5AY8D

Crystal structure of human nucleosome containing h3.y
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords H3.Y
publication title Structure and function of human histone H3.Y nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ay8D00
4J8VB 3LELC 5GT3B 4G92C 5BNXA 1M18B 4J8WB 5GSUA 3NQJA 5B31B 3AFAB 1TZYA 5AVCB 5B24B 2F8NA 3VH6T 3X1SD 4XUJD 5AV8C 3WAAA 5JRGD 4UUZA 5B32B 3AZHA 2NZDB 4LD9C 3AZLC 4AWLC 4Z66B 5B33D 5GSUD 1WWIA 2HIOC 3LZ0C 1P3OB 2F8ND 3O62A 1U35C 4WU8B 4H9RB 3C1CB 1S32C 3MGRA 1P3GA 3MVDA 3WAAD 4H9PA 2NQBA 3AZHD 5AVBA 3AN2C 3RELA 5B0YA 5BO0A 3REHB 4ZBJB 4J8XA 3C1BC 4WZSB 4X23C 3O62D 4EO5B 5GT0B 5AV6B 3REJA 3MGRD 1P3GD 1P34A 4YS3A 2FJ7D 3MNNA 3A6NA 2NQBD 5AVBD 1R4VA 3RELD 3AZKA 1JFIB 3AYWD 1ZLAA 2LY8A 3KXBA 5CP6B 1P3AC 5AV5A 5KDMA 4KUDC 3REJD 4YM6B 3MNND 3A6ND 5CHLB 5B2IC 3W99B 3VH6A 3REKB 3AV1C 3AZKD 3LZ1C 5AY8B 5BNVB 5CPJC 1HQ3A 5F99C 3X1TB 3W97C 4J8VC 5GT3C 1P3KB 4CAYB 5CPIB 3W96B 1M18C 4J8WC 5B31C 5AV5D 3AFAC 5AVCC 4WNNB 4H9OB 5B32C 1HQ3D 2NZDC 3AZGA 2CV5D 4Z66C 4G91C 3B6FA 4NE3A 1P3OC 3X1SB 3UTBA 4WU8C 3B6GD 4H9SA 3AZMA 3REID 1BH8A 4G92B 2F8NK 1BH9A 5GSUB 5B33B 1KX4A 3REHC 4ZBJC 2F8NB 3B6FD 5B2JD 3UTAA 3KUYA 4EO5C 5GT0C 5AV6C 2BYKA 1H3OB 3AZHB 3NQUA 3TU4D 4LD9B 2IO5B 1KX4D 3AZJA 4ZUXA 4J8UA 3MGSB 1P3LA 3LZ0B 1U35B 5C3IB 3AZEA 3VH5W 5CP6C 1M19A 2YFVA 4KHAB 2FJ7B 4YM6C 3W99C 3AYWB 3REKC 4XZQD 1F66A 1P3BD 3WTPE 4ZUXD 3AZJD 1P3IA 4H9NA 4QLCD 4M6BA 2YFWA 4J8UD 3X1TC 1P3LD 5CPKD 1P3KC 5G49B 2RVQD 3W96C 5B1MB 5CPIC 3REJB 3AZED 1M19D 1ID3A 5E5AA 3A6NB 3LJAB 5B31G 1P3FA 4KGCD 1WWSA 1F66D 4Z5TA 4DRAA 5DNMA 3MGQD 1Q9CA 4NE5A 5AV5B 1P3AB 5BS7C 5E5AD 3KWQA 3X1SC 4Z5TD 3AZIA 4Z2MG 5CPJB 2CV5B 3MGPA 1EQZA 5B33C 1N1JB 5GSUC 2BYMB 1KX5D 1KX3D 5JA4B 3B6GB 1TAFA 2L5AA 5DNND 3REIB 1P3MB 5B40D 3AZHC 3AZNB 3AZFA 3MGPD 2IO5C 3R45B 4NE6A 1EQZD 5AV9A 4G91B 3B6FB 1TZYD 3MGSC 5B2JB 3O62C 5C3IC 1AOIA 3WA9B 2FJ7C 3TU4B 3LELA 2NQBC 5AVBC 3AZFD 5BT1D 3AYWC 1KX4B 5AV8A 4Z2MH 5B1MC 2BYKB 3VH5T 3REJC 3WKJA 3MVDD 3AV2B 3A6NC 3LJAC 3AZLA 4XZQB 5B0YD 1P3BB 2HIOA 4ZUXB 4QLCB 5B0ZA 4J8XD 1S32A 5CPKB 5AV8D 1M19B 2YFVB 5AV5C 3WKJD 3AN2A 5FUGA 1P34D 4YS3D 3X1VA 4KGCB 3AZLD 1F66B 5B1LA 3MGQB 1ZLAD 3C1BA 4H9NB 1HQ3C 5GXQB 5B0ZD 2CV5C 3KXBD 5E5AB 3UT9A 3X1VD 2AROB 3B6GC 1BFMA 5B1LD 3REIC 1P3MC 3AZNC 1P3PA 1KX5B 2PYOA 1KX3B 3B6FC 3AV1A 3UT9D 5B2JC 4R8PA 3LZ1A 4XUJB 5DNNB 5JRGB 3VH5A 3WA9C 5F99A 5B40B 3W97A 3W98A 3TU4C 4H9QA 4J8VA 5GT3A 4JJNA 1M18A 5BNXB 3AZGD 1EQZB 1KX4C 5B31A 1P3PD 3NQJB 2PYOD 1TZYB 5AVCA 5B24A 4R8PD 3UTBD 3WAAB 3AZMD 2NZDA 4UUZB 3AV2C 3W98D 1HTAA 4J8VD 5GT3D 4JJND 4XZQC 4Z66A 1P3BC 5B31D 4ZUXC 4QLCC 4J8UC 5AVCD 5B24D 1P3OA 1P3LC 4WU8A 4H9RA 3C1CA 3O62B 5CPKC 2RVQC 3UTAD 3KUYD 3MGRB 1P3GB 4CSRA 3MVDB 1M19C 4H9PB 2NQBB 5AVBB 3RELB 5B0YB 4KGCC 4Z66D 1F66C 3REHA 5BO0B 3MGQC 4J8XB 4E44A 5GXQC 3C1CD 4WU8D 3WKJB 1P34B 4YS3B 3MNNB 5E5AC 1M1AA 4WU9A 1JFIA 3X1UA 2AROC 3AZKB 3B0CW 1ZLAB 4Z5TC 3B0DB 1P3ID 3KXBB 5CP6A 5B32G 3KSYA 1KX5C 5KDMB 4YM6A 1KX3C 3X1VB 1ID3D 3REKA 1M1AD 5AY8A 4WU9D 3X1UD 1P3FD 5B1LB 5BNVA 5DNNC 5JRGC 4XUJC 5B40C 3X1TA 1HQ3B 5DNMD 1P3KA 4CAYA 3W96A 5CP6D 1EQZC 1TZYC 3UT9B 3KWQD 5AY8D 3WAAC 3X1TD 3AZID 5BT1C 3AZGB 1P3KD 1P3PB 3WTPA 3W96D 2PYOB 5BS7A 4R8PB 3UTBB 3AZMB 3MGRC 1P3GC 3MVDC 3W98B 4H9QB 1BH8B 1A7WA 4JJNB 5B33A 5B0YC 3RELC 1BH9B 3WTPD 3B0BA 5AV9D 4J8XC 3UTAB 3KUYB 1H3OA 1AOID 3WKJC 1P34C 4YS3C 4LD9A 3NQUB 3MNNC 3LELD 3AZKC 1ZLAC 3AZJB 3MGSA 3LZ0A 4J8UB 3B0DC 5B0ZC 1U35A 1P3LB 4HGAB 3KXBC 3AZEB 2FJ7A 4KHAA 4CSRB 3V9RA 3X1VC 4LD9D 2HUEB 3AYWA 5B1LC 3B0CT 2HIOD 1P3IB 3MGSD 3LZ0D 2YFWB 4DRBA 4X23A 1U35D 5G49A 1S32D 5B1MA 3LJAA 1ID3B 3AN2D 3UT9C 1M1AB 4WU9B 3X1UB 1P3FB 2F8NG 4Z5TB 5DNMB 3C1BD 4X23D 3AZGC 1P3AA 5B1MD 1P3PC 4KUDA 2PYOC 3LJAD 1B6WA 5B2IA 3KWQB 4R8PC 3UTBC 4H9SC 3AZMC 5CPJA 1KU5A 1ULYA 3AZIB 3W98C 2CV5A 4JJNC 4J8WA 1N1JA 3MGPB 2CWEA 2BYMA 1P3AD 4KUDD 3AFAA 1B67A 5B24C 5JA4A 5B2ID 3B6GA 3AV1D 1TAFB 3LZ1D 3KUYC 3REIA 3UTAC 1P3MA 5B32A 5CPJD 3AZNA 5F99D 3W97D 3AZFB 3R45A 3WTPB 1M18D 4J8WD 5AV9B 3AFAD 3AZJC 5B2JA 2F8NH 3VH6W 3C1CC 4HGAC 3WA9A 1AOIB 3AZEC 3TU4A 1P3MD 5B32D 3LELB 3AZND 2NZDD 2HUEC 1P3IC 1P3OD 5GT0A 5AV8B 5AV6A 3WA9D 4NFTA 3AV2A 1ID3C 4XZQA 3AZLB 4AWLB 4WU9C 1P3BA 3X1UC 1P3FC 1M1AC 4QLCA 2HIOB 3REHD 5DNMC 5CPKA 5B0ZB 1S32B 5GT0D 5AV6D 3AV2D 3V9RB 3AN2B 1F1EA 5FUGB 4KGCA 3W99A 3KWQC 5AY8C 3MGQA 3C1BB 5GXQA 3AZIC 4X23B 5CPIA 3MGPC 4YM6D 2AROA 4WNNA 3W99D 3REKD 4H9OA 5GXQD 3AZFC 3WTPC 5CPID 1KX5A 4KUDB 1KX3A 5AV9C 5B2IB 3AV1B 3X1SA 2AROD 4XUJA 3LZ1B 5DNNA 4E45A 5JRGA 2JSSA 1AOIC 5B40A 4WV4B 5F99B 3W97B
chains in the Genus database with same CATH superfamily
4J8VB 3LELC 5GT3B 4G92C 5BNXA 1M18B 4J8WB 5GSUA 3NQJA 5B31B 3AFAB 1TZYA 5AVCB 5B24B 2F8NA 3VH6T 3X1SD 4XUJD 5AV8C 3WAAA 5JRGD 4UUZA 5B32B 3AZHA 2NZDB 4LD9C 3H0MC 4AWLC 3AZLC 4Z66B 5B33D 5GSUD 1WWIA 2HIOC 2Y2KA 3LZ0C 1P3OB 2F8ND 3O62A 1U35C 4WU8B 4H9RB 3C1CB 1S32C 3MGRA 1P3GA 3MVDA 3WAAD 4H9PA 2NQBA 3AZHD 5AVBA 3AN2C 3RELA 5B0YA 2Y2PA 5BO0A 3REHB 1PZRA 4ZBJB 2Y2JA 4J8XA 3C1BC 4WZSB 4X23C 3O62D 4EO5B 5GT0B 5AV6B 1T3UA 3REJA 3MGRD 1P3GD 1P34A 4YS3A 2FJ7D 3MNNA 3A6NA 2NQBD 5AVBD 1R4VA 3RELD 3AZKA 1JFIB 3AYWD 1ZLAA 2LY8A 3KXBA 5CP6B 1P3AC 5AV5A 5KDMA 4KUDC 3REJD 4YM6B 3MNND 3A6ND 5CHLB 5B2IC 3W99B 3VH6A 3REKB 3AV1C 3AZKD 3LZ1C 5AY8B 5BNVB 5CPJC 1HQ3A 5F99C 3X1TB 3W97C 2Y2MA 4J8VC 5GT3C 3H0RC 1P3KB 4CAYB 5CPIB 3W96B 1M18C 4J8WC 5B31C 5AV5D 3AFAC 5AVCC 4WNNB 2F2AC 4H9OB 5B32C 1HQ3D 2NZDC 3AZGA 2CV5D 4Z66C 4G91C 3B6FA 4NE3A 1P3OC 3X1SB 3UTBA 4WU8C 3B6GD 2Y2NA 4H9SA 3AZMA 3REID 1BH8A 4G92B 2F8NK 1BH9A 5GSUB 5B33B 1KX4A 4WJ3C 3REHC 4ZBJC 2F8NB 3B6FD 5B2JD 3UTAA 3KUYA 4EO5C 5GT0C 5AV6C 2BYKA 1H3OB 3EG5B 3AZHB 3NQUA 3TU4D 4LD9B 2J8PA 2IO5B 1KX4D 3AZJA 4ZUXA 4J8UA 3MGSB 1P3LA 3LZ0B 1U35B 5C3IB 3AZEA 3VH5W 5CP6C 1M19A 2YFVA 4KHAB 2FJ7B 4YM6C 3W99C 3AYWB 3REKC 4XZQD 1F66A 1P3BD 3WTPE 4ZUXD 3AZJD 1P3IA 4H9NA 4QLCD 4M6BA 2YFWA 3A1IA 4J8UD 3X1TC 3A1KA 1P3LD 5CPKD 1P3KC 5G49B 2RVQD 3W96C 5B1MB 5CPIC 3F6TA 3REJB 3AZED 1M19D 1ID3A 5E5AA 3A6NB 3LJAB 5B31G 1P3FA 4KGCD 1WWSA 3EPLA 1F66D 4Z5TA 4DRAA 5DNMA 3MGQD 1Q9CA 2G5HC 3IP4C 4NE5A 5AV5B 1P3AB 5BS7C 5E5AD 3KWQA 3X1SC 4Z5TD 3AZIA 4Z2MG 5CPJB 2CV5B 3MGPA 1EQZA 5B33C 1N1JB 5GSUC 2BYMB 1KX5D 3EPHA 1KX3D 5JA4B 3B6GB 1TAFA 2L5AA 5DNND 3REIB 1P3MB 5B40D 3AZHC 3AZNB 3AZFA 3MGPD 2IO5C 3R45B 4NE6A 1EQZD 5AV9A 4G91B 3B6FB 1TZYD 3MGSC 5B2JB 3O62C 5C3IC 1AOIA 3WA9B 2FJ7C 3TU4B 3LELA 2NQBC 2Y2IA 5AVBC 3AZFD 5BT1D 3AYWC 1KX4B 2ZM5A 2Y2HA 5AV8A 4Z2MH 2DQNC 5B1MC 2BYKB 3VH5T 3REJC 3WKJA 3MVDD 3AV2B 3A6NC 3LJAC 3AZLA 4XZQB 5B0YD 1P3BB 2HIOA 4ZUXB 4QLCB 5B0ZA 4J8XD 1S32A 5CPKB 5AV8D 1M19B 2YFVB 5AV5C 3WKJD 3AN2A 5FUGA 1P34D 4YS3D 3X1VA 4KGCB 3AZLD 1F66B 5B1LA 3MGQB 1ZLAD 3C1BA 4H9NB 1HQ3C 5GXQB 2Y2GA 2Y2OA 5B0ZD 2CV5C 3KXBD 5E5AB 3UT9A 3X1VD 2AROB 3B6GC 1BFMA 5B1LD 3REIC 1P3MC 3FDDA 3AZNC 1P3PA 1KX5B 2PYOA 1KX3B 3B6FC 2JE5A 3AV1A 3UT9D 5B2JC 4R8PA 3LZ1A 2ZY5A 4XUJB 5DNNB 5JRGB 3VH5A 3WA9C 5F99A 5B40B 3W97A 3W98A 3TU4C 4H9QA 4J8VA 5GT3A 4JJNA 1M18A 5BNXB 3AZGD 1EQZB 1KX4C 5B31A 1P3PD 3NQJB 2PYOD 1TZYB 5AVCA 5B24A 4R8PD 3UTBD 3WAAB 3AZMD 2NZDA 4UUZB 3AV2C 3W98D 1HTAA 4J8VD 5GT3D 4JJND 4XZQC 4Z66A 1P3BC 5B31D 3P5JB 4ZUXC 4QLCC 4J8UC 5AVCD 5B24D 1P3OA 1P3LC 4WU8A 4H9RA 3C1CA 3O62B 5CPKC 2RVQC 3UTAD 3KUYD 3MGRB 1P3GB 4CSRA 3MVDB 1M19C 4H9PB 2NQBB 2BG1A 2G5IC 5AVBB 3RELB 5B0YB 4KGCC 4Z66D 1F66C 3REHA 5BO0B 3MGQC 2RIQA 4J8XB 4E44A 5GXQC 3C1CD 4WU8D 3WKJB 1P34B 4YS3B 3MNNB 5E5AC 1M1AA 4WU9A 1JFIA 3X1UA 2AROC 3AZKB 3B0CW 1ZLAB 4Z5TC 3B0DB 1P3ID 3KXBB 5CP6A 5B32G 3KSYA 2UWXA 5KDMB 4YM6A 1KX5C 1KX3C 3X1VB 1ID3D 3REKA 1M1AD 5AY8A 4WU9D 3X1UD 1P3FD 5B1LB 5BNVA 5DNNC 5JRGC 4XUJC 5B40C 3X1TA 1HQ3B 5DNMD 1P3KA 4CAYA 3W96A 5CP6D 1EQZC 1TZYC 3UT9B 3KWQD 5AY8D 3KFUG 3WAAC 3X1TD 3AZID 5BT1C 3AZGB 1P3KD 1P3PB 3WTPA 3W96D 2PYOB 5BS7A 4R8PB 3UTBB 3AZMB 3MGRC 1P3GC 3MVDC 3W98B 4H9QB 1BH8B 1A7WA 4JJNB 5B33A 5B0YC 3RELC 1BH9B 3WTPD 3B0BA 5AV9D 4J8XC 3UTAB 3KUYB 1H3OA 1AOID 3WKJC 1P34C 4YS3C 4LD9A 3NQUB 3MNNC 3LELD 3H0LC 3AZKC 1ZLAC 3AZJB 2ZY2A 3MGSA 3LZ0A 4J8UB 3B0DC 5B0ZC 1U35A 1P3LB 4HGAB 3KXBC 2Y2LA 3AZEB 2FJ7A 4KHAA 4CSRB 3V9RA 3X1VC 4LD9D 2HUEB 2JCHA 3AYWA 5B1LC 3B0CT 2HIOD 1P3IB 3MGSD 3LZ0D 2YFWB 4DRBA 4X23A 1U35D 5G49A 1S32D 5B1MA 3LJAA 1ID3B 3AN2D 3UT9C 1M1AB 4WU9B 3X1UB 1P3FB 2F8NG 4Z5TB 5DNMB 3C1BD 4X23D 3AZGC 1P3AA 5B1MD 1P3PC 4KUDA 2XD5A 2PYOC 2XD1A 3LJAD 1B6WA 2ZY3A 5B2IA 3KWQB 4R8PC 3UTBC 4H9SC 3AZMC 5CPJA 1KU5A 1ULYA 3AZIB 3W98C 2CV5A 4JJNC 4J8WA 1N1JA 3MGPB 2CWEA 2BYMA 1P3AD 4KUDD 3AFAA 1B67A 5B24C 5JA4A 5B2ID 3B6GA 3AV1D 1TAFB 3LZ1D 3KUYC 3REIA 3UTAC 1P3MA 5B32A 5CPJD 3AZNA 5F99D 3W97D 3AZFB 3R45A 3WTPB 4DQYB 1M18D 4J8WD 5AV9B 2FFFB 3AFAD 3AZJC 5B2JA 2F8NH 3VH6W 3C1CC 4HGAC 3EPKA 3WA9A 1AOIB 3AZEC 3TU4A 1P3MD 2W8SA 5B32D 3LELB 3AZND 2NZDD 2HUEC 1P3IC 1P3OD 1Z2CB 5GT0A 5AV8B 5AV6A 3WA9D 4NFTA 3AV2A 2VQRA 1ID3C 4XZQA 3AZLB 4AWLB 4WU9C 1P3BA 3X1UC 1P3FC 1M1AC 4UPKA 4QLCA 2HIOB 3REHD 5DNMC 5CPKA 5B0ZB 1S32B 5GT0D 5AV6D 3AV2D 3V9RB 3AN2B 1F1EA 5FUGB 4KGCA 3W99A 3KWQC 5AY8C 3MGQA 3C1BB 5GXQA 3AZIC 2Y2QA 4X23B 5CPIA 3MGPC 4YM6D 2AROA 4WNNA 3W99D 2ZY4A 3REKD 4H9OA 1W2EA 5GXQD 3AZFC 2DF4C 3WTPC 5CPID 1KX5A 4KUDB 1KX3A 5AV9C 5B2IB 3EPJA 3X1SA 2AROD 4XUJA 3LZ1B 5DNNA 4E45A 5JRGA 3AV1B 3AL0C 2JSSA 1AOIC 5B40A 4WV4B 5F99B 3W97B
chains in the Genus database with same CATH topology
4J8VB 3LELC 5GT3B 4G92C 5BNXA 1M18B 4J8WB 5GSUA 3NQJA 5B31B 3AFAB 1TZYA 5AVCB 5B24B 2F8NA 3VH6T 3X1SD 4XUJD 5AV8C 3WAAA 5JRGD 4UUZA 5B32B 3AZHA 2NZDB 4LD9C 3H0MC 4AWLC 3AZLC 4Z66B 5B33D 5GSUD 1WWIA 2HIOC 2Y2KA 3LZ0C 1P3OB 2F8ND 3O62A 1U35C 4WU8B 4H9RB 3C1CB 1S32C 3MGRA 1P3GA 3MVDA 3WAAD 4H9PA 2NQBA 3AZHD 5AVBA 3AN2C 3RELA 5B0YA 2Y2PA 5BO0A 3REHB 1PZRA 4ZBJB 2Y2JA 4J8XA 3C1BC 4WZSB 4X23C 3O62D 4EO5B 5GT0B 5AV6B 1T3UA 3REJA 3MGRD 1P3GD 1P34A 4YS3A 2FJ7D 3MNNA 3A6NA 2NQBD 5AVBD 1R4VA 3RELD 3AZKA 1JFIB 3AYWD 1ZLAA 2LY8A 3KXBA 5CP6B 1P3AC 5AV5A 5KDMA 4KUDC 3REJD 4YM6B 3MNND 3A6ND 5CHLB 5B2IC 3W99B 3VH6A 3REKB 3AV1C 3AZKD 3LZ1C 5AY8B 5BNVB 5CPJC 1HQ3A 5F99C 3X1TB 3W97C 2Y2MA 4J8VC 5GT3C 3H0RC 1P3KB 4CAYB 5CPIB 3W96B 1M18C 4J8WC 5B31C 5AV5D 3AFAC 5AVCC 4WNNB 2F2AC 4H9OB 5B32C 1HQ3D 2NZDC 3AZGA 2CV5D 4Z66C 4G91C 3B6FA 4NE3A 1P3OC 3X1SB 3UTBA 4WU8C 3B6GD 2Y2NA 4H9SA 3AZMA 3REID 1BH8A 4G92B 2F8NK 1BH9A 5GSUB 5B33B 1KX4A 4WJ3C 3REHC 4ZBJC 2F8NB 3B6FD 5B2JD 3UTAA 3KUYA 4EO5C 5GT0C 5AV6C 2BYKA 1H3OB 3EG5B 3AZHB 3NQUA 3TU4D 4LD9B 2J8PA 2IO5B 1KX4D 3AZJA 4ZUXA 4J8UA 3MGSB 1P3LA 3LZ0B 1U35B 5C3IB 3AZEA 3VH5W 5CP6C 1M19A 2YFVA 4KHAB 2FJ7B 4YM6C 3W99C 3AYWB 3REKC 4XZQD 1F66A 1P3BD 3WTPE 4ZUXD 3AZJD 1P3IA 4H9NA 4QLCD 4M6BA 2YFWA 3A1IA 4J8UD 3X1TC 3A1KA 1P3LD 5CPKD 1P3KC 5G49B 2RVQD 3W96C 5B1MB 5CPIC 3F6TA 3REJB 3AZED 1M19D 1ID3A 5E5AA 3A6NB 3LJAB 5B31G 1P3FA 4KGCD 1WWSA 3EPLA 1F66D 4Z5TA 4DRAA 5DNMA 3MGQD 1Q9CA 2G5HC 3IP4C 4NE5A 5AV5B 1P3AB 5BS7C 5E5AD 3KWQA 3X1SC 4Z5TD 3AZIA 4Z2MG 5CPJB 2CV5B 3MGPA 1EQZA 5B33C 1N1JB 5GSUC 2BYMB 1KX5D 3EPHA 1KX3D 5JA4B 3B6GB 1TAFA 2L5AA 5DNND 3REIB 1P3MB 5B40D 3AZHC 3AZNB 3AZFA 3MGPD 2IO5C 3R45B 4NE6A 1EQZD 5AV9A 4G91B 3B6FB 1TZYD 3MGSC 5B2JB 3O62C 5C3IC 1AOIA 3WA9B 2FJ7C 3TU4B 3LELA 2NQBC 2Y2IA 5AVBC 3AZFD 5BT1D 3AYWC 1KX4B 2ZM5A 2Y2HA 5AV8A 4Z2MH 2DQNC 5B1MC 2BYKB 3VH5T 3REJC 3WKJA 3MVDD 3AV2B 3A6NC 3LJAC 3AZLA 4XZQB 5B0YD 1P3BB 2HIOA 4ZUXB 4QLCB 5B0ZA 4J8XD 1S32A 5CPKB 5AV8D 1M19B 2YFVB 5AV5C 3WKJD 3AN2A 5FUGA 1P34D 4YS3D 3X1VA 4KGCB 3AZLD 1F66B 5B1LA 3MGQB 1ZLAD 3C1BA 4H9NB 1HQ3C 5GXQB 2Y2GA 2Y2OA 5B0ZD 2CV5C 3KXBD 5E5AB 3UT9A 3X1VD 2AROB 3B6GC 1BFMA 5B1LD 3REIC 1P3MC 3FDDA 3AZNC 1P3PA 1KX5B 2PYOA 1KX3B 3B6FC 2JE5A 3AV1A 3UT9D 5B2JC 4R8PA 3LZ1A 2ZY5A 4XUJB 5DNNB 5JRGB 3VH5A 3WA9C 5F99A 5B40B 3W97A 3W98A 3TU4C 4H9QA 4J8VA 5GT3A 4JJNA 1M18A 5BNXB 3AZGD 1EQZB 1KX4C 5B31A 1P3PD 3NQJB 2PYOD 1TZYB 5AVCA 5B24A 4R8PD 3UTBD 3WAAB 3AZMD 2NZDA 4UUZB 3AV2C 3W98D 1HTAA 4J8VD 5GT3D 4JJND 4XZQC 4Z66A 1P3BC 5B31D 3P5JB 4ZUXC 4QLCC 4J8UC 5AVCD 5B24D 1P3OA 1P3LC 4WU8A 4H9RA 3C1CA 3O62B 5CPKC 2RVQC 3UTAD 3KUYD 3MGRB 1P3GB 4CSRA 3MVDB 1M19C 4H9PB 2NQBB 2BG1A 2G5IC 5AVBB 3RELB 5B0YB 4KGCC 4Z66D 1F66C 3REHA 5BO0B 3MGQC 2RIQA 4J8XB 4E44A 5GXQC 3C1CD 4WU8D 3WKJB 1P34B 4YS3B 3MNNB 5E5AC 1M1AA 4WU9A 1JFIA 3X1UA 2AROC 3AZKB 3B0CW 1ZLAB 4Z5TC 3B0DB 1P3ID 3KXBB 5CP6A 5B32G 3KSYA 2UWXA 5KDMB 4YM6A 1KX5C 1KX3C 3X1VB 1ID3D 3REKA 1M1AD 5AY8A 4WU9D 3X1UD 1P3FD 5B1LB 5BNVA 5DNNC 5JRGC 4XUJC 5B40C 3X1TA 1HQ3B 5DNMD 1P3KA 4CAYA 3W96A 5CP6D 1EQZC 1TZYC 3UT9B 3KWQD 5AY8D 3KFUG 3WAAC 3X1TD 3AZID 5BT1C 3AZGB 1P3KD 1P3PB 3WTPA 3W96D 2PYOB 5BS7A 4R8PB 3UTBB 3AZMB 3MGRC 1P3GC 3MVDC 3W98B 4H9QB 1BH8B 1A7WA 4JJNB 5B33A 5B0YC 3RELC 1BH9B 3WTPD 3B0BA 5AV9D 4J8XC 3UTAB 3KUYB 1H3OA 1AOID 3WKJC 1P34C 4YS3C 4LD9A 3NQUB 3MNNC 3LELD 3H0LC 3AZKC 1ZLAC 3AZJB 2ZY2A 3MGSA 3LZ0A 4J8UB 3B0DC 5B0ZC 1U35A 1P3LB 4HGAB 3KXBC 2Y2LA 3AZEB 2FJ7A 4KHAA 4CSRB 3V9RA 3X1VC 4LD9D 2HUEB 2JCHA 3AYWA 5B1LC 3B0CT 2HIOD 1P3IB 3MGSD 3LZ0D 2YFWB 4DRBA 4X23A 1U35D 5G49A 1S32D 5B1MA 3LJAA 1ID3B 3AN2D 3UT9C 1M1AB 4WU9B 3X1UB 1P3FB 2F8NG 4Z5TB 5DNMB 3C1BD 4X23D 3AZGC 1P3AA 5B1MD 1P3PC 4KUDA 2XD5A 2PYOC 2XD1A 3LJAD 1B6WA 2ZY3A 5B2IA 3KWQB 4R8PC 3UTBC 4H9SC 3AZMC 5CPJA 1KU5A 1ULYA 3AZIB 3W98C 2CV5A 4JJNC 4J8WA 1N1JA 3MGPB 2CWEA 2BYMA 1P3AD 4KUDD 3AFAA 1B67A 5B24C 5JA4A 5B2ID 3B6GA 3AV1D 1TAFB 3LZ1D 3KUYC 3REIA 3UTAC 1P3MA 5B32A 5CPJD 3AZNA 5F99D 3W97D 3AZFB 3R45A 3WTPB 4DQYB 1M18D 4J8WD 5AV9B 2FFFB 3AFAD 3AZJC 5B2JA 2F8NH 3VH6W 3C1CC 4HGAC 3EPKA 3WA9A 1AOIB 3AZEC 3TU4A 1P3MD 2W8SA 5B32D 3LELB 3AZND 2NZDD 2HUEC 1P3IC 1P3OD 1Z2CB 5GT0A 5AV8B 5AV6A 3WA9D 4NFTA 3AV2A 2VQRA 1ID3C 4XZQA 3AZLB 4AWLB 4WU9C 1P3BA 3X1UC 1P3FC 1M1AC 4UPKA 4QLCA 2HIOB 3REHD 5DNMC 5CPKA 5B0ZB 1S32B 5GT0D 5AV6D 3AV2D 3V9RB 3AN2B 1F1EA 5FUGB 4KGCA 3W99A 3KWQC 5AY8C 3MGQA 3C1BB 5GXQA 3AZIC 2Y2QA 4X23B 5CPIA 3MGPC 4YM6D 2AROA 4WNNA 3W99D 2ZY4A 3REKD 4H9OA 1W2EA 5GXQD 3AZFC 2DF4C 3WTPC 5CPID 1KX5A 4KUDB 1KX3A 5AV9C 5B2IB 3EPJA 3X1SA 2AROD 4XUJA 3LZ1B 5DNNA 4E45A 5JRGA 3AV1B 3AL0C 2JSSA 1AOIC 5B40A 4WV4B 5F99B 3W97B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V B;  3LEL C;  5GT3 B;  4G92 C;  5BNX A;  1M18 B;  4J8W B;  5GSU A;  3NQJ A;  5B31 B;  3AFA B;  1TZY A;  5AVC B;  5B24 B;  2F8N A;  3VH6 T;  3X1S D;  4XUJ D;  5AV8 C;  3WAA A;  5JRG D;  4UUZ A;  5B32 B;  3AZH A;  2NZD B;  4LD9 C;  3AZL C;  4AWL C;  4Z66 B;  5B33 D;  5GSU D;  1WWI A;  2HIO C;  3LZ0 C;  1P3O B;  2F8N D;  3O62 A;  1U35 C;  4WU8 B;  4H9R B;  3C1C B;  1S32 C;  3MGR A;  1P3G A;  3MVD A;  3WAA D;  4H9P A;  2NQB A;  3AZH D;  5AVB A;  3AN2 C;  3REL A;  5B0Y A;  5BO0 A;  3REH B;  4ZBJ B;  4J8X A;  3C1B C;  4WZS B;  4X23 C;  3O62 D;  4EO5 B;  5GT0 B;  5AV6 B;  3REJ A;  3MGR D;  1P3G D;  1P34 A;  4YS3 A;  2FJ7 D;  3MNN A;  3A6N A;  2NQB D;  5AVB D;  1R4V A;  3REL D;  3AZK A;  1JFI B;  3AYW D;  1ZLA A;  2LY8 A;  3KXB A;  5CP6 B;  1P3A C;  5AV5 A;  5KDM A;  4KUD C;  3REJ D;  4YM6 B;  3MNN D;  3A6N D;  5CHL B;  5B2I C;  3W99 B;  3VH6 A;  3REK B;  3AV1 C;  3AZK D;  3LZ1 C;  5AY8 B;  5BNV B;  5CPJ C;  1HQ3 A;  5F99 C;  3X1T B;  3W97 C;  4J8V C;  5GT3 C;  1P3K B;  4CAY B;  5CPI B;  3W96 B;  1M18 C;  4J8W C;  5B31 C;  5AV5 D;  3AFA C;  5AVC C;  4WNN B;  4H9O B;  5B32 C;  1HQ3 D;  2NZD C;  3AZG A;  2CV5 D;  4Z66 C;  4G91 C;  3B6F A;  4NE3 A;  1P3O C;  3X1S B;  3UTB A;  4WU8 C;  3B6G D;  4H9S A;  3AZM A;  3REI D;  1BH8 A;  4G92 B;  2F8N K;  1BH9 A;  5GSU B;  5B33 B;  1KX4 A;  3REH C;  4ZBJ C;  2F8N B;  3B6F D;  5B2J D;  3UTA A;  3KUY A;  4EO5 C;  5GT0 C;  5AV6 C;  2BYK A;  1H3O B;  3AZH B;  3NQU A;  3TU4 D;  4LD9 B;  2IO5 B;  1KX4 D;  3AZJ A;  4ZUX A;  4J8U A;  3MGS B;  1P3L A;  3LZ0 B;  1U35 B;  5C3I B;  3AZE A;  3VH5 W;  5CP6 C;  1M19 A;  2YFV A;  4KHA B;  2FJ7 B;  4YM6 C;  3W99 C;  3AYW B;  3REK C;  4XZQ D;  1F66 A;  1P3B D;  3WTP E;  4ZUX D;  3AZJ D;  1P3I A;  4H9N A;  4QLC D;  4M6B A;  2YFW A;  4J8U D;  3X1T C;  1P3L D;  5CPK D;  1P3K C;  5G49 B;  2RVQ D;  3W96 C;  5B1M B;  5CPI C;  3REJ B;  3AZE D;  1M19 D;  1ID3 A;  5E5A A;  3A6N B;  3LJA B;  5B31 G;  1P3F A;  4KGC D;  1WWS A;  1F66 D;  4Z5T A;  4DRA A;  5DNM A;  3MGQ D;  1Q9C A;  4NE5 A;  5AV5 B;  1P3A B;  5BS7 C;  5E5A D;  3KWQ A;  3X1S C;  4Z5T D;  3AZI A;  4Z2M G;  5CPJ B;  2CV5 B;  3MGP A;  1EQZ A;  5B33 C;  1N1J B;  5GSU C;  2BYM B;  1KX5 D;  1KX3 D;  5JA4 B;  3B6G B;  1TAF A;  2L5A A;  5DNN D;  3REI B;  1P3M B;  5B40 D;  3AZH C;  3AZN B;  3AZF A;  3MGP D;  2IO5 C;  3R45 B;  4NE6 A;  1EQZ D;  5AV9 A;  4G91 B;  3B6F B;  1TZY D;  3MGS C;  5B2J B;  3O62 C;  5C3I C;  1AOI A;  3WA9 B;  2FJ7 C;  3TU4 B;  3LEL A;  2NQB C;  5AVB C;  3AZF D;  5BT1 D;  3AYW C;  1KX4 B;  5AV8 A;  4Z2M H;  5B1M C;  2BYK B;  3VH5 T;  3REJ C;  3WKJ A;  3MVD D;  3AV2 B;  3A6N C;  3LJA C;  3AZL A;  4XZQ B;  5B0Y D;  1P3B B;  2HIO A;  4ZUX B;  4QLC B;  5B0Z A;  4J8X D;  1S32 A;  5CPK B;  5AV8 D;  1M19 B;  2YFV B;  5AV5 C;  3WKJ D;  3AN2 A;  5FUG A;  1P34 D;  4YS3 D;  3X1V A;  4KGC B;  3AZL D;  1F66 B;  5B1L A;  3MGQ B;  1ZLA D;  3C1B A;  4H9N B;  1HQ3 C;  5GXQ B;  5B0Z D;  2CV5 C;  3KXB D;  5E5A B;  3UT9 A;  3X1V D;  2ARO B;  3B6G C;  1BFM A;  5B1L D;  3REI C;  1P3M C;  3AZN C;  1P3P A;  1KX5 B;  2PYO A;  1KX3 B;  3B6F C;  3AV1 A;  3UT9 D;  5B2J C;  4R8P A;  3LZ1 A;  4XUJ B;  5DNN B;  5JRG B;  3VH5 A;  3WA9 C;  5F99 A;  5B40 B;  3W97 A;  3W98 A;  3TU4 C;  4H9Q A;  4J8V A;  5GT3 A;  4JJN A;  1M18 A;  5BNX B;  3AZG D;  1EQZ B;  1KX4 C;  5B31 A;  1P3P D;  3NQJ B;  2PYO D;  1TZY B;  5AVC A;  5B24 A;  4R8P D;  3UTB D;  3WAA B;  3AZM D;  2NZD A;  4UUZ B;  3AV2 C;  3W98 D;  1HTA A;  4J8V D;  5GT3 D;  4JJN D;  4XZQ C;  4Z66 A;  1P3B C;  5B31 D;  4ZUX C;  4QLC C;  4J8U C;  5AVC D;  5B24 D;  1P3O A;  1P3L C;  4WU8 A;  4H9R A;  3C1C A;  3O62 B;  5CPK C;  2RVQ C;  3UTA D;  3KUY D;  3MGR B;  1P3G B;  4CSR A;  3MVD B;  1M19 C;  4H9P B;  2NQB B;  5AVB B;  3REL B;  5B0Y B;  4KGC C;  4Z66 D;  1F66 C;  3REH A;  5BO0 B;  3MGQ C;  4J8X B;  4E44 A;  5GXQ C;  3C1C D;  4WU8 D;  3WKJ B;  1P34 B;  4YS3 B;  3MNN B;  5E5A C;  1M1A A;  4WU9 A;  1JFI A;  3X1U A;  2ARO C;  3AZK B;  3B0C W;  1ZLA B;  4Z5T C;  3B0D B;  1P3I D;  3KXB B;  5CP6 A;  5B32 G;  3KSY A;  1KX5 C;  5KDM B;  4YM6 A;  1KX3 C;  3X1V B;  1ID3 D;  3REK A;  1M1A D;  5AY8 A;  4WU9 D;  3X1U D;  1P3F D;  5B1L B;  5BNV A;  5DNN C;  5JRG C;  4XUJ C;  5B40 C;  3X1T A;  1HQ3 B;  5DNM D;  1P3K A;  4CAY A;  3W96 A;  5CP6 D;  1EQZ C;  1TZY C;  3UT9 B;  3KWQ D;  5AY8 D;  3WAA C;  3X1T D;  3AZI D;  5BT1 C;  3AZG B;  1P3K D;  1P3P B;  3WTP A;  3W96 D;  2PYO B;  5BS7 A;  4R8P B;  3UTB B;  3AZM B;  3MGR C;  1P3G C;  3MVD C;  3W98 B;  4H9Q B;  1BH8 B;  1A7W A;  4JJN B;  5B33 A;  5B0Y C;  3REL C;  1BH9 B;  3WTP D;  3B0B A;  5AV9 D;  4J8X C;  3UTA B;  3KUY B;  1H3O A;  1AOI D;  3WKJ C;  1P34 C;  4YS3 C;  4LD9 A;  3NQU B;  3MNN C;  3LEL D;  3AZK C;  1ZLA C;  3AZJ B;  3MGS A;  3LZ0 A;  4J8U B;  3B0D C;  5B0Z C;  1U35 A;  1P3L B;  4HGA B;  3KXB C;  3AZE B;  2FJ7 A;  4KHA A;  4CSR B;  3V9R A;  3X1V C;  4LD9 D;  2HUE B;  3AYW A;  5B1L C;  3B0C T;  2HIO D;  1P3I B;  3MGS D;  3LZ0 D;  2YFW B;  4DRB A;  4X23 A;  1U35 D;  5G49 A;  1S32 D;  5B1M A;  3LJA A;  1ID3 B;  3AN2 D;  3UT9 C;  1M1A B;  4WU9 B;  3X1U B;  1P3F B;  2F8N G;  4Z5T B;  5DNM B;  3C1B D;  4X23 D;  3AZG C;  1P3A A;  5B1M D;  1P3P C;  4KUD A;  2PYO C;  3LJA D;  1B6W A;  5B2I A;  3KWQ B;  4R8P C;  3UTB C;  4H9S C;  3AZM C;  5CPJ A;  1KU5 A;  1ULY A;  3AZI B;  3W98 C;  2CV5 A;  4JJN C;  4J8W A;  1N1J A;  3MGP B;  2CWE A;  2BYM A;  1P3A D;  4KUD D;  3AFA A;  1B67 A;  5B24 C;  5JA4 A;  5B2I D;  3B6G A;  3AV1 D;  1TAF B;  3LZ1 D;  3KUY C;  3REI A;  3UTA C;  1P3M A;  5B32 A;  5CPJ D;  3AZN A;  5F99 D;  3W97 D;  3AZF B;  3R45 A;  3WTP B;  1M18 D;  4J8W D;  5AV9 B;  3AFA D;  3AZJ C;  5B2J A;  2F8N H;  3VH6 W;  3C1C C;  4HGA C;  3WA9 A;  1AOI B;  3AZE C;  3TU4 A;  1P3M D;  5B32 D;  3LEL B;  3AZN D;  2NZD D;  2HUE C;  1P3I C;  1P3O D;  5GT0 A;  5AV8 B;  5AV6 A;  3WA9 D;  4NFT A;  3AV2 A;  1ID3 C;  4XZQ A;  3AZL B;  4AWL B;  4WU9 C;  1P3B A;  3X1U C;  1P3F C;  1M1A C;  4QLC A;  2HIO B;  3REH D;  5DNM C;  5CPK A;  5B0Z B;  1S32 B;  5GT0 D;  5AV6 D;  3AV2 D;  3V9R B;  3AN2 B;  1F1E A;  5FUG B;  4KGC A;  3W99 A;  3KWQ C;  5AY8 C;  3MGQ A;  3C1B B;  5GXQ A;  3AZI C;  4X23 B;  5CPI A;  3MGP C;  4YM6 D;  2ARO A;  4WNN A;  3W99 D;  3REK D;  4H9O A;  5GXQ D;  3AZF C;  3WTP C;  5CPI D;  1KX5 A;  4KUD B;  1KX3 A;  5AV9 C;  5B2I B;  3AV1 B;  3X1S A;  2ARO D;  4XUJ A;  3LZ1 B;  5DNN A;  4E45 A;  5JRG A;  2JSS A;  1AOI C;  5B40 A;  4WV4 B;  5F99 B;  3W97 B; 
#chains in the Genus database with same CATH topology
 4J8V B;  3LEL C;  5GT3 B;  4G92 C;  5BNX A;  1M18 B;  4J8W B;  5GSU A;  3NQJ A;  5B31 B;  3AFA B;  1TZY A;  5AVC B;  5B24 B;  2F8N A;  3VH6 T;  3X1S D;  4XUJ D;  5AV8 C;  3WAA A;  5JRG D;  4UUZ A;  5B32 B;  3AZH A;  2NZD B;  4LD9 C;  3H0M C;  4AWL C;  3AZL C;  4Z66 B;  5B33 D;  5GSU D;  1WWI A;  2HIO C;  2Y2K A;  3LZ0 C;  1P3O B;  2F8N D;  3O62 A;  1U35 C;  4WU8 B;  4H9R B;  3C1C B;  1S32 C;  3MGR A;  1P3G A;  3MVD A;  3WAA D;  4H9P A;  2NQB A;  3AZH D;  5AVB A;  3AN2 C;  3REL A;  5B0Y A;  2Y2P A;  5BO0 A;  3REH B;  1PZR A;  4ZBJ B;  2Y2J A;  4J8X A;  3C1B C;  4WZS B;  4X23 C;  3O62 D;  4EO5 B;  5GT0 B;  5AV6 B;  1T3U A;  3REJ A;  3MGR D;  1P3G D;  1P34 A;  4YS3 A;  2FJ7 D;  3MNN A;  3A6N A;  2NQB D;  5AVB D;  1R4V A;  3REL D;  3AZK A;  1JFI B;  3AYW D;  1ZLA A;  2LY8 A;  3KXB A;  5CP6 B;  1P3A C;  5AV5 A;  5KDM A;  4KUD C;  3REJ D;  4YM6 B;  3MNN D;  3A6N D;  5CHL B;  5B2I C;  3W99 B;  3VH6 A;  3REK B;  3AV1 C;  3AZK D;  3LZ1 C;  5AY8 B;  5BNV B;  5CPJ C;  1HQ3 A;  5F99 C;  3X1T B;  3W97 C;  2Y2M A;  4J8V C;  5GT3 C;  3H0R C;  1P3K B;  4CAY B;  5CPI B;  3W96 B;  1M18 C;  4J8W C;  5B31 C;  5AV5 D;  3AFA C;  5AVC C;  4WNN B;  2F2A C;  4H9O B;  5B32 C;  1HQ3 D;  2NZD C;  3AZG A;  2CV5 D;  4Z66 C;  4G91 C;  3B6F A;  4NE3 A;  1P3O C;  3X1S B;  3UTB A;  4WU8 C;  3B6G D;  2Y2N A;  4H9S A;  3AZM A;  3REI D;  1BH8 A;  4G92 B;  2F8N K;  1BH9 A;  5GSU B;  5B33 B;  1KX4 A;  4WJ3 C;  3REH C;  4ZBJ C;  2F8N B;  3B6F D;  5B2J D;  3UTA A;  3KUY A;  4EO5 C;  5GT0 C;  5AV6 C;  2BYK A;  1H3O B;  3EG5 B;  3AZH B;  3NQU A;  3TU4 D;  4LD9 B;  2J8P A;  2IO5 B;  1KX4 D;  3AZJ A;  4ZUX A;  4J8U A;  3MGS B;  1P3L A;  3LZ0 B;  1U35 B;  5C3I B;  3AZE A;  3VH5 W;  5CP6 C;  1M19 A;  2YFV A;  4KHA B;  2FJ7 B;  4YM6 C;  3W99 C;  3AYW B;  3REK C;  4XZQ D;  1F66 A;  1P3B D;  3WTP E;  4ZUX D;  3AZJ D;  1P3I A;  4H9N A;  4QLC D;  4M6B A;  2YFW A;  3A1I A;  4J8U D;  3X1T C;  3A1K A;  1P3L D;  5CPK D;  1P3K C;  5G49 B;  2RVQ D;  3W96 C;  5B1M B;  5CPI C;  3F6T A;  3REJ B;  3AZE D;  1M19 D;  1ID3 A;  5E5A A;  3A6N B;  3LJA B;  5B31 G;  1P3F A;  4KGC D;  1WWS A;  3EPL A;  1F66 D;  4Z5T A;  4DRA A;  5DNM A;  3MGQ D;  1Q9C A;  2G5H C;  3IP4 C;  4NE5 A;  5AV5 B;  1P3A B;  5BS7 C;  5E5A D;  3KWQ A;  3X1S C;  4Z5T D;  3AZI A;  4Z2M G;  5CPJ B;  2CV5 B;  3MGP A;  1EQZ A;  5B33 C;  1N1J B;  5GSU C;  2BYM B;  1KX5 D;  3EPH A;  1KX3 D;  5JA4 B;  3B6G B;  1TAF A;  2L5A A;  5DNN D;  3REI B;  1P3M B;  5B40 D;  3AZH C;  3AZN B;  3AZF A;  3MGP D;  2IO5 C;  3R45 B;  4NE6 A;  1EQZ D;  5AV9 A;  4G91 B;  3B6F B;  1TZY D;  3MGS C;  5B2J B;  3O62 C;  5C3I C;  1AOI A;  3WA9 B;  2FJ7 C;  3TU4 B;  3LEL A;  2NQB C;  2Y2I A;  5AVB C;  3AZF D;  5BT1 D;  3AYW C;  1KX4 B;  2ZM5 A;  2Y2H A;  5AV8 A;  4Z2M H;  2DQN C;  5B1M C;  2BYK B;  3VH5 T;  3REJ C;  3WKJ A;  3MVD D;  3AV2 B;  3A6N C;  3LJA C;  3AZL A;  4XZQ B;  5B0Y D;  1P3B B;  2HIO A;  4ZUX B;  4QLC B;  5B0Z A;  4J8X D;  1S32 A;  5CPK B;  5AV8 D;  1M19 B;  2YFV B;  5AV5 C;  3WKJ D;  3AN2 A;  5FUG A;  1P34 D;  4YS3 D;  3X1V A;  4KGC B;  3AZL D;  1F66 B;  5B1L A;  3MGQ B;  1ZLA D;  3C1B A;  4H9N B;  1HQ3 C;  5GXQ B;  2Y2G A;  2Y2O A;  5B0Z D;  2CV5 C;  3KXB D;  5E5A B;  3UT9 A;  3X1V D;  2ARO B;  3B6G C;  1BFM A;  5B1L D;  3REI C;  1P3M C;  3FDD A;  3AZN C;  1P3P A;  1KX5 B;  2PYO A;  1KX3 B;  3B6F C;  2JE5 A;  3AV1 A;  3UT9 D;  5B2J C;  4R8P A;  3LZ1 A;  2ZY5 A;  4XUJ B;  5DNN B;  5JRG B;  3VH5 A;  3WA9 C;  5F99 A;  5B40 B;  3W97 A;  3W98 A;  3TU4 C;  4H9Q A;  4J8V A;  5GT3 A;  4JJN A;  1M18 A;  5BNX B;  3AZG D;  1EQZ B;  1KX4 C;  5B31 A;  1P3P D;  3NQJ B;  2PYO D;  1TZY B;  5AVC A;  5B24 A;  4R8P D;  3UTB D;  3WAA B;  3AZM D;  2NZD A;  4UUZ B;  3AV2 C;  3W98 D;  1HTA A;  4J8V D;  5GT3 D;  4JJN D;  4XZQ C;  4Z66 A;  1P3B C;  5B31 D;  3P5J B;  4ZUX C;  4QLC C;  4J8U C;  5AVC D;  5B24 D;  1P3O A;  1P3L C;  4WU8 A;  4H9R A;  3C1C A;  3O62 B;  5CPK C;  2RVQ C;  3UTA D;  3KUY D;  3MGR B;  1P3G B;  4CSR A;  3MVD B;  1M19 C;  4H9P B;  2NQB B;  2BG1 A;  2G5I C;  5AVB B;  3REL B;  5B0Y B;  4KGC C;  4Z66 D;  1F66 C;  3REH A;  5BO0 B;  3MGQ C;  2RIQ A;  4J8X B;  4E44 A;  5GXQ C;  3C1C D;  4WU8 D;  3WKJ B;  1P34 B;  4YS3 B;  3MNN B;  5E5A C;  1M1A A;  4WU9 A;  1JFI A;  3X1U A;  2ARO C;  3AZK B;  3B0C W;  1ZLA B;  4Z5T C;  3B0D B;  1P3I D;  3KXB B;  5CP6 A;  5B32 G;  3KSY A;  2UWX A;  5KDM B;  4YM6 A;  1KX5 C;  1KX3 C;  3X1V B;  1ID3 D;  3REK A;  1M1A D;  5AY8 A;  4WU9 D;  3X1U D;  1P3F D;  5B1L B;  5BNV A;  5DNN C;  5JRG C;  4XUJ C;  5B40 C;  3X1T A;  1HQ3 B;  5DNM D;  1P3K A;  4CAY A;  3W96 A;  5CP6 D;  1EQZ C;  1TZY C;  3UT9 B;  3KWQ D;  5AY8 D;  3KFU G;  3WAA C;  3X1T D;  3AZI D;  5BT1 C;  3AZG B;  1P3K D;  1P3P B;  3WTP A;  3W96 D;  2PYO B;  5BS7 A;  4R8P B;  3UTB B;  3AZM B;  3MGR C;  1P3G C;  3MVD C;  3W98 B;  4H9Q B;  1BH8 B;  1A7W A;  4JJN B;  5B33 A;  5B0Y C;  3REL C;  1BH9 B;  3WTP D;  3B0B A;  5AV9 D;  4J8X C;  3UTA B;  3KUY B;  1H3O A;  1AOI D;  3WKJ C;  1P34 C;  4YS3 C;  4LD9 A;  3NQU B;  3MNN C;  3LEL D;  3H0L C;  3AZK C;  1ZLA C;  3AZJ B;  2ZY2 A;  3MGS A;  3LZ0 A;  4J8U B;  3B0D C;  5B0Z C;  1U35 A;  1P3L B;  4HGA B;  3KXB C;  2Y2L A;  3AZE B;  2FJ7 A;  4KHA A;  4CSR B;  3V9R A;  3X1V C;  4LD9 D;  2HUE B;  2JCH A;  3AYW A;  5B1L C;  3B0C T;  2HIO D;  1P3I B;  3MGS D;  3LZ0 D;  2YFW B;  4DRB A;  4X23 A;  1U35 D;  5G49 A;  1S32 D;  5B1M A;  3LJA A;  1ID3 B;  3AN2 D;  3UT9 C;  1M1A B;  4WU9 B;  3X1U B;  1P3F B;  2F8N G;  4Z5T B;  5DNM B;  3C1B D;  4X23 D;  3AZG C;  1P3A A;  5B1M D;  1P3P C;  4KUD A;  2XD5 A;  2PYO C;  2XD1 A;  3LJA D;  1B6W A;  2ZY3 A;  5B2I A;  3KWQ B;  4R8P C;  3UTB C;  4H9S C;  3AZM C;  5CPJ A;  1KU5 A;  1ULY A;  3AZI B;  3W98 C;  2CV5 A;  4JJN C;  4J8W A;  1N1J A;  3MGP B;  2CWE A;  2BYM A;  1P3A D;  4KUD D;  3AFA A;  1B67 A;  5B24 C;  5JA4 A;  5B2I D;  3B6G A;  3AV1 D;  1TAF B;  3LZ1 D;  3KUY C;  3REI A;  3UTA C;  1P3M A;  5B32 A;  5CPJ D;  3AZN A;  5F99 D;  3W97 D;  3AZF B;  3R45 A;  3WTP B;  4DQY B;  1M18 D;  4J8W D;  5AV9 B;  2FFF B;  3AFA D;  3AZJ C;  5B2J A;  2F8N H;  3VH6 W;  3C1C C;  4HGA C;  3EPK A;  3WA9 A;  1AOI B;  3AZE C;  3TU4 A;  1P3M D;  2W8S A;  5B32 D;  3LEL B;  3AZN D;  2NZD D;  2HUE C;  1P3I C;  1P3O D;  1Z2C B;  5GT0 A;  5AV8 B;  5AV6 A;  3WA9 D;  4NFT A;  3AV2 A;  2VQR A;  1ID3 C;  4XZQ A;  3AZL B;  4AWL B;  4WU9 C;  1P3B A;  3X1U C;  1P3F C;  1M1A C;  4UPK A;  4QLC A;  2HIO B;  3REH D;  5DNM C;  5CPK A;  5B0Z B;  1S32 B;  5GT0 D;  5AV6 D;  3AV2 D;  3V9R B;  3AN2 B;  1F1E A;  5FUG B;  4KGC A;  3W99 A;  3KWQ C;  5AY8 C;  3MGQ A;  3C1B B;  5GXQ A;  3AZI C;  2Y2Q A;  4X23 B;  5CPI A;  3MGP C;  4YM6 D;  2ARO A;  4WNN A;  3W99 D;  2ZY4 A;  3REK D;  4H9O A;  1W2E A;  5GXQ D;  3AZF C;  2DF4 C;  3WTP C;  5CPI D;  1KX5 A;  4KUD B;  1KX3 A;  5AV9 C;  5B2I B;  3EPJ A;  3X1S A;  2ARO D;  4XUJ A;  3LZ1 B;  5DNN A;  4E45 A;  5JRG A;  3AV1 B;  3AL0 C;  2JSS A;  1AOI C;  5B40 A;  4WV4 B;  5F99 B;  3W97 B; 
#chains in the Genus database with same CATH homology
 4J8V B;  3LEL C;  5GT3 B;  4G92 C;  5BNX A;  1M18 B;  4J8W B;  5GSU A;  3NQJ A;  5B31 B;  3AFA B;  1TZY A;  5AVC B;  5B24 B;  2F8N A;  3VH6 T;  3X1S D;  4XUJ D;  5AV8 C;  3WAA A;  5JRG D;  4UUZ A;  5B32 B;  3AZH A;  2NZD B;  4LD9 C;  3H0M C;  4AWL C;  3AZL C;  4Z66 B;  5B33 D;  5GSU D;  1WWI A;  2HIO C;  2Y2K A;  3LZ0 C;  1P3O B;  2F8N D;  3O62 A;  1U35 C;  4WU8 B;  4H9R B;  3C1C B;  1S32 C;  3MGR A;  1P3G A;  3MVD A;  3WAA D;  4H9P A;  2NQB A;  3AZH D;  5AVB A;  3AN2 C;  3REL A;  5B0Y A;  2Y2P A;  5BO0 A;  3REH B;  1PZR A;  4ZBJ B;  2Y2J A;  4J8X A;  3C1B C;  4WZS B;  4X23 C;  3O62 D;  4EO5 B;  5GT0 B;  5AV6 B;  1T3U A;  3REJ A;  3MGR D;  1P3G D;  1P34 A;  4YS3 A;  2FJ7 D;  3MNN A;  3A6N A;  2NQB D;  5AVB D;  1R4V A;  3REL D;  3AZK A;  1JFI B;  3AYW D;  1ZLA A;  2LY8 A;  3KXB A;  5CP6 B;  1P3A C;  5AV5 A;  5KDM A;  4KUD C;  3REJ D;  4YM6 B;  3MNN D;  3A6N D;  5CHL B;  5B2I C;  3W99 B;  3VH6 A;  3REK B;  3AV1 C;  3AZK D;  3LZ1 C;  5AY8 B;  5BNV B;  5CPJ C;  1HQ3 A;  5F99 C;  3X1T B;  3W97 C;  2Y2M A;  4J8V C;  5GT3 C;  3H0R C;  1P3K B;  4CAY B;  5CPI B;  3W96 B;  1M18 C;  4J8W C;  5B31 C;  5AV5 D;  3AFA C;  5AVC C;  4WNN B;  2F2A C;  4H9O B;  5B32 C;  1HQ3 D;  2NZD C;  3AZG A;  2CV5 D;  4Z66 C;  4G91 C;  3B6F A;  4NE3 A;  1P3O C;  3X1S B;  3UTB A;  4WU8 C;  3B6G D;  2Y2N A;  4H9S A;  3AZM A;  3REI D;  1BH8 A;  4G92 B;  2F8N K;  1BH9 A;  5GSU B;  5B33 B;  1KX4 A;  4WJ3 C;  3REH C;  4ZBJ C;  2F8N B;  3B6F D;  5B2J D;  3UTA A;  3KUY A;  4EO5 C;  5GT0 C;  5AV6 C;  2BYK A;  1H3O B;  3EG5 B;  3AZH B;  3NQU A;  3TU4 D;  4LD9 B;  2J8P A;  2IO5 B;  1KX4 D;  3AZJ A;  4ZUX A;  4J8U A;  3MGS B;  1P3L A;  3LZ0 B;  1U35 B;  5C3I B;  3AZE A;  3VH5 W;  5CP6 C;  1M19 A;  2YFV A;  4KHA B;  2FJ7 B;  4YM6 C;  3W99 C;  3AYW B;  3REK C;  4XZQ D;  1F66 A;  1P3B D;  3WTP E;  4ZUX D;  3AZJ D;  1P3I A;  4H9N A;  4QLC D;  4M6B A;  2YFW A;  3A1I A;  4J8U D;  3X1T C;  3A1K A;  1P3L D;  5CPK D;  1P3K C;  5G49 B;  2RVQ D;  3W96 C;  5B1M B;  5CPI C;  3F6T A;  3REJ B;  3AZE D;  1M19 D;  1ID3 A;  5E5A A;  3A6N B;  3LJA B;  5B31 G;  1P3F A;  4KGC D;  1WWS A;  3EPL A;  1F66 D;  4Z5T A;  4DRA A;  5DNM A;  3MGQ D;  1Q9C A;  2G5H C;  3IP4 C;  4NE5 A;  5AV5 B;  1P3A B;  5BS7 C;  5E5A D;  3KWQ A;  3X1S C;  4Z5T D;  3AZI A;  4Z2M G;  5CPJ B;  2CV5 B;  3MGP A;  1EQZ A;  5B33 C;  1N1J B;  5GSU C;  2BYM B;  1KX5 D;  3EPH A;  1KX3 D;  5JA4 B;  3B6G B;  1TAF A;  2L5A A;  5DNN D;  3REI B;  1P3M B;  5B40 D;  3AZH C;  3AZN B;  3AZF A;  3MGP D;  2IO5 C;  3R45 B;  4NE6 A;  1EQZ D;  5AV9 A;  4G91 B;  3B6F B;  1TZY D;  3MGS C;  5B2J B;  3O62 C;  5C3I C;  1AOI A;  3WA9 B;  2FJ7 C;  3TU4 B;  3LEL A;  2NQB C;  2Y2I A;  5AVB C;  3AZF D;  5BT1 D;  3AYW C;  1KX4 B;  2ZM5 A;  2Y2H A;  5AV8 A;  4Z2M H;  2DQN C;  5B1M C;  2BYK B;  3VH5 T;  3REJ C;  3WKJ A;  3MVD D;  3AV2 B;  3A6N C;  3LJA C;  3AZL A;  4XZQ B;  5B0Y D;  1P3B B;  2HIO A;  4ZUX B;  4QLC B;  5B0Z A;  4J8X D;  1S32 A;  5CPK B;  5AV8 D;  1M19 B;  2YFV B;  5AV5 C;  3WKJ D;  3AN2 A;  5FUG A;  1P34 D;  4YS3 D;  3X1V A;  4KGC B;  3AZL D;  1F66 B;  5B1L A;  3MGQ B;  1ZLA D;  3C1B A;  4H9N B;  1HQ3 C;  5GXQ B;  2Y2G A;  2Y2O A;  5B0Z D;  2CV5 C;  3KXB D;  5E5A B;  3UT9 A;  3X1V D;  2ARO B;  3B6G C;  1BFM A;  5B1L D;  3REI C;  1P3M C;  3FDD A;  3AZN C;  1P3P A;  1KX5 B;  2PYO A;  1KX3 B;  3B6F C;  2JE5 A;  3AV1 A;  3UT9 D;  5B2J C;  4R8P A;  3LZ1 A;  2ZY5 A;  4XUJ B;  5DNN B;  5JRG B;  3VH5 A;  3WA9 C;  5F99 A;  5B40 B;  3W97 A;  3W98 A;  3TU4 C;  4H9Q A;  4J8V A;  5GT3 A;  4JJN A;  1M18 A;  5BNX B;  3AZG D;  1EQZ B;  1KX4 C;  5B31 A;  1P3P D;  3NQJ B;  2PYO D;  1TZY B;  5AVC A;  5B24 A;  4R8P D;  3UTB D;  3WAA B;  3AZM D;  2NZD A;  4UUZ B;  3AV2 C;  3W98 D;  1HTA A;  4J8V D;  5GT3 D;  4JJN D;  4XZQ C;  4Z66 A;  1P3B C;  5B31 D;  3P5J B;  4ZUX C;  4QLC C;  4J8U C;  5AVC D;  5B24 D;  1P3O A;  1P3L C;  4WU8 A;  4H9R A;  3C1C A;  3O62 B;  5CPK C;  2RVQ C;  3UTA D;  3KUY D;  3MGR B;  1P3G B;  4CSR A;  3MVD B;  1M19 C;  4H9P B;  2NQB B;  2BG1 A;  2G5I C;  5AVB B;  3REL B;  5B0Y B;  4KGC C;  4Z66 D;  1F66 C;  3REH A;  5BO0 B;  3MGQ C;  2RIQ A;  4J8X B;  4E44 A;  5GXQ C;  3C1C D;  4WU8 D;  3WKJ B;  1P34 B;  4YS3 B;  3MNN B;  5E5A C;  1M1A A;  4WU9 A;  1JFI A;  3X1U A;  2ARO C;  3AZK B;  3B0C W;  1ZLA B;  4Z5T C;  3B0D B;  1P3I D;  3KXB B;  5CP6 A;  5B32 G;  3KSY A;  2UWX A;  5KDM B;  4YM6 A;  1KX5 C;  1KX3 C;  3X1V B;  1ID3 D;  3REK A;  1M1A D;  5AY8 A;  4WU9 D;  3X1U D;  1P3F D;  5B1L B;  5BNV A;  5DNN C;  5JRG C;  4XUJ C;  5B40 C;  3X1T A;  1HQ3 B;  5DNM D;  1P3K A;  4CAY A;  3W96 A;  5CP6 D;  1EQZ C;  1TZY C;  3UT9 B;  3KWQ D;  5AY8 D;  3KFU G;  3WAA C;  3X1T D;  3AZI D;  5BT1 C;  3AZG B;  1P3K D;  1P3P B;  3WTP A;  3W96 D;  2PYO B;  5BS7 A;  4R8P B;  3UTB B;  3AZM B;  3MGR C;  1P3G C;  3MVD C;  3W98 B;  4H9Q B;  1BH8 B;  1A7W A;  4JJN B;  5B33 A;  5B0Y C;  3REL C;  1BH9 B;  3WTP D;  3B0B A;  5AV9 D;  4J8X C;  3UTA B;  3KUY B;  1H3O A;  1AOI D;  3WKJ C;  1P34 C;  4YS3 C;  4LD9 A;  3NQU B;  3MNN C;  3LEL D;  3H0L C;  3AZK C;  1ZLA C;  3AZJ B;  2ZY2 A;  3MGS A;  3LZ0 A;  4J8U B;  3B0D C;  5B0Z C;  1U35 A;  1P3L B;  4HGA B;  3KXB C;  2Y2L A;  3AZE B;  2FJ7 A;  4KHA A;  4CSR B;  3V9R A;  3X1V C;  4LD9 D;  2HUE B;  2JCH A;  3AYW A;  5B1L C;  3B0C T;  2HIO D;  1P3I B;  3MGS D;  3LZ0 D;  2YFW B;  4DRB A;  4X23 A;  1U35 D;  5G49 A;  1S32 D;  5B1M A;  3LJA A;  1ID3 B;  3AN2 D;  3UT9 C;  1M1A B;  4WU9 B;  3X1U B;  1P3F B;  2F8N G;  4Z5T B;  5DNM B;  3C1B D;  4X23 D;  3AZG C;  1P3A A;  5B1M D;  1P3P C;  4KUD A;  2XD5 A;  2PYO C;  2XD1 A;  3LJA D;  1B6W A;  2ZY3 A;  5B2I A;  3KWQ B;  4R8P C;  3UTB C;  4H9S C;  3AZM C;  5CPJ A;  1KU5 A;  1ULY A;  3AZI B;  3W98 C;  2CV5 A;  4JJN C;  4J8W A;  1N1J A;  3MGP B;  2CWE A;  2BYM A;  1P3A D;  4KUD D;  3AFA A;  1B67 A;  5B24 C;  5JA4 A;  5B2I D;  3B6G A;  3AV1 D;  1TAF B;  3LZ1 D;  3KUY C;  3REI A;  3UTA C;  1P3M A;  5B32 A;  5CPJ D;  3AZN A;  5F99 D;  3W97 D;  3AZF B;  3R45 A;  3WTP B;  4DQY B;  1M18 D;  4J8W D;  5AV9 B;  2FFF B;  3AFA D;  3AZJ C;  5B2J A;  2F8N H;  3VH6 W;  3C1C C;  4HGA C;  3EPK A;  3WA9 A;  1AOI B;  3AZE C;  3TU4 A;  1P3M D;  2W8S A;  5B32 D;  3LEL B;  3AZN D;  2NZD D;  2HUE C;  1P3I C;  1P3O D;  1Z2C B;  5GT0 A;  5AV8 B;  5AV6 A;  3WA9 D;  4NFT A;  3AV2 A;  2VQR A;  1ID3 C;  4XZQ A;  3AZL B;  4AWL B;  4WU9 C;  1P3B A;  3X1U C;  1P3F C;  1M1A C;  4UPK A;  4QLC A;  2HIO B;  3REH D;  5DNM C;  5CPK A;  5B0Z B;  1S32 B;  5GT0 D;  5AV6 D;  3AV2 D;  3V9R B;  3AN2 B;  1F1E A;  5FUG B;  4KGC A;  3W99 A;  3KWQ C;  5AY8 C;  3MGQ A;  3C1B B;  5GXQ A;  3AZI C;  2Y2Q A;  4X23 B;  5CPI A;  3MGP C;  4YM6 D;  2ARO A;  4WNN A;  3W99 D;  2ZY4 A;  3REK D;  4H9O A;  1W2E A;  5GXQ D;  3AZF C;  2DF4 C;  3WTP C;  5CPI D;  1KX5 A;  4KUD B;  1KX3 A;  5AV9 C;  5B2I B;  3EPJ A;  3X1S A;  2ARO D;  4XUJ A;  3LZ1 B;  5DNN A;  4E45 A;  5JRG A;  3AV1 B;  3AL0 C;  2JSS A;  1AOI C;  5B40 A;  4WV4 B;  5F99 B;  3W97 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...