5AY8D

Crystal structure of human nucleosome containing h3.y
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
b'RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H3.Y
publication title Structure and function of human histone H3.Y nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 36
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ay8D00
5E5AA 1P3KA 5AV8D 3VH5W 5AVCD 3WTPA 5G49B 1HQ3D 3UT9A 5B0YC 3AZJC 4X23A 4J8XB 1TAFA 5JRGD 4AWLC 5CPJB 5CPKB 2F8NG 5GT0C 2F8ND 3AZIA 4ZBJC 3NQUB 3X1VC 3WAAC 1M18A 1TZYC 3AN2C 2FJ7D 5F99A 1P3GB 1JFIB 2YFWA 3REHA 1P34A 3MGQD 3KSYA 3X1TB 4R8PA 4G92B 4NE6A 3MGRB 4KGCB 3C1CC 5B0YD 5B0ZD 3AZJD 3V9RB 5B2JB 3RELC 5B24B 3AZFB 3W97D 3AZGB 3B6FA 3WTPE 1U35B 1P3OC 3X1VD 4H9QA 3WAAD 2NQBB 5B32C 5KDMB 3X1UA 5AV6B 4Z5TA 3AZLD 1P3BD 5CP6C 5CPIB 1EQZB 4JJNC 3AZMA 3WA9C 2L5AA 3LZ0D 4WU8D 4J8WC 3WKJC 4H9NA 3REKB 4KUDB 5B31A 4H9SC 3MNNB 3W98C 4XZQD 1P3FC 1BH9B 1P3MD 5C3IB 3VH5A 3MGPD 4YS3A 3LZ1A 3MVDD 5DNMB 4DRAA 4LD9D 4J8XC 5AV5A 3KUYB 5CPJC 5CPKC 5B32D 3KXBA 1KX3A 1M19D 1N1JA 5E5AB 1P3KB 4JJND 1AOIA 1P3PA 3UT9B 3WTPB 5AVBA 5GT3A 4NE3A 5B1LA 3AZEA 4X23B 1P3GC 1P3LD 4WZSB 1ZLAA 1TAFB 3LJAA 1P3FD 3X1TC 2F8NK 3X1SA 3MGRC 4KGCC 1S32D 3A6ND 3AZIB 3AZKA 5BS7C 3AYWA 1M18B 3AV1C 5B2JC 5B24C 3AZFC 3AZGC 5F99B 1KU5A 3MGSD 1U35C 3AFAD 3REHB 1P34B 1P3IA 4Z66A 5BNXA 4H9PA 2NQBC 5AV6C 5AY8A 5B33A 1P3GD 4WV4B 3REID 5CPIC 3LELD 1EQZC 4H9RA 4XUJA 3REKC 4KUDC 3B6GD 1B67A 3MNNC 4H9QB 3X1UB 3AV1D 5C3IC 4Z5TB 3AZFD 2PYOC 3W96D 2HIOA 5DNND 4YM6D 4HGAB 5DNMC 3W99A 4NE5A 3AZMB 1M1AA 4ZUXD 5AV9A 2AROA 4H9NB 2NZDA 5B31B 3KWQD 5B40D 5CPID 5E5AC 1P3KC 4YS3B 3UT9C 1KX5A 3WTPC 2RVQC 4Z2MH 5B1MA 4X23C 3UTBA 4KUDD 5AV5B 5B2IA 3AZNA 1KX4D 3KXBB 1KX3B 4WNNA 2PYOD 3AZIC 1AOIB 1P3PB 5AVBB 1M18C 5GT3B 3AZHD 5B1LB 3AZEB 5F99C 3LJAB 2CWEA 5GSUA 1F66D 3TU4D 5E5AD 3REHC 1P34C 3X1SB 4J8UD 3UTAA 1ID3D 3AZKB 3AYWB 4J8VA 1A7WA 1BFMA 5AV8A 3O62D 5AVCA 5GXQA 1P3IB 4Z66B 4CSRA 4H9PB 5BNXB 3X1UC 4Z5TC 5AY8B 5F99D 5B33B 1P3AC 2F8NA 4HGAC 3AZMC 4KHAA 4H9RB 4XUJB 5GT0D 5B31C 2FJ7A 4YS3C 2HIOB 3MGQA 1TZYD 3AN2D 3W99B 5B0ZA 1M1AB 5AV5C 5AV9B 3KXBC 2AROB 1KX3C 3W97A 1P3AD 1H3OA 3C1CD 1AOIC 1P3PC 1KX5B 5AVBC 5GT3C 3RELD 5BT1C 5B1LC 3AZEC 3UTBB 5B1MB 3AZLA 5B2IB 3AZNB 1P3BA 3LJAC 2BYMB 5B32G 1P3OD 4WNNB 3X1SC 2BYKA 3LZ0A 4WU8A 3B0CT 5CP6D 3AZKC 2F8NH 3AYWC 4XZQA 1P3MA 1KX3D 3WA9D 3MGPA 3WKJD 4H9OA 4J8WD 5GSUB 3MVDA 3W98D 3NQJA 1P3IC 4Z66C 3UTAB 4LD9A 4G92C 5AY8C 5B33C 4J8VB 4G91B 1M19A 4J8XD 1ULYA 5CPJD 1WWSA 4JJNA 5CPKD 5AV8B 4XUJC 5GXQB 2YFWB 4CSRB 1P3LA 4H9SA 4R8PB 2HIOC 2F8NB 3W99C 1HTAA 4WU9A 1S32A 3A6NA 1M1AC 4KHAB 2HUEB 5AV9C 2AROC 5FUGA 3B6FB 3X1TD 5BNVA 2LY8A 2YFVA 3MGRD 3C1BA 2CV5A 2FJ7B 4KGCD 3MGSA 3AV2A 3AFAA 1KX5C 3MGQB 5B2JD 5B24D 4XUJD 3AZGD 3REJA 5B1MC 5B0ZB 3UTBC 1U35D 5B2IC 3AZNC 4UUZA 1Q9CA 3B0BA 3REIA 3LELA 3KUYC 3W97B 1H3OB 2HIOD 2NQBD 1B6WA 5AV6D 3B6GA 1EQZD 3AV1A 3LZ1B 3AZLB 3AZFA 3W96A 1P3BB 5GSUC 3REKD 5DNNA 4YM6A 4CAYA 3MNND 1KX5D 3UTAC 4ZUXA 2BYKB 3LZ0B 4WU8B 1N1JB 4EO5B 4J8VC 4G91C 4XZQB 5B40A 4QLCA 5DNMD 3KWQA 1P3MB 3MGPB 3KUYD 4H9OB 5AV8C 5GXQC 3MVDB 1ZLAB 3VH6T 2IO5B 4LD9B 1P3KD 1R4VA 4R8PC 1KX4A 3UT9D 3WTPD 2PYOA 2RVQD 4X23D 1M19B 2HUEC 3B6FC 3AZHA 3R45A 2FJ7C 1P3LB 1HQ3A 3AZID 1F66A 3TU4A 1M18D 3MGQC 5JRGA 4J8UA 1BH8A 5GXQD 4WU9B 1S32B 5B0ZC 3A6NB 1ID3A 5FUGB 3REHD 1P34D 5BNVB 4R8PD 3W97C 2YFVB 3C1BB 2CV5B 3MGSB 3AV2B 3O62A 4M6BA 5CHLB 3AFAB 3REJB 3B6FD 3LZ1C 3AZLC 1P3BC 4UUZB 5B0YA 3AZJA 3REIB 3LELB 3X1UD 2NZDB 4Z5TD 3LZ0C 4WU8C 5GT0A 3B6GB 4EO5C 4XZQC 3AZMD 1P3MC 3AV1B 5B31G 3MGPC 3X1VA 3W96B 3WAAA 5DNNB 1TZYA 5B31D 4YM6B 3MVDC 5JA4A 4CAYB 3AN2A 1ZLAC 3VH6W 2IO5C 4ZUXB 4LD9C 4YS3D 4E44A 3LZ1D 1P3AA 3KWQB 5B40B 4QLCB 3C1CA 1M19C 5AV5D 3KXBD 1F1EA 3RELA 1P3LC 1AOID 1P3PD 1KX4B 5AVBD 3B0DB 5GT3D 1P3OA 2PYOB 5BT1D 5B1LD 3AZED 5B32A 5BO0A 1S32C 4WU9C 3A6NC 1ZLAD 5CP6A 3LJAD 3AZHB 3X1SD 3R45B 3C1BC 3WA9A 5AVCB 2CV5C 1HQ3B 3MGSC 3AV2C 3WKJA 4J8WA 3AZKD 1F66B 3AYWD 3TU4B 3AFAC 3W98A 5JRGB 1P3FA 4Z2MG 4J8UB 1BH8B 3REJC 1ID3B 5G49A 4E45A 3REIC 1WWIA 4NFTA 3LELC 4Z66D 1P3ID 4J8XA 2NZDC 5CPJA 5CPKA 3O62B 5AY8D 5B33D 4WU9D 3B6GC 3NQUA 3C1BD 3W96C 3VH5T 2CV5D 3AV2D 5DNNC 3VH6A 5B0YB 4YM6C 3AZJB 1P3GA 1JFIA 4ZUXC 4AWLB 5GT0B 3REJD 3X1TA 3B0CW 3MGRA 3KWQC 3W99D 4QLCC 5B40C 1M1AD 4KGCA 4ZBJB 5BS7A 3X1VB 5AV9D 3WAAB 3V9RA 2AROD 2JSSA 2NZDD 1TZYB 5B2JA 5JA4B 5B24A 3AN2B 3AZGA 1U35A 1KX4C 3B0DC 1P3AB 2NQBA 3C1CB 5B1MD 5KDMA 3UTBD 5AV6A 5B2ID 3AZND 5CPIA 3RELB 1EQZA 3AZHC 5AVCC 1HQ3C 3NQJB 4QLCD 1F66C 3REKA 4KUDA 3TU4C 1P3OB 3MNNA 5JRGC 4DRBA 1BH9A 4J8UC 5B32B 5BO0B 1ID3C 5CP6B 5GSUD 4JJNB 5DNMA 3WA9B 2BYMA 3UTAD 3KUYA 4J8WB 3WKJB 3O62C 4J8VD 3W98B 1P3FB
chains in the Genus database with same CATH superfamily
5E5AA 1P3KA 3IP4C 5AV8D 3VH5W 5AVCD 3WTPA 5G49B 1HQ3D 3UT9A 5B0YC 3AZJC 4X23A 4J8XB 1TAFA 5JRGD 4AWLC 5CPJB 5CPKB 2F8NG 3A1KA 5GT0C 2F8ND 3AZIA 4ZBJC 3NQUB 3X1VC 3WAAC 1M18A 1TZYC 3AN2C 2FJ7D 5F99A 1P3GB 1JFIB 2YFWA 3REHA 1P34A 3MGQD 3KSYA 3X1TB 4R8PA 4G92B 4NE6A 1P3FB 3MGRB 4KGCB 3C1CC 5B0YD 5B0ZD 3AZJD 2W8SA 2ZY4A 3V9RB 5B2JB 3RELC 5B24B 3AZFB 3W97D 3AZGB 3B6FA 3WTPE 1U35B 3EPKA 1P3OC 3X1VD 2FFFB 4H9QA 3WAAD 2NQBB 5B32C 5KDMB 3X1UA 5AV6B 4Z5TA 3AZLD 1P3BD 5CP6C 2G5HC 5CPIB 1EQZB 4JJNC 3AZMA 3WA9C 2L5AA 3LZ0D 4WU8D 4J8WC 3WKJC 4H9NA 3REKB 2Y2IA 4KUDB 5B31A 4H9SC 3MNNB 3W98C 4XZQD 1P3FC 1BH9B 1P3MD 5C3IB 3VH5A 3MGPD 4YS3A 3LZ1A 3MVDD 5DNMB 4DRAA 4LD9D 4J8XC 5AV5A 3KUYB 5CPJC 5CPKC 5B32D 3KXBA 1KX3A 1M19D 2F2AC 1N1JA 5E5AB 1P3KB 4JJND 1AOIA 1P3PA 3A1IA 3UT9B 3WTPB 5AVBA 5GT3A 4NE3A 5B1LA 3AZEA 4X23B 1P3GC 1P3LD 4WZSB 1ZLAA 1TAFB 3LJAA 1P3FD 3X1TC 2F8NK 3X1SA 3MGRC 4KGCC 1S32D 2J8PA 3A6ND 3AZIB 3AZKA 5BS7C 3AYWA 1M18B 3H0LC 3AV1C 5B2JC 5B24C 3AZFC 3AZGC 2DF4C 5F99B 1KU5A 3MGSD 1U35C 3AFAD 3REHB 3P5JB 1P34B 1P3IA 4Z66A 5BNXA 4H9PA 2NQBC 3FDDA 5AV6C 5AY8A 5B33A 3EG5B 1P3GD 4WV4B 3REID 5CPIC 3LELD 1EQZC 2ZY3A 4H9RA 4XUJA 3REKC 4KUDC 3B6GD 1B67A 3MNNC 4H9QB 3X1UB 3AV1D 5C3IC 4Z5TB 3AZFD 2PYOC 3W96D 2HIOA 2XD1A 5DNND 4YM6D 1T3UA 1PZRA 4HGAB 5DNMC 3W99A 4NE5A 3AZMB 1M1AA 4ZUXD 5AV9A 2AROA 4H9NB 2NZDA 2Y2MA 5B31B 3KWQD 5B40D 3EPJA 5CPID 5E5AC 1P3KC 4YS3B 2ZY2A 3UT9C 3WTPC 1KX5A 2RVQC 4Z2MH 5B1MA 4X23C 3UTBA 4KUDD 5AV5B 5B2IA 3AZNA 1KX4D 3KXBB 1KX3B 4WNNA 2PYOD 3AZIC 1AOIB 1P3PB 3H0RC 5AVBB 1M18C 5GT3B 3AZHD 2Y2GA 5B1LB 3AZEB 5F99C 4DQYB 3LJAB 2CWEA 5GSUA 1F66D 3TU4D 5E5AD 3REHC 1P34C 3X1SB 4J8UD 3UTAA 1ID3D 3AZKB 3AYWB 4J8VA 1A7WA 1BFMA 5AV8A 3O62D 5AVCA 5GXQA 1P3IB 4Z66B 4CSRA 4H9PB 5BNXB 3X1UC 4Z5TC 3H0MC 5AY8B 5B33B 5F99D 1P3AC 2Y2PA 2F8NA 4HGAC 3AZMC 4KHAA 4H9RB 4XUJB 5GT0D 1Z2CB 5B31C 2FJ7A 4YS3C 2HIOB 3MGQA 1TZYD 2Y2OA 3AN2D 3W99B 5B0ZA 1M1AB 5AV5C 5AV9B 3KXBC 2AROB 1KX3C 3W97A 1P3AD 1H3OA 3C1CD 1AOIC 1P3PC 1KX5B 5AVBC 5GT3C 3RELD 5BT1C 5B1LC 3AZEC 3UTBB 5B1MB 1W2EA 3AZLA 5B2IB 3AZNB 1P3BA 3LJAC 2BYMB 5B32G 2DQNC 2JE5A 1P3OD 4WNNB 3X1SC 2BYKA 3LZ0A 4WU8A 3B0CT 5CP6D 3AZKC 2F8NH 3AYWC 4XZQA 2ZY5A 1P3MA 1KX3D 3WA9D 3MGPA 3WKJD 4H9OA 4J8WD 5GSUB 3MVDA 2Y2LA 3NQJA 3W98D 1P3IC 4Z66C 3UTAB 4LD9A 4G92C 5AY8C 5B33C 2Y2NA 4J8VB 4G91B 1M19A 4J8XD 1ULYA 5CPJD 1WWSA 4JJNA 5CPKD 5AV8B 4XUJC 5GXQB 2YFWB 4CSRB 1P3LA 4H9SA 4R8PB 2HIOC 2F8NB 3W99C 1HTAA 4WU9A 1S32A 3A6NA 1M1AC 4KHAB 2HUEB 5AV9C 2AROC 5FUGA 3B6FB 3X1TD 5BNVA 2LY8A 2YFVA 3MGRD 3C1BA 2CV5A 2FJ7B 4KGCD 3MGSA 3AV2A 3AFAA 1KX5C 3MGQB 5B2JD 5B24D 4XUJD 3AZGD 3REJA 5B1MC 5B0ZB 3UTBC 1U35D 5B2IC 3AZNC 4UUZA 1Q9CA 3B0BA 3REIA 3LELA 3KUYC 3W97B 1H3OB 2HIOD 2NQBD 1B6WA 5AV6D 2UWXA 3B6GA 1EQZD 3AV1A 3LZ1B 3AZLB 3AZFA 3W96A 1P3BB 5GSUC 3REKD 5DNNA 4YM6A 4CAYA 3MNND 1KX5D 3UTAC 4ZUXA 2BYKB 3LZ0B 4WU8B 1N1JB 4EO5B 4J8VC 4G91C 4XZQB 5B40A 4QLCA 5DNMD 3KWQA 1P3MB 3F6TA 3MGPB 3KUYD 4H9OB 5AV8C 5GXQC 3MVDB 1ZLAB 3VH6T 2IO5B 4LD9B 1P3KD 1R4VA 4R8PC 1KX4A 3UT9D 3WTPD 2PYOA 2RVQD 4X23D 1M19B 2BG1A 2HUEC 3B6FC 3AZHA 3R45A 2FJ7C 4WJ3C 1P3LB 1HQ3A 3AZID 1F66A 3TU4A 1M18D 3MGQC 5JRGA 2G5IC 4J8UA 1BH8A 5GXQD 4WU9B 1S32B 5B0ZC 3A6NB 2RIQA 1ID3A 5FUGB 3REHD 1P34D 5BNVB 4R8PD 3W97C 2YFVB 3C1BB 2CV5B 3MGSB 3AV2B 3O62A 4M6BA 5CHLB 3AFAB 3REJB 3B6FD 3LZ1C 3AZLC 1P3BC 4UUZB 5B0YA 3AZJA 3REIB 3LELB 3X1UD 2NZDB 4Z5TD 3LZ0C 4WU8C 5GT0A 3B6GB 4EO5C 4XZQC 3AZMD 1P3MC 3AV1B 5B31G 3MGPC 3X1VA 2VQRA 3W96B 3WAAA 5DNNB 1TZYA 5B31D 4YM6B 3MVDC 5JA4A 4CAYB 3AN2A 1ZLAC 3VH6W 2IO5C 4ZUXB 4LD9C 4YS3D 4E44A 3LZ1D 1P3AA 3KWQB 5B40B 4QLCB 3C1CA 1M19C 5AV5D 3KXBD 1F1EA 3RELA 1P3LC 1AOID 1P3PD 1KX4B 5AVBD 3B0DB 5GT3D 1P3OA 2XD5A 2PYOB 5BT1D 5B1LD 3AZED 5B32A 5BO0A 1S32C 4WU9C 3A6NC 1ZLAD 5CP6A 3LJAD 3AZHB 3X1SD 3R45B 3C1BC 3WA9A 5AVCB 2CV5C 3EPHA 1HQ3B 3MGSC 3AV2C 3WKJA 4J8WA 3AZKD 1F66B 3AYWD 3TU4B 3AFAC 3W98A 5JRGB 1P3FA 4Z2MG 4J8UB 1BH8B 3REJC 1ID3B 5G49A 4E45A 3REIC 1WWIA 4NFTA 3LELC 4Z66D 1P3ID 4J8XA 2NZDC 5CPJA 5CPKA 3O62B 5AY8D 5B33D 4WU9D 3B6GC 2ZM5A 2Y2QA 3NQUA 3C1BD 3W96C 3VH5T 2CV5D 3AV2D 5DNNC 3VH6A 5B0YB 4YM6C 3AZJB 1P3GA 1JFIA 4ZUXC 4AWLB 5GT0B 3REJD 3X1TA 3B0CW 3MGRA 3KWQC 3W99D 4QLCC 5B40C 1M1AD 4KGCA 4ZBJB 5BS7A 3X1VB 5AV9D 3WAAB 3V9RA 2AROD 2JSSA 3AL0C 2NZDD 1TZYB 5B2JA 5JA4B 5B24A 3AN2B 3AZGA 2JCHA 1U35A 1KX4C 3B0DC 1P3AB 2NQBA 3C1CB 5B1MD 5KDMA 3UTBD 5AV6A 5B2ID 3AZND 5CPIA 3RELB 1EQZA 3AZHC 5AVCC 1HQ3C 3NQJB 4QLCD 4UPKA 3REKA 1F66C 4KUDA 3TU4C 1P3OB 3MNNA 5JRGC 3KFUG 4DRBA 1BH9A 4J8UC 5B32B 5BO0B 1ID3C 5CP6B 5GSUD 4JJNB 5DNMA 3WA9B 2BYMA 3UTAD 2Y2KA 3EPLA 3KUYA 4J8WB 3WKJB 3O62C 2Y2JA 4J8VD 3W98B 2Y2HA
chains in the Genus database with same CATH topology
5E5AA 1P3KA 3IP4C 5AV8D 3VH5W 5AVCD 3WTPA 5G49B 1HQ3D 3UT9A 5B0YC 3AZJC 4X23A 4J8XB 1TAFA 5JRGD 4AWLC 5CPJB 5CPKB 2F8NG 3A1KA 5GT0C 2F8ND 3AZIA 4ZBJC 3NQUB 3X1VC 3WAAC 1M18A 1TZYC 3AN2C 2FJ7D 5F99A 1P3GB 1JFIB 2YFWA 3REHA 1P34A 3MGQD 3KSYA 3X1TB 4R8PA 4G92B 4NE6A 1P3FB 3MGRB 4KGCB 3C1CC 5B0YD 5B0ZD 3AZJD 2W8SA 2ZY4A 3V9RB 5B2JB 3RELC 5B24B 3AZFB 3W97D 3AZGB 3B6FA 3WTPE 1U35B 3EPKA 1P3OC 3X1VD 2FFFB 4H9QA 3WAAD 2NQBB 5B32C 5KDMB 3X1UA 5AV6B 4Z5TA 3AZLD 1P3BD 5CP6C 2G5HC 5CPIB 1EQZB 4JJNC 3AZMA 3WA9C 2L5AA 3LZ0D 4WU8D 4J8WC 3WKJC 4H9NA 3REKB 2Y2IA 4KUDB 5B31A 4H9SC 3MNNB 3W98C 4XZQD 1P3FC 1BH9B 1P3MD 5C3IB 3VH5A 3MGPD 4YS3A 3LZ1A 3MVDD 5DNMB 4DRAA 4LD9D 4J8XC 5AV5A 3KUYB 5CPJC 5CPKC 5B32D 3KXBA 1KX3A 1M19D 2F2AC 1N1JA 5E5AB 1P3KB 4JJND 1AOIA 1P3PA 3A1IA 3UT9B 3WTPB 5AVBA 5GT3A 4NE3A 5B1LA 3AZEA 4X23B 1P3GC 1P3LD 4WZSB 1ZLAA 1TAFB 3LJAA 1P3FD 3X1TC 2F8NK 3X1SA 3MGRC 4KGCC 1S32D 2J8PA 3A6ND 3AZIB 3AZKA 5BS7C 3AYWA 1M18B 3H0LC 3AV1C 5B2JC 5B24C 3AZFC 3AZGC 2DF4C 5F99B 1KU5A 3MGSD 1U35C 3AFAD 3REHB 3P5JB 1P34B 1P3IA 4Z66A 5BNXA 4H9PA 2NQBC 3FDDA 5AV6C 5AY8A 5B33A 3EG5B 1P3GD 4WV4B 3REID 5CPIC 3LELD 1EQZC 2ZY3A 4H9RA 4XUJA 3REKC 4KUDC 3B6GD 1B67A 3MNNC 4H9QB 3X1UB 3AV1D 5C3IC 4Z5TB 3AZFD 2PYOC 3W96D 2HIOA 2XD1A 5DNND 4YM6D 1T3UA 1PZRA 4HGAB 5DNMC 3W99A 4NE5A 3AZMB 1M1AA 4ZUXD 5AV9A 2AROA 4H9NB 2NZDA 2Y2MA 5B31B 3KWQD 5B40D 3EPJA 5CPID 5E5AC 1P3KC 4YS3B 2ZY2A 3UT9C 3WTPC 1KX5A 2RVQC 4Z2MH 5B1MA 4X23C 3UTBA 4KUDD 5AV5B 5B2IA 3AZNA 1KX4D 3KXBB 1KX3B 4WNNA 2PYOD 3AZIC 1AOIB 1P3PB 3H0RC 5AVBB 1M18C 5GT3B 3AZHD 2Y2GA 5B1LB 3AZEB 5F99C 4DQYB 3LJAB 2CWEA 5GSUA 1F66D 3TU4D 5E5AD 3REHC 1P34C 3X1SB 4J8UD 3UTAA 1ID3D 3AZKB 3AYWB 4J8VA 1A7WA 1BFMA 5AV8A 3O62D 5AVCA 5GXQA 1P3IB 4Z66B 4CSRA 4H9PB 5BNXB 3X1UC 4Z5TC 3H0MC 5AY8B 5B33B 5F99D 1P3AC 2Y2PA 2F8NA 4HGAC 3AZMC 4KHAA 4H9RB 4XUJB 5GT0D 1Z2CB 5B31C 2FJ7A 4YS3C 2HIOB 3MGQA 1TZYD 2Y2OA 3AN2D 3W99B 5B0ZA 1M1AB 5AV5C 5AV9B 3KXBC 2AROB 1KX3C 3W97A 1P3AD 1H3OA 3C1CD 1AOIC 1P3PC 1KX5B 5AVBC 5GT3C 3RELD 5BT1C 5B1LC 3AZEC 3UTBB 5B1MB 1W2EA 3AZLA 5B2IB 3AZNB 1P3BA 3LJAC 2BYMB 5B32G 2DQNC 2JE5A 1P3OD 4WNNB 3X1SC 2BYKA 3LZ0A 4WU8A 3B0CT 5CP6D 3AZKC 2F8NH 3AYWC 4XZQA 2ZY5A 1P3MA 1KX3D 3WA9D 3MGPA 3WKJD 4H9OA 4J8WD 5GSUB 3MVDA 2Y2LA 3NQJA 3W98D 1P3IC 4Z66C 3UTAB 4LD9A 4G92C 5AY8C 5B33C 2Y2NA 4J8VB 4G91B 1M19A 4J8XD 1ULYA 5CPJD 1WWSA 4JJNA 5CPKD 5AV8B 4XUJC 5GXQB 2YFWB 4CSRB 1P3LA 4H9SA 4R8PB 2HIOC 2F8NB 3W99C 1HTAA 4WU9A 1S32A 3A6NA 1M1AC 4KHAB 2HUEB 5AV9C 2AROC 5FUGA 3B6FB 3X1TD 5BNVA 2LY8A 2YFVA 3MGRD 3C1BA 2CV5A 2FJ7B 4KGCD 3MGSA 3AV2A 3AFAA 1KX5C 3MGQB 5B2JD 5B24D 4XUJD 3AZGD 3REJA 5B1MC 5B0ZB 3UTBC 1U35D 5B2IC 3AZNC 4UUZA 1Q9CA 3B0BA 3REIA 3LELA 3KUYC 3W97B 1H3OB 2HIOD 2NQBD 1B6WA 5AV6D 2UWXA 3B6GA 1EQZD 3AV1A 3LZ1B 3AZLB 3AZFA 3W96A 1P3BB 5GSUC 3REKD 5DNNA 4YM6A 4CAYA 3MNND 1KX5D 3UTAC 4ZUXA 2BYKB 3LZ0B 4WU8B 1N1JB 4EO5B 4J8VC 4G91C 4XZQB 5B40A 4QLCA 5DNMD 3KWQA 1P3MB 3F6TA 3MGPB 3KUYD 4H9OB 5AV8C 5GXQC 3MVDB 1ZLAB 3VH6T 2IO5B 4LD9B 1P3KD 1R4VA 4R8PC 1KX4A 3UT9D 3WTPD 2PYOA 2RVQD 4X23D 1M19B 2BG1A 2HUEC 3B6FC 3AZHA 3R45A 2FJ7C 4WJ3C 1P3LB 1HQ3A 3AZID 1F66A 3TU4A 1M18D 3MGQC 5JRGA 2G5IC 4J8UA 1BH8A 5GXQD 4WU9B 1S32B 5B0ZC 3A6NB 2RIQA 1ID3A 5FUGB 3REHD 1P34D 5BNVB 4R8PD 3W97C 2YFVB 3C1BB 2CV5B 3MGSB 3AV2B 3O62A 4M6BA 5CHLB 3AFAB 3REJB 3B6FD 3LZ1C 3AZLC 1P3BC 4UUZB 5B0YA 3AZJA 3REIB 3LELB 3X1UD 2NZDB 4Z5TD 3LZ0C 4WU8C 5GT0A 3B6GB 4EO5C 4XZQC 3AZMD 1P3MC 3AV1B 5B31G 3MGPC 3X1VA 2VQRA 3W96B 3WAAA 5DNNB 1TZYA 5B31D 4YM6B 3MVDC 5JA4A 4CAYB 3AN2A 1ZLAC 3VH6W 2IO5C 4ZUXB 4LD9C 4YS3D 4E44A 3LZ1D 1P3AA 3KWQB 5B40B 4QLCB 3C1CA 1M19C 5AV5D 3KXBD 1F1EA 3RELA 1P3LC 1AOID 1P3PD 1KX4B 5AVBD 3B0DB 5GT3D 1P3OA 2XD5A 2PYOB 5BT1D 5B1LD 3AZED 5B32A 5BO0A 1S32C 4WU9C 3A6NC 1ZLAD 5CP6A 3LJAD 3AZHB 3X1SD 3R45B 3C1BC 3WA9A 5AVCB 2CV5C 3EPHA 1HQ3B 3MGSC 3AV2C 3WKJA 4J8WA 3AZKD 1F66B 3AYWD 3TU4B 3AFAC 3W98A 5JRGB 1P3FA 4Z2MG 4J8UB 1BH8B 3REJC 1ID3B 5G49A 4E45A 3REIC 1WWIA 4NFTA 3LELC 4Z66D 1P3ID 4J8XA 2NZDC 5CPJA 5CPKA 3O62B 5AY8D 5B33D 4WU9D 3B6GC 2ZM5A 2Y2QA 3NQUA 3C1BD 3W96C 3VH5T 2CV5D 3AV2D 5DNNC 3VH6A 5B0YB 4YM6C 3AZJB 1P3GA 1JFIA 4ZUXC 4AWLB 5GT0B 3REJD 3X1TA 3B0CW 3MGRA 3KWQC 3W99D 4QLCC 5B40C 1M1AD 4KGCA 4ZBJB 5BS7A 3X1VB 5AV9D 3WAAB 3V9RA 2AROD 2JSSA 3AL0C 2NZDD 1TZYB 5B2JA 5JA4B 5B24A 3AN2B 3AZGA 2JCHA 1U35A 1KX4C 3B0DC 1P3AB 2NQBA 3C1CB 5B1MD 5KDMA 3UTBD 5AV6A 5B2ID 3AZND 5CPIA 3RELB 1EQZA 3AZHC 5AVCC 1HQ3C 3NQJB 4QLCD 4UPKA 3REKA 1F66C 4KUDA 3TU4C 1P3OB 3MNNA 5JRGC 3KFUG 4DRBA 1BH9A 4J8UC 5B32B 5BO0B 1ID3C 5CP6B 5GSUD 4JJNB 5DNMA 3WA9B 2BYMA 3UTAD 2Y2KA 3EPLA 3KUYA 4J8WB 3WKJB 3O62C 2Y2JA 4J8VD 3W98B 2Y2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E5A A;  1P3K A;  5AV8 D;  3VH5 W;  5AVC D;  3WTP A;  5G49 B;  1HQ3 D;  3UT9 A;  5B0Y C;  3AZJ C;  4X23 A;  4J8X B;  1TAF A;  5JRG D;  4AWL C;  5CPJ B;  5CPK B;  2F8N G;  5GT0 C;  2F8N D;  3AZI A;  4ZBJ C;  3NQU B;  3X1V C;  3WAA C;  1M18 A;  1TZY C;  3AN2 C;  2FJ7 D;  5F99 A;  1P3G B;  1JFI B;  2YFW A;  3REH A;  1P34 A;  3MGQ D;  3KSY A;  3X1T B;  4R8P A;  4G92 B;  4NE6 A;  3MGR B;  4KGC B;  3C1C C;  5B0Y D;  5B0Z D;  3AZJ D;  3V9R B;  5B2J B;  3REL C;  5B24 B;  3AZF B;  3W97 D;  3AZG B;  3B6F A;  3WTP E;  1U35 B;  1P3O C;  3X1V D;  4H9Q A;  3WAA D;  2NQB B;  5B32 C;  5KDM B;  3X1U A;  5AV6 B;  4Z5T A;  3AZL D;  1P3B D;  5CP6 C;  5CPI B;  1EQZ B;  4JJN C;  3AZM A;  3WA9 C;  2L5A A;  3LZ0 D;  4WU8 D;  4J8W C;  3WKJ C;  4H9N A;  3REK B;  4KUD B;  5B31 A;  4H9S C;  3MNN B;  3W98 C;  4XZQ D;  1P3F C;  1BH9 B;  1P3M D;  5C3I B;  3VH5 A;  3MGP D;  4YS3 A;  3LZ1 A;  3MVD D;  5DNM B;  4DRA A;  4LD9 D;  4J8X C;  5AV5 A;  3KUY B;  5CPJ C;  5CPK C;  5B32 D;  3KXB A;  1KX3 A;  1M19 D;  1N1J A;  5E5A B;  1P3K B;  4JJN D;  1AOI A;  1P3P A;  3UT9 B;  3WTP B;  5AVB A;  5GT3 A;  4NE3 A;  5B1L A;  3AZE A;  4X23 B;  1P3G C;  1P3L D;  4WZS B;  1ZLA A;  1TAF B;  3LJA A;  1P3F D;  3X1T C;  2F8N K;  3X1S A;  3MGR C;  4KGC C;  1S32 D;  3A6N D;  3AZI B;  3AZK A;  5BS7 C;  3AYW A;  1M18 B;  3AV1 C;  5B2J C;  5B24 C;  3AZF C;  3AZG C;  5F99 B;  1KU5 A;  3MGS D;  1U35 C;  3AFA D;  3REH B;  1P34 B;  1P3I A;  4Z66 A;  5BNX A;  4H9P A;  2NQB C;  5AV6 C;  5AY8 A;  5B33 A;  1P3G D;  4WV4 B;  3REI D;  5CPI C;  3LEL D;  1EQZ C;  4H9R A;  4XUJ A;  3REK C;  4KUD C;  3B6G D;  1B67 A;  3MNN C;  4H9Q B;  3X1U B;  3AV1 D;  5C3I C;  4Z5T B;  3AZF D;  2PYO C;  3W96 D;  2HIO A;  5DNN D;  4YM6 D;  4HGA B;  5DNM C;  3W99 A;  4NE5 A;  3AZM B;  1M1A A;  4ZUX D;  5AV9 A;  2ARO A;  4H9N B;  2NZD A;  5B31 B;  3KWQ D;  5B40 D;  5CPI D;  5E5A C;  1P3K C;  4YS3 B;  3UT9 C;  1KX5 A;  3WTP C;  2RVQ C;  4Z2M H;  5B1M A;  4X23 C;  3UTB A;  4KUD D;  5AV5 B;  5B2I A;  3AZN A;  1KX4 D;  3KXB B;  1KX3 B;  4WNN A;  2PYO D;  3AZI C;  1AOI B;  1P3P B;  5AVB B;  1M18 C;  5GT3 B;  3AZH D;  5B1L B;  3AZE B;  5F99 C;  3LJA B;  2CWE A;  5GSU A;  1F66 D;  3TU4 D;  5E5A D;  3REH C;  1P34 C;  3X1S B;  4J8U D;  3UTA A;  1ID3 D;  3AZK B;  3AYW B;  4J8V A;  1A7W A;  1BFM A;  5AV8 A;  3O62 D;  5AVC A;  5GXQ A;  1P3I B;  4Z66 B;  4CSR A;  4H9P B;  5BNX B;  3X1U C;  4Z5T C;  5AY8 B;  5F99 D;  5B33 B;  1P3A C;  2F8N A;  4HGA C;  3AZM C;  4KHA A;  4H9R B;  4XUJ B;  5GT0 D;  5B31 C;  2FJ7 A;  4YS3 C;  2HIO B;  3MGQ A;  1TZY D;  3AN2 D;  3W99 B;  5B0Z A;  1M1A B;  5AV5 C;  5AV9 B;  3KXB C;  2ARO B;  1KX3 C;  3W97 A;  1P3A D;  1H3O A;  3C1C D;  1AOI C;  1P3P C;  1KX5 B;  5AVB C;  5GT3 C;  3REL D;  5BT1 C;  5B1L C;  3AZE C;  3UTB B;  5B1M B;  3AZL A;  5B2I B;  3AZN B;  1P3B A;  3LJA C;  2BYM B;  5B32 G;  1P3O D;  4WNN B;  3X1S C;  2BYK A;  3LZ0 A;  4WU8 A;  3B0C T;  5CP6 D;  3AZK C;  2F8N H;  3AYW C;  4XZQ A;  1P3M A;  1KX3 D;  3WA9 D;  3MGP A;  3WKJ D;  4H9O A;  4J8W D;  5GSU B;  3MVD A;  3W98 D;  3NQJ A;  1P3I C;  4Z66 C;  3UTA B;  4LD9 A;  4G92 C;  5AY8 C;  5B33 C;  4J8V B;  4G91 B;  1M19 A;  4J8X D;  1ULY A;  5CPJ D;  1WWS A;  4JJN A;  5CPK D;  5AV8 B;  4XUJ C;  5GXQ B;  2YFW B;  4CSR B;  1P3L A;  4H9S A;  4R8P B;  2HIO C;  2F8N B;  3W99 C;  1HTA A;  4WU9 A;  1S32 A;  3A6N A;  1M1A C;  4KHA B;  2HUE B;  5AV9 C;  2ARO C;  5FUG A;  3B6F B;  3X1T D;  5BNV A;  2LY8 A;  2YFV A;  3MGR D;  3C1B A;  2CV5 A;  2FJ7 B;  4KGC D;  3MGS A;  3AV2 A;  3AFA A;  1KX5 C;  3MGQ B;  5B2J D;  5B24 D;  4XUJ D;  3AZG D;  3REJ A;  5B1M C;  5B0Z B;  3UTB C;  1U35 D;  5B2I C;  3AZN C;  4UUZ A;  1Q9C A;  3B0B A;  3REI A;  3LEL A;  3KUY C;  3W97 B;  1H3O B;  2HIO D;  2NQB D;  1B6W A;  5AV6 D;  3B6G A;  1EQZ D;  3AV1 A;  3LZ1 B;  3AZL B;  3AZF A;  3W96 A;  1P3B B;  5GSU C;  3REK D;  5DNN A;  4YM6 A;  4CAY A;  3MNN D;  1KX5 D;  3UTA C;  4ZUX A;  2BYK B;  3LZ0 B;  4WU8 B;  1N1J B;  4EO5 B;  4J8V C;  4G91 C;  4XZQ B;  5B40 A;  4QLC A;  5DNM D;  3KWQ A;  1P3M B;  3MGP B;  3KUY D;  4H9O B;  5AV8 C;  5GXQ C;  3MVD B;  1ZLA B;  3VH6 T;  2IO5 B;  4LD9 B;  1P3K D;  1R4V A;  4R8P C;  1KX4 A;  3UT9 D;  3WTP D;  2PYO A;  2RVQ D;  4X23 D;  1M19 B;  2HUE C;  3B6F C;  3AZH A;  3R45 A;  2FJ7 C;  1P3L B;  1HQ3 A;  3AZI D;  1F66 A;  3TU4 A;  1M18 D;  3MGQ C;  5JRG A;  4J8U A;  1BH8 A;  5GXQ D;  4WU9 B;  1S32 B;  5B0Z C;  3A6N B;  1ID3 A;  5FUG B;  3REH D;  1P34 D;  5BNV B;  4R8P D;  3W97 C;  2YFV B;  3C1B B;  2CV5 B;  3MGS B;  3AV2 B;  3O62 A;  4M6B A;  5CHL B;  3AFA B;  3REJ B;  3B6F D;  3LZ1 C;  3AZL C;  1P3B C;  4UUZ B;  5B0Y A;  3AZJ A;  3REI B;  3LEL B;  3X1U D;  2NZD B;  4Z5T D;  3LZ0 C;  4WU8 C;  5GT0 A;  3B6G B;  4EO5 C;  4XZQ C;  3AZM D;  1P3M C;  3AV1 B;  5B31 G;  3MGP C;  3X1V A;  3W96 B;  3WAA A;  5DNN B;  1TZY A;  5B31 D;  4YM6 B;  3MVD C;  5JA4 A;  4CAY B;  3AN2 A;  1ZLA C;  3VH6 W;  2IO5 C;  4ZUX B;  4LD9 C;  4YS3 D;  4E44 A;  3LZ1 D;  1P3A A;  3KWQ B;  5B40 B;  4QLC B;  3C1C A;  1M19 C;  5AV5 D;  3KXB D;  1F1E A;  3REL A;  1P3L C;  1AOI D;  1P3P D;  1KX4 B;  5AVB D;  3B0D B;  5GT3 D;  1P3O A;  2PYO B;  5BT1 D;  5B1L D;  3AZE D;  5B32 A;  5BO0 A;  1S32 C;  4WU9 C;  3A6N C;  1ZLA D;  5CP6 A;  3LJA D;  3AZH B;  3X1S D;  3R45 B;  3C1B C;  3WA9 A;  5AVC B;  2CV5 C;  1HQ3 B;  3MGS C;  3AV2 C;  3WKJ A;  4J8W A;  3AZK D;  1F66 B;  3AYW D;  3TU4 B;  3AFA C;  3W98 A;  5JRG B;  1P3F A;  4Z2M G;  4J8U B;  1BH8 B;  3REJ C;  1ID3 B;  5G49 A;  4E45 A;  3REI C;  1WWI A;  4NFT A;  3LEL C;  4Z66 D;  1P3I D;  4J8X A;  2NZD C;  5CPJ A;  5CPK A;  3O62 B;  5AY8 D;  5B33 D;  4WU9 D;  3B6G C;  3NQU A;  3C1B D;  3W96 C;  3VH5 T;  2CV5 D;  3AV2 D;  5DNN C;  3VH6 A;  5B0Y B;  4YM6 C;  3AZJ B;  1P3G A;  1JFI A;  4ZUX C;  4AWL B;  5GT0 B;  3REJ D;  3X1T A;  3B0C W;  3MGR A;  3KWQ C;  3W99 D;  4QLC C;  5B40 C;  1M1A D;  4KGC A;  4ZBJ B;  5BS7 A;  3X1V B;  5AV9 D;  3WAA B;  3V9R A;  2ARO D;  2JSS A;  2NZD D;  1TZY B;  5B2J A;  5JA4 B;  5B24 A;  3AN2 B;  3AZG A;  1U35 A;  1KX4 C;  3B0D C;  1P3A B;  2NQB A;  3C1C B;  5B1M D;  5KDM A;  3UTB D;  5AV6 A;  5B2I D;  3AZN D;  5CPI A;  3REL B;  1EQZ A;  3AZH C;  5AVC C;  1HQ3 C;  3NQJ B;  4QLC D;  1F66 C;  3REK A;  4KUD A;  3TU4 C;  1P3O B;  3MNN A;  5JRG C;  4DRB A;  1BH9 A;  4J8U C;  5B32 B;  5BO0 B;  1ID3 C;  5CP6 B;  5GSU D;  4JJN B;  5DNM A;  3WA9 B;  2BYM A;  3UTA D;  3KUY A;  4J8W B;  3WKJ B;  3O62 C;  4J8V D;  3W98 B;  1P3F B; 
#chains in the Genus database with same CATH topology
 5E5A A;  1P3K A;  3IP4 C;  5AV8 D;  3VH5 W;  5AVC D;  3WTP A;  5G49 B;  1HQ3 D;  3UT9 A;  5B0Y C;  3AZJ C;  4X23 A;  4J8X B;  1TAF A;  5JRG D;  4AWL C;  5CPJ B;  5CPK B;  2F8N G;  3A1K A;  5GT0 C;  2F8N D;  3AZI A;  4ZBJ C;  3NQU B;  3X1V C;  3WAA C;  1M18 A;  1TZY C;  3AN2 C;  2FJ7 D;  5F99 A;  1P3G B;  1JFI B;  2YFW A;  3REH A;  1P34 A;  3MGQ D;  3KSY A;  3X1T B;  4R8P A;  4G92 B;  4NE6 A;  1P3F B;  3MGR B;  4KGC B;  3C1C C;  5B0Y D;  5B0Z D;  3AZJ D;  2W8S A;  2ZY4 A;  3V9R B;  5B2J B;  3REL C;  5B24 B;  3AZF B;  3W97 D;  3AZG B;  3B6F A;  3WTP E;  1U35 B;  3EPK A;  1P3O C;  3X1V D;  2FFF B;  4H9Q A;  3WAA D;  2NQB B;  5B32 C;  5KDM B;  3X1U A;  5AV6 B;  4Z5T A;  3AZL D;  1P3B D;  5CP6 C;  2G5H C;  5CPI B;  1EQZ B;  4JJN C;  3AZM A;  3WA9 C;  2L5A A;  3LZ0 D;  4WU8 D;  4J8W C;  3WKJ C;  4H9N A;  3REK B;  2Y2I A;  4KUD B;  5B31 A;  4H9S C;  3MNN B;  3W98 C;  4XZQ D;  1P3F C;  1BH9 B;  1P3M D;  5C3I B;  3VH5 A;  3MGP D;  4YS3 A;  3LZ1 A;  3MVD D;  5DNM B;  4DRA A;  4LD9 D;  4J8X C;  5AV5 A;  3KUY B;  5CPJ C;  5CPK C;  5B32 D;  3KXB A;  1KX3 A;  1M19 D;  2F2A C;  1N1J A;  5E5A B;  1P3K B;  4JJN D;  1AOI A;  1P3P A;  3A1I A;  3UT9 B;  3WTP B;  5AVB A;  5GT3 A;  4NE3 A;  5B1L A;  3AZE A;  4X23 B;  1P3G C;  1P3L D;  4WZS B;  1ZLA A;  1TAF B;  3LJA A;  1P3F D;  3X1T C;  2F8N K;  3X1S A;  3MGR C;  4KGC C;  1S32 D;  2J8P A;  3A6N D;  3AZI B;  3AZK A;  5BS7 C;  3AYW A;  1M18 B;  3H0L C;  3AV1 C;  5B2J C;  5B24 C;  3AZF C;  3AZG C;  2DF4 C;  5F99 B;  1KU5 A;  3MGS D;  1U35 C;  3AFA D;  3REH B;  3P5J B;  1P34 B;  1P3I A;  4Z66 A;  5BNX A;  4H9P A;  2NQB C;  3FDD A;  5AV6 C;  5AY8 A;  5B33 A;  3EG5 B;  1P3G D;  4WV4 B;  3REI D;  5CPI C;  3LEL D;  1EQZ C;  2ZY3 A;  4H9R A;  4XUJ A;  3REK C;  4KUD C;  3B6G D;  1B67 A;  3MNN C;  4H9Q B;  3X1U B;  3AV1 D;  5C3I C;  4Z5T B;  3AZF D;  2PYO C;  3W96 D;  2HIO A;  2XD1 A;  5DNN D;  4YM6 D;  1T3U A;  1PZR A;  4HGA B;  5DNM C;  3W99 A;  4NE5 A;  3AZM B;  1M1A A;  4ZUX D;  5AV9 A;  2ARO A;  4H9N B;  2NZD A;  2Y2M A;  5B31 B;  3KWQ D;  5B40 D;  3EPJ A;  5CPI D;  5E5A C;  1P3K C;  4YS3 B;  2ZY2 A;  3UT9 C;  3WTP C;  1KX5 A;  2RVQ C;  4Z2M H;  5B1M A;  4X23 C;  3UTB A;  4KUD D;  5AV5 B;  5B2I A;  3AZN A;  1KX4 D;  3KXB B;  1KX3 B;  4WNN A;  2PYO D;  3AZI C;  1AOI B;  1P3P B;  3H0R C;  5AVB B;  1M18 C;  5GT3 B;  3AZH D;  2Y2G A;  5B1L B;  3AZE B;  5F99 C;  4DQY B;  3LJA B;  2CWE A;  5GSU A;  1F66 D;  3TU4 D;  5E5A D;  3REH C;  1P34 C;  3X1S B;  4J8U D;  3UTA A;  1ID3 D;  3AZK B;  3AYW B;  4J8V A;  1A7W A;  1BFM A;  5AV8 A;  3O62 D;  5AVC A;  5GXQ A;  1P3I B;  4Z66 B;  4CSR A;  4H9P B;  5BNX B;  3X1U C;  4Z5T C;  3H0M C;  5AY8 B;  5B33 B;  5F99 D;  1P3A C;  2Y2P A;  2F8N A;  4HGA C;  3AZM C;  4KHA A;  4H9R B;  4XUJ B;  5GT0 D;  1Z2C B;  5B31 C;  2FJ7 A;  4YS3 C;  2HIO B;  3MGQ A;  1TZY D;  2Y2O A;  3AN2 D;  3W99 B;  5B0Z A;  1M1A B;  5AV5 C;  5AV9 B;  3KXB C;  2ARO B;  1KX3 C;  3W97 A;  1P3A D;  1H3O A;  3C1C D;  1AOI C;  1P3P C;  1KX5 B;  5AVB C;  5GT3 C;  3REL D;  5BT1 C;  5B1L C;  3AZE C;  3UTB B;  5B1M B;  1W2E A;  3AZL A;  5B2I B;  3AZN B;  1P3B A;  3LJA C;  2BYM B;  5B32 G;  2DQN C;  2JE5 A;  1P3O D;  4WNN B;  3X1S C;  2BYK A;  3LZ0 A;  4WU8 A;  3B0C T;  5CP6 D;  3AZK C;  2F8N H;  3AYW C;  4XZQ A;  2ZY5 A;  1P3M A;  1KX3 D;  3WA9 D;  3MGP A;  3WKJ D;  4H9O A;  4J8W D;  5GSU B;  3MVD A;  2Y2L A;  3NQJ A;  3W98 D;  1P3I C;  4Z66 C;  3UTA B;  4LD9 A;  4G92 C;  5AY8 C;  5B33 C;  2Y2N A;  4J8V B;  4G91 B;  1M19 A;  4J8X D;  1ULY A;  5CPJ D;  1WWS A;  4JJN A;  5CPK D;  5AV8 B;  4XUJ C;  5GXQ B;  2YFW B;  4CSR B;  1P3L A;  4H9S A;  4R8P B;  2HIO C;  2F8N B;  3W99 C;  1HTA A;  4WU9 A;  1S32 A;  3A6N A;  1M1A C;  4KHA B;  2HUE B;  5AV9 C;  2ARO C;  5FUG A;  3B6F B;  3X1T D;  5BNV A;  2LY8 A;  2YFV A;  3MGR D;  3C1B A;  2CV5 A;  2FJ7 B;  4KGC D;  3MGS A;  3AV2 A;  3AFA A;  1KX5 C;  3MGQ B;  5B2J D;  5B24 D;  4XUJ D;  3AZG D;  3REJ A;  5B1M C;  5B0Z B;  3UTB C;  1U35 D;  5B2I C;  3AZN C;  4UUZ A;  1Q9C A;  3B0B A;  3REI A;  3LEL A;  3KUY C;  3W97 B;  1H3O B;  2HIO D;  2NQB D;  1B6W A;  5AV6 D;  2UWX A;  3B6G A;  1EQZ D;  3AV1 A;  3LZ1 B;  3AZL B;  3AZF A;  3W96 A;  1P3B B;  5GSU C;  3REK D;  5DNN A;  4YM6 A;  4CAY A;  3MNN D;  1KX5 D;  3UTA C;  4ZUX A;  2BYK B;  3LZ0 B;  4WU8 B;  1N1J B;  4EO5 B;  4J8V C;  4G91 C;  4XZQ B;  5B40 A;  4QLC A;  5DNM D;  3KWQ A;  1P3M B;  3F6T A;  3MGP B;  3KUY D;  4H9O B;  5AV8 C;  5GXQ C;  3MVD B;  1ZLA B;  3VH6 T;  2IO5 B;  4LD9 B;  1P3K D;  1R4V A;  4R8P C;  1KX4 A;  3UT9 D;  3WTP D;  2PYO A;  2RVQ D;  4X23 D;  1M19 B;  2BG1 A;  2HUE C;  3B6F C;  3AZH A;  3R45 A;  2FJ7 C;  4WJ3 C;  1P3L B;  1HQ3 A;  3AZI D;  1F66 A;  3TU4 A;  1M18 D;  3MGQ C;  5JRG A;  2G5I C;  4J8U A;  1BH8 A;  5GXQ D;  4WU9 B;  1S32 B;  5B0Z C;  3A6N B;  2RIQ A;  1ID3 A;  5FUG B;  3REH D;  1P34 D;  5BNV B;  4R8P D;  3W97 C;  2YFV B;  3C1B B;  2CV5 B;  3MGS B;  3AV2 B;  3O62 A;  4M6B A;  5CHL B;  3AFA B;  3REJ B;  3B6F D;  3LZ1 C;  3AZL C;  1P3B C;  4UUZ B;  5B0Y A;  3AZJ A;  3REI B;  3LEL B;  3X1U D;  2NZD B;  4Z5T D;  3LZ0 C;  4WU8 C;  5GT0 A;  3B6G B;  4EO5 C;  4XZQ C;  3AZM D;  1P3M C;  3AV1 B;  5B31 G;  3MGP C;  3X1V A;  2VQR A;  3W96 B;  3WAA A;  5DNN B;  1TZY A;  5B31 D;  4YM6 B;  3MVD C;  5JA4 A;  4CAY B;  3AN2 A;  1ZLA C;  3VH6 W;  2IO5 C;  4ZUX B;  4LD9 C;  4YS3 D;  4E44 A;  3LZ1 D;  1P3A A;  3KWQ B;  5B40 B;  4QLC B;  3C1C A;  1M19 C;  5AV5 D;  3KXB D;  1F1E A;  3REL A;  1P3L C;  1AOI D;  1P3P D;  1KX4 B;  5AVB D;  3B0D B;  5GT3 D;  1P3O A;  2XD5 A;  2PYO B;  5BT1 D;  5B1L D;  3AZE D;  5B32 A;  5BO0 A;  1S32 C;  4WU9 C;  3A6N C;  1ZLA D;  5CP6 A;  3LJA D;  3AZH B;  3X1S D;  3R45 B;  3C1B C;  3WA9 A;  5AVC B;  2CV5 C;  3EPH A;  1HQ3 B;  3MGS C;  3AV2 C;  3WKJ A;  4J8W A;  3AZK D;  1F66 B;  3AYW D;  3TU4 B;  3AFA C;  3W98 A;  5JRG B;  1P3F A;  4Z2M G;  4J8U B;  1BH8 B;  3REJ C;  1ID3 B;  5G49 A;  4E45 A;  3REI C;  1WWI A;  4NFT A;  3LEL C;  4Z66 D;  1P3I D;  4J8X A;  2NZD C;  5CPJ A;  5CPK A;  3O62 B;  5AY8 D;  5B33 D;  4WU9 D;  3B6G C;  2ZM5 A;  2Y2Q A;  3NQU A;  3C1B D;  3W96 C;  3VH5 T;  2CV5 D;  3AV2 D;  5DNN C;  3VH6 A;  5B0Y B;  4YM6 C;  3AZJ B;  1P3G A;  1JFI A;  4ZUX C;  4AWL B;  5GT0 B;  3REJ D;  3X1T A;  3B0C W;  3MGR A;  3KWQ C;  3W99 D;  4QLC C;  5B40 C;  1M1A D;  4KGC A;  4ZBJ B;  5BS7 A;  3X1V B;  5AV9 D;  3WAA B;  3V9R A;  2ARO D;  2JSS A;  3AL0 C;  2NZD D;  1TZY B;  5B2J A;  5JA4 B;  5B24 A;  3AN2 B;  3AZG A;  2JCH A;  1U35 A;  1KX4 C;  3B0D C;  1P3A B;  2NQB A;  3C1C B;  5B1M D;  5KDM A;  3UTB D;  5AV6 A;  5B2I D;  3AZN D;  5CPI A;  3REL B;  1EQZ A;  3AZH C;  5AVC C;  1HQ3 C;  3NQJ B;  4QLC D;  4UPK A;  3REK A;  1F66 C;  4KUD A;  3TU4 C;  1P3O B;  3MNN A;  5JRG C;  3KFU G;  4DRB A;  1BH9 A;  4J8U C;  5B32 B;  5BO0 B;  1ID3 C;  5CP6 B;  5GSU D;  4JJN B;  5DNM A;  3WA9 B;  2BYM A;  3UTA D;  2Y2K A;  3EPL A;  3KUY A;  4J8W B;  3WKJ B;  3O62 C;  2Y2J A;  4J8V D;  3W98 B;  2Y2H A; 
#chains in the Genus database with same CATH homology
 5E5A A;  1P3K A;  3IP4 C;  5AV8 D;  3VH5 W;  5AVC D;  3WTP A;  5G49 B;  1HQ3 D;  3UT9 A;  5B0Y C;  3AZJ C;  4X23 A;  4J8X B;  1TAF A;  5JRG D;  4AWL C;  5CPJ B;  5CPK B;  2F8N G;  3A1K A;  5GT0 C;  2F8N D;  3AZI A;  4ZBJ C;  3NQU B;  3X1V C;  3WAA C;  1M18 A;  1TZY C;  3AN2 C;  2FJ7 D;  5F99 A;  1P3G B;  1JFI B;  2YFW A;  3REH A;  1P34 A;  3MGQ D;  3KSY A;  3X1T B;  4R8P A;  4G92 B;  4NE6 A;  1P3F B;  3MGR B;  4KGC B;  3C1C C;  5B0Y D;  5B0Z D;  3AZJ D;  2W8S A;  2ZY4 A;  3V9R B;  5B2J B;  3REL C;  5B24 B;  3AZF B;  3W97 D;  3AZG B;  3B6F A;  3WTP E;  1U35 B;  3EPK A;  1P3O C;  3X1V D;  2FFF B;  4H9Q A;  3WAA D;  2NQB B;  5B32 C;  5KDM B;  3X1U A;  5AV6 B;  4Z5T A;  3AZL D;  1P3B D;  5CP6 C;  2G5H C;  5CPI B;  1EQZ B;  4JJN C;  3AZM A;  3WA9 C;  2L5A A;  3LZ0 D;  4WU8 D;  4J8W C;  3WKJ C;  4H9N A;  3REK B;  2Y2I A;  4KUD B;  5B31 A;  4H9S C;  3MNN B;  3W98 C;  4XZQ D;  1P3F C;  1BH9 B;  1P3M D;  5C3I B;  3VH5 A;  3MGP D;  4YS3 A;  3LZ1 A;  3MVD D;  5DNM B;  4DRA A;  4LD9 D;  4J8X C;  5AV5 A;  3KUY B;  5CPJ C;  5CPK C;  5B32 D;  3KXB A;  1KX3 A;  1M19 D;  2F2A C;  1N1J A;  5E5A B;  1P3K B;  4JJN D;  1AOI A;  1P3P A;  3A1I A;  3UT9 B;  3WTP B;  5AVB A;  5GT3 A;  4NE3 A;  5B1L A;  3AZE A;  4X23 B;  1P3G C;  1P3L D;  4WZS B;  1ZLA A;  1TAF B;  3LJA A;  1P3F D;  3X1T C;  2F8N K;  3X1S A;  3MGR C;  4KGC C;  1S32 D;  2J8P A;  3A6N D;  3AZI B;  3AZK A;  5BS7 C;  3AYW A;  1M18 B;  3H0L C;  3AV1 C;  5B2J C;  5B24 C;  3AZF C;  3AZG C;  2DF4 C;  5F99 B;  1KU5 A;  3MGS D;  1U35 C;  3AFA D;  3REH B;  3P5J B;  1P34 B;  1P3I A;  4Z66 A;  5BNX A;  4H9P A;  2NQB C;  3FDD A;  5AV6 C;  5AY8 A;  5B33 A;  3EG5 B;  1P3G D;  4WV4 B;  3REI D;  5CPI C;  3LEL D;  1EQZ C;  2ZY3 A;  4H9R A;  4XUJ A;  3REK C;  4KUD C;  3B6G D;  1B67 A;  3MNN C;  4H9Q B;  3X1U B;  3AV1 D;  5C3I C;  4Z5T B;  3AZF D;  2PYO C;  3W96 D;  2HIO A;  2XD1 A;  5DNN D;  4YM6 D;  1T3U A;  1PZR A;  4HGA B;  5DNM C;  3W99 A;  4NE5 A;  3AZM B;  1M1A A;  4ZUX D;  5AV9 A;  2ARO A;  4H9N B;  2NZD A;  2Y2M A;  5B31 B;  3KWQ D;  5B40 D;  3EPJ A;  5CPI D;  5E5A C;  1P3K C;  4YS3 B;  2ZY2 A;  3UT9 C;  3WTP C;  1KX5 A;  2RVQ C;  4Z2M H;  5B1M A;  4X23 C;  3UTB A;  4KUD D;  5AV5 B;  5B2I A;  3AZN A;  1KX4 D;  3KXB B;  1KX3 B;  4WNN A;  2PYO D;  3AZI C;  1AOI B;  1P3P B;  3H0R C;  5AVB B;  1M18 C;  5GT3 B;  3AZH D;  2Y2G A;  5B1L B;  3AZE B;  5F99 C;  4DQY B;  3LJA B;  2CWE A;  5GSU A;  1F66 D;  3TU4 D;  5E5A D;  3REH C;  1P34 C;  3X1S B;  4J8U D;  3UTA A;  1ID3 D;  3AZK B;  3AYW B;  4J8V A;  1A7W A;  1BFM A;  5AV8 A;  3O62 D;  5AVC A;  5GXQ A;  1P3I B;  4Z66 B;  4CSR A;  4H9P B;  5BNX B;  3X1U C;  4Z5T C;  3H0M C;  5AY8 B;  5B33 B;  5F99 D;  1P3A C;  2Y2P A;  2F8N A;  4HGA C;  3AZM C;  4KHA A;  4H9R B;  4XUJ B;  5GT0 D;  1Z2C B;  5B31 C;  2FJ7 A;  4YS3 C;  2HIO B;  3MGQ A;  1TZY D;  2Y2O A;  3AN2 D;  3W99 B;  5B0Z A;  1M1A B;  5AV5 C;  5AV9 B;  3KXB C;  2ARO B;  1KX3 C;  3W97 A;  1P3A D;  1H3O A;  3C1C D;  1AOI C;  1P3P C;  1KX5 B;  5AVB C;  5GT3 C;  3REL D;  5BT1 C;  5B1L C;  3AZE C;  3UTB B;  5B1M B;  1W2E A;  3AZL A;  5B2I B;  3AZN B;  1P3B A;  3LJA C;  2BYM B;  5B32 G;  2DQN C;  2JE5 A;  1P3O D;  4WNN B;  3X1S C;  2BYK A;  3LZ0 A;  4WU8 A;  3B0C T;  5CP6 D;  3AZK C;  2F8N H;  3AYW C;  4XZQ A;  2ZY5 A;  1P3M A;  1KX3 D;  3WA9 D;  3MGP A;  3WKJ D;  4H9O A;  4J8W D;  5GSU B;  3MVD A;  2Y2L A;  3NQJ A;  3W98 D;  1P3I C;  4Z66 C;  3UTA B;  4LD9 A;  4G92 C;  5AY8 C;  5B33 C;  2Y2N A;  4J8V B;  4G91 B;  1M19 A;  4J8X D;  1ULY A;  5CPJ D;  1WWS A;  4JJN A;  5CPK D;  5AV8 B;  4XUJ C;  5GXQ B;  2YFW B;  4CSR B;  1P3L A;  4H9S A;  4R8P B;  2HIO C;  2F8N B;  3W99 C;  1HTA A;  4WU9 A;  1S32 A;  3A6N A;  1M1A C;  4KHA B;  2HUE B;  5AV9 C;  2ARO C;  5FUG A;  3B6F B;  3X1T D;  5BNV A;  2LY8 A;  2YFV A;  3MGR D;  3C1B A;  2CV5 A;  2FJ7 B;  4KGC D;  3MGS A;  3AV2 A;  3AFA A;  1KX5 C;  3MGQ B;  5B2J D;  5B24 D;  4XUJ D;  3AZG D;  3REJ A;  5B1M C;  5B0Z B;  3UTB C;  1U35 D;  5B2I C;  3AZN C;  4UUZ A;  1Q9C A;  3B0B A;  3REI A;  3LEL A;  3KUY C;  3W97 B;  1H3O B;  2HIO D;  2NQB D;  1B6W A;  5AV6 D;  2UWX A;  3B6G A;  1EQZ D;  3AV1 A;  3LZ1 B;  3AZL B;  3AZF A;  3W96 A;  1P3B B;  5GSU C;  3REK D;  5DNN A;  4YM6 A;  4CAY A;  3MNN D;  1KX5 D;  3UTA C;  4ZUX A;  2BYK B;  3LZ0 B;  4WU8 B;  1N1J B;  4EO5 B;  4J8V C;  4G91 C;  4XZQ B;  5B40 A;  4QLC A;  5DNM D;  3KWQ A;  1P3M B;  3F6T A;  3MGP B;  3KUY D;  4H9O B;  5AV8 C;  5GXQ C;  3MVD B;  1ZLA B;  3VH6 T;  2IO5 B;  4LD9 B;  1P3K D;  1R4V A;  4R8P C;  1KX4 A;  3UT9 D;  3WTP D;  2PYO A;  2RVQ D;  4X23 D;  1M19 B;  2BG1 A;  2HUE C;  3B6F C;  3AZH A;  3R45 A;  2FJ7 C;  4WJ3 C;  1P3L B;  1HQ3 A;  3AZI D;  1F66 A;  3TU4 A;  1M18 D;  3MGQ C;  5JRG A;  2G5I C;  4J8U A;  1BH8 A;  5GXQ D;  4WU9 B;  1S32 B;  5B0Z C;  3A6N B;  2RIQ A;  1ID3 A;  5FUG B;  3REH D;  1P34 D;  5BNV B;  4R8P D;  3W97 C;  2YFV B;  3C1B B;  2CV5 B;  3MGS B;  3AV2 B;  3O62 A;  4M6B A;  5CHL B;  3AFA B;  3REJ B;  3B6F D;  3LZ1 C;  3AZL C;  1P3B C;  4UUZ B;  5B0Y A;  3AZJ A;  3REI B;  3LEL B;  3X1U D;  2NZD B;  4Z5T D;  3LZ0 C;  4WU8 C;  5GT0 A;  3B6G B;  4EO5 C;  4XZQ C;  3AZM D;  1P3M C;  3AV1 B;  5B31 G;  3MGP C;  3X1V A;  2VQR A;  3W96 B;  3WAA A;  5DNN B;  1TZY A;  5B31 D;  4YM6 B;  3MVD C;  5JA4 A;  4CAY B;  3AN2 A;  1ZLA C;  3VH6 W;  2IO5 C;  4ZUX B;  4LD9 C;  4YS3 D;  4E44 A;  3LZ1 D;  1P3A A;  3KWQ B;  5B40 B;  4QLC B;  3C1C A;  1M19 C;  5AV5 D;  3KXB D;  1F1E A;  3REL A;  1P3L C;  1AOI D;  1P3P D;  1KX4 B;  5AVB D;  3B0D B;  5GT3 D;  1P3O A;  2XD5 A;  2PYO B;  5BT1 D;  5B1L D;  3AZE D;  5B32 A;  5BO0 A;  1S32 C;  4WU9 C;  3A6N C;  1ZLA D;  5CP6 A;  3LJA D;  3AZH B;  3X1S D;  3R45 B;  3C1B C;  3WA9 A;  5AVC B;  2CV5 C;  3EPH A;  1HQ3 B;  3MGS C;  3AV2 C;  3WKJ A;  4J8W A;  3AZK D;  1F66 B;  3AYW D;  3TU4 B;  3AFA C;  3W98 A;  5JRG B;  1P3F A;  4Z2M G;  4J8U B;  1BH8 B;  3REJ C;  1ID3 B;  5G49 A;  4E45 A;  3REI C;  1WWI A;  4NFT A;  3LEL C;  4Z66 D;  1P3I D;  4J8X A;  2NZD C;  5CPJ A;  5CPK A;  3O62 B;  5AY8 D;  5B33 D;  4WU9 D;  3B6G C;  2ZM5 A;  2Y2Q A;  3NQU A;  3C1B D;  3W96 C;  3VH5 T;  2CV5 D;  3AV2 D;  5DNN C;  3VH6 A;  5B0Y B;  4YM6 C;  3AZJ B;  1P3G A;  1JFI A;  4ZUX C;  4AWL B;  5GT0 B;  3REJ D;  3X1T A;  3B0C W;  3MGR A;  3KWQ C;  3W99 D;  4QLC C;  5B40 C;  1M1A D;  4KGC A;  4ZBJ B;  5BS7 A;  3X1V B;  5AV9 D;  3WAA B;  3V9R A;  2ARO D;  2JSS A;  3AL0 C;  2NZD D;  1TZY B;  5B2J A;  5JA4 B;  5B24 A;  3AN2 B;  3AZG A;  2JCH A;  1U35 A;  1KX4 C;  3B0D C;  1P3A B;  2NQB A;  3C1C B;  5B1M D;  5KDM A;  3UTB D;  5AV6 A;  5B2I D;  3AZN D;  5CPI A;  3REL B;  1EQZ A;  3AZH C;  5AVC C;  1HQ3 C;  3NQJ B;  4QLC D;  4UPK A;  3REK A;  1F66 C;  4KUD A;  3TU4 C;  1P3O B;  3MNN A;  5JRG C;  3KFU G;  4DRB A;  1BH9 A;  4J8U C;  5B32 B;  5BO0 B;  1ID3 C;  5CP6 B;  5GSU D;  4JJN B;  5DNM A;  3WA9 B;  2BYM A;  3UTA D;  2Y2K A;  3EPL A;  3KUY A;  4J8W B;  3WKJ B;  3O62 C;  2Y2J A;  4J8V D;  3W98 B;  2Y2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...