5AY8D

Crystal structure of human nucleosome containing h3.y
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
b'RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H3.Y
molecule tags Dna binding protein/dna
source organism Homo sapiens
publication title Structure and function of human histone H3.Y nucleosome
pubmed doi rcsb
total genus 36
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ay8D00
2F8ND 5B33A 3LJAC 3X1UA 4E45A 5CPKC 2HIOB 4KUDD 5CP6A 5BT1D 3W96D 4H9NA 3MGRA 3AZMB 1M1AD 2PYOA 3WA9A 5AV8B 3B6FD 3UTAA 3AZIB 3WAAB 3AZJA 3AZED 5GT0D 4G92C 1M19B 3MNNB 1P3IA 5GSUC 5GXQA 1H3OB 1P3PC 4H9OB 1KX4D 2HUEC 3AV1A 1P3GA 4M6BA 5JRGB 4WU9B 3KXBA 4QLCB 3AV2A 3WTPB 5B33C 5B2JB 4WNNA 5CPKA 1U35B 3X1SC 5B40A 5C3IB 1P3FC 1F66C 1TZYB 1ZLAA 3LELD 4LD9B 1HTAA 5B24D 4KGCC 3C1CD 2CV5C 5B0YC 4X23B 1TZYA 1P3FD 5B1MC 1F66D 2LY8A 5BNVA 2RVQC 2YFWB 5B0ZD 4KUDB 5CP6D 1M19A 1P3OB 3AV2C 3C1BB 1ID3B 3MGPA 1P3AA 4KUDA 3X1VA 4WZSB 1JFIA 1P34D 1KU5A 5GT3C 3WTPD 3REHA 5CPJB 1EQZA 2HIOA 5CP6B 3X1UB 3AZKA 1U35C 1HQ3D 5B0YA 3X1TA 3WTPC 5B33B 3MGSD 2PYOB 3REKB 2NZDB 5DNMD 3C1CB 3VH5T 4QLCD 3W99C 1R4VA 3AZID 3W98C 1KX5D 3WKJC 3MGSC 1KX5B 5AV8D 5E5AC 3MVDD 1M1AB 5F99D 4YM6D 3AN2A 1P3AC 5B1LC 3B6FA 3W99D 3AZIC 1P3MB 1BH9B 2PYOD 5B32B 3MGSB 1BFMA 3W96A 5BO0B 5GT3A 3KWQD 3REHC 1S32A 4WU9D 4Z5TA 2AROB 5DNMA 1KX3C 3RELB 1BH9A 4WU8D 5B32C 5BO0A 4R8PB 3O62C 1JFIB 3MGQB 3W96B 1P34B 2RVQD 3LJAA 4HGAB 3A6NA 5B1LB 1N1JA 2AROA 5CP6C 3AZEB 4XZQC 2F8NB 5DNNC 1P3LB 3C1BD 4J8XA 1WWIA 4YS3A 4H9PB 1P3BC 3AZMD 4NE5A 3REKA 3RELD 3AZJC 2NZDA 4XZQD 5GSUD 4J8UA 1AOIA 1P3PD 5AV9D 4J8VC 5AV9B 4ZUXA 5GXQC 1P3PA 1S32C 3LZ1C 3KUYD 2FJ7B 5AV6C 2YFVB 5B31B 1A7WA 1TZYD 1ID3A 2CV5B 5AV5A 3VH5W 1P3AB 3AFAC 5DNMB 5B24A 3REIC 1EQZB 5B31C 5B2JD 5AV5D 4KHAA 5AV6B 4KGCD 5AVBC 1HQ3B 3LZ1B 3AYWC 1P3BA 4Z5TD 2PYOC 4WU9C 3W97B 3MNND 4X23A 3V9RA 2F8NH 3AV1D 1P3GD 3AZNB 4YM6A 3O62D 5AVBB 1TAFB 5F99B 1P3IC 5GSUA 5CHLB 5B2IC 4H9RA 4YS3D 4J8XD 3WAAA 5BS7C 1M1AC 3X1VC 3MGQC 3REIA 5B31A 4Z66C 3NQJB 2BYMB 2YFWA 3A6ND 3X1SA 3NQUB 4H9OA 5CPKB 1U35A 3VH5A 4XUJC 3KXBB 3UTBA 3AZGA 3X1TC 3WTPA 1P3MC 4WU9A 3UT9D 4CAYA 5CPJC 3W99A 4LD9C 3VH6W 3AN2D 5JRGD 4EO5C 3TU4C 3W97C 3X1SD 4H9SC 4ZUXB 3AZIA 4H9RB 4H9NB 3MGRB 3W96C 2YFVA 5BT1C 3REJD 3AZFC 3WA9B 4KUDC 3TU4D 3B6GC 4Z5TC 4DRBA 2F8NG 5GXQB 3WAAD 3AZHA 5B32A 4Z66B 3REJC 3AZFD 3UTBC 3AZGC 1P3MA 5JRGA 3AZJB 3AN2B 2BYKB 1P34A 3AZLD 1P3BB 1N1JB 5DNND 5B2ID 4E44A 5DNNB 4DRAA 4YS3C 3MGPD 4J8XC 3REHB 3REKC 3LZ0D 3MGRC 3AZFB 2NZDC 1KX4A 1AOIC 5GXQD 5B0ZA 3LJAB 4UUZB 4H9QB 4EO5B 1M18A 5G49A 3LZ0C 3WKJD 4H9PA 1P3KD 5E5AD 1ID3D 1P3PB 3W98B 3C1CA 3UTAD 5CPIC 3B6FB 5FUGA 5JA4B 3AFAD 1M18D 5DNMC 3AFAB 1KX3A 3LELA 3KUYA 3KXBC 4XUJB 5B40D 3O62A 1KX5C 1ULYA 5AV8C 2AROC 3AYWB 4J8UD 4X23D 3W97D 4XZQA 1S32B 4WV4B 3KXBD 5B40C 4CSRB 4WU8B 3MNNC 5DNNA 3X1VB 3AZLA 2JSSA 4CAYB 5B0YB 4X23C 4KGCA 5AY8B 3C1BC 5B32D 5B1MA 3AZHD 4J8VA 3W99B 3AZJD 3B6GB 3LZ1A 4JJNB 4J8VB 1M1AA 3X1TB 1S32D 4Z66A 3MGPC 3X1UC 4JJNC 5B24C 5KDMB 5B33D 1P3LC 5AY8D 1AOID 1TAFA 5F99A 4AWLC 3REIB 3NQJA 3R45A 5B1MD 4JJND 3AYWA 4J8WA 1WWSA 2IO5C 5E5AB 3R45B 5CPID 3UT9B 1HQ3A 5B0YD 5B1LD 3LJAD 3AZKD 3W97A 5B31D 5B2JC 3V9RB 5B1MB 4Z2MG 3REHD 3WTPE 2NQBD 3AYWD 4UUZA 3WAAC 5GT3D 3KWQA 4JJNA 1B67A 5CPIB 3B6FC 5FUGB 5B2IB 1P3IB 5GSUB 4YM6B 3AZEC 4AWLB 5BNXB 4Z66D 1P34C 1AOIB 4XUJA 4QLCA 3AV2B 4ZBJB 2BYKA 3AZMC 4CSRA 1HQ3C 2FJ7C 4NE3A 3X1TD 1H3OA 4KHAB 3MGQD 5AVCA 5AV9C 4J8VD 5B2JA 1P3KC 5AV6D 5CPJD 5AV5B 4KGCB 3KWQC 4H9SA 1P3MD 1B6WA 5GT0B 3AZFA 3C1CC 4WU8C 2CV5D 1P3AD 3AV2D 5G49B 2HIOC 4ZUXD 5GT0C 3REJA 3UTAB 5JRGC 3TU4B 1P3ID 3AZMA 3AFAA 1KX3B 5JA4A 2NQBB 3X1SB 3WKJA 3AZLC 3LELB 3UT9A 4HGAC 3A6NB 1P3OC 1KX4C 4R8PC 1BH8B 3WKJB 3B0DB 3UTBD 3AZGD 3RELC 1U35D 2F8NA 1P3OD 4H9QA 1M18B 5B2IA 3B0DC 5CPIA 5B0ZB 3REID 3A6NC 1KX4B 3LELC 3KWQB 4J8WD 4G91C 1KX5A 5C3IC 1P3FB 1F66B 3B0BA 5F99C 3AZNC 5KDMA 3MVDB 2CWEA 4NE6A 4J8WC 5BNVB 3MNNA 3MGPB 1P3OA 2F8NK 4J8UC 3UTAC 4Z2MH 3AZHB 3AV1B 1P3GB 2HIOD 4ZUXC 1EQZD 4J8WB 3AZLB 1P3BD 5CPJA 5AV6A 2NQBC 4G92B 1M19C 4LD9A 3B0CW 3X1VD 3AZKB 4WNNB 4J8UB 1M19D 1ZLAB 3VH6A 3AZNA 4XUJD 5B40B 3B6GA 5AVBA 1P3LA 4R8PD 3AZHC 1P3FA 1F66A 1ZLAC 4QLCC 3KUYB 2FJ7D 3W98D 2HUEB 2CV5A 1KX3D 3MVDC 1TZYC 1ZLAD 2BYMA 5AVCC 4YM6C 3W98A 2NQBA 4XZQB 5E5AA 5CPKD 5B24B 1P3KA 1P3LD 2AROD 4ZBJC 5B1LA 5BS7A 5AVBD 5AVCD 3O62B 5B0ZC 3MGQA 3AZND 3B6GD 1BH8A 4NFTA 1M18C 4WU8A 5B31G 3LZ0A 4J8XB 4YS3B 5GT0A 4G91B 3AZEA 1EQZC 5AY8A 3AZKC 3KUYC 2L5AA 3MVDA 3WA9D 5AV8A 3MGRD 3REJB 3VH6T 3KSYA 5BNXA 2FJ7A 4Z5TB 3TU4A 3X1UD 3UT9C 5AV9A 3WA9C 3LZ1D 4R8PA 3MGSA 2IO5B 3REKD 3RELA 2NZDD 3AN2C 1F1EA 1P3KB 3C1BA 5GT3B 3UTBB 3AZGB 3B0CT 5AVCB 3NQUA 1Q9CA 5B32G 1ID3C 3LZ0B 3AV1C 5AY8C 5AV5C 1P3GC 4LD9D
chains in the Genus database with same CATH superfamily
2F8ND 5B33A 3LJAC 3X1UA 4E45A 5CPKC 2HIOB 4KUDD 5CP6A 5BT1D 3W96D 4H9NA 3MGRA 3AZMB 1M1AD 2PYOA 3WA9A 5AV8B 3B6FD 3UTAA 3AZIB 3WAAB 3AZJA 3AZED 5GT0D 4G92C 1M19B 3MNNB 1JFIB 1P3IA 5GSUC 5GXQA 1H3OB 1P3PC 4H9OB 1KX4D 2HUEC 3AV1A 1P3GA 4M6BA 5JRGB 4WU9B 3KXBA 4QLCB 2ZY3A 3AV2A 3WTPB 5B33C 5B2JB 4WNNA 5CPKA 1U35B 3X1SC 5B40A 3EPLA 5C3IB 1P3FC 2ZY5A 1TZYB 1F66C 3LELD 1ZLAA 4LD9B 1HTAA 5B24D 4KGCC 3C1CD 2CV5C 5B0YC 4X23B 1TZYA 1P3FD 5B1MC 1F66D 2LY8A 5BNVA 2RVQC 2YFWB 5B0ZD 4KUDB 5CP6D 1M19A 1P3OB 3AV2C 3C1BB 1ID3B 3MGPA 1P3AA 4KUDA 3X1VA 4WZSB 1JFIA 1P34D 1KU5A 5GT3C 3WTPD 3REHA 5CPJB 1EQZA 2HIOA 5CP6B 3X1UB 3AZKA 3EPKA 1U35C 5B0YA 1HQ3D 3X1TA 5B33B 3WTPC 3MGSD 2PYOB 3REKB 2NZDB 5DNMD 3C1CB 4QLCD 3VH5T 3W99C 1R4VA 2RIQA 3AZID 3W98C 1KX5D 3WKJC 3MGSC 1KX5B 5AV8D 5E5AC 3MVDD 2FFFB 1M1AB 5F99D 2VQRA 4YM6D 3AN2A 1P3AC 5B1LC 3B6FA 3W99D 3AZIC 1P3MB 1BH9B 2PYOD 5B32B 3MGSB 1BFMA 3W96A 5BO0B 5GT3A 3KWQD 3REHC 1S32A 4WU9D 4Z5TA 2AROB 5DNMA 1KX3C 3RELB 1BH9A 4WU8D 5B32C 5BO0A 4R8PB 2F2AC 3O62C 2Y2PA 3MGQB 1P34B 2RVQD 3LJAA 4HGAB 3A6NA 5B1LB 1N1JA 2AROA 5CP6C 3AZEB 4XZQC 2F8NB 5DNNC 1P3LB 3C1BD 4J8XA 1WWIA 4YS3A 4H9PB 1PZRA 1P3BC 3AZMD 4NE5A 3REKA 3RELD 3AZJC 2NZDA 4XZQD 5GSUD 4J8UA 1AOIA 1P3PD 5AV9D 4J8VC 5AV9B 4ZUXA 5GXQC 1P3PA 1S32C 3LZ1C 3KUYD 2FJ7B 5AV6C 2YFVB 5B31B 3F6TA 1A7WA 1TZYD 1ID3A 2CV5B 5AV5A 3VH5W 1P3AB 3AFAC 5DNMB 5B24A 2Y2IA 3REIC 5B31C 5B2JD 1EQZB 2JE5A 2Y2OA 5AV5D 4KHAA 5AV6B 4KGCD 5AVBC 1HQ3B 3LZ1B 3AYWC 1P3BA 4Z5TD 2PYOC 4DQYB 2DQNC 4WU9C 3W97B 3MNND 4X23A 3V9RA 2F8NH 3AV1D 1P3GD 3AZNB 4YM6A 5AVBB 3O62D 1TAFB 2XD5A 5F99B 5GSUA 5CHLB 1P3IC 5B2IC 4H9RA 3H0RC 4YS3D 4J8XD 3WAAA 5BS7C 1M1AC 3X1VC 3MGQC 3REIA 5B31A 4Z66C 3NQJB 2BYMB 2YFWA 3A6ND 3X1SA 3NQUB 4H9OA 5CPKB 1U35A 3VH5A 4XUJC 3KXBB 3UTBA 3AZGA 3X1TC 3WTPA 1P3MC 4WU9A 3UT9D 4CAYA 3KFUG 5CPJC 3W99A 4LD9C 3FDDA 3VH6W 3AN2D 5JRGD 4EO5C 2JCHA 3TU4C 3W97C 3X1SD 4H9SC 4ZUXB 3AZIA 4WJ3C 4H9RB 4H9NB 3MGRB 3A1KA 2YFVA 3W96C 5BT1C 3REJD 3AZFC 3WA9B 4KUDC 2BG1A 3TU4D 3B6GC 2W8SA 4Z5TC 4DRBA 2F8NG 5GXQB 3WAAD 2Y2LA 3AZHA 1T3UA 5B32A 4Z66B 3REJC 3AZFD 3UTBC 3AZGC 1P3MA 5JRGA 3AZJB 3AN2B 2BYKB 1P34A 3AZLD 1P3BB 1N1JB 2G5IC 5DNND 5B2ID 4E44A 5DNNB 4DRAA 4YS3C 3MGPD 4J8XC 3REHB 3REKC 3LZ0D 3MGRC 3AZFB 2NZDC 1KX4A 1AOIC 5GXQD 5B0ZA 3LJAB 4UUZB 4H9QB 4EO5B 1M18A 5G49A 3LZ0C 3WKJD 4H9PA 1P3KD 5E5AD 1ID3D 1P3PB 3W98B 3C1CA 3UTAD 5CPIC 3B6FB 5FUGA 5JA4B 3AFAD 1M18D 5DNMC 3AFAB 1KX3A 3LELA 3KUYA 4XUJB 5B40D 3KXBC 3O62A 1KX5C 1ULYA 3P5JB 5AV8C 2AROC 3AYWB 4J8UD 4X23D 3W97D 4XZQA 1S32B 4WV4B 3KXBD 5B40C 4CSRB 4WU8B 4UPKA 5DNNA 3MNNC 3X1VB 3AZLA 2JSSA 4CAYB 5B0YB 4X23C 4KGCA 5AY8B 3C1BC 1Z2CB 5B1MA 5B32D 3AZHD 4J8VA 3W99B 2Y2HA 3AZJD 3B6GB 3LZ1A 4JJNB 4J8VB 1M1AA 3X1TB 1S32D 4Z66A 3MGPC 3X1UC 2Y2GA 4JJNC 5B24C 5KDMB 5B33D 1P3LC 5AY8D 1AOID 1TAFA 5F99A 4AWLC 3REIB 3NQJA 3R45A 5B1MD 4JJND 3AYWA 4J8WA 1WWSA 2IO5C 5E5AB 3R45B 5CPID 3UT9B 1HQ3A 5B0YD 5B1LD 3LJAD 3AZKD 3W97A 5B31D 5B2JC 3V9RB 5B1MB 4Z2MG 3REHD 3WTPE 2NQBD 3AYWD 4UUZA 3WAAC 5GT3D 3KWQA 4JJNA 1B67A 5CPIB 3B6FC 5FUGB 5B2IB 1P3IB 5GSUB 4YM6B 3AZEC 4AWLB 5BNXB 4Z66D 1P34C 1AOIB 4XUJA 4QLCA 3AV2B 4ZBJB 2BYKA 3AZMC 4CSRA 1HQ3C 2FJ7C 4NE3A 3X1TD 1H3OA 4KHAB 3MGQD 5AVCA 5AV9C 4J8VD 5B2JA 3IP4C 1P3KC 5AV6D 5CPJD 5AV5B 4KGCB 3KWQC 4H9SA 1P3MD 1B6WA 5GT0B 3AZFA 3AL0C 3C1CC 4WU8C 2CV5D 1P3AD 3AV2D 5G49B 2HIOC 4ZUXD 3EPHA 5GT0C 3REJA 3UTAB 5JRGC 3TU4B 1P3ID 3EPJA 3AZMA 2Y2JA 3AFAA 1KX3B 5JA4A 2NQBB 3X1SB 3WKJA 3AZLC 3H0MC 3LELB 3UT9A 4HGAC 3A6NB 1P3OC 1KX4C 4R8PC 1BH8B 3WKJB 3B0DB 3UTBD 3AZGD 3RELC 2XD1A 1U35D 2F8NA 1P3OD 2UWXA 4H9QA 1M18B 2Y2NA 5B2IA 3B0DC 5CPIA 5B0ZB 3REID 3A6NC 1KX4B 3LELC 2Y2QA 3KWQB 4J8WD 4G91C 1KX5A 5C3IC 1P3FB 1F66B 3B0BA 5F99C 3AZNC 5KDMA 3MVDB 2CWEA 4NE6A 4J8WC 2J8PA 5BNVB 3MNNA 3MGPB 1P3OA 2F8NK 4J8UC 3UTAC 2G5HC 4Z2MH 3AZHB 3AV1B 1P3GB 2HIOD 4ZUXC 1EQZD 4J8WB 3AZLB 1P3BD 5CPJA 5AV6A 2NQBC 4G92B 1M19C 4LD9A 3B0CW 3X1VD 3AZKB 4WNNB 4J8UB 1M19D 1ZLAB 3VH6A 3W96B 3AZNA 4XUJD 5B40B 3B6GA 5AVBA 1P3LA 4R8PD 3AZHC 1P3FA 1F66A 1ZLAC 2DF4C 4QLCC 3KUYB 2FJ7D 3W98D 2HUEB 2CV5A 1KX3D 3MVDC 1TZYC 1ZLAD 2BYMA 5AVCC 4YM6C 3W98A 2NQBA 4XZQB 5E5AA 5CPKD 5B24B 1P3KA 1P3LD 2AROD 2Y2MA 2ZY2A 4ZBJC 5B1LA 5BS7A 5AVBD 5B0ZC 5AVCD 3O62B 3MGQA 3AZND 1BH8A 3B6GD 4NFTA 1M18C 4WU8A 5B31G 3LZ0A 2ZY4A 4J8XB 4YS3B 3H0LC 5GT0A 4G91B 3AZEA 1EQZC 2ZM5A 5AY8A 3AZKC 2Y2KA 3KUYC 3EG5B 2L5AA 3A1IA 3MVDA 3WA9D 5AV8A 3MGRD 3REJB 3VH6T 3KSYA 5BNXA 2FJ7A 4Z5TB 3TU4A 3X1UD 3UT9C 5AV9A 3WA9C 3LZ1D 4R8PA 3MGSA 2IO5B 3REKD 3RELA 2NZDD 3AN2C 1F1EA 1P3KB 3C1BA 5GT3B 3UTBB 3AZGB 3B0CT 5AVCB 1W2EA 3NQUA 1Q9CA 5B32G 1ID3C 3LZ0B 3AV1C 5AY8C 5AV5C 1P3GC 4LD9D
chains in the Genus database with same CATH topology
2F8ND 5B33A 3LJAC 3X1UA 4E45A 5CPKC 2HIOB 4KUDD 5CP6A 5BT1D 3W96D 4H9NA 3MGRA 3AZMB 1M1AD 2PYOA 3WA9A 5AV8B 3B6FD 3UTAA 3AZIB 3WAAB 3AZJA 3AZED 5GT0D 4G92C 1M19B 3MNNB 1JFIB 1P3IA 5GSUC 5GXQA 1H3OB 1P3PC 4H9OB 1KX4D 2HUEC 3AV1A 1P3GA 4M6BA 5JRGB 4WU9B 3KXBA 4QLCB 2ZY3A 3AV2A 3WTPB 5B33C 5B2JB 4WNNA 5CPKA 1U35B 3X1SC 5B40A 3EPLA 5C3IB 1P3FC 2ZY5A 1TZYB 1F66C 3LELD 1ZLAA 4LD9B 1HTAA 5B24D 4KGCC 3C1CD 2CV5C 5B0YC 4X23B 1TZYA 1P3FD 5B1MC 1F66D 2LY8A 5BNVA 2RVQC 2YFWB 5B0ZD 4KUDB 5CP6D 1M19A 1P3OB 3AV2C 3C1BB 1ID3B 3MGPA 1P3AA 4KUDA 3X1VA 4WZSB 1JFIA 1P34D 1KU5A 5GT3C 3WTPD 3REHA 5CPJB 1EQZA 2HIOA 5CP6B 3X1UB 3AZKA 3EPKA 1U35C 5B0YA 1HQ3D 3X1TA 5B33B 3WTPC 3MGSD 2PYOB 3REKB 2NZDB 5DNMD 3C1CB 4QLCD 3VH5T 3W99C 1R4VA 2RIQA 3AZID 3W98C 1KX5D 3WKJC 3MGSC 1KX5B 5AV8D 5E5AC 3MVDD 2FFFB 1M1AB 5F99D 2VQRA 4YM6D 3AN2A 1P3AC 5B1LC 3B6FA 3W99D 3AZIC 1P3MB 1BH9B 2PYOD 5B32B 3MGSB 1BFMA 3W96A 5BO0B 5GT3A 3KWQD 3REHC 1S32A 4WU9D 4Z5TA 2AROB 5DNMA 1KX3C 3RELB 1BH9A 4WU8D 5B32C 5BO0A 4R8PB 2F2AC 3O62C 2Y2PA 3MGQB 1P34B 2RVQD 3LJAA 4HGAB 3A6NA 5B1LB 1N1JA 2AROA 5CP6C 3AZEB 4XZQC 2F8NB 5DNNC 1P3LB 3C1BD 4J8XA 1WWIA 4YS3A 4H9PB 1PZRA 1P3BC 3AZMD 4NE5A 3REKA 3RELD 3AZJC 2NZDA 4XZQD 5GSUD 4J8UA 1AOIA 1P3PD 5AV9D 4J8VC 5AV9B 4ZUXA 5GXQC 1P3PA 1S32C 3LZ1C 3KUYD 2FJ7B 5AV6C 2YFVB 5B31B 3F6TA 1A7WA 1TZYD 1ID3A 2CV5B 5AV5A 3VH5W 1P3AB 3AFAC 5DNMB 5B24A 2Y2IA 3REIC 5B31C 5B2JD 1EQZB 2JE5A 2Y2OA 5AV5D 4KHAA 5AV6B 4KGCD 5AVBC 1HQ3B 3LZ1B 3AYWC 1P3BA 4Z5TD 2PYOC 4DQYB 2DQNC 4WU9C 3W97B 3MNND 4X23A 3V9RA 2F8NH 3AV1D 1P3GD 3AZNB 4YM6A 5AVBB 3O62D 1TAFB 2XD5A 5F99B 5GSUA 5CHLB 1P3IC 5B2IC 4H9RA 3H0RC 4YS3D 4J8XD 3WAAA 5BS7C 1M1AC 3X1VC 3MGQC 3REIA 5B31A 4Z66C 3NQJB 2BYMB 2YFWA 3A6ND 3X1SA 3NQUB 4H9OA 5CPKB 1U35A 3VH5A 4XUJC 3KXBB 3UTBA 3AZGA 3X1TC 3WTPA 1P3MC 4WU9A 3UT9D 4CAYA 3KFUG 5CPJC 3W99A 4LD9C 3FDDA 3VH6W 3AN2D 5JRGD 4EO5C 2JCHA 3TU4C 3W97C 3X1SD 4H9SC 4ZUXB 3AZIA 4WJ3C 4H9RB 4H9NB 3MGRB 3A1KA 2YFVA 3W96C 5BT1C 3REJD 3AZFC 3WA9B 4KUDC 2BG1A 3TU4D 3B6GC 2W8SA 4Z5TC 4DRBA 2F8NG 5GXQB 3WAAD 2Y2LA 3AZHA 1T3UA 5B32A 4Z66B 3REJC 3AZFD 3UTBC 3AZGC 1P3MA 5JRGA 3AZJB 3AN2B 2BYKB 1P34A 3AZLD 1P3BB 1N1JB 2G5IC 5DNND 5B2ID 4E44A 5DNNB 4DRAA 4YS3C 3MGPD 4J8XC 3REHB 3REKC 3LZ0D 3MGRC 3AZFB 2NZDC 1KX4A 1AOIC 5GXQD 5B0ZA 3LJAB 4UUZB 4H9QB 4EO5B 1M18A 5G49A 3LZ0C 3WKJD 4H9PA 1P3KD 5E5AD 1ID3D 1P3PB 3W98B 3C1CA 3UTAD 5CPIC 3B6FB 5FUGA 5JA4B 3AFAD 1M18D 5DNMC 3AFAB 1KX3A 3LELA 3KUYA 4XUJB 5B40D 3KXBC 3O62A 1KX5C 1ULYA 3P5JB 5AV8C 2AROC 3AYWB 4J8UD 4X23D 3W97D 4XZQA 1S32B 4WV4B 3KXBD 5B40C 4CSRB 4WU8B 4UPKA 5DNNA 3MNNC 3X1VB 3AZLA 2JSSA 4CAYB 5B0YB 4X23C 4KGCA 5AY8B 3C1BC 1Z2CB 5B1MA 5B32D 3AZHD 4J8VA 3W99B 2Y2HA 3AZJD 3B6GB 3LZ1A 4JJNB 4J8VB 1M1AA 3X1TB 1S32D 4Z66A 3MGPC 3X1UC 2Y2GA 4JJNC 5B24C 5KDMB 5B33D 1P3LC 5AY8D 1AOID 1TAFA 5F99A 4AWLC 3REIB 3NQJA 3R45A 5B1MD 4JJND 3AYWA 4J8WA 1WWSA 2IO5C 5E5AB 3R45B 5CPID 3UT9B 1HQ3A 5B0YD 5B1LD 3LJAD 3AZKD 3W97A 5B31D 5B2JC 3V9RB 5B1MB 4Z2MG 3REHD 3WTPE 2NQBD 3AYWD 4UUZA 3WAAC 5GT3D 3KWQA 4JJNA 1B67A 5CPIB 3B6FC 5FUGB 5B2IB 1P3IB 5GSUB 4YM6B 3AZEC 4AWLB 5BNXB 4Z66D 1P34C 1AOIB 4XUJA 4QLCA 3AV2B 4ZBJB 2BYKA 3AZMC 4CSRA 1HQ3C 2FJ7C 4NE3A 3X1TD 1H3OA 4KHAB 3MGQD 5AVCA 5AV9C 4J8VD 5B2JA 3IP4C 1P3KC 5AV6D 5CPJD 5AV5B 4KGCB 3KWQC 4H9SA 1P3MD 1B6WA 5GT0B 3AZFA 3AL0C 3C1CC 4WU8C 2CV5D 1P3AD 3AV2D 5G49B 2HIOC 4ZUXD 3EPHA 5GT0C 3REJA 3UTAB 5JRGC 3TU4B 1P3ID 3EPJA 3AZMA 2Y2JA 3AFAA 1KX3B 5JA4A 2NQBB 3X1SB 3WKJA 3AZLC 3H0MC 3LELB 3UT9A 4HGAC 3A6NB 1P3OC 1KX4C 4R8PC 1BH8B 3WKJB 3B0DB 3UTBD 3AZGD 3RELC 2XD1A 1U35D 2F8NA 1P3OD 2UWXA 4H9QA 1M18B 2Y2NA 5B2IA 3B0DC 5CPIA 5B0ZB 3REID 3A6NC 1KX4B 3LELC 2Y2QA 3KWQB 4J8WD 4G91C 1KX5A 5C3IC 1P3FB 1F66B 3B0BA 5F99C 3AZNC 5KDMA 3MVDB 2CWEA 4NE6A 4J8WC 2J8PA 5BNVB 3MNNA 3MGPB 1P3OA 2F8NK 4J8UC 3UTAC 2G5HC 4Z2MH 3AZHB 3AV1B 1P3GB 2HIOD 4ZUXC 1EQZD 4J8WB 3AZLB 1P3BD 5CPJA 5AV6A 2NQBC 4G92B 1M19C 4LD9A 3B0CW 3X1VD 3AZKB 4WNNB 4J8UB 1M19D 1ZLAB 3VH6A 3W96B 3AZNA 4XUJD 5B40B 3B6GA 5AVBA 1P3LA 4R8PD 3AZHC 1P3FA 1F66A 1ZLAC 2DF4C 4QLCC 3KUYB 2FJ7D 3W98D 2HUEB 2CV5A 1KX3D 3MVDC 1TZYC 1ZLAD 2BYMA 5AVCC 4YM6C 3W98A 2NQBA 4XZQB 5E5AA 5CPKD 5B24B 1P3KA 1P3LD 2AROD 2Y2MA 2ZY2A 4ZBJC 5B1LA 5BS7A 5AVBD 5B0ZC 5AVCD 3O62B 3MGQA 3AZND 1BH8A 3B6GD 4NFTA 1M18C 4WU8A 5B31G 3LZ0A 2ZY4A 4J8XB 4YS3B 3H0LC 5GT0A 4G91B 3AZEA 1EQZC 2ZM5A 5AY8A 3AZKC 2Y2KA 3KUYC 3EG5B 2L5AA 3A1IA 3MVDA 3WA9D 5AV8A 3MGRD 3REJB 3VH6T 3KSYA 5BNXA 2FJ7A 4Z5TB 3TU4A 3X1UD 3UT9C 5AV9A 3WA9C 3LZ1D 4R8PA 3MGSA 2IO5B 3REKD 3RELA 2NZDD 3AN2C 1F1EA 1P3KB 3C1BA 5GT3B 3UTBB 3AZGB 3B0CT 5AVCB 1W2EA 3NQUA 1Q9CA 5B32G 1ID3C 3LZ0B 3AV1C 5AY8C 5AV5C 1P3GC 4LD9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8N D;  5B33 A;  3LJA C;  3X1U A;  4E45 A;  5CPK C;  2HIO B;  4KUD D;  5CP6 A;  5BT1 D;  3W96 D;  4H9N A;  3MGR A;  3AZM B;  1M1A D;  2PYO A;  3WA9 A;  5AV8 B;  3B6F D;  3UTA A;  3AZI B;  3WAA B;  3AZJ A;  3AZE D;  5GT0 D;  4G92 C;  1M19 B;  3MNN B;  1P3I A;  5GSU C;  5GXQ A;  1H3O B;  1P3P C;  4H9O B;  1KX4 D;  2HUE C;  3AV1 A;  1P3G A;  4M6B A;  5JRG B;  4WU9 B;  3KXB A;  4QLC B;  3AV2 A;  3WTP B;  5B33 C;  5B2J B;  4WNN A;  5CPK A;  1U35 B;  3X1S C;  5B40 A;  5C3I B;  1P3F C;  1F66 C;  1TZY B;  1ZLA A;  3LEL D;  4LD9 B;  1HTA A;  5B24 D;  4KGC C;  3C1C D;  2CV5 C;  5B0Y C;  4X23 B;  1TZY A;  1P3F D;  5B1M C;  1F66 D;  2LY8 A;  5BNV A;  2RVQ C;  2YFW B;  5B0Z D;  4KUD B;  5CP6 D;  1M19 A;  1P3O B;  3AV2 C;  3C1B B;  1ID3 B;  3MGP A;  1P3A A;  4KUD A;  3X1V A;  4WZS B;  1JFI A;  1P34 D;  1KU5 A;  5GT3 C;  3WTP D;  3REH A;  5CPJ B;  1EQZ A;  2HIO A;  5CP6 B;  3X1U B;  3AZK A;  1U35 C;  1HQ3 D;  5B0Y A;  3X1T A;  3WTP C;  5B33 B;  3MGS D;  2PYO B;  3REK B;  2NZD B;  5DNM D;  3C1C B;  3VH5 T;  4QLC D;  3W99 C;  1R4V A;  3AZI D;  3W98 C;  1KX5 D;  3WKJ C;  3MGS C;  1KX5 B;  5AV8 D;  5E5A C;  3MVD D;  1M1A B;  5F99 D;  4YM6 D;  3AN2 A;  1P3A C;  5B1L C;  3B6F A;  3W99 D;  3AZI C;  1P3M B;  1BH9 B;  2PYO D;  5B32 B;  3MGS B;  1BFM A;  3W96 A;  5BO0 B;  5GT3 A;  3KWQ D;  3REH C;  1S32 A;  4WU9 D;  4Z5T A;  2ARO B;  5DNM A;  1KX3 C;  3REL B;  1BH9 A;  4WU8 D;  5B32 C;  5BO0 A;  4R8P B;  3O62 C;  1JFI B;  3MGQ B;  3W96 B;  1P34 B;  2RVQ D;  3LJA A;  4HGA B;  3A6N A;  5B1L B;  1N1J A;  2ARO A;  5CP6 C;  3AZE B;  4XZQ C;  2F8N B;  5DNN C;  1P3L B;  3C1B D;  4J8X A;  1WWI A;  4YS3 A;  4H9P B;  1P3B C;  3AZM D;  4NE5 A;  3REK A;  3REL D;  3AZJ C;  2NZD A;  4XZQ D;  5GSU D;  4J8U A;  1AOI A;  1P3P D;  5AV9 D;  4J8V C;  5AV9 B;  4ZUX A;  5GXQ C;  1P3P A;  1S32 C;  3LZ1 C;  3KUY D;  2FJ7 B;  5AV6 C;  2YFV B;  5B31 B;  1A7W A;  1TZY D;  1ID3 A;  2CV5 B;  5AV5 A;  3VH5 W;  1P3A B;  3AFA C;  5DNM B;  5B24 A;  3REI C;  1EQZ B;  5B31 C;  5B2J D;  5AV5 D;  4KHA A;  5AV6 B;  4KGC D;  5AVB C;  1HQ3 B;  3LZ1 B;  3AYW C;  1P3B A;  4Z5T D;  2PYO C;  4WU9 C;  3W97 B;  3MNN D;  4X23 A;  3V9R A;  2F8N H;  3AV1 D;  1P3G D;  3AZN B;  4YM6 A;  3O62 D;  5AVB B;  1TAF B;  5F99 B;  1P3I C;  5GSU A;  5CHL B;  5B2I C;  4H9R A;  4YS3 D;  4J8X D;  3WAA A;  5BS7 C;  1M1A C;  3X1V C;  3MGQ C;  3REI A;  5B31 A;  4Z66 C;  3NQJ B;  2BYM B;  2YFW A;  3A6N D;  3X1S A;  3NQU B;  4H9O A;  5CPK B;  1U35 A;  3VH5 A;  4XUJ C;  3KXB B;  3UTB A;  3AZG A;  3X1T C;  3WTP A;  1P3M C;  4WU9 A;  3UT9 D;  4CAY A;  5CPJ C;  3W99 A;  4LD9 C;  3VH6 W;  3AN2 D;  5JRG D;  4EO5 C;  3TU4 C;  3W97 C;  3X1S D;  4H9S C;  4ZUX B;  3AZI A;  4H9R B;  4H9N B;  3MGR B;  3W96 C;  2YFV A;  5BT1 C;  3REJ D;  3AZF C;  3WA9 B;  4KUD C;  3TU4 D;  3B6G C;  4Z5T C;  4DRB A;  2F8N G;  5GXQ B;  3WAA D;  3AZH A;  5B32 A;  4Z66 B;  3REJ C;  3AZF D;  3UTB C;  3AZG C;  1P3M A;  5JRG A;  3AZJ B;  3AN2 B;  2BYK B;  1P34 A;  3AZL D;  1P3B B;  1N1J B;  5DNN D;  5B2I D;  4E44 A;  5DNN B;  4DRA A;  4YS3 C;  3MGP D;  4J8X C;  3REH B;  3REK C;  3LZ0 D;  3MGR C;  3AZF B;  2NZD C;  1KX4 A;  1AOI C;  5GXQ D;  5B0Z A;  3LJA B;  4UUZ B;  4H9Q B;  4EO5 B;  1M18 A;  5G49 A;  3LZ0 C;  3WKJ D;  4H9P A;  1P3K D;  5E5A D;  1ID3 D;  1P3P B;  3W98 B;  3C1C A;  3UTA D;  5CPI C;  3B6F B;  5FUG A;  5JA4 B;  3AFA D;  1M18 D;  5DNM C;  3AFA B;  1KX3 A;  3LEL A;  3KUY A;  3KXB C;  4XUJ B;  5B40 D;  3O62 A;  1KX5 C;  1ULY A;  5AV8 C;  2ARO C;  3AYW B;  4J8U D;  4X23 D;  3W97 D;  4XZQ A;  1S32 B;  4WV4 B;  3KXB D;  5B40 C;  4CSR B;  4WU8 B;  3MNN C;  5DNN A;  3X1V B;  3AZL A;  2JSS A;  4CAY B;  5B0Y B;  4X23 C;  4KGC A;  5AY8 B;  3C1B C;  5B32 D;  5B1M A;  3AZH D;  4J8V A;  3W99 B;  3AZJ D;  3B6G B;  3LZ1 A;  4JJN B;  4J8V B;  1M1A A;  3X1T B;  1S32 D;  4Z66 A;  3MGP C;  3X1U C;  4JJN C;  5B24 C;  5KDM B;  5B33 D;  1P3L C;  5AY8 D;  1AOI D;  1TAF A;  5F99 A;  4AWL C;  3REI B;  3NQJ A;  3R45 A;  5B1M D;  4JJN D;  3AYW A;  4J8W A;  1WWS A;  2IO5 C;  5E5A B;  3R45 B;  5CPI D;  3UT9 B;  1HQ3 A;  5B0Y D;  5B1L D;  3LJA D;  3AZK D;  3W97 A;  5B31 D;  5B2J C;  3V9R B;  5B1M B;  4Z2M G;  3REH D;  3WTP E;  2NQB D;  3AYW D;  4UUZ A;  3WAA C;  5GT3 D;  3KWQ A;  4JJN A;  1B67 A;  5CPI B;  3B6F C;  5FUG B;  5B2I B;  1P3I B;  5GSU B;  4YM6 B;  3AZE C;  4AWL B;  5BNX B;  4Z66 D;  1P34 C;  1AOI B;  4XUJ A;  4QLC A;  3AV2 B;  4ZBJ B;  2BYK A;  3AZM C;  4CSR A;  1HQ3 C;  2FJ7 C;  4NE3 A;  3X1T D;  1H3O A;  4KHA B;  3MGQ D;  5AVC A;  5AV9 C;  4J8V D;  5B2J A;  1P3K C;  5AV6 D;  5CPJ D;  5AV5 B;  4KGC B;  3KWQ C;  4H9S A;  1P3M D;  1B6W A;  5GT0 B;  3AZF A;  3C1C C;  4WU8 C;  2CV5 D;  1P3A D;  3AV2 D;  5G49 B;  2HIO C;  4ZUX D;  5GT0 C;  3REJ A;  3UTA B;  5JRG C;  3TU4 B;  1P3I D;  3AZM A;  3AFA A;  1KX3 B;  5JA4 A;  2NQB B;  3X1S B;  3WKJ A;  3AZL C;  3LEL B;  3UT9 A;  4HGA C;  3A6N B;  1P3O C;  1KX4 C;  4R8P C;  1BH8 B;  3WKJ B;  3B0D B;  3UTB D;  3AZG D;  3REL C;  1U35 D;  2F8N A;  1P3O D;  4H9Q A;  1M18 B;  5B2I A;  3B0D C;  5CPI A;  5B0Z B;  3REI D;  3A6N C;  1KX4 B;  3LEL C;  3KWQ B;  4J8W D;  4G91 C;  1KX5 A;  5C3I C;  1P3F B;  1F66 B;  3B0B A;  5F99 C;  3AZN C;  5KDM A;  3MVD B;  2CWE A;  4NE6 A;  4J8W C;  5BNV B;  3MNN A;  3MGP B;  1P3O A;  2F8N K;  4J8U C;  3UTA C;  4Z2M H;  3AZH B;  3AV1 B;  1P3G B;  2HIO D;  4ZUX C;  1EQZ D;  4J8W B;  3AZL B;  1P3B D;  5CPJ A;  5AV6 A;  2NQB C;  4G92 B;  1M19 C;  4LD9 A;  3B0C W;  3X1V D;  3AZK B;  4WNN B;  4J8U B;  1M19 D;  1ZLA B;  3VH6 A;  3AZN A;  4XUJ D;  5B40 B;  3B6G A;  5AVB A;  1P3L A;  4R8P D;  3AZH C;  1P3F A;  1F66 A;  1ZLA C;  4QLC C;  3KUY B;  2FJ7 D;  3W98 D;  2HUE B;  2CV5 A;  1KX3 D;  3MVD C;  1TZY C;  1ZLA D;  2BYM A;  5AVC C;  4YM6 C;  3W98 A;  2NQB A;  4XZQ B;  5E5A A;  5CPK D;  5B24 B;  1P3K A;  1P3L D;  2ARO D;  4ZBJ C;  5B1L A;  5BS7 A;  5AVB D;  5AVC D;  3O62 B;  5B0Z C;  3MGQ A;  3AZN D;  3B6G D;  1BH8 A;  4NFT A;  1M18 C;  4WU8 A;  5B31 G;  3LZ0 A;  4J8X B;  4YS3 B;  5GT0 A;  4G91 B;  3AZE A;  1EQZ C;  5AY8 A;  3AZK C;  3KUY C;  2L5A A;  3MVD A;  3WA9 D;  5AV8 A;  3MGR D;  3REJ B;  3VH6 T;  3KSY A;  5BNX A;  2FJ7 A;  4Z5T B;  3TU4 A;  3X1U D;  3UT9 C;  5AV9 A;  3WA9 C;  3LZ1 D;  4R8P A;  3MGS A;  2IO5 B;  3REK D;  3REL A;  2NZD D;  3AN2 C;  1F1E A;  1P3K B;  3C1B A;  5GT3 B;  3UTB B;  3AZG B;  3B0C T;  5AVC B;  3NQU A;  1Q9C A;  5B32 G;  1ID3 C;  3LZ0 B;  3AV1 C;  5AY8 C;  5AV5 C;  1P3G C;  4LD9 D; 
#chains in the Genus database with same CATH topology
 2F8N D;  5B33 A;  3LJA C;  3X1U A;  4E45 A;  5CPK C;  2HIO B;  4KUD D;  5CP6 A;  5BT1 D;  3W96 D;  4H9N A;  3MGR A;  3AZM B;  1M1A D;  2PYO A;  3WA9 A;  5AV8 B;  3B6F D;  3UTA A;  3AZI B;  3WAA B;  3AZJ A;  3AZE D;  5GT0 D;  4G92 C;  1M19 B;  3MNN B;  1JFI B;  1P3I A;  5GSU C;  5GXQ A;  1H3O B;  1P3P C;  4H9O B;  1KX4 D;  2HUE C;  3AV1 A;  1P3G A;  4M6B A;  5JRG B;  4WU9 B;  3KXB A;  4QLC B;  2ZY3 A;  3AV2 A;  3WTP B;  5B33 C;  5B2J B;  4WNN A;  5CPK A;  1U35 B;  3X1S C;  5B40 A;  3EPL A;  5C3I B;  1P3F C;  2ZY5 A;  1TZY B;  1F66 C;  3LEL D;  1ZLA A;  4LD9 B;  1HTA A;  5B24 D;  4KGC C;  3C1C D;  2CV5 C;  5B0Y C;  4X23 B;  1TZY A;  1P3F D;  5B1M C;  1F66 D;  2LY8 A;  5BNV A;  2RVQ C;  2YFW B;  5B0Z D;  4KUD B;  5CP6 D;  1M19 A;  1P3O B;  3AV2 C;  3C1B B;  1ID3 B;  3MGP A;  1P3A A;  4KUD A;  3X1V A;  4WZS B;  1JFI A;  1P34 D;  1KU5 A;  5GT3 C;  3WTP D;  3REH A;  5CPJ B;  1EQZ A;  2HIO A;  5CP6 B;  3X1U B;  3AZK A;  3EPK A;  1U35 C;  5B0Y A;  1HQ3 D;  3X1T A;  5B33 B;  3WTP C;  3MGS D;  2PYO B;  3REK B;  2NZD B;  5DNM D;  3C1C B;  4QLC D;  3VH5 T;  3W99 C;  1R4V A;  2RIQ A;  3AZI D;  3W98 C;  1KX5 D;  3WKJ C;  3MGS C;  1KX5 B;  5AV8 D;  5E5A C;  3MVD D;  2FFF B;  1M1A B;  5F99 D;  2VQR A;  4YM6 D;  3AN2 A;  1P3A C;  5B1L C;  3B6F A;  3W99 D;  3AZI C;  1P3M B;  1BH9 B;  2PYO D;  5B32 B;  3MGS B;  1BFM A;  3W96 A;  5BO0 B;  5GT3 A;  3KWQ D;  3REH C;  1S32 A;  4WU9 D;  4Z5T A;  2ARO B;  5DNM A;  1KX3 C;  3REL B;  1BH9 A;  4WU8 D;  5B32 C;  5BO0 A;  4R8P B;  2F2A C;  3O62 C;  2Y2P A;  3MGQ B;  1P34 B;  2RVQ D;  3LJA A;  4HGA B;  3A6N A;  5B1L B;  1N1J A;  2ARO A;  5CP6 C;  3AZE B;  4XZQ C;  2F8N B;  5DNN C;  1P3L B;  3C1B D;  4J8X A;  1WWI A;  4YS3 A;  4H9P B;  1PZR A;  1P3B C;  3AZM D;  4NE5 A;  3REK A;  3REL D;  3AZJ C;  2NZD A;  4XZQ D;  5GSU D;  4J8U A;  1AOI A;  1P3P D;  5AV9 D;  4J8V C;  5AV9 B;  4ZUX A;  5GXQ C;  1P3P A;  1S32 C;  3LZ1 C;  3KUY D;  2FJ7 B;  5AV6 C;  2YFV B;  5B31 B;  3F6T A;  1A7W A;  1TZY D;  1ID3 A;  2CV5 B;  5AV5 A;  3VH5 W;  1P3A B;  3AFA C;  5DNM B;  5B24 A;  2Y2I A;  3REI C;  5B31 C;  5B2J D;  1EQZ B;  2JE5 A;  2Y2O A;  5AV5 D;  4KHA A;  5AV6 B;  4KGC D;  5AVB C;  1HQ3 B;  3LZ1 B;  3AYW C;  1P3B A;  4Z5T D;  2PYO C;  4DQY B;  2DQN C;  4WU9 C;  3W97 B;  3MNN D;  4X23 A;  3V9R A;  2F8N H;  3AV1 D;  1P3G D;  3AZN B;  4YM6 A;  5AVB B;  3O62 D;  1TAF B;  2XD5 A;  5F99 B;  5GSU A;  5CHL B;  1P3I C;  5B2I C;  4H9R A;  3H0R C;  4YS3 D;  4J8X D;  3WAA A;  5BS7 C;  1M1A C;  3X1V C;  3MGQ C;  3REI A;  5B31 A;  4Z66 C;  3NQJ B;  2BYM B;  2YFW A;  3A6N D;  3X1S A;  3NQU B;  4H9O A;  5CPK B;  1U35 A;  3VH5 A;  4XUJ C;  3KXB B;  3UTB A;  3AZG A;  3X1T C;  3WTP A;  1P3M C;  4WU9 A;  3UT9 D;  4CAY A;  3KFU G;  5CPJ C;  3W99 A;  4LD9 C;  3FDD A;  3VH6 W;  3AN2 D;  5JRG D;  4EO5 C;  2JCH A;  3TU4 C;  3W97 C;  3X1S D;  4H9S C;  4ZUX B;  3AZI A;  4WJ3 C;  4H9R B;  4H9N B;  3MGR B;  3A1K A;  2YFV A;  3W96 C;  5BT1 C;  3REJ D;  3AZF C;  3WA9 B;  4KUD C;  2BG1 A;  3TU4 D;  3B6G C;  2W8S A;  4Z5T C;  4DRB A;  2F8N G;  5GXQ B;  3WAA D;  2Y2L A;  3AZH A;  1T3U A;  5B32 A;  4Z66 B;  3REJ C;  3AZF D;  3UTB C;  3AZG C;  1P3M A;  5JRG A;  3AZJ B;  3AN2 B;  2BYK B;  1P34 A;  3AZL D;  1P3B B;  1N1J B;  2G5I C;  5DNN D;  5B2I D;  4E44 A;  5DNN B;  4DRA A;  4YS3 C;  3MGP D;  4J8X C;  3REH B;  3REK C;  3LZ0 D;  3MGR C;  3AZF B;  2NZD C;  1KX4 A;  1AOI C;  5GXQ D;  5B0Z A;  3LJA B;  4UUZ B;  4H9Q B;  4EO5 B;  1M18 A;  5G49 A;  3LZ0 C;  3WKJ D;  4H9P A;  1P3K D;  5E5A D;  1ID3 D;  1P3P B;  3W98 B;  3C1C A;  3UTA D;  5CPI C;  3B6F B;  5FUG A;  5JA4 B;  3AFA D;  1M18 D;  5DNM C;  3AFA B;  1KX3 A;  3LEL A;  3KUY A;  4XUJ B;  5B40 D;  3KXB C;  3O62 A;  1KX5 C;  1ULY A;  3P5J B;  5AV8 C;  2ARO C;  3AYW B;  4J8U D;  4X23 D;  3W97 D;  4XZQ A;  1S32 B;  4WV4 B;  3KXB D;  5B40 C;  4CSR B;  4WU8 B;  4UPK A;  5DNN A;  3MNN C;  3X1V B;  3AZL A;  2JSS A;  4CAY B;  5B0Y B;  4X23 C;  4KGC A;  5AY8 B;  3C1B C;  1Z2C B;  5B1M A;  5B32 D;  3AZH D;  4J8V A;  3W99 B;  2Y2H A;  3AZJ D;  3B6G B;  3LZ1 A;  4JJN B;  4J8V B;  1M1A A;  3X1T B;  1S32 D;  4Z66 A;  3MGP C;  3X1U C;  2Y2G A;  4JJN C;  5B24 C;  5KDM B;  5B33 D;  1P3L C;  5AY8 D;  1AOI D;  1TAF A;  5F99 A;  4AWL C;  3REI B;  3NQJ A;  3R45 A;  5B1M D;  4JJN D;  3AYW A;  4J8W A;  1WWS A;  2IO5 C;  5E5A B;  3R45 B;  5CPI D;  3UT9 B;  1HQ3 A;  5B0Y D;  5B1L D;  3LJA D;  3AZK D;  3W97 A;  5B31 D;  5B2J C;  3V9R B;  5B1M B;  4Z2M G;  3REH D;  3WTP E;  2NQB D;  3AYW D;  4UUZ A;  3WAA C;  5GT3 D;  3KWQ A;  4JJN A;  1B67 A;  5CPI B;  3B6F C;  5FUG B;  5B2I B;  1P3I B;  5GSU B;  4YM6 B;  3AZE C;  4AWL B;  5BNX B;  4Z66 D;  1P34 C;  1AOI B;  4XUJ A;  4QLC A;  3AV2 B;  4ZBJ B;  2BYK A;  3AZM C;  4CSR A;  1HQ3 C;  2FJ7 C;  4NE3 A;  3X1T D;  1H3O A;  4KHA B;  3MGQ D;  5AVC A;  5AV9 C;  4J8V D;  5B2J A;  3IP4 C;  1P3K C;  5AV6 D;  5CPJ D;  5AV5 B;  4KGC B;  3KWQ C;  4H9S A;  1P3M D;  1B6W A;  5GT0 B;  3AZF A;  3AL0 C;  3C1C C;  4WU8 C;  2CV5 D;  1P3A D;  3AV2 D;  5G49 B;  2HIO C;  4ZUX D;  3EPH A;  5GT0 C;  3REJ A;  3UTA B;  5JRG C;  3TU4 B;  1P3I D;  3EPJ A;  3AZM A;  2Y2J A;  3AFA A;  1KX3 B;  5JA4 A;  2NQB B;  3X1S B;  3WKJ A;  3AZL C;  3H0M C;  3LEL B;  3UT9 A;  4HGA C;  3A6N B;  1P3O C;  1KX4 C;  4R8P C;  1BH8 B;  3WKJ B;  3B0D B;  3UTB D;  3AZG D;  3REL C;  2XD1 A;  1U35 D;  2F8N A;  1P3O D;  2UWX A;  4H9Q A;  1M18 B;  2Y2N A;  5B2I A;  3B0D C;  5CPI A;  5B0Z B;  3REI D;  3A6N C;  1KX4 B;  3LEL C;  2Y2Q A;  3KWQ B;  4J8W D;  4G91 C;  1KX5 A;  5C3I C;  1P3F B;  1F66 B;  3B0B A;  5F99 C;  3AZN C;  5KDM A;  3MVD B;  2CWE A;  4NE6 A;  4J8W C;  2J8P A;  5BNV B;  3MNN A;  3MGP B;  1P3O A;  2F8N K;  4J8U C;  3UTA C;  2G5H C;  4Z2M H;  3AZH B;  3AV1 B;  1P3G B;  2HIO D;  4ZUX C;  1EQZ D;  4J8W B;  3AZL B;  1P3B D;  5CPJ A;  5AV6 A;  2NQB C;  4G92 B;  1M19 C;  4LD9 A;  3B0C W;  3X1V D;  3AZK B;  4WNN B;  4J8U B;  1M19 D;  1ZLA B;  3VH6 A;  3W96 B;  3AZN A;  4XUJ D;  5B40 B;  3B6G A;  5AVB A;  1P3L A;  4R8P D;  3AZH C;  1P3F A;  1F66 A;  1ZLA C;  2DF4 C;  4QLC C;  3KUY B;  2FJ7 D;  3W98 D;  2HUE B;  2CV5 A;  1KX3 D;  3MVD C;  1TZY C;  1ZLA D;  2BYM A;  5AVC C;  4YM6 C;  3W98 A;  2NQB A;  4XZQ B;  5E5A A;  5CPK D;  5B24 B;  1P3K A;  1P3L D;  2ARO D;  2Y2M A;  2ZY2 A;  4ZBJ C;  5B1L A;  5BS7 A;  5AVB D;  5B0Z C;  5AVC D;  3O62 B;  3MGQ A;  3AZN D;  1BH8 A;  3B6G D;  4NFT A;  1M18 C;  4WU8 A;  5B31 G;  3LZ0 A;  2ZY4 A;  4J8X B;  4YS3 B;  3H0L C;  5GT0 A;  4G91 B;  3AZE A;  1EQZ C;  2ZM5 A;  5AY8 A;  3AZK C;  2Y2K A;  3KUY C;  3EG5 B;  2L5A A;  3A1I A;  3MVD A;  3WA9 D;  5AV8 A;  3MGR D;  3REJ B;  3VH6 T;  3KSY A;  5BNX A;  2FJ7 A;  4Z5T B;  3TU4 A;  3X1U D;  3UT9 C;  5AV9 A;  3WA9 C;  3LZ1 D;  4R8P A;  3MGS A;  2IO5 B;  3REK D;  3REL A;  2NZD D;  3AN2 C;  1F1E A;  1P3K B;  3C1B A;  5GT3 B;  3UTB B;  3AZG B;  3B0C T;  5AVC B;  1W2E A;  3NQU A;  1Q9C A;  5B32 G;  1ID3 C;  3LZ0 B;  3AV1 C;  5AY8 C;  5AV5 C;  1P3G C;  4LD9 D; 
#chains in the Genus database with same CATH homology
 2F8N D;  5B33 A;  3LJA C;  3X1U A;  4E45 A;  5CPK C;  2HIO B;  4KUD D;  5CP6 A;  5BT1 D;  3W96 D;  4H9N A;  3MGR A;  3AZM B;  1M1A D;  2PYO A;  3WA9 A;  5AV8 B;  3B6F D;  3UTA A;  3AZI B;  3WAA B;  3AZJ A;  3AZE D;  5GT0 D;  4G92 C;  1M19 B;  3MNN B;  1JFI B;  1P3I A;  5GSU C;  5GXQ A;  1H3O B;  1P3P C;  4H9O B;  1KX4 D;  2HUE C;  3AV1 A;  1P3G A;  4M6B A;  5JRG B;  4WU9 B;  3KXB A;  4QLC B;  2ZY3 A;  3AV2 A;  3WTP B;  5B33 C;  5B2J B;  4WNN A;  5CPK A;  1U35 B;  3X1S C;  5B40 A;  3EPL A;  5C3I B;  1P3F C;  2ZY5 A;  1TZY B;  1F66 C;  3LEL D;  1ZLA A;  4LD9 B;  1HTA A;  5B24 D;  4KGC C;  3C1C D;  2CV5 C;  5B0Y C;  4X23 B;  1TZY A;  1P3F D;  5B1M C;  1F66 D;  2LY8 A;  5BNV A;  2RVQ C;  2YFW B;  5B0Z D;  4KUD B;  5CP6 D;  1M19 A;  1P3O B;  3AV2 C;  3C1B B;  1ID3 B;  3MGP A;  1P3A A;  4KUD A;  3X1V A;  4WZS B;  1JFI A;  1P34 D;  1KU5 A;  5GT3 C;  3WTP D;  3REH A;  5CPJ B;  1EQZ A;  2HIO A;  5CP6 B;  3X1U B;  3AZK A;  3EPK A;  1U35 C;  5B0Y A;  1HQ3 D;  3X1T A;  5B33 B;  3WTP C;  3MGS D;  2PYO B;  3REK B;  2NZD B;  5DNM D;  3C1C B;  4QLC D;  3VH5 T;  3W99 C;  1R4V A;  2RIQ A;  3AZI D;  3W98 C;  1KX5 D;  3WKJ C;  3MGS C;  1KX5 B;  5AV8 D;  5E5A C;  3MVD D;  2FFF B;  1M1A B;  5F99 D;  2VQR A;  4YM6 D;  3AN2 A;  1P3A C;  5B1L C;  3B6F A;  3W99 D;  3AZI C;  1P3M B;  1BH9 B;  2PYO D;  5B32 B;  3MGS B;  1BFM A;  3W96 A;  5BO0 B;  5GT3 A;  3KWQ D;  3REH C;  1S32 A;  4WU9 D;  4Z5T A;  2ARO B;  5DNM A;  1KX3 C;  3REL B;  1BH9 A;  4WU8 D;  5B32 C;  5BO0 A;  4R8P B;  2F2A C;  3O62 C;  2Y2P A;  3MGQ B;  1P34 B;  2RVQ D;  3LJA A;  4HGA B;  3A6N A;  5B1L B;  1N1J A;  2ARO A;  5CP6 C;  3AZE B;  4XZQ C;  2F8N B;  5DNN C;  1P3L B;  3C1B D;  4J8X A;  1WWI A;  4YS3 A;  4H9P B;  1PZR A;  1P3B C;  3AZM D;  4NE5 A;  3REK A;  3REL D;  3AZJ C;  2NZD A;  4XZQ D;  5GSU D;  4J8U A;  1AOI A;  1P3P D;  5AV9 D;  4J8V C;  5AV9 B;  4ZUX A;  5GXQ C;  1P3P A;  1S32 C;  3LZ1 C;  3KUY D;  2FJ7 B;  5AV6 C;  2YFV B;  5B31 B;  3F6T A;  1A7W A;  1TZY D;  1ID3 A;  2CV5 B;  5AV5 A;  3VH5 W;  1P3A B;  3AFA C;  5DNM B;  5B24 A;  2Y2I A;  3REI C;  5B31 C;  5B2J D;  1EQZ B;  2JE5 A;  2Y2O A;  5AV5 D;  4KHA A;  5AV6 B;  4KGC D;  5AVB C;  1HQ3 B;  3LZ1 B;  3AYW C;  1P3B A;  4Z5T D;  2PYO C;  4DQY B;  2DQN C;  4WU9 C;  3W97 B;  3MNN D;  4X23 A;  3V9R A;  2F8N H;  3AV1 D;  1P3G D;  3AZN B;  4YM6 A;  5AVB B;  3O62 D;  1TAF B;  2XD5 A;  5F99 B;  5GSU A;  5CHL B;  1P3I C;  5B2I C;  4H9R A;  3H0R C;  4YS3 D;  4J8X D;  3WAA A;  5BS7 C;  1M1A C;  3X1V C;  3MGQ C;  3REI A;  5B31 A;  4Z66 C;  3NQJ B;  2BYM B;  2YFW A;  3A6N D;  3X1S A;  3NQU B;  4H9O A;  5CPK B;  1U35 A;  3VH5 A;  4XUJ C;  3KXB B;  3UTB A;  3AZG A;  3X1T C;  3WTP A;  1P3M C;  4WU9 A;  3UT9 D;  4CAY A;  3KFU G;  5CPJ C;  3W99 A;  4LD9 C;  3FDD A;  3VH6 W;  3AN2 D;  5JRG D;  4EO5 C;  2JCH A;  3TU4 C;  3W97 C;  3X1S D;  4H9S C;  4ZUX B;  3AZI A;  4WJ3 C;  4H9R B;  4H9N B;  3MGR B;  3A1K A;  2YFV A;  3W96 C;  5BT1 C;  3REJ D;  3AZF C;  3WA9 B;  4KUD C;  2BG1 A;  3TU4 D;  3B6G C;  2W8S A;  4Z5T C;  4DRB A;  2F8N G;  5GXQ B;  3WAA D;  2Y2L A;  3AZH A;  1T3U A;  5B32 A;  4Z66 B;  3REJ C;  3AZF D;  3UTB C;  3AZG C;  1P3M A;  5JRG A;  3AZJ B;  3AN2 B;  2BYK B;  1P34 A;  3AZL D;  1P3B B;  1N1J B;  2G5I C;  5DNN D;  5B2I D;  4E44 A;  5DNN B;  4DRA A;  4YS3 C;  3MGP D;  4J8X C;  3REH B;  3REK C;  3LZ0 D;  3MGR C;  3AZF B;  2NZD C;  1KX4 A;  1AOI C;  5GXQ D;  5B0Z A;  3LJA B;  4UUZ B;  4H9Q B;  4EO5 B;  1M18 A;  5G49 A;  3LZ0 C;  3WKJ D;  4H9P A;  1P3K D;  5E5A D;  1ID3 D;  1P3P B;  3W98 B;  3C1C A;  3UTA D;  5CPI C;  3B6F B;  5FUG A;  5JA4 B;  3AFA D;  1M18 D;  5DNM C;  3AFA B;  1KX3 A;  3LEL A;  3KUY A;  4XUJ B;  5B40 D;  3KXB C;  3O62 A;  1KX5 C;  1ULY A;  3P5J B;  5AV8 C;  2ARO C;  3AYW B;  4J8U D;  4X23 D;  3W97 D;  4XZQ A;  1S32 B;  4WV4 B;  3KXB D;  5B40 C;  4CSR B;  4WU8 B;  4UPK A;  5DNN A;  3MNN C;  3X1V B;  3AZL A;  2JSS A;  4CAY B;  5B0Y B;  4X23 C;  4KGC A;  5AY8 B;  3C1B C;  1Z2C B;  5B1M A;  5B32 D;  3AZH D;  4J8V A;  3W99 B;  2Y2H A;  3AZJ D;  3B6G B;  3LZ1 A;  4JJN B;  4J8V B;  1M1A A;  3X1T B;  1S32 D;  4Z66 A;  3MGP C;  3X1U C;  2Y2G A;  4JJN C;  5B24 C;  5KDM B;  5B33 D;  1P3L C;  5AY8 D;  1AOI D;  1TAF A;  5F99 A;  4AWL C;  3REI B;  3NQJ A;  3R45 A;  5B1M D;  4JJN D;  3AYW A;  4J8W A;  1WWS A;  2IO5 C;  5E5A B;  3R45 B;  5CPI D;  3UT9 B;  1HQ3 A;  5B0Y D;  5B1L D;  3LJA D;  3AZK D;  3W97 A;  5B31 D;  5B2J C;  3V9R B;  5B1M B;  4Z2M G;  3REH D;  3WTP E;  2NQB D;  3AYW D;  4UUZ A;  3WAA C;  5GT3 D;  3KWQ A;  4JJN A;  1B67 A;  5CPI B;  3B6F C;  5FUG B;  5B2I B;  1P3I B;  5GSU B;  4YM6 B;  3AZE C;  4AWL B;  5BNX B;  4Z66 D;  1P34 C;  1AOI B;  4XUJ A;  4QLC A;  3AV2 B;  4ZBJ B;  2BYK A;  3AZM C;  4CSR A;  1HQ3 C;  2FJ7 C;  4NE3 A;  3X1T D;  1H3O A;  4KHA B;  3MGQ D;  5AVC A;  5AV9 C;  4J8V D;  5B2J A;  3IP4 C;  1P3K C;  5AV6 D;  5CPJ D;  5AV5 B;  4KGC B;  3KWQ C;  4H9S A;  1P3M D;  1B6W A;  5GT0 B;  3AZF A;  3AL0 C;  3C1C C;  4WU8 C;  2CV5 D;  1P3A D;  3AV2 D;  5G49 B;  2HIO C;  4ZUX D;  3EPH A;  5GT0 C;  3REJ A;  3UTA B;  5JRG C;  3TU4 B;  1P3I D;  3EPJ A;  3AZM A;  2Y2J A;  3AFA A;  1KX3 B;  5JA4 A;  2NQB B;  3X1S B;  3WKJ A;  3AZL C;  3H0M C;  3LEL B;  3UT9 A;  4HGA C;  3A6N B;  1P3O C;  1KX4 C;  4R8P C;  1BH8 B;  3WKJ B;  3B0D B;  3UTB D;  3AZG D;  3REL C;  2XD1 A;  1U35 D;  2F8N A;  1P3O D;  2UWX A;  4H9Q A;  1M18 B;  2Y2N A;  5B2I A;  3B0D C;  5CPI A;  5B0Z B;  3REI D;  3A6N C;  1KX4 B;  3LEL C;  2Y2Q A;  3KWQ B;  4J8W D;  4G91 C;  1KX5 A;  5C3I C;  1P3F B;  1F66 B;  3B0B A;  5F99 C;  3AZN C;  5KDM A;  3MVD B;  2CWE A;  4NE6 A;  4J8W C;  2J8P A;  5BNV B;  3MNN A;  3MGP B;  1P3O A;  2F8N K;  4J8U C;  3UTA C;  2G5H C;  4Z2M H;  3AZH B;  3AV1 B;  1P3G B;  2HIO D;  4ZUX C;  1EQZ D;  4J8W B;  3AZL B;  1P3B D;  5CPJ A;  5AV6 A;  2NQB C;  4G92 B;  1M19 C;  4LD9 A;  3B0C W;  3X1V D;  3AZK B;  4WNN B;  4J8U B;  1M19 D;  1ZLA B;  3VH6 A;  3W96 B;  3AZN A;  4XUJ D;  5B40 B;  3B6G A;  5AVB A;  1P3L A;  4R8P D;  3AZH C;  1P3F A;  1F66 A;  1ZLA C;  2DF4 C;  4QLC C;  3KUY B;  2FJ7 D;  3W98 D;  2HUE B;  2CV5 A;  1KX3 D;  3MVD C;  1TZY C;  1ZLA D;  2BYM A;  5AVC C;  4YM6 C;  3W98 A;  2NQB A;  4XZQ B;  5E5A A;  5CPK D;  5B24 B;  1P3K A;  1P3L D;  2ARO D;  2Y2M A;  2ZY2 A;  4ZBJ C;  5B1L A;  5BS7 A;  5AVB D;  5B0Z C;  5AVC D;  3O62 B;  3MGQ A;  3AZN D;  1BH8 A;  3B6G D;  4NFT A;  1M18 C;  4WU8 A;  5B31 G;  3LZ0 A;  2ZY4 A;  4J8X B;  4YS3 B;  3H0L C;  5GT0 A;  4G91 B;  3AZE A;  1EQZ C;  2ZM5 A;  5AY8 A;  3AZK C;  2Y2K A;  3KUY C;  3EG5 B;  2L5A A;  3A1I A;  3MVD A;  3WA9 D;  5AV8 A;  3MGR D;  3REJ B;  3VH6 T;  3KSY A;  5BNX A;  2FJ7 A;  4Z5T B;  3TU4 A;  3X1U D;  3UT9 C;  5AV9 A;  3WA9 C;  3LZ1 D;  4R8P A;  3MGS A;  2IO5 B;  3REK D;  3REL A;  2NZD D;  3AN2 C;  1F1E A;  1P3K B;  3C1B A;  5GT3 B;  3UTB B;  3AZG B;  3B0C T;  5AVC B;  1W2E A;  3NQU A;  1Q9C A;  5B32 G;  1ID3 C;  3LZ0 B;  3AV1 C;  5AY8 C;  5AV5 C;  1P3G C;  4LD9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...