 4Z5TA 3AZHD 1B67A 1H3OB 1HQ3D 3LZ0B 1TZYB 5B0ZA 5BT1C
chains in the Genus database with same CATH topology
2ZY3A 1M19D 1WWSA 4KHAA 4J8UB 5E5AA 5B24D 3REJD 3AZLB 5B33C 4ZUXB 4QLCD 3KSYA 3UTBC 4KUDC 3AZFB 2G5IC 1P3IC 3AZED 4G92C 5GT0C 3O62D 1P3MB 3B6FC 2HIOA 4AWLB 3W97D 3KWQD 5B40C 3RELA 2F8NK 4J8VA 1A7WA 2ZY4A 4HGAC 5CPKB 5CPJC 1P3AC 1P3FB 3AZHC 1F66B 1HQ3C 3KXBD 4WV4B 3REHA 5AVCD 2NZDB 3AV2B 5C3IB 4Z5TB 4E44A 5KDMA 5B24C 5B33A 3REJC 3REKB 4QLCC 5B0ZB 2PYOD 3UTBA 5GSUD 4KUDA 2RVQC 5E5AB 4H9RB 1P3BC 5GT0A 4UUZB 3O62C 3B6FA 4H9OA 3EPKA 3KUYB 3W97C 4DQYB 3LZ0D 3KWQC 1P3KC 1EQZC 5GT3B 2RIQA 2HIOB 4LD9D 4J8UD 3AZLD 5CPJA 4ZUXD 1P3AA 3AZHA 4J8VB 1HQ3A 3W96D 1S32B 4E45A 3VH6W 5AVCC 2CV5D 1P34D 1M19A 5DNMD 1P3MD 5B24A 3REJA 4QLCA 2HUEC 5GSUC 4YM6B 2Y2LA 4DRAA 1P3BA 3H0MC 3O62A 3AZJB 2FJ7D 3VH5T 5CPKD 3UTBB 1P3PD 4KUDB 5CP6C 3W97A 1P3IB 2Y2MA 3KWQA 4G92B 3LZ0C 5GT0B 1P3KA 1EQZA 1F66D 2Y2HA 3B6FB 3AV2D 4LD9C 1KX3B 5B1LD 4Z5TD 5B40B 3X1UC 3REKD 4ZUXC 4H9SC 3REIB 1AOIB 2BYMA 1R4VA 3W96C 3AL0C 5AVCA 2CV5C 1P34C 4HGAB 4M6BA 5AV6D 5CPJB 5DNMC 1P3AB 1P3MC 3UTAC 3AZHB 1HQ3B 3KUYD 3NQJB 2PYOA 5GSUA 3W99D 5GT3D 5B24B 1JFIA 1F1EA 2JSSA 4EO5B 3B0CT 2FJ7C 4Z2MH 3W98B 5AV5B 5CPKC 5CP6A 1P3PC 4J8VD 1P3BB 3LZ0A 5CPIC 2AROB 1F66C 1S32D 2NQBB 3O62B 3A6NB 1B6WA 4JJND 4LD9A 3W97B 5B1LC 3KWQB 1P3KB 1EQZB 4ZUXA 4H9SA 3A1KA 3R45B 4H9QA 4Z66C 3W96A 3AV1C 5BNVB 4YM6D 4X23D 2CV5A 1P34A 4R8PB 5DNMA 2XD1A 5AV6C 3AZJD 3AZMB 2JCHA 3UTAA 1P3MA 2BYMB 1KX5C 4XZQB 5AVCB 3KUYC 1P3ID 2F8NB 5GT0D 3W99C 3B6FD 5GT3C 1KX3D 2FJ7A 2ZM5A 3UT9C 5CPKA 2HUEB 1P3PA 5B40D 1AOID 3REID 3MNND 5CPIA 1F66A 3B0DB 1S32C 4JJNC 5CP6B 3EPJA 5F99D 5B1LA 3AZID 2W8SA 4ZBJC 4Z66A 3VH5W 4LD9B 4YM6C 4X23C 1ZLAD 4H9RA 5BS7C 5AV6A 1KX5A 3X1UB 4UUZA 3AZJC 1KU5A 4H9QB 3W98D 5AV5D 3W96B 5BO0A 2RVQD 3KUYA 2CV5B 1P34B 2NQBD 1P3BD 2AROD 5DNMB 3W99A 3A6ND 5GT3A 3UTAB 4J8XC 1KX3C 3UT9A 2YFVA 1P3KD 2VQRA 2Y2KA 5DNND 1EQZD 1AOIC 3REIC 3MNNC 3H0RC 3MVDC 1S32A 2UWXA 2FJ7B 4R8PD 3AZGB 4JJNA 1P3PB 3AZMD 5F99C 1M18D 1KX4C 2F8NG 5CPIB 4G91C 4XZQD 3X1TC 3AZIC 4WZSB 3B0CW 2F8ND 4YM6A 4X23A 5B1LB 2G5HC 1ZLAC 5BS7A 3TU4B 3AZJA 4EO5C 4Z66B 3W98C 5AV5C 3AV1B 1P3IA 2NQBC 2AROC 5AV6B 1KX5B 3A6NC 4KGCD 5CP6D 4J8XA 5BO0B 1KX3A 4J8WB 1BH9B 3B0BA 5DNNC 5B40A 3REIA 1AOIA 3W99B 3MNNA 3MVDA 3UT9B 2YFVB 4R8PC 3X1UD 5F99A 3AZMC 1KX4A 1M18C 3X1TA 3LELD 4XZQC 3NQJA 3AZIA 3AYWB 4CSRA 4JJNB 1U35C 2Y2IA 3UTAD 1ZLAA 3B6GB 4WNNB 4ZBJB 3AFAB 3W98A 1W2EA 5AV5A 4X23B 2NQBA 2AROA 3B0DC 3A6NA 2Y2QA 3AZGD 4KGCC 3IP4C 5BNXB 5CPID 4WJ3C 5DNNA 2L5AA 3R45A 5G49B 5BNVA 4J8XB 2JE5A 4R8PA 3AZMA 2ZY5A 3TU4D 1M18A 4Z66D 3MNNB 3MVDB 3AV1D 4XZQA 3LELC 3WAAD 2Y2OA 1P3OB 2F8NA 1U35A 1KX5D 5F99B 1T3UA 1KX4B 4G91B 3X1TB 3AZIB 4J8WD 4DRBA 4CSRB 2F2AC 1ZLAB 3WTPB 3UT9D 4KGCA 3AZGC 1ID3C 4NE3A 3X1SB 3AYWD 1PZRA 3B6GD 5DNNB 4NE5A 3X1UA 3TU4C 3AFAD 3LELA 2Y2NA 3WAAC 2Y2PA 3REKA 1M1AC 1M18B 3LZ1B 3MGSD 3V9RA 3X1VB 4J8WC 1U35B 4WU8C 3WKJD 1P3GC 4J8XD 2BYKA 3AZGA 1Z2CB 5B2IC 1ID3A 4YS3D 3MVDD 5CHLB 3AYWC 4WU9B 5JA4B 1P3OD 4KGCB 1KX4D 3X1TD 3B6GC 3TU4A 3AFAC 5FUGA 4H9PA 3AV1A 2YFWB 3NQUA 3WAAA 3WTPD 5B2JB 2DF4C 3AZKD 3LELB 3MGSC 2BG1A 4J8WA 1N1JA 3H0LC 3X1SD 4WU8A 1BH9A 3WKJC 3RELC 1BFMA 5GXQD 1P3LB 5B1MD 3EPLA 3V9RB 5B2IA 5JRGD 4YS3C 2BYKB 5AY8C 4XUJC 3AYWA 3AN2B 3REHC 1P3OC 5AV8C 1ID3B 3LJAB 3WA9C 3LZ1D 3B6GA 4WNNA 3X1VD 3AFAA 1TAFA 5AV9B 4UPKA 5B31G 1U35D 3AZNB 2CWEA 3P5JB 2IO5C 3A1IA 5B31D 3WTPC 4CAYA 3MGQC 5FUGB 3C1BC 4H9PB 3MGSA 3C1CD 3AZKC 3F6TA 3WAAB 3NQUB 1BH8B 5BNXA 5B32C 2Y2JA 3X1SC 1M1AB 4WU9D 3WKJA 5G49A 3MGPC 5GXQC 5B1MC 1N1JB 4WU8B 3EPHA 5B0YD 5AVBC 1P3GB 4YS3A 5JRGC 3VH6A 5AY8A 4XUJA 1P3OA 5B2IB 5B2JD 1WWIA 5AV8A 1M19C 3WA9A 4NFTA 3LZ1C 3X1VC 2DQNC 3MGRD 4KHAB 3WTPA 3AZEC 1P3LD 5B31C 3FDDA 3MGQA 1TAFB 3C1BA 3AZKA 4Z2MG 3C1CC 3X1SA 5B32A 2J8PA 1TZYD 4CAYB 3AN2D 4WU9C 3MGPA 5GXQA 3MGSB 5B1MA 3LJAD 1ID3D 3WKJB 2XD5A 5AVBA 5B0YC 5AV9D 3RELB 5JRGA 3AZND 3KXBC 3AZFD 5B2JC 2F8NH 4YS3B 3LZ1A 5AY8B 4XUJB 3X1VA 3REHB 2PYOC 5AV8B 3MGRC 1M1AD 3WA9B 3AZEA 5B31A 5KDMB 1P3LC 5B33B 4H9NB 4WU8D 3C1CA 1P3GD 2IO5B 1P3FD 4WU9A 5JA4A 1TZYC 3MGQB 3AN2C 3C1BB 5B2ID 3AZKB 2NZDD 4H9OB 3LJAC 4J8UC 5B32B 5B0YA 3AZLC 5AV9C 5B0ZD 3MGPB 5GXQB 3AZNC 5B1MB 3KXBA 2YFWA 3AZFC 1ULYA 5E5AD 2Y2GA 5B2JA 5AVBB 1HTAA 5JRGB 4AWLC 3MGRA 1M19B 3KFUG 1Q9CA 1P3LA 2HIOD 3REJB 4QLCB 3RELD 3AZEB 5B31B 1P3FC 1H3OA 1TZYA 3AN2A 4H9NA 3C1CB 3LJAA 3AV2C 2NZDC 5C3IC 4J8UA 4Z5TC 5AY8D 4XUJD 3AZLA 2LY8A 3REHD 3VH5A 5AV9A 5BT1D 3REKC 5B0ZC 3AZNA 5AV8D 2ZY2A 3WA9D 3AZFA 4NE6A 5E5AC 5B33D 5B0YB 3EG5B 3UTBD 4KUDD 3KXBB 1BH8A 2FFFB 1M1AA 3MGQD 3C1BD 5B32G 2HIOC 3VH6T 2PYOB 5B32D 3MGRB 3WTPE 5GSUB 1P3GA 3MGPD 1P3FA 4J8VC 1JFIB 2NZDA 5CPJD 3AV2A 5AVBD 1P3AD 4Z5TA 3AZHD 1B67A 1H3OB 1HQ3D 3LZ0B 1TZYB 5B0ZA 5BT1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 D;  1WWS A;  4KHA A;  4J8U B;  5E5A A;  5B24 D;  3REJ D;  3AZL B;  5B33 C;  4ZUX B;  4QLC D;  3KSY A;  3UTB C;  4KUD C;  3AZF B;  1P3I C;  3AZE D;  4G92 C;  5GT0 C;  3O62 D;  1P3M B;  3B6F C;  2HIO A;  4AWL B;  3W97 D;  3KWQ D;  5B40 C;  3REL A;  2F8N K;  4J8V A;  1A7W A;  4HGA C;  5CPK B;  5CPJ C;  1P3A C;  1P3F B;  3AZH C;  1F66 B;  1HQ3 C;  3KXB D;  4WV4 B;  3REH A;  5AVC D;  2NZD B;  3AV2 B;  5C3I B;  4Z5T B;  4E44 A;  5KDM A;  5B24 C;  5B33 A;  3REJ C;  3REK B;  4QLC C;  5B0Z B;  2PYO D;  3UTB A;  5GSU D;  4KUD A;  2RVQ C;  5E5A B;  4H9R B;  1P3B C;  5GT0 A;  4UUZ B;  3O62 C;  3B6F A;  4H9O A;  3KUY B;  3W97 C;  3LZ0 D;  3KWQ C;  1P3K C;  1EQZ C;  5GT3 B;  2HIO B;  4LD9 D;  4J8U D;  3AZL D;  5CPJ A;  4ZUX D;  1P3A A;  3AZH A;  4J8V B;  1HQ3 A;  3W96 D;  1S32 B;  4E45 A;  3VH6 W;  5AVC C;  2CV5 D;  1P34 D;  1M19 A;  5DNM D;  1P3M D;  5B24 A;  3REJ A;  4QLC A;  2HUE C;  5GSU C;  4YM6 B;  4DRA A;  1P3B A;  3O62 A;  3AZJ B;  2FJ7 D;  3VH5 T;  5CPK D;  3UTB B;  1P3P D;  4KUD B;  5CP6 C;  3W97 A;  1P3I B;  3KWQ A;  4G92 B;  3LZ0 C;  5GT0 B;  1P3K A;  1EQZ A;  1F66 D;  3B6F B;  3AV2 D;  4LD9 C;  1KX3 B;  5B1L D;  4Z5T D;  5B40 B;  3X1U C;  3REK D;  4ZUX C;  4H9S C;  3REI B;  1AOI B;  2BYM A;  1R4V A;  3W96 C;  5AVC A;  2CV5 C;  1P34 C;  4HGA B;  4M6B A;  5AV6 D;  5CPJ B;  5DNM C;  1P3A B;  1P3M C;  3UTA C;  3AZH B;  1HQ3 B;  3KUY D;  3NQJ B;  2PYO A;  5GSU A;  3W99 D;  5GT3 D;  5B24 B;  1JFI A;  1F1E A;  2JSS A;  4EO5 B;  3B0C T;  2FJ7 C;  4Z2M H;  3W98 B;  5AV5 B;  5CPK C;  5CP6 A;  1P3P C;  4J8V D;  1P3B B;  3LZ0 A;  5CPI C;  2ARO B;  1F66 C;  1S32 D;  2NQB B;  3O62 B;  3A6N B;  1B6W A;  4JJN D;  4LD9 A;  3W97 B;  5B1L C;  3KWQ B;  1P3K B;  1EQZ B;  4ZUX A;  4H9S A;  3R45 B;  4H9Q A;  4Z66 C;  3W96 A;  3AV1 C;  5BNV B;  4YM6 D;  4X23 D;  2CV5 A;  1P34 A;  4R8P B;  5DNM A;  5AV6 C;  3AZJ D;  3AZM B;  1P3M A;  1KX5 C;  3UTA A;  2BYM B;  4XZQ B;  5AVC B;  3KUY C;  1P3I D;  2F8N B;  5GT0 D;  3W99 C;  3B6F D;  5GT3 C;  1KX3 D;  2FJ7 A;  3UT9 C;  5CPK A;  2HUE B;  1P3P A;  5B40 D;  1AOI D;  3REI D;  3MNN D;  5CPI A;  1F66 A;  3B0D B;  1S32 C;  4JJN C;  5CP6 B;  5F99 D;  5B1L A;  3AZI D;  4ZBJ C;  4Z66 A;  3VH5 W;  4LD9 B;  4YM6 C;  4X23 C;  1ZLA D;  4H9R A;  5BS7 C;  5AV6 A;  1KX5 A;  3X1U B;  4UUZ A;  3AZJ C;  1KU5 A;  4H9Q B;  3W98 D;  5AV5 D;  3W96 B;  5BO0 A;  2RVQ D;  3KUY A;  2CV5 B;  1P34 B;  2NQB D;  1P3B D;  2ARO D;  5DNM B;  3W99 A;  3A6N D;  5GT3 A;  3UTA B;  4J8X C;  1KX3 C;  3UT9 A;  2YFV A;  1P3K D;  1EQZ D;  5DNN D;  1AOI C;  3REI C;  3MNN C;  3MVD C;  1S32 A;  2FJ7 B;  4R8P D;  3AZG B;  4JJN A;  1P3P B;  3AZM D;  5F99 C;  1M18 D;  1KX4 C;  2F8N G;  5CPI B;  4G91 C;  4XZQ D;  3X1T C;  3AZI C;  4WZS B;  3B0C W;  2F8N D;  4YM6 A;  4X23 A;  5B1L B;  1ZLA C;  5BS7 A;  3TU4 B;  3AZJ A;  4EO5 C;  4Z66 B;  3W98 C;  5AV5 C;  3AV1 B;  1P3I A;  2NQB C;  2ARO C;  5AV6 B;  1KX5 B;  3A6N C;  4KGC D;  5CP6 D;  4J8X A;  5BO0 B;  1KX3 A;  4J8W B;  1BH9 B;  3B0B A;  5DNN C;  5B40 A;  3REI A;  1AOI A;  3W99 B;  3MNN A;  3MVD A;  3UT9 B;  2YFV B;  4R8P C;  3X1U D;  5F99 A;  3AZM C;  1KX4 A;  1M18 C;  3X1T A;  3LEL D;  4XZQ C;  3NQJ A;  3AZI A;  3AYW B;  4CSR A;  4JJN B;  1U35 C;  3UTA D;  1ZLA A;  3B6G B;  4WNN B;  4ZBJ B;  3AFA B;  3W98 A;  5AV5 A;  4X23 B;  2NQB A;  2ARO A;  3B0D C;  3A6N A;  3AZG D;  4KGC C;  5BNX B;  5CPI D;  5DNN A;  2L5A A;  3R45 A;  5G49 B;  5BNV A;  4J8X B;  4R8P A;  3AZM A;  3TU4 D;  1M18 A;  4Z66 D;  3MNN B;  3MVD B;  3AV1 D;  4XZQ A;  3LEL C;  3WAA D;  1P3O B;  2F8N A;  1U35 A;  1KX5 D;  5F99 B;  1KX4 B;  4G91 B;  3X1T B;  3AZI B;  4J8W D;  4DRB A;  4CSR B;  1ZLA B;  3WTP B;  3UT9 D;  4KGC A;  3AZG C;  1ID3 C;  4NE3 A;  3X1S B;  3AYW D;  3B6G D;  5DNN B;  4NE5 A;  3X1U A;  3TU4 C;  3AFA D;  3LEL A;  3WAA C;  3REK A;  1M1A C;  1M18 B;  3LZ1 B;  3MGS D;  3V9R A;  3X1V B;  4J8W C;  1U35 B;  4WU8 C;  3WKJ D;  1P3G C;  4J8X D;  2BYK A;  3AZG A;  5B2I C;  1ID3 A;  4YS3 D;  3MVD D;  5CHL B;  3AYW C;  4WU9 B;  5JA4 B;  1P3O D;  4KGC B;  1KX4 D;  3X1T D;  3B6G C;  3TU4 A;  3AFA C;  5FUG A;  4H9P A;  3AV1 A;  2YFW B;  3NQU A;  3WAA A;  3WTP D;  5B2J B;  3AZK D;  3LEL B;  3MGS C;  4J8W A;  1N1J A;  3X1S D;  4WU8 A;  1BH9 A;  3WKJ C;  3REL C;  1BFM A;  5GXQ D;  1P3L B;  5B1M D;  3V9R B;  5B2I A;  5JRG D;  4YS3 C;  2BYK B;  5AY8 C;  4XUJ C;  3AYW A;  3AN2 B;  3REH C;  1P3O C;  5AV8 C;  1ID3 B;  3LJA B;  3WA9 C;  3LZ1 D;  3B6G A;  4WNN A;  3X1V D;  3AFA A;  1TAF A;  5AV9 B;  5B31 G;  1U35 D;  3AZN B;  2CWE A;  2IO5 C;  3WTP C;  5B31 D;  4CAY A;  3MGQ C;  5FUG B;  3C1B C;  4H9P B;  3MGS A;  3C1C D;  3AZK C;  3WAA B;  3NQU B;  1BH8 B;  5BNX A;  5B32 C;  3X1S C;  1M1A B;  4WU9 D;  3WKJ A;  5G49 A;  3MGP C;  5GXQ C;  5B1M C;  1N1J B;  4WU8 B;  5B0Y D;  5AVB C;  1P3G B;  4YS3 A;  5JRG C;  3VH6 A;  5AY8 A;  4XUJ A;  1P3O A;  5B2I B;  1WWI A;  5B2J D;  5AV8 A;  1M19 C;  3WA9 A;  4NFT A;  3LZ1 C;  3X1V C;  3MGR D;  4KHA B;  3WTP A;  3AZE C;  1P3L D;  5B31 C;  3MGQ A;  1TAF B;  3C1B A;  3AZK A;  4Z2M G;  3C1C C;  3X1S A;  5B32 A;  4CAY B;  1TZY D;  3AN2 D;  4WU9 C;  3MGP A;  5GXQ A;  3MGS B;  5B1M A;  3LJA D;  1ID3 D;  3WKJ B;  5AVB A;  5B0Y C;  5AV9 D;  3REL B;  5JRG A;  3AZN D;  3KXB C;  3AZF D;  5B2J C;  2F8N H;  4YS3 B;  3LZ1 A;  5AY8 B;  4XUJ B;  3X1V A;  3REH B;  2PYO C;  5AV8 B;  3MGR C;  1M1A D;  3WA9 B;  3AZE A;  5B31 A;  5KDM B;  1P3L C;  5B33 B;  4H9N B;  4WU8 D;  3C1C A;  1P3G D;  2IO5 B;  1P3F D;  4WU9 A;  5JA4 A;  1TZY C;  3MGQ B;  3AN2 C;  3C1B B;  5B2I D;  3AZK B;  2NZD D;  4H9O B;  3LJA C;  4J8U C;  5B32 B;  5B0Y A;  3AZL C;  5AV9 C;  5B0Z D;  3MGP B;  5GXQ B;  3AZN C;  5B1M B;  3KXB A;  2YFW A;  3AZF C;  1ULY A;  5E5A D;  5B2J A;  5AVB B;  1HTA A;  5JRG B;  4AWL C;  3MGR A;  1M19 B;  1Q9C A;  1P3L A;  2HIO D;  3REJ B;  4QLC B;  3REL D;  3AZE B;  5B31 B;  1P3F C;  1H3O A;  1TZY A;  3AN2 A;  4H9N A;  3C1C B;  3LJA A;  3AV2 C;  2NZD C;  5C3I C;  4J8U A;  4Z5T C;  5AY8 D;  4XUJ D;  3AZL A;  2LY8 A;  3REH D;  3VH5 A;  5AV9 A;  5BT1 D;  3REK C;  5B0Z C;  3AZN A;  5AV8 D;  3WA9 D;  3AZF A;  4NE6 A;  5E5A C;  5B33 D;  5B0Y B;  3UTB D;  4KUD D;  3KXB B;  1BH8 A;  1M1A A;  3MGQ D;  3C1B D;  5B32 G;  2HIO C;  3VH6 T;  2PYO B;  5B32 D;  3MGR B;  3WTP E;  5GSU B;  1P3G A;  3MGP D;  1P3F A;  4J8V C;  1JFI B;  2NZD A;  5CPJ D;  3AV2 A;  5AVB D;  1P3A D;  4Z5T A;  3AZH D;  1B67 A;  1H3O B;  1HQ3 D;  3LZ0 B;  1TZY B;  5B0Z A;  5BT1 C; 
#chains in the Genus database with same CATH topology
 2ZY3 A;  1M19 D;  1WWS A;  4KHA A;  4J8U B;  5E5A A;  5B24 D;  3REJ D;  3AZL B;  5B33 C;  4ZUX B;  4QLC D;  3KSY A;  3UTB C;  4KUD C;  3AZF B;  2G5I C;  1P3I C;  3AZE D;  4G92 C;  5GT0 C;  3O62 D;  1P3M B;  3B6F C;  2HIO A;  4AWL B;  3W97 D;  3KWQ D;  5B40 C;  3REL A;  2F8N K;  4J8V A;  1A7W A;  2ZY4 A;  4HGA C;  5CPK B;  5CPJ C;  1P3A C;  1P3F B;  3AZH C;  1F66 B;  1HQ3 C;  3KXB D;  4WV4 B;  3REH A;  5AVC D;  2NZD B;  3AV2 B;  5C3I B;  4Z5T B;  4E44 A;  5KDM A;  5B24 C;  5B33 A;  3REJ C;  3REK B;  4QLC C;  5B0Z B;  2PYO D;  3UTB A;  5GSU D;  4KUD A;  2RVQ C;  5E5A B;  4H9R B;  1P3B C;  5GT0 A;  4UUZ B;  3O62 C;  3B6F A;  4H9O A;  3EPK A;  3KUY B;  3W97 C;  4DQY B;  3LZ0 D;  3KWQ C;  1P3K C;  1EQZ C;  5GT3 B;  2RIQ A;  2HIO B;  4LD9 D;  4J8U D;  3AZL D;  5CPJ A;  4ZUX D;  1P3A A;  3AZH A;  4J8V B;  1HQ3 A;  3W96 D;  1S32 B;  4E45 A;  3VH6 W;  5AVC C;  2CV5 D;  1P34 D;  1M19 A;  5DNM D;  1P3M D;  5B24 A;  3REJ A;  4QLC A;  2HUE C;  5GSU C;  4YM6 B;  2Y2L A;  4DRA A;  1P3B A;  3H0M C;  3O62 A;  3AZJ B;  2FJ7 D;  3VH5 T;  5CPK D;  3UTB B;  1P3P D;  4KUD B;  5CP6 C;  3W97 A;  1P3I B;  2Y2M A;  3KWQ A;  4G92 B;  3LZ0 C;  5GT0 B;  1P3K A;  1EQZ A;  1F66 D;  2Y2H A;  3B6F B;  3AV2 D;  4LD9 C;  1KX3 B;  5B1L D;  4Z5T D;  5B40 B;  3X1U C;  3REK D;  4ZUX C;  4H9S C;  3REI B;  1AOI B;  2BYM A;  1R4V A;  3W96 C;  3AL0 C;  5AVC A;  2CV5 C;  1P34 C;  4HGA B;  4M6B A;  5AV6 D;  5CPJ B;  5DNM C;  1P3A B;  1P3M C;  3UTA C;  3AZH B;  1HQ3 B;  3KUY D;  3NQJ B;  2PYO A;  5GSU A;  3W99 D;  5GT3 D;  5B24 B;  1JFI A;  1F1E A;  2JSS A;  4EO5 B;  3B0C T;  2FJ7 C;  4Z2M H;  3W98 B;  5AV5 B;  5CPK C;  5CP6 A;  1P3P C;  4J8V D;  1P3B B;  3LZ0 A;  5CPI C;  2ARO B;  1F66 C;  1S32 D;  2NQB B;  3O62 B;  3A6N B;  1B6W A;  4JJN D;  4LD9 A;  3W97 B;  5B1L C;  3KWQ B;  1P3K B;  1EQZ B;  4ZUX A;  4H9S A;  3A1K A;  3R45 B;  4H9Q A;  4Z66 C;  3W96 A;  3AV1 C;  5BNV B;  4YM6 D;  4X23 D;  2CV5 A;  1P34 A;  4R8P B;  5DNM A;  2XD1 A;  5AV6 C;  3AZJ D;  3AZM B;  2JCH A;  3UTA A;  1P3M A;  2BYM B;  1KX5 C;  4XZQ B;  5AVC B;  3KUY C;  1P3I D;  2F8N B;  5GT0 D;  3W99 C;  3B6F D;  5GT3 C;  1KX3 D;  2FJ7 A;  2ZM5 A;  3UT9 C;  5CPK A;  2HUE B;  1P3P A;  5B40 D;  1AOI D;  3REI D;  3MNN D;  5CPI A;  1F66 A;  3B0D B;  1S32 C;  4JJN C;  5CP6 B;  3EPJ A;  5F99 D;  5B1L A;  3AZI D;  2W8S A;  4ZBJ C;  4Z66 A;  3VH5 W;  4LD9 B;  4YM6 C;  4X23 C;  1ZLA D;  4H9R A;  5BS7 C;  5AV6 A;  1KX5 A;  3X1U B;  4UUZ A;  3AZJ C;  1KU5 A;  4H9Q B;  3W98 D;  5AV5 D;  3W96 B;  5BO0 A;  2RVQ D;  3KUY A;  2CV5 B;  1P34 B;  2NQB D;  1P3B D;  2ARO D;  5DNM B;  3W99 A;  3A6N D;  5GT3 A;  3UTA B;  4J8X C;  1KX3 C;  3UT9 A;  2YFV A;  1P3K D;  2VQR A;  2Y2K A;  5DNN D;  1EQZ D;  1AOI C;  3REI C;  3MNN C;  3H0R C;  3MVD C;  1S32 A;  2UWX A;  2FJ7 B;  4R8P D;  3AZG B;  4JJN A;  1P3P B;  3AZM D;  5F99 C;  1M18 D;  1KX4 C;  2F8N G;  5CPI B;  4G91 C;  4XZQ D;  3X1T C;  3AZI C;  4WZS B;  3B0C W;  2F8N D;  4YM6 A;  4X23 A;  5B1L B;  2G5H C;  1ZLA C;  5BS7 A;  3TU4 B;  3AZJ A;  4EO5 C;  4Z66 B;  3W98 C;  5AV5 C;  3AV1 B;  1P3I A;  2NQB C;  2ARO C;  5AV6 B;  1KX5 B;  3A6N C;  4KGC D;  5CP6 D;  4J8X A;  5BO0 B;  1KX3 A;  4J8W B;  1BH9 B;  3B0B A;  5DNN C;  5B40 A;  3REI A;  1AOI A;  3W99 B;  3MNN A;  3MVD A;  3UT9 B;  2YFV B;  4R8P C;  3X1U D;  5F99 A;  3AZM C;  1KX4 A;  1M18 C;  3X1T A;  3LEL D;  4XZQ C;  3NQJ A;  3AZI A;  3AYW B;  4CSR A;  4JJN B;  1U35 C;  2Y2I A;  3UTA D;  1ZLA A;  3B6G B;  4WNN B;  4ZBJ B;  3AFA B;  3W98 A;  1W2E A;  5AV5 A;  4X23 B;  2NQB A;  2ARO A;  3B0D C;  3A6N A;  2Y2Q A;  3AZG D;  4KGC C;  3IP4 C;  5BNX B;  5CPI D;  4WJ3 C;  5DNN A;  2L5A A;  3R45 A;  5G49 B;  5BNV A;  4J8X B;  2JE5 A;  4R8P A;  3AZM A;  2ZY5 A;  3TU4 D;  1M18 A;  4Z66 D;  3MNN B;  3MVD B;  3AV1 D;  4XZQ A;  3LEL C;  3WAA D;  2Y2O A;  1P3O B;  2F8N A;  1U35 A;  1KX5 D;  5F99 B;  1T3U A;  1KX4 B;  4G91 B;  3X1T B;  3AZI B;  4J8W D;  4DRB A;  4CSR B;  2F2A C;  1ZLA B;  3WTP B;  3UT9 D;  4KGC A;  3AZG C;  1ID3 C;  4NE3 A;  3X1S B;  3AYW D;  1PZR A;  3B6G D;  5DNN B;  4NE5 A;  3X1U A;  3TU4 C;  3AFA D;  3LEL A;  2Y2N A;  3WAA C;  2Y2P A;  3REK A;  1M1A C;  1M18 B;  3LZ1 B;  3MGS D;  3V9R A;  3X1V B;  4J8W C;  1U35 B;  4WU8 C;  3WKJ D;  1P3G C;  4J8X D;  2BYK A;  3AZG A;  1Z2C B;  5B2I C;  1ID3 A;  4YS3 D;  3MVD D;  5CHL B;  3AYW C;  4WU9 B;  5JA4 B;  1P3O D;  4KGC B;  1KX4 D;  3X1T D;  3B6G C;  3TU4 A;  3AFA C;  5FUG A;  4H9P A;  3AV1 A;  2YFW B;  3NQU A;  3WAA A;  3WTP D;  5B2J B;  2DF4 C;  3AZK D;  3LEL B;  3MGS C;  2BG1 A;  4J8W A;  1N1J A;  3H0L C;  3X1S D;  4WU8 A;  1BH9 A;  3WKJ C;  3REL C;  1BFM A;  5GXQ D;  1P3L B;  5B1M D;  3EPL A;  3V9R B;  5B2I A;  5JRG D;  4YS3 C;  2BYK B;  5AY8 C;  4XUJ C;  3AYW A;  3AN2 B;  3REH C;  1P3O C;  5AV8 C;  1ID3 B;  3LJA B;  3WA9 C;  3LZ1 D;  3B6G A;  4WNN A;  3X1V D;  3AFA A;  1TAF A;  5AV9 B;  4UPK A;  5B31 G;  1U35 D;  3AZN B;  2CWE A;  3P5J B;  2IO5 C;  3A1I A;  5B31 D;  3WTP C;  4CAY A;  3MGQ C;  5FUG B;  3C1B C;  4H9P B;  3MGS A;  3C1C D;  3AZK C;  3F6T A;  3WAA B;  3NQU B;  1BH8 B;  5BNX A;  5B32 C;  2Y2J A;  3X1S C;  1M1A B;  4WU9 D;  3WKJ A;  5G49 A;  3MGP C;  5GXQ C;  5B1M C;  1N1J B;  4WU8 B;  3EPH A;  5B0Y D;  5AVB C;  1P3G B;  4YS3 A;  5JRG C;  3VH6 A;  5AY8 A;  4XUJ A;  1P3O A;  5B2I B;  5B2J D;  1WWI A;  5AV8 A;  1M19 C;  3WA9 A;  4NFT A;  3LZ1 C;  3X1V C;  2DQN C;  3MGR D;  4KHA B;  3WTP A;  3AZE C;  1P3L D;  5B31 C;  3FDD A;  3MGQ A;  1TAF B;  3C1B A;  3AZK A;  4Z2M G;  3C1C C;  3X1S A;  5B32 A;  2J8P A;  1TZY D;  4CAY B;  3AN2 D;  4WU9 C;  3MGP A;  5GXQ A;  3MGS B;  5B1M A;  3LJA D;  1ID3 D;  3WKJ B;  2XD5 A;  5AVB A;  5B0Y C;  5AV9 D;  3REL B;  5JRG A;  3AZN D;  3KXB C;  3AZF D;  5B2J C;  2F8N H;  4YS3 B;  3LZ1 A;  5AY8 B;  4XUJ B;  3X1V A;  3REH B;  2PYO C;  5AV8 B;  3MGR C;  1M1A D;  3WA9 B;  3AZE A;  5B31 A;  5KDM B;  1P3L C;  5B33 B;  4H9N B;  4WU8 D;  3C1C A;  1P3G D;  2IO5 B;  1P3F D;  4WU9 A;  5JA4 A;  1TZY C;  3MGQ B;  3AN2 C;  3C1B B;  5B2I D;  3AZK B;  2NZD D;  4H9O B;  3LJA C;  4J8U C;  5B32 B;  5B0Y A;  3AZL C;  5AV9 C;  5B0Z D;  3MGP B;  5GXQ B;  3AZN C;  5B1M B;  3KXB A;  2YFW A;  3AZF C;  1ULY A;  5E5A D;  2Y2G A;  5B2J A;  5AVB B;  1HTA A;  5JRG B;  4AWL C;  3MGR A;  1M19 B;  3KFU G;  1Q9C A;  1P3L A;  2HIO D;  3REJ B;  4QLC B;  3REL D;  3AZE B;  5B31 B;  1P3F C;  1H3O A;  1TZY A;  3AN2 A;  4H9N A;  3C1C B;  3LJA A;  3AV2 C;  2NZD C;  5C3I C;  4J8U A;  4Z5T C;  5AY8 D;  4XUJ D;  3AZL A;  2LY8 A;  3REH D;  3VH5 A;  5AV9 A;  5BT1 D;  3REK C;  5B0Z C;  3AZN A;  5AV8 D;  2ZY2 A;  3WA9 D;  3AZF A;  4NE6 A;  5E5A C;  5B33 D;  5B0Y B;  3EG5 B;  3UTB D;  4KUD D;  3KXB B;  1BH8 A;  2FFF B;  1M1A A;  3MGQ D;  3C1B D;  5B32 G;  2HIO C;  3VH6 T;  2PYO B;  5B32 D;  3MGR B;  3WTP E;  5GSU B;  1P3G A;  3MGP D;  1P3F A;  4J8V C;  1JFI B;  2NZD A;  5CPJ D;  3AV2 A;  5AVB D;  1P3A D;  4Z5T A;  3AZH D;  1B67 A;  1H3O B;  1HQ3 D;  3LZ0 B;  1TZY B;  5B0Z A;  5BT1 C; 
#chains in the Genus database with same CATH homology
 2ZY3 A;  1M19 D;  1WWS A;  4KHA A;  4J8U B;  5E5A A;  5B24 D;  3REJ D;  3AZL B;  5B33 C;  4ZUX B;  4QLC D;  3KSY A;  3UTB C;  4KUD C;  3AZF B;  2G5I C;  1P3I C;  3AZE D;  4G92 C;  5GT0 C;  3O62 D;  1P3M B;  3B6F C;  2HIO A;  4AWL B;  3W97 D;  3KWQ D;  5B40 C;  3REL A;  2F8N K;  4J8V A;  1A7W A;  2ZY4 A;  4HGA C;  5CPK B;  5CPJ C;  1P3A C;  1P3F B;  3AZH C;  1F66 B;  1HQ3 C;  3KXB D;  4WV4 B;  3REH A;  5AVC D;  2NZD B;  3AV2 B;  5C3I B;  4Z5T B;  4E44 A;  5KDM A;  5B24 C;  5B33 A;  3REJ C;  3REK B;  4QLC C;  5B0Z B;  2PYO D;  3UTB A;  5GSU D;  4KUD A;  2RVQ C;  5E5A B;  4H9R B;  1P3B C;  5GT0 A;  4UUZ B;  3O62 C;  3B6F A;  4H9O A;  3EPK A;  3KUY B;  3W97 C;  4DQY B;  3LZ0 D;  3KWQ C;  1P3K C;  1EQZ C;  5GT3 B;  2RIQ A;  2HIO B;  4LD9 D;  4J8U D;  3AZL D;  5CPJ A;  4ZUX D;  1P3A A;  3AZH A;  4J8V B;  1HQ3 A;  3W96 D;  1S32 B;  4E45 A;  3VH6 W;  5AVC C;  2CV5 D;  1P34 D;  1M19 A;  5DNM D;  1P3M D;  5B24 A;  3REJ A;  4QLC A;  2HUE C;  5GSU C;  4YM6 B;  2Y2L A;  4DRA A;  1P3B A;  3H0M C;  3O62 A;  3AZJ B;  2FJ7 D;  3VH5 T;  5CPK D;  3UTB B;  1P3P D;  4KUD B;  5CP6 C;  3W97 A;  1P3I B;  2Y2M A;  3KWQ A;  4G92 B;  3LZ0 C;  5GT0 B;  1P3K A;  1EQZ A;  1F66 D;  2Y2H A;  3B6F B;  3AV2 D;  4LD9 C;  1KX3 B;  5B1L D;  4Z5T D;  5B40 B;  3X1U C;  3REK D;  4ZUX C;  4H9S C;  3REI B;  1AOI B;  2BYM A;  1R4V A;  3W96 C;  3AL0 C;  5AVC A;  2CV5 C;  1P34 C;  4HGA B;  4M6B A;  5AV6 D;  5CPJ B;  5DNM C;  1P3A B;  1P3M C;  3UTA C;  3AZH B;  1HQ3 B;  3KUY D;  3NQJ B;  2PYO A;  5GSU A;  3W99 D;  5GT3 D;  5B24 B;  1JFI A;  1F1E A;  2JSS A;  4EO5 B;  3B0C T;  2FJ7 C;  4Z2M H;  3W98 B;  5AV5 B;  5CPK C;  5CP6 A;  1P3P C;  4J8V D;  1P3B B;  3LZ0 A;  5CPI C;  2ARO B;  1F66 C;  1S32 D;  2NQB B;  3O62 B;  3A6N B;  1B6W A;  4JJN D;  4LD9 A;  3W97 B;  5B1L C;  3KWQ B;  1P3K B;  1EQZ B;  4ZUX A;  4H9S A;  3A1K A;  3R45 B;  4H9Q A;  4Z66 C;  3W96 A;  3AV1 C;  5BNV B;  4YM6 D;  4X23 D;  2CV5 A;  1P34 A;  4R8P B;  5DNM A;  2XD1 A;  5AV6 C;  3AZJ D;  3AZM B;  2JCH A;  3UTA A;  1P3M A;  2BYM B;  1KX5 C;  4XZQ B;  5AVC B;  3KUY C;  1P3I D;  2F8N B;  5GT0 D;  3W99 C;  3B6F D;  5GT3 C;  1KX3 D;  2FJ7 A;  2ZM5 A;  3UT9 C;  5CPK A;  2HUE B;  1P3P A;  5B40 D;  1AOI D;  3REI D;  3MNN D;  5CPI A;  1F66 A;  3B0D B;  1S32 C;  4JJN C;  5CP6 B;  3EPJ A;  5F99 D;  5B1L A;  3AZI D;  2W8S A;  4ZBJ C;  4Z66 A;  3VH5 W;  4LD9 B;  4YM6 C;  4X23 C;  1ZLA D;  4H9R A;  5BS7 C;  5AV6 A;  1KX5 A;  3X1U B;  4UUZ A;  3AZJ C;  1KU5 A;  4H9Q B;  3W98 D;  5AV5 D;  3W96 B;  5BO0 A;  2RVQ D;  3KUY A;  2CV5 B;  1P34 B;  2NQB D;  1P3B D;  2ARO D;  5DNM B;  3W99 A;  3A6N D;  5GT3 A;  3UTA B;  4J8X C;  1KX3 C;  3UT9 A;  2YFV A;  1P3K D;  2VQR A;  2Y2K A;  5DNN D;  1EQZ D;  1AOI C;  3REI C;  3MNN C;  3H0R C;  3MVD C;  1S32 A;  2UWX A;  2FJ7 B;  4R8P D;  3AZG B;  4JJN A;  1P3P B;  3AZM D;  5F99 C;  1M18 D;  1KX4 C;  2F8N G;  5CPI B;  4G91 C;  4XZQ D;  3X1T C;  3AZI C;  4WZS B;  3B0C W;  2F8N D;  4YM6 A;  4X23 A;  5B1L B;  2G5H C;  1ZLA C;  5BS7 A;  3TU4 B;  3AZJ A;  4EO5 C;  4Z66 B;  3W98 C;  5AV5 C;  3AV1 B;  1P3I A;  2NQB C;  2ARO C;  5AV6 B;  1KX5 B;  3A6N C;  4KGC D;  5CP6 D;  4J8X A;  5BO0 B;  1KX3 A;  4J8W B;  1BH9 B;  3B0B A;  5DNN C;  5B40 A;  3REI A;  1AOI A;  3W99 B;  3MNN A;  3MVD A;  3UT9 B;  2YFV B;  4R8P C;  3X1U D;  5F99 A;  3AZM C;  1KX4 A;  1M18 C;  3X1T A;  3LEL D;  4XZQ C;  3NQJ A;  3AZI A;  3AYW B;  4CSR A;  4JJN B;  1U35 C;  2Y2I A;  3UTA D;  1ZLA A;  3B6G B;  4WNN B;  4ZBJ B;  3AFA B;  3W98 A;  1W2E A;  5AV5 A;  4X23 B;  2NQB A;  2ARO A;  3B0D C;  3A6N A;  2Y2Q A;  3AZG D;  4KGC C;  3IP4 C;  5BNX B;  5CPI D;  4WJ3 C;  5DNN A;  2L5A A;  3R45 A;  5G49 B;  5BNV A;  4J8X B;  2JE5 A;  4R8P A;  3AZM A;  2ZY5 A;  3TU4 D;  1M18 A;  4Z66 D;  3MNN B;  3MVD B;  3AV1 D;  4XZQ A;  3LEL C;  3WAA D;  2Y2O A;  1P3O B;  2F8N A;  1U35 A;  1KX5 D;  5F99 B;  1T3U A;  1KX4 B;  4G91 B;  3X1T B;  3AZI B;  4J8W D;  4DRB A;  4CSR B;  2F2A C;  1ZLA B;  3WTP B;  3UT9 D;  4KGC A;  3AZG C;  1ID3 C;  4NE3 A;  3X1S B;  3AYW D;  1PZR A;  3B6G D;  5DNN B;  4NE5 A;  3X1U A;  3TU4 C;  3AFA D;  3LEL A;  2Y2N A;  3WAA C;  2Y2P A;  3REK A;  1M1A C;  1M18 B;  3LZ1 B;  3MGS D;  3V9R A;  3X1V B;  4J8W C;  1U35 B;  4WU8 C;  3WKJ D;  1P3G C;  4J8X D;  2BYK A;  3AZG A;  1Z2C B;  5B2I C;  1ID3 A;  4YS3 D;  3MVD D;  5CHL B;  3AYW C;  4WU9 B;  5JA4 B;  1P3O D;  4KGC B;  1KX4 D;  3X1T D;  3B6G C;  3TU4 A;  3AFA C;  5FUG A;  4H9P A;  3AV1 A;  2YFW B;  3NQU A;  3WAA A;  3WTP D;  5B2J B;  2DF4 C;  3AZK D;  3LEL B;  3MGS C;  2BG1 A;  4J8W A;  1N1J A;  3H0L C;  3X1S D;  4WU8 A;  1BH9 A;  3WKJ C;  3REL C;  1BFM A;  5GXQ D;  1P3L B;  5B1M D;  3EPL A;  3V9R B;  5B2I A;  5JRG D;  4YS3 C;  2BYK B;  5AY8 C;  4XUJ C;  3AYW A;  3AN2 B;  3REH C;  1P3O C;  5AV8 C;  1ID3 B;  3LJA B;  3WA9 C;  3LZ1 D;  3B6G A;  4WNN A;  3X1V D;  3AFA A;  1TAF A;  5AV9 B;  4UPK A;  5B31 G;  1U35 D;  3AZN B;  2CWE A;  3P5J B;  2IO5 C;  3A1I A;  5B31 D;  3WTP C;  4CAY A;  3MGQ C;  5FUG B;  3C1B C;  4H9P B;  3MGS A;  3C1C D;  3AZK C;  3F6T A;  3WAA B;  3NQU B;  1BH8 B;  5BNX A;  5B32 C;  2Y2J A;  3X1S C;  1M1A B;  4WU9 D;  3WKJ A;  5G49 A;  3MGP C;  5GXQ C;  5B1M C;  1N1J B;  4WU8 B;  3EPH A;  5B0Y D;  5AVB C;  1P3G B;  4YS3 A;  5JRG C;  3VH6 A;  5AY8 A;  4XUJ A;  1P3O A;  5B2I B;  5B2J D;  1WWI A;  5AV8 A;  1M19 C;  3WA9 A;  4NFT A;  3LZ1 C;  3X1V C;  2DQN C;  3MGR D;  4KHA B;  3WTP A;  3AZE C;  1P3L D;  5B31 C;  3FDD A;  3MGQ A;  1TAF B;  3C1B A;  3AZK A;  4Z2M G;  3C1C C;  3X1S A;  5B32 A;  2J8P A;  1TZY D;  4CAY B;  3AN2 D;  4WU9 C;  3MGP A;  5GXQ A;  3MGS B;  5B1M A;  3LJA D;  1ID3 D;  3WKJ B;  2XD5 A;  5AVB A;  5B0Y C;  5AV9 D;  3REL B;  5JRG A;  3AZN D;  3KXB C;  3AZF D;  5B2J C;  2F8N H;  4YS3 B;  3LZ1 A;  5AY8 B;  4XUJ B;  3X1V A;  3REH B;  2PYO C;  5AV8 B;  3MGR C;  1M1A D;  3WA9 B;  3AZE A;  5B31 A;  5KDM B;  1P3L C;  5B33 B;  4H9N B;  4WU8 D;  3C1C A;  1P3G D;  2IO5 B;  1P3F D;  4WU9 A;  5JA4 A;  1TZY C;  3MGQ B;  3AN2 C;  3C1B B;  5B2I D;  3AZK B;  2NZD D;  4H9O B;  3LJA C;  4J8U C;  5B32 B;  5B0Y A;  3AZL C;  5AV9 C;  5B0Z D;  3MGP B;  5GXQ B;  3AZN C;  5B1M B;  3KXB A;  2YFW A;  3AZF C;  1ULY A;  5E5A D;  2Y2G A;  5B2J A;  5AVB B;  1HTA A;  5JRG B;  4AWL C;  3MGR A;  1M19 B;  3KFU G;  1Q9C A;  1P3L A;  2HIO D;  3REJ B;  4QLC B;  3REL D;  3AZE B;  5B31 B;  1P3F C;  1H3O A;  1TZY A;  3AN2 A;  4H9N A;  3C1C B;  3LJA A;  3AV2 C;  2NZD C;  5C3I C;  4J8U A;  4Z5T C;  5AY8 D;  4XUJ D;  3AZL A;  2LY8 A;  3REH D;  3VH5 A;  5AV9 A;  5BT1 D;  3REK C;  5B0Z C;  3AZN A;  5AV8 D;  2ZY2 A;  3WA9 D;  3AZF A;  4NE6 A;  5E5A C;  5B33 D;  5B0Y B;  3EG5 B;  3UTB D;  4KUD D;  3KXB B;  1BH8 A;  2FFF B;  1M1A A;  3MGQ D;  3C1B D;  5B32 G;  2HIO C;  3VH6 T;  2PYO B;  5B32 D;  3MGR B;  3WTP E;  5GSU B;  1P3G A;  3MGP D;  1P3F A;  4J8V C;  1JFI B;  2NZD A;  5CPJ D;  3AV2 A;  5AVB D;  1P3A D;  4Z5T A;  3AZH D;  1B67 A;  1H3O B;  1HQ3 D;  3LZ0 B;  1TZY B;  5B0Z A;  5BT1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...