3O62B

Nucleosome core particle modified with a cisplatin 1,3-cis-{pt(nh3)2}2+-d(gptpg) intrastrand cross-link
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Consequences of Cisplatin binding on nucleosome structure and dynamics.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 24
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3o62B00
2NZDB 5B0YC 3MGQA 4HGAB 2AROB 1M18D 3W97D 5B31A 3X1TB 2FJ7B 2F8NA 5B24B 1U35D 5E5AC 5BNVB 5GXQA 5B2JB 5C3IB 5B2ID 3LELC 4Z66A 3AZHA 1ID3B 2L5AA 5B40D 3MGSA 1P3OA 1P3PD 5GT0A 3KXBD 1HQ3A 3WA9B 1B6WA 1P34D 1S32B 3VH6T 4KUDC 5AV6D 5AV8B 4KHAA 3TU4B 1F66C 4X23A 3AZGA 5CP6C 5AV5A 5AV9C 4G91B 3REID 3UTAD 3W98C 3AZFA 1M18B 3W97B 4HGAC 2AROC 4H9NB 3X1TC 5GSUD 1JFIB 2BYKA 5B24C 5B2IB 3AZIA 5B2JC 3AZMC 5B31D 3R45A 5B40B 1ID3C 4Z5TC 1P3PB 3LZ0A 5AVBA 4NFTA 1KX4A 4Z66D 1P34B 4NE5A 3REJA 3MGSD 5GT3A 1P3OD 1AOIC 5G49B 5F99D 5AV8C 3AV2C 4CSRB 1HQ3D 3REIB 3B6GD 1KX3B 3UTAB 3REHA 4G91C 2F8NH 2RVQC 1H3OA 3MGRC 1M19C 4X23D 5B1MD 3AZGD 3W97C 4XZQB 5B1LA 4KGCC 3AFAD 5AY8A 3MVDA 3W96D 3WKJA 3VH5A 2NZDA 3KUYA 1BH8B 5B31B 5B0ZD 3AZEC 2NQBD 5GXQB 5B40C 4Z66B 5CPJD 4XUJD 3AZHB 3AZID 4J8UD 2IO5B 3MGSB 4YM6D 1P3OB 5F99B 4YS3A 1HQ3B 3LZ0D 5AVBD 3B6GB 5JRGC 3REIC 3WAAD 5BS7A 3REJD 1KX3C 3UTAC 1S32A 4X23B 5B1MB 5GT3D 3AZGB 5B33C 3VH5T 3AFAB 3W96B 4XZQC 3REKC 3LJAD 3MGQC 2LY8A 1P3IA 4J8XA 5B0ZB 1P3AD 5B31C 4H9NA 2BYKB 1U35A 1TZYA 5GXQC 3AZIB 1JFIA 3KUYD 5B2IA 1ULYA 3AZHC 4WU8C 2IO5C 3RELC 4J8WC 3MGSC 3LZ0B 4H9RB 5AVBB 4ZUXD 1P3PA 5B32G 5GT0C 3KXBA 3WAAB 3REJB 3A6NC 5GT3B 5AV6A 3UTBC 4YS3D 2YFVA 4Z2MH 4H9SA 4G92B 5DNNA 4X23C 3AZGC 3AYWD 4CSRA 5AV5C 4DRBA 3B0DC 1H3OB 3X1UD 1KU5A 3AZFC 3AV1D 4H9OB 5AY8B 3MVDB 5GSUA 3WTPD 3LZ1A 3KUYB 1P3ID 4J8XD 1P3BA 1KX5D 1BH8A 2HIOC 3AN2A 3NQJA 1TZYD 4R8PC 3LZ0C 5AVBC 1KX4C 5B32D 3AZJD 2CV5D 4YS3B 4QLCC 1P3KD 5GT3C 5F99A 3W99A 3O62A 4G92C 4AWLB 3UT9D 3B6GA 4J8VD 2PYOD 3REHC 3AZLD 5B1MA 5DNND 5B1LC 5CPIC 3AFAA 3WTPB 3W96A 5AY8C 3V9RA 3MVDC 1M1AD 2CWEA 3WKJC 2NZDC 1P3FD 1P3IB 4J8XB 1TAFB 5B0ZA 2F8NG 1P3LA 1U35B 1TZYB 1P3GC 2FJ7C 2NQBA 1A7WA 1EQZA 5CPKD 3LZ1D 4WU9A 5BT1C 3B0CW 5CPJA 4XUJA 3AZJB 5CHLB 2CV5B 1P3BD 4J8UA 5C3IC 3AN2D 1P3KB 5AVCD 4YM6A 4YS3C 4EO5B 3KXBB 4H9RA 3UT9B 4J8VB 4E44A 5AV6B 3WA9C 3WAAA 2YFVB 4E45A 5BS7C 1S32C 3VH6W 5DNNB 3C1CA 3TU4C 3AZKD 3W99D 3O62D 4ZBJB 1P3FB 3LJAA 4UUZA 1M18C 1P3AA 5GSUB 4H9OA 3WTPE 5CPKB 3LZ1B 1U35C 5BO0A 3KWQD 1P3BB 5B2IC 3AN2B 3NQJB 5AVCB 1P3LD 1N1JA 4NE6A 3NQUA 1EQZD 3X1SD 4WU9D 4ZUXA 2BYMB 1P3PC 3KXBC 3C1BD 3AZND 4NE3A 1ZLAD 1B67A 3B6FD 1P34C 4KUDA 5AV6C 1P3MD 4LD9D 1F66A 3B0BA 3AZKB 3W99B 3O62B 3AYWA 5CP6A 4JJND 3X1UA 3C1CD 3AV1A 3V9RB 4Z2MG 5B0YD 5GSUC 3KWQB 3WTPA 1KX5A 1P3LB 2NQBB 1TAFA 1EQZB 5JA4B 3X1SB 5E5AD 4WU9B 5CPJB 4XUJB 3AZNB 4J8UB 1ZLAB 5B32A 4Z66C 3AZJA 4CAYA 4YM6B 2CV5A 1P3MB 4LD9B 1P3KA 1P3OC 1AOIA 4H9PA 5F99C 4H9QB 1HQ3C 4JJNB 3UT9A 4J8VA 3B6GC 2PYOA 3AZLA 4KUDD 3C1CB 1F66D 3MGRA 1M19A 5B1MC 5B0YB 5CP6D 4KGCA 3AFAC 1M1AA 3W96C 5AV9D 3LJAB 4UUZB 1P3FA 3W98D 1P3AB 5B0ZC 5E5AB 3AZEA 5BO0B 2NQBC 5CPKA 1EQZC 5CPJC 5DNMA 4XUJC 5B2JD 3AZMD 3AZIC 4J8UC 1N1JB 3NQUB 5AVCA 4YM6C 1ID3D 4ZUXB 4Z5TD 2BYMA 4KUDB 3WAAC 3REJC 1F66B 1AOID 5KDMA 5AV8D 5CP6B 3AZKA 3AYWB 3AV2D 5AV9B 4DRAA 3REKA 3W98B 3X1UB 3LJAC 3AV1B 2RVQD 3MGRD 1M19D 1P3AC 4KGCD 3B0CT 3KWQA 5BNXA 1KX5B 3AZMB 3KUYC 5B31G 4WU8A 3RELA 3AZED 4Z5TB 4J8WA 3MNNA 1WWIA 5JA4A 3X1SA 4ZUXC 5B32B 5DNMD 1F1EA 4CAYB 3C1BA 3AZNA 1ZLAA 3B6FA 3X1VA 3A6NA 1P3MA 1AOIB 3UTBA 4H9PB 4LD9A 3AV2B 3AYWC 4H9QA 2PYOB 5JRGD 3AZLB 4AWLC 4JJNA 2F8NK 1KX3D 3MGRB 1M19B 3MGPA 3X1UC 5B33D 3AV1C 4KGCB 1M1AB 4WNNB 2YFWA 1P3GA 4XZQD 5B0YA 3REKD 1BH9B 3WTPC 3MGQD 1WWSA 1P3IC 4J8XC 1KX5C 3AZEB 5FUGB 2HIOA 2F8ND 5E5AA 1TZYC 3KSYA 5DNMB 5GXQD 4R8PA 3LELA 1HTAA 5B32C 3AZJC 3AZHD 2CV5C 4WU8D 3RELD 4QLCA 4J8WD 3MNND 1P3KC 4EO5C 5JRGB 5GT0D 3UT9C 4J8VC 3X1VD 3A6ND 2PYOC 3AZLC 5B33B 3UTBD 5KDMB 4H9SC 5DNNC 3REKB 5CPIA 5AV5D 5AV9A 1M1AC 3MGQB 2HUEB 4ZBJC 1Q9CA 1P3FC 1R4VA 3W98A 3MGPD 3AZFD 2AROA 2F8NB 1P3GD 3X1TA 2FJ7A 5BNXB 5CPKC 3LZ1C 5B24A 5BNVA 5DNMC 5B2JA 3AZMA 4WU8B 1P3BC 3RELB 2HIOD 4J8WB 3AN2C 3MNNB 5AVCC 1ID3A 4Z5TA 5GT0B 3C1BB 4R8PD 3B6FB 3X1VB 3LELD 1KX4D 3A6NB 3WA9A 3UTBB 4KHAB 4QLCD 5AV8A 3TU4A 3AV2A 3AZKC 3W99C 5AV5B 3O62C 3B0DB 3MGPB 3REHD 3AZFB 2HUEC 2YFWB 3W97A 1P3GB 3VH5W 1M18A 5B1LD 5CPID 5AY8D 4WNNA 3MVDD 3WKJD 2NZDD 1BH9A 3KWQC 2JSSA 2HIOB 3R45B 2AROD 1P3LC 3X1TD 5FUGA 2FJ7D 5B40A 3MNNC 4R8PB 5B24D 3X1SC 4WU9C 5BT1D 4WZSB 3LELB 1KX4B 3AZNC 3C1BC 1ZLAC 3B6FC 4QLCB 3X1VC 1P34A 4M6BA 4WV4B 1P3MC 4LD9C 1BFMA 5G49A 5JRGA 3REHB 3WA9D 3REIA 4JJNC 1KX3A 3UTAA 1S32D 3MGPC 5B33A 3C1CC 5B1LB 3TU4D 5CPIB 3VH6A 3WKJB 4XZQA
chains in the Genus database with same CATH superfamily
2NZDB 5B0YC 2VQRA 3MGQA 4HGAB 2AROB 1M18D 3W97D 5B31A 3X1TB 2FJ7B 2F8NA 2Y2GA 5B24B 5E5AC 1U35D 5BNVB 5GXQA 5B2JB 5C3IB 5B2ID 3LELC 4Z66A 3AZHA 1ID3B 2L5AA 5B40D 3MGSA 1P3OA 1P3PD 5GT0A 3KXBD 1HQ3A 3WA9B 1B6WA 3P5JB 1P34D 1S32B 3VH6T 4KUDC 5AV6D 5AV8B 4KHAA 3TU4B 1F66C 4X23A 2JE5A 3AZGA 5CP6C 5AV5A 4WJ3C 5AV9C 4G91B 3REID 2JCHA 3UTAD 3W98C 3AZFA 1M18B 3W97B 4HGAC 2AROC 4H9NB 3X1TC 5GSUD 3EPLA 1JFIB 2BYKA 5B24C 5B2IB 3IP4C 3AZIA 5B2JC 3AZMC 2DQNC 1PZRA 3KFUG 5B31D 3R45A 5B40B 1ID3C 4Z5TC 1P3PB 3LZ0A 5AVBA 4NFTA 1KX4A 4Z66D 1P34B 4NE5A 3FDDA 3REJA 3MGSD 5GT3A 1P3OD 1AOIC 5G49B 5F99D 5AV8C 3AV2C 4CSRB 1HQ3D 3REIB 3B6GD 1KX3B 3UTAB 3REHA 4G91C 2F8NH 2RVQC 1H3OA 3MGRC 1M19C 4X23D 5B1MD 3AZGD 2RIQA 3W97C 4XZQB 5B1LA 4KGCC 3AFAD 5AY8A 3MVDA 3W96D 3WKJA 3VH5A 2NZDA 3A1KA 3KUYA 1BH8B 5B31B 5B0ZD 2Y2HA 3AZEC 2NQBD 5GXQB 5B40C 4Z66B 5CPJD 4XUJD 3AZHB 3AZID 4J8UD 2IO5B 3MGSB 4YM6D 1P3OB 5F99B 4YS3A 1HQ3B 3LZ0D 5AVBD 3B6GB 5JRGC 3REIC 3WAAD 5BS7A 3REJD 1KX3C 3UTAC 1S32A 4X23B 5B1MB 5GT3D 3AZGB 5B33C 3VH5T 3AFAB 3W96B 4XZQC 3REKC 2G5IC 3LJAD 3MGQC 2LY8A 1P3IA 4J8XA 5B0ZB 1P3AD 5B31C 4H9NA 2BYKB 1U35A 2FFFB 1TZYA 5GXQC 3AZIB 1JFIA 2Y2KA 3KUYD 5B2IA 1ULYA 3AZHC 4WU8C 2IO5C 3RELC 2W8SA 4J8WC 3MGSC 3LZ0B 4H9RB 5AVBB 4ZUXD 1P3PA 5B32G 5GT0C 3KXBA 3WAAB 3REJB 3A6NC 5GT3B 5AV6A 3UTBC 4YS3D 2YFVA 4Z2MH 4H9SA 4G92B 5DNNA 4X23C 3AZGC 3AYWD 4CSRA 5AV5C 4DRBA 3B0DC 1H3OB 3H0RC 3X1UD 1KU5A 3AZFC 3AV1D 4H9OB 5AY8B 3MVDB 5GSUA 3WTPD 3LZ1A 3KUYB 1P3ID 4J8XD 1P3BA 1KX5D 1BH8A 2HIOC 3AN2A 3NQJA 1TZYD 2Y2LA 4R8PC 3LZ0C 5AVBC 1KX4C 5B32D 3AZJD 2CV5D 4YS3B 4QLCC 1P3KD 5GT3C 5F99A 2G5HC 3W99A 3O62A 4G92C 4AWLB 3UT9D 3B6GA 2Y2NA 4J8VD 2PYOD 3REHC 3AZLD 3H0LC 5B1MA 5DNND 2ZY4A 5B1LC 5CPIC 3AFAA 3WTPB 3W96A 5AY8C 3V9RA 3MVDC 1M1AD 2CWEA 3WKJC 2NZDC 1P3FD 1P3IB 4J8XB 1TAFB 5B0ZA 2F8NG 1P3LA 1U35B 1TZYB 1P3GC 2FJ7C 2NQBA 1A7WA 1EQZA 5CPKD 3LZ1D 4WU9A 5BT1C 3B0CW 5CPJA 4XUJA 3AZJB 5CHLB 2CV5B 1P3BD 4J8UA 5C3IC 1Z2CB 3AN2D 1P3KB 5AVCD 4YM6A 4YS3C 4EO5B 3KXBB 4H9RA 3UT9B 4J8VB 4E44A 5AV6B 3WA9C 3WAAA 2YFVB 4E45A 5BS7C 1S32C 3VH6W 5DNNB 3C1CA 3TU4C 3AZKD 3W99D 3O62D 3EG5B 4ZBJB 3AL0C 1P3FB 3LJAA 4UUZA 1M18C 1P3AA 5GSUB 4H9OA 3WTPE 5CPKB 3LZ1B 1U35C 5BO0A 3KWQD 1P3BB 5B2IC 3AN2B 3NQJB 5AVCB 1P3LD 1N1JA 4NE6A 3NQUA 1EQZD 3X1SD 4ZUXA 2BG1A 4WU9D 2F2AC 2BYMB 1P3PC 3KXBC 3C1BD 3AZND 4NE3A 1ZLAD 1B67A 3B6FD 2ZY3A 1P34C 3H0MC 4KUDA 5AV6C 1P3MD 4LD9D 1F66A 2UWXA 3B0BA 3AZKB 3O62B 3W99B 3AYWA 5CP6A 4JJND 2Y2PA 3X1UA 3C1CD 3AV1A 3V9RB 4Z2MG 5B0YD 5GSUC 3KWQB 3WTPA 1KX5A 3F6TA 1P3LB 2NQBB 1TAFA 1EQZB 5JA4B 3X1SB 5E5AD 4WU9B 5CPJB 4XUJB 2Y2JA 3AZNB 4J8UB 1ZLAB 1T3UA 5B32A 4Z66C 3AZJA 4CAYA 4YM6B 2CV5A 1P3MB 4LD9B 2Y2QA 1P3KA 1P3OC 1AOIA 4H9PA 5F99C 4H9QB 1HQ3C 4JJNB 3UT9A 4J8VA 3B6GC 2PYOA 3AZLA 4KUDD 3C1CB 1F66D 3MGRA 1M19A 5B1MC 5B0YB 5CP6D 4KGCA 3AFAC 1M1AA 3W96C 5AV9D 3LJAB 4UUZB 1P3FA 3W98D 1P3AB 5B0ZC 5E5AB 3AZEA 5BO0B 2NQBC 5CPKA 1EQZC 5CPJC 5DNMA 4XUJC 5B2JD 3AZMD 3AZIC 4J8UC 1N1JB 2Y2OA 3NQUB 5AVCA 4YM6C 1ID3D 4ZUXB 3EPJA 4Z5TD 2DF4C 2BYMA 2ZM5A 2XD5A 4KUDB 3WAAC 3REJC 1F66B 1AOID 5KDMA 5AV8D 5CP6B 3AZKA 3AYWB 3AV2D 5AV9B 4DRAA 3REKA 3W98B 3X1UB 3LJAC 3AV1B 2RVQD 3MGRD 1M19D 1P3AC 4KGCD 3B0CT 3KWQA 5BNXA 1KX5B 3AZMB 3KUYC 5B31G 4WU8A 3RELA 3AZED 4Z5TB 4J8WA 3MNNA 1WWIA 5JA4A 3X1SA 4ZUXC 5B32B 5DNMD 1F1EA 4CAYB 3C1BA 3AZNA 1ZLAA 2Y2IA 3B6FA 3X1VA 3A6NA 1P3MA 1AOIB 3UTBA 4H9PB 4LD9A 3AV2B 4UPKA 2ZY2A 3AYWC 4H9QA 2PYOB 5JRGD 3AZLB 4AWLC 4JJNA 2F8NK 1KX3D 3MGRB 1M19B 3MGPA 3X1UC 5B33D 3AV1C 4KGCB 1M1AB 4WNNB 2YFWA 1P3GA 4XZQD 5B0YA 3REKD 1BH9B 3WTPC 3MGQD 1WWSA 1P3IC 4J8XC 1KX5C 3AZEB 5FUGB 2HIOA 2F8ND 5E5AA 1TZYC 3KSYA 5DNMB 5GXQD 4R8PA 3LELA 1HTAA 5B32C 3AZJC 3AZHD 2CV5C 4WU8D 3RELD 4QLCA 4J8WD 3MNND 1P3KC 4EO5C 5JRGB 5GT0D 3UT9C 4J8VC 3X1VD 3A6ND 2PYOC 3AZLC 5B33B 3UTBD 5KDMB 3A1IA 4H9SC 5DNNC 3REKB 5CPIA 5AV5D 1W2EA 5AV9A 1M1AC 3MGQB 2HUEB 4ZBJC 1Q9CA 1P3FC 3EPKA 1R4VA 3W98A 3MGPD 3AZFD 2AROA 2F8NB 1P3GD 3X1TA 2FJ7A 5BNXB 5CPKC 3LZ1C 5B24A 5BNVA 5DNMC 5B2JA 3AZMA 4WU8B 1P3BC 2XD1A 3RELB 2HIOD 4J8WB 3AN2C 3MNNB 5AVCC 4DQYB 1ID3A 4Z5TA 5GT0B 3C1BB 4R8PD 3B6FB 3X1VB 3LELD 1KX4D 3A6NB 3WA9A 3UTBB 4KHAB 4QLCD 5AV8A 3TU4A 3AV2A 3EPHA 3AZKC 2Y2MA 3W99C 5AV5B 3O62C 3B0DB 3MGPB 3REHD 3AZFB 2J8PA 2HUEC 2YFWB 3W97A 1P3GB 3VH5W 1M18A 5B1LD 5CPID 5AY8D 4WNNA 3MVDD 3WKJD 2NZDD 1BH9A 3KWQC 2JSSA 2HIOB 3R45B 2AROD 1P3LC 3X1TD 5FUGA 2FJ7D 2ZY5A 5B40A 3MNNC 4R8PB 5B24D 3X1SC 4WU9C 5BT1D 4WZSB 3LELB 1KX4B 3AZNC 3C1BC 1ZLAC 3B6FC 4QLCB 3X1VC 1P34A 4M6BA 4WV4B 1P3MC 4LD9C 1BFMA 5G49A 5JRGA 3REHB 3WA9D 3REIA 4JJNC 1KX3A 3UTAA 1S32D 3MGPC 5B33A 3C1CC 5B1LB 3TU4D 5CPIB 3VH6A 3WKJB 4XZQA
chains in the Genus database with same CATH topology
2NZDB 5B0YC 2VQRA 3MGQA 4HGAB 2AROB 1M18D 3W97D 5B31A 3X1TB 2FJ7B 2F8NA 2Y2GA 5B24B 5E5AC 1U35D 5BNVB 5GXQA 5B2JB 5C3IB 5B2ID 3LELC 4Z66A 3AZHA 1ID3B 2L5AA 5B40D 3MGSA 1P3OA 1P3PD 5GT0A 3KXBD 1HQ3A 3WA9B 1B6WA 3P5JB 1P34D 1S32B 3VH6T 4KUDC 5AV6D 5AV8B 4KHAA 3TU4B 1F66C 4X23A 2JE5A 3AZGA 5CP6C 5AV5A 4WJ3C 5AV9C 4G91B 3REID 2JCHA 3UTAD 3W98C 3AZFA 1M18B 3W97B 4HGAC 2AROC 4H9NB 3X1TC 5GSUD 3EPLA 1JFIB 2BYKA 5B24C 5B2IB 3IP4C 3AZIA 5B2JC 3AZMC 2DQNC 1PZRA 3KFUG 5B31D 3R45A 5B40B 1ID3C 4Z5TC 1P3PB 3LZ0A 5AVBA 4NFTA 1KX4A 4Z66D 1P34B 4NE5A 3FDDA 3REJA 3MGSD 5GT3A 1P3OD 1AOIC 5G49B 5F99D 5AV8C 3AV2C 4CSRB 1HQ3D 3REIB 3B6GD 1KX3B 3UTAB 3REHA 4G91C 2F8NH 2RVQC 1H3OA 3MGRC 1M19C 4X23D 5B1MD 3AZGD 2RIQA 3W97C 4XZQB 5B1LA 4KGCC 3AFAD 5AY8A 3MVDA 3W96D 3WKJA 3VH5A 2NZDA 3A1KA 3KUYA 1BH8B 5B31B 5B0ZD 2Y2HA 3AZEC 2NQBD 5GXQB 5B40C 4Z66B 5CPJD 4XUJD 3AZHB 3AZID 4J8UD 2IO5B 3MGSB 4YM6D 1P3OB 5F99B 4YS3A 1HQ3B 3LZ0D 5AVBD 3B6GB 5JRGC 3REIC 3WAAD 5BS7A 3REJD 1KX3C 3UTAC 1S32A 4X23B 5B1MB 5GT3D 3AZGB 5B33C 3VH5T 3AFAB 3W96B 4XZQC 3REKC 2G5IC 3LJAD 3MGQC 2LY8A 1P3IA 4J8XA 5B0ZB 1P3AD 5B31C 4H9NA 2BYKB 1U35A 2FFFB 1TZYA 5GXQC 3AZIB 1JFIA 2Y2KA 3KUYD 5B2IA 1ULYA 3AZHC 4WU8C 2IO5C 3RELC 2W8SA 4J8WC 3MGSC 3LZ0B 4H9RB 5AVBB 4ZUXD 1P3PA 5B32G 5GT0C 3KXBA 3WAAB 3REJB 3A6NC 5GT3B 5AV6A 3UTBC 4YS3D 2YFVA 4Z2MH 4H9SA 4G92B 5DNNA 4X23C 3AZGC 3AYWD 4CSRA 5AV5C 4DRBA 3B0DC 1H3OB 3H0RC 3X1UD 1KU5A 3AZFC 3AV1D 4H9OB 5AY8B 3MVDB 5GSUA 3WTPD 3LZ1A 3KUYB 1P3ID 4J8XD 1P3BA 1KX5D 1BH8A 2HIOC 3AN2A 3NQJA 1TZYD 2Y2LA 4R8PC 3LZ0C 5AVBC 1KX4C 5B32D 3AZJD 2CV5D 4YS3B 4QLCC 1P3KD 5GT3C 5F99A 2G5HC 3W99A 3O62A 4G92C 4AWLB 3UT9D 3B6GA 2Y2NA 4J8VD 2PYOD 3REHC 3AZLD 3H0LC 5B1MA 5DNND 2ZY4A 5B1LC 5CPIC 3AFAA 3WTPB 3W96A 5AY8C 3V9RA 3MVDC 1M1AD 2CWEA 3WKJC 2NZDC 1P3FD 1P3IB 4J8XB 1TAFB 5B0ZA 2F8NG 1P3LA 1U35B 1TZYB 1P3GC 2FJ7C 2NQBA 1A7WA 1EQZA 5CPKD 3LZ1D 4WU9A 5BT1C 3B0CW 5CPJA 4XUJA 3AZJB 5CHLB 2CV5B 1P3BD 4J8UA 5C3IC 1Z2CB 3AN2D 1P3KB 5AVCD 4YM6A 4YS3C 4EO5B 3KXBB 4H9RA 3UT9B 4J8VB 4E44A 5AV6B 3WA9C 3WAAA 2YFVB 4E45A 5BS7C 1S32C 3VH6W 5DNNB 3C1CA 3TU4C 3AZKD 3W99D 3O62D 3EG5B 4ZBJB 3AL0C 1P3FB 3LJAA 4UUZA 1M18C 1P3AA 5GSUB 4H9OA 3WTPE 5CPKB 3LZ1B 1U35C 5BO0A 3KWQD 1P3BB 5B2IC 3AN2B 3NQJB 5AVCB 1P3LD 1N1JA 4NE6A 3NQUA 1EQZD 3X1SD 4ZUXA 2BG1A 4WU9D 2F2AC 2BYMB 1P3PC 3KXBC 3C1BD 3AZND 4NE3A 1ZLAD 1B67A 3B6FD 2ZY3A 1P34C 3H0MC 4KUDA 5AV6C 1P3MD 4LD9D 1F66A 2UWXA 3B0BA 3AZKB 3O62B 3W99B 3AYWA 5CP6A 4JJND 2Y2PA 3X1UA 3C1CD 3AV1A 3V9RB 4Z2MG 5B0YD 5GSUC 3KWQB 3WTPA 1KX5A 3F6TA 1P3LB 2NQBB 1TAFA 1EQZB 5JA4B 3X1SB 5E5AD 4WU9B 5CPJB 4XUJB 2Y2JA 3AZNB 4J8UB 1ZLAB 1T3UA 5B32A 4Z66C 3AZJA 4CAYA 4YM6B 2CV5A 1P3MB 4LD9B 2Y2QA 1P3KA 1P3OC 1AOIA 4H9PA 5F99C 4H9QB 1HQ3C 4JJNB 3UT9A 4J8VA 3B6GC 2PYOA 3AZLA 4KUDD 3C1CB 1F66D 3MGRA 1M19A 5B1MC 5B0YB 5CP6D 4KGCA 3AFAC 1M1AA 3W96C 5AV9D 3LJAB 4UUZB 1P3FA 3W98D 1P3AB 5B0ZC 5E5AB 3AZEA 5BO0B 2NQBC 5CPKA 1EQZC 5CPJC 5DNMA 4XUJC 5B2JD 3AZMD 3AZIC 4J8UC 1N1JB 2Y2OA 3NQUB 5AVCA 4YM6C 1ID3D 4ZUXB 3EPJA 4Z5TD 2DF4C 2BYMA 2ZM5A 2XD5A 4KUDB 3WAAC 3REJC 1F66B 1AOID 5KDMA 5AV8D 5CP6B 3AZKA 3AYWB 3AV2D 5AV9B 4DRAA 3REKA 3W98B 3X1UB 3LJAC 3AV1B 2RVQD 3MGRD 1M19D 1P3AC 4KGCD 3B0CT 3KWQA 5BNXA 1KX5B 3AZMB 3KUYC 5B31G 4WU8A 3RELA 3AZED 4Z5TB 4J8WA 3MNNA 1WWIA 5JA4A 3X1SA 4ZUXC 5B32B 5DNMD 1F1EA 4CAYB 3C1BA 3AZNA 1ZLAA 2Y2IA 3B6FA 3X1VA 3A6NA 1P3MA 1AOIB 3UTBA 4H9PB 4LD9A 3AV2B 4UPKA 2ZY2A 3AYWC 4H9QA 2PYOB 5JRGD 3AZLB 4AWLC 4JJNA 2F8NK 1KX3D 3MGRB 1M19B 3MGPA 3X1UC 5B33D 3AV1C 4KGCB 1M1AB 4WNNB 2YFWA 1P3GA 4XZQD 5B0YA 3REKD 1BH9B 3WTPC 3MGQD 1WWSA 1P3IC 4J8XC 1KX5C 3AZEB 5FUGB 2HIOA 2F8ND 5E5AA 1TZYC 3KSYA 5DNMB 5GXQD 4R8PA 3LELA 1HTAA 5B32C 3AZJC 3AZHD 2CV5C 4WU8D 3RELD 4QLCA 4J8WD 3MNND 1P3KC 4EO5C 5JRGB 5GT0D 3UT9C 4J8VC 3X1VD 3A6ND 2PYOC 3AZLC 5B33B 3UTBD 5KDMB 3A1IA 4H9SC 5DNNC 3REKB 5CPIA 5AV5D 1W2EA 5AV9A 1M1AC 3MGQB 2HUEB 4ZBJC 1Q9CA 1P3FC 3EPKA 1R4VA 3W98A 3MGPD 3AZFD 2AROA 2F8NB 1P3GD 3X1TA 2FJ7A 5BNXB 5CPKC 3LZ1C 5B24A 5BNVA 5DNMC 5B2JA 3AZMA 4WU8B 1P3BC 2XD1A 3RELB 2HIOD 4J8WB 3AN2C 3MNNB 5AVCC 4DQYB 1ID3A 4Z5TA 5GT0B 3C1BB 4R8PD 3B6FB 3X1VB 3LELD 1KX4D 3A6NB 3WA9A 3UTBB 4KHAB 4QLCD 5AV8A 3TU4A 3AV2A 3EPHA 3AZKC 2Y2MA 3W99C 5AV5B 3O62C 3B0DB 3MGPB 3REHD 3AZFB 2J8PA 2HUEC 2YFWB 3W97A 1P3GB 3VH5W 1M18A 5B1LD 5CPID 5AY8D 4WNNA 3MVDD 3WKJD 2NZDD 1BH9A 3KWQC 2JSSA 2HIOB 3R45B 2AROD 1P3LC 3X1TD 5FUGA 2FJ7D 2ZY5A 5B40A 3MNNC 4R8PB 5B24D 3X1SC 4WU9C 5BT1D 4WZSB 3LELB 1KX4B 3AZNC 3C1BC 1ZLAC 3B6FC 4QLCB 3X1VC 1P34A 4M6BA 4WV4B 1P3MC 4LD9C 1BFMA 5G49A 5JRGA 3REHB 3WA9D 3REIA 4JJNC 1KX3A 3UTAA 1S32D 3MGPC 5B33A 3C1CC 5B1LB 3TU4D 5CPIB 3VH6A 3WKJB 4XZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZD B;  5B0Y C;  3MGQ A;  4HGA B;  2ARO B;  1M18 D;  3W97 D;  5B31 A;  3X1T B;  2FJ7 B;  2F8N A;  5B24 B;  1U35 D;  5E5A C;  5BNV B;  5GXQ A;  5B2J B;  5C3I B;  5B2I D;  3LEL C;  4Z66 A;  3AZH A;  1ID3 B;  2L5A A;  5B40 D;  3MGS A;  1P3O A;  1P3P D;  5GT0 A;  3KXB D;  1HQ3 A;  3WA9 B;  1B6W A;  1P34 D;  1S32 B;  3VH6 T;  4KUD C;  5AV6 D;  5AV8 B;  4KHA A;  3TU4 B;  1F66 C;  4X23 A;  3AZG A;  5CP6 C;  5AV5 A;  5AV9 C;  4G91 B;  3REI D;  3UTA D;  3W98 C;  3AZF A;  1M18 B;  3W97 B;  4HGA C;  2ARO C;  4H9N B;  3X1T C;  5GSU D;  1JFI B;  2BYK A;  5B24 C;  5B2I B;  3AZI A;  5B2J C;  3AZM C;  5B31 D;  3R45 A;  5B40 B;  1ID3 C;  4Z5T C;  1P3P B;  3LZ0 A;  5AVB A;  4NFT A;  1KX4 A;  4Z66 D;  1P34 B;  4NE5 A;  3REJ A;  3MGS D;  5GT3 A;  1P3O D;  1AOI C;  5G49 B;  5F99 D;  5AV8 C;  3AV2 C;  4CSR B;  1HQ3 D;  3REI B;  3B6G D;  1KX3 B;  3UTA B;  3REH A;  4G91 C;  2F8N H;  2RVQ C;  1H3O A;  3MGR C;  1M19 C;  4X23 D;  5B1M D;  3AZG D;  3W97 C;  4XZQ B;  5B1L A;  4KGC C;  3AFA D;  5AY8 A;  3MVD A;  3W96 D;  3WKJ A;  3VH5 A;  2NZD A;  3KUY A;  1BH8 B;  5B31 B;  5B0Z D;  3AZE C;  2NQB D;  5GXQ B;  5B40 C;  4Z66 B;  5CPJ D;  4XUJ D;  3AZH B;  3AZI D;  4J8U D;  2IO5 B;  3MGS B;  4YM6 D;  1P3O B;  5F99 B;  4YS3 A;  1HQ3 B;  3LZ0 D;  5AVB D;  3B6G B;  5JRG C;  3REI C;  3WAA D;  5BS7 A;  3REJ D;  1KX3 C;  3UTA C;  1S32 A;  4X23 B;  5B1M B;  5GT3 D;  3AZG B;  5B33 C;  3VH5 T;  3AFA B;  3W96 B;  4XZQ C;  3REK C;  3LJA D;  3MGQ C;  2LY8 A;  1P3I A;  4J8X A;  5B0Z B;  1P3A D;  5B31 C;  4H9N A;  2BYK B;  1U35 A;  1TZY A;  5GXQ C;  3AZI B;  1JFI A;  3KUY D;  5B2I A;  1ULY A;  3AZH C;  4WU8 C;  2IO5 C;  3REL C;  4J8W C;  3MGS C;  3LZ0 B;  4H9R B;  5AVB B;  4ZUX D;  1P3P A;  5B32 G;  5GT0 C;  3KXB A;  3WAA B;  3REJ B;  3A6N C;  5GT3 B;  5AV6 A;  3UTB C;  4YS3 D;  2YFV A;  4Z2M H;  4H9S A;  4G92 B;  5DNN A;  4X23 C;  3AZG C;  3AYW D;  4CSR A;  5AV5 C;  4DRB A;  3B0D C;  1H3O B;  3X1U D;  1KU5 A;  3AZF C;  3AV1 D;  4H9O B;  5AY8 B;  3MVD B;  5GSU A;  3WTP D;  3LZ1 A;  3KUY B;  1P3I D;  4J8X D;  1P3B A;  1KX5 D;  1BH8 A;  2HIO C;  3AN2 A;  3NQJ A;  1TZY D;  4R8P C;  3LZ0 C;  5AVB C;  1KX4 C;  5B32 D;  3AZJ D;  2CV5 D;  4YS3 B;  4QLC C;  1P3K D;  5GT3 C;  5F99 A;  3W99 A;  3O62 A;  4G92 C;  4AWL B;  3UT9 D;  3B6G A;  4J8V D;  2PYO D;  3REH C;  3AZL D;  5B1M A;  5DNN D;  5B1L C;  5CPI C;  3AFA A;  3WTP B;  3W96 A;  5AY8 C;  3V9R A;  3MVD C;  1M1A D;  2CWE A;  3WKJ C;  2NZD C;  1P3F D;  1P3I B;  4J8X B;  1TAF B;  5B0Z A;  2F8N G;  1P3L A;  1U35 B;  1TZY B;  1P3G C;  2FJ7 C;  2NQB A;  1A7W A;  1EQZ A;  5CPK D;  3LZ1 D;  4WU9 A;  5BT1 C;  3B0C W;  5CPJ A;  4XUJ A;  3AZJ B;  5CHL B;  2CV5 B;  1P3B D;  4J8U A;  5C3I C;  3AN2 D;  1P3K B;  5AVC D;  4YM6 A;  4YS3 C;  4EO5 B;  3KXB B;  4H9R A;  3UT9 B;  4J8V B;  4E44 A;  5AV6 B;  3WA9 C;  3WAA A;  2YFV B;  4E45 A;  5BS7 C;  1S32 C;  3VH6 W;  5DNN B;  3C1C A;  3TU4 C;  3AZK D;  3W99 D;  3O62 D;  4ZBJ B;  1P3F B;  3LJA A;  4UUZ A;  1M18 C;  1P3A A;  5GSU B;  4H9O A;  3WTP E;  5CPK B;  3LZ1 B;  1U35 C;  5BO0 A;  3KWQ D;  1P3B B;  5B2I C;  3AN2 B;  3NQJ B;  5AVC B;  1P3L D;  1N1J A;  4NE6 A;  3NQU A;  1EQZ D;  3X1S D;  4WU9 D;  4ZUX A;  2BYM B;  1P3P C;  3KXB C;  3C1B D;  3AZN D;  4NE3 A;  1ZLA D;  1B67 A;  3B6F D;  1P34 C;  4KUD A;  5AV6 C;  1P3M D;  4LD9 D;  1F66 A;  3B0B A;  3AZK B;  3W99 B;  3O62 B;  3AYW A;  5CP6 A;  4JJN D;  3X1U A;  3C1C D;  3AV1 A;  3V9R B;  4Z2M G;  5B0Y D;  5GSU C;  3KWQ B;  3WTP A;  1KX5 A;  1P3L B;  2NQB B;  1TAF A;  1EQZ B;  5JA4 B;  3X1S B;  5E5A D;  4WU9 B;  5CPJ B;  4XUJ B;  3AZN B;  4J8U B;  1ZLA B;  5B32 A;  4Z66 C;  3AZJ A;  4CAY A;  4YM6 B;  2CV5 A;  1P3M B;  4LD9 B;  1P3K A;  1P3O C;  1AOI A;  4H9P A;  5F99 C;  4H9Q B;  1HQ3 C;  4JJN B;  3UT9 A;  4J8V A;  3B6G C;  2PYO A;  3AZL A;  4KUD D;  3C1C B;  1F66 D;  3MGR A;  1M19 A;  5B1M C;  5B0Y B;  5CP6 D;  4KGC A;  3AFA C;  1M1A A;  3W96 C;  5AV9 D;  3LJA B;  4UUZ B;  1P3F A;  3W98 D;  1P3A B;  5B0Z C;  5E5A B;  3AZE A;  5BO0 B;  2NQB C;  5CPK A;  1EQZ C;  5CPJ C;  5DNM A;  4XUJ C;  5B2J D;  3AZM D;  3AZI C;  4J8U C;  1N1J B;  3NQU B;  5AVC A;  4YM6 C;  1ID3 D;  4ZUX B;  4Z5T D;  2BYM A;  4KUD B;  3WAA C;  3REJ C;  1F66 B;  1AOI D;  5KDM A;  5AV8 D;  5CP6 B;  3AZK A;  3AYW B;  3AV2 D;  5AV9 B;  4DRA A;  3REK A;  3W98 B;  3X1U B;  3LJA C;  3AV1 B;  2RVQ D;  3MGR D;  1M19 D;  1P3A C;  4KGC D;  3B0C T;  3KWQ A;  5BNX A;  1KX5 B;  3AZM B;  3KUY C;  5B31 G;  4WU8 A;  3REL A;  3AZE D;  4Z5T B;  4J8W A;  3MNN A;  1WWI A;  5JA4 A;  3X1S A;  4ZUX C;  5B32 B;  5DNM D;  1F1E A;  4CAY B;  3C1B A;  3AZN A;  1ZLA A;  3B6F A;  3X1V A;  3A6N A;  1P3M A;  1AOI B;  3UTB A;  4H9P B;  4LD9 A;  3AV2 B;  3AYW C;  4H9Q A;  2PYO B;  5JRG D;  3AZL B;  4AWL C;  4JJN A;  2F8N K;  1KX3 D;  3MGR B;  1M19 B;  3MGP A;  3X1U C;  5B33 D;  3AV1 C;  4KGC B;  1M1A B;  4WNN B;  2YFW A;  1P3G A;  4XZQ D;  5B0Y A;  3REK D;  1BH9 B;  3WTP C;  3MGQ D;  1WWS A;  1P3I C;  4J8X C;  1KX5 C;  3AZE B;  5FUG B;  2HIO A;  2F8N D;  5E5A A;  1TZY C;  3KSY A;  5DNM B;  5GXQ D;  4R8P A;  3LEL A;  1HTA A;  5B32 C;  3AZJ C;  3AZH D;  2CV5 C;  4WU8 D;  3REL D;  4QLC A;  4J8W D;  3MNN D;  1P3K C;  4EO5 C;  5JRG B;  5GT0 D;  3UT9 C;  4J8V C;  3X1V D;  3A6N D;  2PYO C;  3AZL C;  5B33 B;  3UTB D;  5KDM B;  4H9S C;  5DNN C;  3REK B;  5CPI A;  5AV5 D;  5AV9 A;  1M1A C;  3MGQ B;  2HUE B;  4ZBJ C;  1Q9C A;  1P3F C;  1R4V A;  3W98 A;  3MGP D;  3AZF D;  2ARO A;  2F8N B;  1P3G D;  3X1T A;  2FJ7 A;  5BNX B;  5CPK C;  3LZ1 C;  5B24 A;  5BNV A;  5DNM C;  5B2J A;  3AZM A;  4WU8 B;  1P3B C;  3REL B;  2HIO D;  4J8W B;  3AN2 C;  3MNN B;  5AVC C;  1ID3 A;  4Z5T A;  5GT0 B;  3C1B B;  4R8P D;  3B6F B;  3X1V B;  3LEL D;  1KX4 D;  3A6N B;  3WA9 A;  3UTB B;  4KHA B;  4QLC D;  5AV8 A;  3TU4 A;  3AV2 A;  3AZK C;  3W99 C;  5AV5 B;  3O62 C;  3B0D B;  3MGP B;  3REH D;  3AZF B;  2HUE C;  2YFW B;  3W97 A;  1P3G B;  3VH5 W;  1M18 A;  5B1L D;  5CPI D;  5AY8 D;  4WNN A;  3MVD D;  3WKJ D;  2NZD D;  1BH9 A;  3KWQ C;  2JSS A;  2HIO B;  3R45 B;  2ARO D;  1P3L C;  3X1T D;  5FUG A;  2FJ7 D;  5B40 A;  3MNN C;  4R8P B;  5B24 D;  3X1S C;  4WU9 C;  5BT1 D;  4WZS B;  3LEL B;  1KX4 B;  3AZN C;  3C1B C;  1ZLA C;  3B6F C;  4QLC B;  3X1V C;  1P34 A;  4M6B A;  4WV4 B;  1P3M C;  4LD9 C;  1BFM A;  5G49 A;  5JRG A;  3REH B;  3WA9 D;  3REI A;  4JJN C;  1KX3 A;  3UTA A;  1S32 D;  3MGP C;  5B33 A;  3C1C C;  5B1L B;  3TU4 D;  5CPI B;  3VH6 A;  3WKJ B;  4XZQ A; 
#chains in the Genus database with same CATH topology
 2NZD B;  5B0Y C;  2VQR A;  3MGQ A;  4HGA B;  2ARO B;  1M18 D;  3W97 D;  5B31 A;  3X1T B;  2FJ7 B;  2F8N A;  2Y2G A;  5B24 B;  5E5A C;  1U35 D;  5BNV B;  5GXQ A;  5B2J B;  5C3I B;  5B2I D;  3LEL C;  4Z66 A;  3AZH A;  1ID3 B;  2L5A A;  5B40 D;  3MGS A;  1P3O A;  1P3P D;  5GT0 A;  3KXB D;  1HQ3 A;  3WA9 B;  1B6W A;  3P5J B;  1P34 D;  1S32 B;  3VH6 T;  4KUD C;  5AV6 D;  5AV8 B;  4KHA A;  3TU4 B;  1F66 C;  4X23 A;  2JE5 A;  3AZG A;  5CP6 C;  5AV5 A;  4WJ3 C;  5AV9 C;  4G91 B;  3REI D;  2JCH A;  3UTA D;  3W98 C;  3AZF A;  1M18 B;  3W97 B;  4HGA C;  2ARO C;  4H9N B;  3X1T C;  5GSU D;  3EPL A;  1JFI B;  2BYK A;  5B24 C;  5B2I B;  3IP4 C;  3AZI A;  5B2J C;  3AZM C;  2DQN C;  1PZR A;  3KFU G;  5B31 D;  3R45 A;  5B40 B;  1ID3 C;  4Z5T C;  1P3P B;  3LZ0 A;  5AVB A;  4NFT A;  1KX4 A;  4Z66 D;  1P34 B;  4NE5 A;  3FDD A;  3REJ A;  3MGS D;  5GT3 A;  1P3O D;  1AOI C;  5G49 B;  5F99 D;  5AV8 C;  3AV2 C;  4CSR B;  1HQ3 D;  3REI B;  3B6G D;  1KX3 B;  3UTA B;  3REH A;  4G91 C;  2F8N H;  2RVQ C;  1H3O A;  3MGR C;  1M19 C;  4X23 D;  5B1M D;  3AZG D;  2RIQ A;  3W97 C;  4XZQ B;  5B1L A;  4KGC C;  3AFA D;  5AY8 A;  3MVD A;  3W96 D;  3WKJ A;  3VH5 A;  2NZD A;  3A1K A;  3KUY A;  1BH8 B;  5B31 B;  5B0Z D;  2Y2H A;  3AZE C;  2NQB D;  5GXQ B;  5B40 C;  4Z66 B;  5CPJ D;  4XUJ D;  3AZH B;  3AZI D;  4J8U D;  2IO5 B;  3MGS B;  4YM6 D;  1P3O B;  5F99 B;  4YS3 A;  1HQ3 B;  3LZ0 D;  5AVB D;  3B6G B;  5JRG C;  3REI C;  3WAA D;  5BS7 A;  3REJ D;  1KX3 C;  3UTA C;  1S32 A;  4X23 B;  5B1M B;  5GT3 D;  3AZG B;  5B33 C;  3VH5 T;  3AFA B;  3W96 B;  4XZQ C;  3REK C;  2G5I C;  3LJA D;  3MGQ C;  2LY8 A;  1P3I A;  4J8X A;  5B0Z B;  1P3A D;  5B31 C;  4H9N A;  2BYK B;  1U35 A;  2FFF B;  1TZY A;  5GXQ C;  3AZI B;  1JFI A;  2Y2K A;  3KUY D;  5B2I A;  1ULY A;  3AZH C;  4WU8 C;  2IO5 C;  3REL C;  2W8S A;  4J8W C;  3MGS C;  3LZ0 B;  4H9R B;  5AVB B;  4ZUX D;  1P3P A;  5B32 G;  5GT0 C;  3KXB A;  3WAA B;  3REJ B;  3A6N C;  5GT3 B;  5AV6 A;  3UTB C;  4YS3 D;  2YFV A;  4Z2M H;  4H9S A;  4G92 B;  5DNN A;  4X23 C;  3AZG C;  3AYW D;  4CSR A;  5AV5 C;  4DRB A;  3B0D C;  1H3O B;  3H0R C;  3X1U D;  1KU5 A;  3AZF C;  3AV1 D;  4H9O B;  5AY8 B;  3MVD B;  5GSU A;  3WTP D;  3LZ1 A;  3KUY B;  1P3I D;  4J8X D;  1P3B A;  1KX5 D;  1BH8 A;  2HIO C;  3AN2 A;  3NQJ A;  1TZY D;  2Y2L A;  4R8P C;  3LZ0 C;  5AVB C;  1KX4 C;  5B32 D;  3AZJ D;  2CV5 D;  4YS3 B;  4QLC C;  1P3K D;  5GT3 C;  5F99 A;  2G5H C;  3W99 A;  3O62 A;  4G92 C;  4AWL B;  3UT9 D;  3B6G A;  2Y2N A;  4J8V D;  2PYO D;  3REH C;  3AZL D;  3H0L C;  5B1M A;  5DNN D;  2ZY4 A;  5B1L C;  5CPI C;  3AFA A;  3WTP B;  3W96 A;  5AY8 C;  3V9R A;  3MVD C;  1M1A D;  2CWE A;  3WKJ C;  2NZD C;  1P3F D;  1P3I B;  4J8X B;  1TAF B;  5B0Z A;  2F8N G;  1P3L A;  1U35 B;  1TZY B;  1P3G C;  2FJ7 C;  2NQB A;  1A7W A;  1EQZ A;  5CPK D;  3LZ1 D;  4WU9 A;  5BT1 C;  3B0C W;  5CPJ A;  4XUJ A;  3AZJ B;  5CHL B;  2CV5 B;  1P3B D;  4J8U A;  5C3I C;  1Z2C B;  3AN2 D;  1P3K B;  5AVC D;  4YM6 A;  4YS3 C;  4EO5 B;  3KXB B;  4H9R A;  3UT9 B;  4J8V B;  4E44 A;  5AV6 B;  3WA9 C;  3WAA A;  2YFV B;  4E45 A;  5BS7 C;  1S32 C;  3VH6 W;  5DNN B;  3C1C A;  3TU4 C;  3AZK D;  3W99 D;  3O62 D;  3EG5 B;  4ZBJ B;  3AL0 C;  1P3F B;  3LJA A;  4UUZ A;  1M18 C;  1P3A A;  5GSU B;  4H9O A;  3WTP E;  5CPK B;  3LZ1 B;  1U35 C;  5BO0 A;  3KWQ D;  1P3B B;  5B2I C;  3AN2 B;  3NQJ B;  5AVC B;  1P3L D;  1N1J A;  4NE6 A;  3NQU A;  1EQZ D;  3X1S D;  4ZUX A;  2BG1 A;  4WU9 D;  2F2A C;  2BYM B;  1P3P C;  3KXB C;  3C1B D;  3AZN D;  4NE3 A;  1ZLA D;  1B67 A;  3B6F D;  2ZY3 A;  1P34 C;  3H0M C;  4KUD A;  5AV6 C;  1P3M D;  4LD9 D;  1F66 A;  2UWX A;  3B0B A;  3AZK B;  3O62 B;  3W99 B;  3AYW A;  5CP6 A;  4JJN D;  2Y2P A;  3X1U A;  3C1C D;  3AV1 A;  3V9R B;  4Z2M G;  5B0Y D;  5GSU C;  3KWQ B;  3WTP A;  1KX5 A;  3F6T A;  1P3L B;  2NQB B;  1TAF A;  1EQZ B;  5JA4 B;  3X1S B;  5E5A D;  4WU9 B;  5CPJ B;  4XUJ B;  2Y2J A;  3AZN B;  4J8U B;  1ZLA B;  1T3U A;  5B32 A;  4Z66 C;  3AZJ A;  4CAY A;  4YM6 B;  2CV5 A;  1P3M B;  4LD9 B;  2Y2Q A;  1P3K A;  1P3O C;  1AOI A;  4H9P A;  5F99 C;  4H9Q B;  1HQ3 C;  4JJN B;  3UT9 A;  4J8V A;  3B6G C;  2PYO A;  3AZL A;  4KUD D;  3C1C B;  1F66 D;  3MGR A;  1M19 A;  5B1M C;  5B0Y B;  5CP6 D;  4KGC A;  3AFA C;  1M1A A;  3W96 C;  5AV9 D;  3LJA B;  4UUZ B;  1P3F A;  3W98 D;  1P3A B;  5B0Z C;  5E5A B;  3AZE A;  5BO0 B;  2NQB C;  5CPK A;  1EQZ C;  5CPJ C;  5DNM A;  4XUJ C;  5B2J D;  3AZM D;  3AZI C;  4J8U C;  1N1J B;  2Y2O A;  3NQU B;  5AVC A;  4YM6 C;  1ID3 D;  4ZUX B;  3EPJ A;  4Z5T D;  2DF4 C;  2BYM A;  2ZM5 A;  2XD5 A;  4KUD B;  3WAA C;  3REJ C;  1F66 B;  1AOI D;  5KDM A;  5AV8 D;  5CP6 B;  3AZK A;  3AYW B;  3AV2 D;  5AV9 B;  4DRA A;  3REK A;  3W98 B;  3X1U B;  3LJA C;  3AV1 B;  2RVQ D;  3MGR D;  1M19 D;  1P3A C;  4KGC D;  3B0C T;  3KWQ A;  5BNX A;  1KX5 B;  3AZM B;  3KUY C;  5B31 G;  4WU8 A;  3REL A;  3AZE D;  4Z5T B;  4J8W A;  3MNN A;  1WWI A;  5JA4 A;  3X1S A;  4ZUX C;  5B32 B;  5DNM D;  1F1E A;  4CAY B;  3C1B A;  3AZN A;  1ZLA A;  2Y2I A;  3B6F A;  3X1V A;  3A6N A;  1P3M A;  1AOI B;  3UTB A;  4H9P B;  4LD9 A;  3AV2 B;  4UPK A;  2ZY2 A;  3AYW C;  4H9Q A;  2PYO B;  5JRG D;  3AZL B;  4AWL C;  4JJN A;  2F8N K;  1KX3 D;  3MGR B;  1M19 B;  3MGP A;  3X1U C;  5B33 D;  3AV1 C;  4KGC B;  1M1A B;  4WNN B;  2YFW A;  1P3G A;  4XZQ D;  5B0Y A;  3REK D;  1BH9 B;  3WTP C;  3MGQ D;  1WWS A;  1P3I C;  4J8X C;  1KX5 C;  3AZE B;  5FUG B;  2HIO A;  2F8N D;  5E5A A;  1TZY C;  3KSY A;  5DNM B;  5GXQ D;  4R8P A;  3LEL A;  1HTA A;  5B32 C;  3AZJ C;  3AZH D;  2CV5 C;  4WU8 D;  3REL D;  4QLC A;  4J8W D;  3MNN D;  1P3K C;  4EO5 C;  5JRG B;  5GT0 D;  3UT9 C;  4J8V C;  3X1V D;  3A6N D;  2PYO C;  3AZL C;  5B33 B;  3UTB D;  5KDM B;  3A1I A;  4H9S C;  5DNN C;  3REK B;  5CPI A;  5AV5 D;  1W2E A;  5AV9 A;  1M1A C;  3MGQ B;  2HUE B;  4ZBJ C;  1Q9C A;  1P3F C;  3EPK A;  1R4V A;  3W98 A;  3MGP D;  3AZF D;  2ARO A;  2F8N B;  1P3G D;  3X1T A;  2FJ7 A;  5BNX B;  5CPK C;  3LZ1 C;  5B24 A;  5BNV A;  5DNM C;  5B2J A;  3AZM A;  4WU8 B;  1P3B C;  2XD1 A;  3REL B;  2HIO D;  4J8W B;  3AN2 C;  3MNN B;  5AVC C;  4DQY B;  1ID3 A;  4Z5T A;  5GT0 B;  3C1B B;  4R8P D;  3B6F B;  3X1V B;  3LEL D;  1KX4 D;  3A6N B;  3WA9 A;  3UTB B;  4KHA B;  4QLC D;  5AV8 A;  3TU4 A;  3AV2 A;  3EPH A;  3AZK C;  2Y2M A;  3W99 C;  5AV5 B;  3O62 C;  3B0D B;  3MGP B;  3REH D;  3AZF B;  2J8P A;  2HUE C;  2YFW B;  3W97 A;  1P3G B;  3VH5 W;  1M18 A;  5B1L D;  5CPI D;  5AY8 D;  4WNN A;  3MVD D;  3WKJ D;  2NZD D;  1BH9 A;  3KWQ C;  2JSS A;  2HIO B;  3R45 B;  2ARO D;  1P3L C;  3X1T D;  5FUG A;  2FJ7 D;  2ZY5 A;  5B40 A;  3MNN C;  4R8P B;  5B24 D;  3X1S C;  4WU9 C;  5BT1 D;  4WZS B;  3LEL B;  1KX4 B;  3AZN C;  3C1B C;  1ZLA C;  3B6F C;  4QLC B;  3X1V C;  1P34 A;  4M6B A;  4WV4 B;  1P3M C;  4LD9 C;  1BFM A;  5G49 A;  5JRG A;  3REH B;  3WA9 D;  3REI A;  4JJN C;  1KX3 A;  3UTA A;  1S32 D;  3MGP C;  5B33 A;  3C1C C;  5B1L B;  3TU4 D;  5CPI B;  3VH6 A;  3WKJ B;  4XZQ A; 
#chains in the Genus database with same CATH homology
 2NZD B;  5B0Y C;  2VQR A;  3MGQ A;  4HGA B;  2ARO B;  1M18 D;  3W97 D;  5B31 A;  3X1T B;  2FJ7 B;  2F8N A;  2Y2G A;  5B24 B;  5E5A C;  1U35 D;  5BNV B;  5GXQ A;  5B2J B;  5C3I B;  5B2I D;  3LEL C;  4Z66 A;  3AZH A;  1ID3 B;  2L5A A;  5B40 D;  3MGS A;  1P3O A;  1P3P D;  5GT0 A;  3KXB D;  1HQ3 A;  3WA9 B;  1B6W A;  3P5J B;  1P34 D;  1S32 B;  3VH6 T;  4KUD C;  5AV6 D;  5AV8 B;  4KHA A;  3TU4 B;  1F66 C;  4X23 A;  2JE5 A;  3AZG A;  5CP6 C;  5AV5 A;  4WJ3 C;  5AV9 C;  4G91 B;  3REI D;  2JCH A;  3UTA D;  3W98 C;  3AZF A;  1M18 B;  3W97 B;  4HGA C;  2ARO C;  4H9N B;  3X1T C;  5GSU D;  3EPL A;  1JFI B;  2BYK A;  5B24 C;  5B2I B;  3IP4 C;  3AZI A;  5B2J C;  3AZM C;  2DQN C;  1PZR A;  3KFU G;  5B31 D;  3R45 A;  5B40 B;  1ID3 C;  4Z5T C;  1P3P B;  3LZ0 A;  5AVB A;  4NFT A;  1KX4 A;  4Z66 D;  1P34 B;  4NE5 A;  3FDD A;  3REJ A;  3MGS D;  5GT3 A;  1P3O D;  1AOI C;  5G49 B;  5F99 D;  5AV8 C;  3AV2 C;  4CSR B;  1HQ3 D;  3REI B;  3B6G D;  1KX3 B;  3UTA B;  3REH A;  4G91 C;  2F8N H;  2RVQ C;  1H3O A;  3MGR C;  1M19 C;  4X23 D;  5B1M D;  3AZG D;  2RIQ A;  3W97 C;  4XZQ B;  5B1L A;  4KGC C;  3AFA D;  5AY8 A;  3MVD A;  3W96 D;  3WKJ A;  3VH5 A;  2NZD A;  3A1K A;  3KUY A;  1BH8 B;  5B31 B;  5B0Z D;  2Y2H A;  3AZE C;  2NQB D;  5GXQ B;  5B40 C;  4Z66 B;  5CPJ D;  4XUJ D;  3AZH B;  3AZI D;  4J8U D;  2IO5 B;  3MGS B;  4YM6 D;  1P3O B;  5F99 B;  4YS3 A;  1HQ3 B;  3LZ0 D;  5AVB D;  3B6G B;  5JRG C;  3REI C;  3WAA D;  5BS7 A;  3REJ D;  1KX3 C;  3UTA C;  1S32 A;  4X23 B;  5B1M B;  5GT3 D;  3AZG B;  5B33 C;  3VH5 T;  3AFA B;  3W96 B;  4XZQ C;  3REK C;  2G5I C;  3LJA D;  3MGQ C;  2LY8 A;  1P3I A;  4J8X A;  5B0Z B;  1P3A D;  5B31 C;  4H9N A;  2BYK B;  1U35 A;  2FFF B;  1TZY A;  5GXQ C;  3AZI B;  1JFI A;  2Y2K A;  3KUY D;  5B2I A;  1ULY A;  3AZH C;  4WU8 C;  2IO5 C;  3REL C;  2W8S A;  4J8W C;  3MGS C;  3LZ0 B;  4H9R B;  5AVB B;  4ZUX D;  1P3P A;  5B32 G;  5GT0 C;  3KXB A;  3WAA B;  3REJ B;  3A6N C;  5GT3 B;  5AV6 A;  3UTB C;  4YS3 D;  2YFV A;  4Z2M H;  4H9S A;  4G92 B;  5DNN A;  4X23 C;  3AZG C;  3AYW D;  4CSR A;  5AV5 C;  4DRB A;  3B0D C;  1H3O B;  3H0R C;  3X1U D;  1KU5 A;  3AZF C;  3AV1 D;  4H9O B;  5AY8 B;  3MVD B;  5GSU A;  3WTP D;  3LZ1 A;  3KUY B;  1P3I D;  4J8X D;  1P3B A;  1KX5 D;  1BH8 A;  2HIO C;  3AN2 A;  3NQJ A;  1TZY D;  2Y2L A;  4R8P C;  3LZ0 C;  5AVB C;  1KX4 C;  5B32 D;  3AZJ D;  2CV5 D;  4YS3 B;  4QLC C;  1P3K D;  5GT3 C;  5F99 A;  2G5H C;  3W99 A;  3O62 A;  4G92 C;  4AWL B;  3UT9 D;  3B6G A;  2Y2N A;  4J8V D;  2PYO D;  3REH C;  3AZL D;  3H0L C;  5B1M A;  5DNN D;  2ZY4 A;  5B1L C;  5CPI C;  3AFA A;  3WTP B;  3W96 A;  5AY8 C;  3V9R A;  3MVD C;  1M1A D;  2CWE A;  3WKJ C;  2NZD C;  1P3F D;  1P3I B;  4J8X B;  1TAF B;  5B0Z A;  2F8N G;  1P3L A;  1U35 B;  1TZY B;  1P3G C;  2FJ7 C;  2NQB A;  1A7W A;  1EQZ A;  5CPK D;  3LZ1 D;  4WU9 A;  5BT1 C;  3B0C W;  5CPJ A;  4XUJ A;  3AZJ B;  5CHL B;  2CV5 B;  1P3B D;  4J8U A;  5C3I C;  1Z2C B;  3AN2 D;  1P3K B;  5AVC D;  4YM6 A;  4YS3 C;  4EO5 B;  3KXB B;  4H9R A;  3UT9 B;  4J8V B;  4E44 A;  5AV6 B;  3WA9 C;  3WAA A;  2YFV B;  4E45 A;  5BS7 C;  1S32 C;  3VH6 W;  5DNN B;  3C1C A;  3TU4 C;  3AZK D;  3W99 D;  3O62 D;  3EG5 B;  4ZBJ B;  3AL0 C;  1P3F B;  3LJA A;  4UUZ A;  1M18 C;  1P3A A;  5GSU B;  4H9O A;  3WTP E;  5CPK B;  3LZ1 B;  1U35 C;  5BO0 A;  3KWQ D;  1P3B B;  5B2I C;  3AN2 B;  3NQJ B;  5AVC B;  1P3L D;  1N1J A;  4NE6 A;  3NQU A;  1EQZ D;  3X1S D;  4ZUX A;  2BG1 A;  4WU9 D;  2F2A C;  2BYM B;  1P3P C;  3KXB C;  3C1B D;  3AZN D;  4NE3 A;  1ZLA D;  1B67 A;  3B6F D;  2ZY3 A;  1P34 C;  3H0M C;  4KUD A;  5AV6 C;  1P3M D;  4LD9 D;  1F66 A;  2UWX A;  3B0B A;  3AZK B;  3O62 B;  3W99 B;  3AYW A;  5CP6 A;  4JJN D;  2Y2P A;  3X1U A;  3C1C D;  3AV1 A;  3V9R B;  4Z2M G;  5B0Y D;  5GSU C;  3KWQ B;  3WTP A;  1KX5 A;  3F6T A;  1P3L B;  2NQB B;  1TAF A;  1EQZ B;  5JA4 B;  3X1S B;  5E5A D;  4WU9 B;  5CPJ B;  4XUJ B;  2Y2J A;  3AZN B;  4J8U B;  1ZLA B;  1T3U A;  5B32 A;  4Z66 C;  3AZJ A;  4CAY A;  4YM6 B;  2CV5 A;  1P3M B;  4LD9 B;  2Y2Q A;  1P3K A;  1P3O C;  1AOI A;  4H9P A;  5F99 C;  4H9Q B;  1HQ3 C;  4JJN B;  3UT9 A;  4J8V A;  3B6G C;  2PYO A;  3AZL A;  4KUD D;  3C1C B;  1F66 D;  3MGR A;  1M19 A;  5B1M C;  5B0Y B;  5CP6 D;  4KGC A;  3AFA C;  1M1A A;  3W96 C;  5AV9 D;  3LJA B;  4UUZ B;  1P3F A;  3W98 D;  1P3A B;  5B0Z C;  5E5A B;  3AZE A;  5BO0 B;  2NQB C;  5CPK A;  1EQZ C;  5CPJ C;  5DNM A;  4XUJ C;  5B2J D;  3AZM D;  3AZI C;  4J8U C;  1N1J B;  2Y2O A;  3NQU B;  5AVC A;  4YM6 C;  1ID3 D;  4ZUX B;  3EPJ A;  4Z5T D;  2DF4 C;  2BYM A;  2ZM5 A;  2XD5 A;  4KUD B;  3WAA C;  3REJ C;  1F66 B;  1AOI D;  5KDM A;  5AV8 D;  5CP6 B;  3AZK A;  3AYW B;  3AV2 D;  5AV9 B;  4DRA A;  3REK A;  3W98 B;  3X1U B;  3LJA C;  3AV1 B;  2RVQ D;  3MGR D;  1M19 D;  1P3A C;  4KGC D;  3B0C T;  3KWQ A;  5BNX A;  1KX5 B;  3AZM B;  3KUY C;  5B31 G;  4WU8 A;  3REL A;  3AZE D;  4Z5T B;  4J8W A;  3MNN A;  1WWI A;  5JA4 A;  3X1S A;  4ZUX C;  5B32 B;  5DNM D;  1F1E A;  4CAY B;  3C1B A;  3AZN A;  1ZLA A;  2Y2I A;  3B6F A;  3X1V A;  3A6N A;  1P3M A;  1AOI B;  3UTB A;  4H9P B;  4LD9 A;  3AV2 B;  4UPK A;  2ZY2 A;  3AYW C;  4H9Q A;  2PYO B;  5JRG D;  3AZL B;  4AWL C;  4JJN A;  2F8N K;  1KX3 D;  3MGR B;  1M19 B;  3MGP A;  3X1U C;  5B33 D;  3AV1 C;  4KGC B;  1M1A B;  4WNN B;  2YFW A;  1P3G A;  4XZQ D;  5B0Y A;  3REK D;  1BH9 B;  3WTP C;  3MGQ D;  1WWS A;  1P3I C;  4J8X C;  1KX5 C;  3AZE B;  5FUG B;  2HIO A;  2F8N D;  5E5A A;  1TZY C;  3KSY A;  5DNM B;  5GXQ D;  4R8P A;  3LEL A;  1HTA A;  5B32 C;  3AZJ C;  3AZH D;  2CV5 C;  4WU8 D;  3REL D;  4QLC A;  4J8W D;  3MNN D;  1P3K C;  4EO5 C;  5JRG B;  5GT0 D;  3UT9 C;  4J8V C;  3X1V D;  3A6N D;  2PYO C;  3AZL C;  5B33 B;  3UTB D;  5KDM B;  3A1I A;  4H9S C;  5DNN C;  3REK B;  5CPI A;  5AV5 D;  1W2E A;  5AV9 A;  1M1A C;  3MGQ B;  2HUE B;  4ZBJ C;  1Q9C A;  1P3F C;  3EPK A;  1R4V A;  3W98 A;  3MGP D;  3AZF D;  2ARO A;  2F8N B;  1P3G D;  3X1T A;  2FJ7 A;  5BNX B;  5CPK C;  3LZ1 C;  5B24 A;  5BNV A;  5DNM C;  5B2J A;  3AZM A;  4WU8 B;  1P3B C;  2XD1 A;  3REL B;  2HIO D;  4J8W B;  3AN2 C;  3MNN B;  5AVC C;  4DQY B;  1ID3 A;  4Z5T A;  5GT0 B;  3C1B B;  4R8P D;  3B6F B;  3X1V B;  3LEL D;  1KX4 D;  3A6N B;  3WA9 A;  3UTB B;  4KHA B;  4QLC D;  5AV8 A;  3TU4 A;  3AV2 A;  3EPH A;  3AZK C;  2Y2M A;  3W99 C;  5AV5 B;  3O62 C;  3B0D B;  3MGP B;  3REH D;  3AZF B;  2J8P A;  2HUE C;  2YFW B;  3W97 A;  1P3G B;  3VH5 W;  1M18 A;  5B1L D;  5CPI D;  5AY8 D;  4WNN A;  3MVD D;  3WKJ D;  2NZD D;  1BH9 A;  3KWQ C;  2JSS A;  2HIO B;  3R45 B;  2ARO D;  1P3L C;  3X1T D;  5FUG A;  2FJ7 D;  2ZY5 A;  5B40 A;  3MNN C;  4R8P B;  5B24 D;  3X1S C;  4WU9 C;  5BT1 D;  4WZS B;  3LEL B;  1KX4 B;  3AZN C;  3C1B C;  1ZLA C;  3B6F C;  4QLC B;  3X1V C;  1P34 A;  4M6B A;  4WV4 B;  1P3M C;  4LD9 C;  1BFM A;  5G49 A;  5JRG A;  3REH B;  3WA9 D;  3REI A;  4JJN C;  1KX3 A;  3UTA A;  1S32 D;  3MGP C;  5B33 A;  3C1C C;  5B1L B;  3TU4 D;  5CPI B;  3VH6 A;  3WKJ B;  4XZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...