5AY8D

Crystal structure of human nucleosome containing h3.y
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H3.Y
publication title Structure and function of human histone H3.Y nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 36
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ay8D00
4WV4B 3AZNC 5CPJC 3AZGC 5B2JC 3X1UC 3MGPC 3REJD 5B0ZD 4KUDC 4YM6B 5AVCB 4J8VB 1ZLAC 3C1CB 5GT0C 3AYWD 5B0YC 3AN2C 1EQZA 3WKJA 1S32A 5AV8B 4E44A 3AZED 1BH8B 1F66A 3B0CW 4H9RB 1P3PC 1N1JB 4ZBJB 4Z2MG 3TU4B 2F8ND 5AV9A 5GT3B 3A6ND 5DNMB 2F8NA 4EO5C 3A6NA 3UT9C 2HIOC 2FJ7C 5AY8C 5KDMB 5B24B 4DRAA 5B32B 1KX3D 3WA9C 4LD9D 5B40B 1KX3A 3AZIC 3W98C 3LJAD 3W99D 5BNVA 3LJAA 2NZDD 3X1TD 1P3GB 3W99A 3X1SB 3AFAC 3AV2B 3WAAA 4ZUXB 3O62C 2LY8A 3AV2C 3NQJB 3W96A 4X23B 4NE3A 3B6GB 4WNNB 4H9QB 3X1VB 1M18B 1P34A 3LZ0D 3C1BD 4AWLC 5CPID 4H9NA 4DRBA 1EQZC 3WKJC 3LZ0A 1P3BB 1S32C 5BNXA 5AV5A 3RELD 2BYMB 3MGRB 4J8XB 5AVBD 2IO5B 1F66C 5AVBA 4G91C 5DNNB 5JA4A 4YS3D 4WU8D 5AV9C 5AV6D 3B6FA 4WU8A 4QLCA 2F8NH 3MNND 1P3FD 1P3AD 3UTAB 1P3FA 5F99C 1P3AA 1BH9B 3KXBB 3MGQA 5C3IC 1P3OB 1P3MA 4KGCA 4R8PA 5B31D 4J8WD 3W99C 4J8WA 1P3OC 3VH6A 3WAAC 3UTBB 3KWQB 4WU9D 4XZQA 3W96C 3AZKB 3AZND 2NQBA 3AZGD 5B2JD 3X1UD 3AZNA 5G49A 3MGPD 3AZHA 4KUDD 1P34C 5B2JA 3KUYB 2RVQC 1ZLAD 1KX4A 1B6WA 3AN2D 5AV5C 4E45A 4YM6D 3KUYC 3AZJB 4YM6A 5AVCA 4J8VA 5AVBC 1P3KB 3AZJC 5CPKB 5AV8D 1P3PD 3NQUB 2BYKB 5AV8A 3B6FC 4WU8C 2CV5B 2YFVB 1BH8A 4QLCC 4H9RA 1N1JA 3UT9D 2FJ7D 3TU4A 5AY8D 1P3LB 3MGQC 5CHLB 5GT3A 5DNMA 3REHB 3MGSB 3WA9D 1U35B 1P3MC 3AZID 4R8PC 3W97B 3WA9A 3W98D 4KGCC 5B32D 5KDMA 5B24A 4J8WC 5B32A 5B40A 3AFAD 1HTAA 4XZQC 3O62D 2AROB 3AV2D 1M1AB 1P3GA 2NQBC 3X1SA 3AV2A 3B0BA 1Q9CA 3LELB 3AZHC 4ZUXA 5BT1C 5CP6B 3NQJA 1KX4C 4X23A 1KX5B 4NFTA 1EQZD 3WKJD 3B6GA 1S32D 4WNNA 4YM6C 5AVCC 4J8VC 4Z66B 4H9QA 3X1VA 1M18A 1F66D 3C1CC 1P3BA 5AV8C 1M19B 2BYMA 5B2IB 3MGRA 4J8XA 5AV9D 1ID3B 5DNND 3AZFB 5DNNA 1B67A 4ZBJC 1TZYB 3TU4C 5GT3C 5DNMC 5F99D 3VH6T 3AZLB 5F99A 5B1MB 3AV1B 3UTAA 5B24C 3AZLC 5B32C 3KXBD 5B40C 1BH9A 3KXBA 1P3OD 3AV1C 1P3OA 3WAAD 4Z5TB 3W96D 1P3GC 3X1SC 1F1EA 4ZUXC 3UTBA 3KWQA 4JJNB 3AZMB 5B1LB 4X23C 3MVDB 1P34D 3AZKA 3LZ1B 5GXQB 2RVQD 3VH5A 3B6GC 5BO0B 5AV5D 3X1VC 3KUYD 1M18C 3KUYA 1P3BC 3AZJD 4J8XC 3MGRC 2IO5C 3AZJA 1P3KD 3B6FD 5JRGB 1P3KA 5DNNC 4QLCD 3REJB 5B0ZB 5CPKA 3NQUA 2BYKA 4HGAB 5B33B 2CV5A 2YFVA 3AYWB 3MGQD 5BS7A 5B33C 3UTAC 1P3MD 4KGCD 4R8PD 1P3LA 3AZEB 3KXBC 3V9RB 3MGSA 3REHA 3W97D 1U35A 3W97A 4XZQD 1HQ3B 3UTBC 2NQBD 3KWQC 2CWEA 3AZHD 4H9OB 3AZKC 5BT1D 4LD9B 2AROA 2F8NG 3B0DB 1M1AA 1KX4D 3KSYA 3LELD 1TAFB 3LELA 5CP6D 2NZDB 5AVCD 4J8VD 3X1TB 5CP6A 1KX5A 3C1CD 3C1CA 4Z66A 1P3KC 5CPKC 1M19D 3TU4D 3REIB 2CV5C 1M19A 1AOIB 5B2IA 3C1BB 5GT3D 5DNMD 5CPIB 1ID3A 3AZFA 5BS7C 3REIC 1AOIC 3WTPE 3RELB 2HUEB 1TZYA 1P3LC 5B24D 3AZLD 3REHC 3MGSC 5B40D 3AZLA 4G92B 4XUJB 1U35C 3W97C 5B1MD 3AV1D 4YS3B 5B1MA 3AV1A 4M6BA 3R45B 4XUJC 5AV6B 1P3GD 3VH5T 3X1SD 3MNNB 5GSUB 4ZUXD 4Z5TD 2AROC 4CAYB 1M1AC 4Z5TA 4X23D 5GSUC 4UUZB 3LELC 5B31B 1H3OB 3B6GD 1WWSA 3WTPB 3MVDD 4JJNA 3AZMA 5CP6C 3X1VD 5B1LA 1M18D 3MVDA 1KX5C 3LZ1A 5GXQA 3B0CT 3WTPC 4WU9B 1P3BD 2L5AA 5BO0A 4J8UB 4Z66C 4J8XD 3MGRD 5B31G 4Z2MH 5CPJB 3AZGB 3X1UB 3MGPB 4KUDB 1M19C 5B2IC 5JRGD 1ID3C 1JFIB 3AZFC 1ZLAB 4KHAB 5JRGA 5GT0B 5B0YB 3AN2B 3REJA 1TZYC 5B0ZA 5B33D 3UTAD 1P3IB 5B33A 3AYWA 1P3PB 2YFWB 1P3IC 5B1MC 5FUGB 3REKB 3AZEA 4EO5B 2PYOB 3V9RA 3UT9B 3UTBD 2HIOB 3KWQD 3REKC 2FJ7B 5AY8B 4H9SA 4Z5TC 2PYOC 1HQ3D 4CSRB 3AZKD 3WA9B 1HQ3A 3AZIB 3W98B 4H9PB 5E5AB 4JJNC 3AZMC 5B1LC 4WZSB 3MVDC 3VH6W 4H9OA 3LZ1C 4LD9A 5GXQC 5E5AC 3AFAB 4NE5A 1TAFA 3O62B 2NZDA 5B32G 3X1TA 5CPKD 2CV5D 5JRGC 4AWLB 1EQZB 3WKJB 3REJC 5B0ZC 1S32B 3REID 1AOID 4HGAC 1WWIA 3REIA 1AOIA 1P3LD 1F66B 1ULYA 3C1BA 3AYWC 5CPIA 3REHD 3MGSD 4G91B 1U35D 3RELA 2JSSA 5AV9B 3AZEC 2F8NB 4XUJD 3A6NB 4XUJA 4YS3A 4H9SC 3A6NC 5AV6A 3R45A 5F99B 2AROD 1HQ3C 1KU5A 1M1AD 1KX3B 5C3IB 5GSUD 4NE6A 3MNNA 5GSUA 5BNVB 3LJAB 1KX3C 4LD9C 3B0DC 4CAYA 3W99B 1KX5D 3LJAC 3WAAB 4UUZA 3WTPD 5B31A 1H3OA 2NZDC 3WTPA 3X1TC 4Z66D 3W96B 4J8UD 4WU9A 4J8UA 1P34B 5B2ID 5CPJD 1ID3D 4H9NB 3AZFD 3LZ0B 5CPJA 3AZGA 5BNXB 3X1UA 5AV5B 1BFMA 3MGPA 4KUDA 1TZYD 3LZ0C 3C1BC 5GT0D 5CPIC 5AVBB 5B0YD 1JFIA 1ZLAA 4KHAA 5GT0A 5JA4B 5B0YA 3AN2A 3RELC 2HUEC 1P3ID 1A7WA 3B6FB 4WU8B 1P3IA 4G92C 4QLCB 4YS3C 1P3PA 2YFWA 1P3FB 5AV6C 3REKD 1P3AB 5FUGA 3MGQB 3REKA 2PYOD 3MNNC 2HIOD 1P3FC 2PYOA 1R4VA 1P3AC 3UT9A 1P3MB 4R8PB 4KGCB 2HIOA 2FJ7A 4JJND 5AY8A 3AZMD 4J8WB 5B1LD 4CSRA 3LZ1D 5GXQD 5E5AD 3AZIA 3W98A 5B31C 4H9PA 5E5AA 4XZQB 2NQBB 3AFAA 4WU9C 3AZNB 5G49B 3AZHB 4J8UC 3O62A 5B2JB 2F8NK 1KX4B 3VH5W
chains in the Genus database with same CATH superfamily
4WV4B 3AZNC 5CPJC 3AZGC 5B2JC 3X1UC 3MGPC 3REJD 5B0ZD 4KUDC 4YM6B 5AVCB 4J8VB 1ZLAC 3C1CB 5GT0C 3AYWD 5B0YC 3AN2C 1EQZA 3WKJA 1S32A 5AV8B 4UPKA 4E44A 3AZED 1BH8B 1F66A 3B0CW 4H9RB 1P3PC 1N1JB 3FDDA 4ZBJB 4Z2MG 3TU4B 2F8ND 5AV9A 5GT3B 3A6ND 5DNMB 2F8NA 2J8PA 4EO5C 3A6NA 3UT9C 2HIOC 2FJ7C 5AY8C 5KDMB 5B24B 4DRAA 5B32B 1KX3D 3WA9C 4LD9D 5B40B 1KX3A 3AZIC 3W98C 3LJAD 1W2EA 3W99D 5BNVA 3LJAA 2NZDD 3X1TD 1P3GB 3W99A 3X1SB 3AFAC 3AV2B 3WAAA 4ZUXB 3O62C 2LY8A 3AV2C 3NQJB 3W96A 4X23B 4NE3A 2JCHA 3B6GB 4WNNB 4H9QB 3X1VB 1M18B 1P34A 3LZ0D 3C1BD 4AWLC 5CPID 4H9NA 4DRBA 1EQZC 3WKJC 3LZ0A 1P3BB 1S32C 5BNXA 5AV5A 3RELD 2BYMB 3MGRB 4J8XB 5AVBD 2IO5B 1F66C 5AVBA 4G91C 5DNNB 5JA4A 4YS3D 4WU8D 5AV9C 5AV6D 3B6FA 4WU8A 4QLCA 2F8NH 3MNND 1P3FD 1P3AD 3UTAB 1P3FA 5F99C 1P3AA 1BH9B 3KXBB 3MGQA 5C3IC 1P3OB 1P3MA 4KGCA 4R8PA 5B31D 4J8WD 3W99C 4J8WA 1P3OC 3VH6A 3WAAC 3UTBB 2RIQA 3KWQB 2Y2IA 4WU9D 4XZQA 3W96C 3AZKB 2BG1A 3EPHA 3AZND 2NQBA 3AZGD 5B2JD 3X1UD 3AZNA 5G49A 3MGPD 3AZHA 4KUDD 1P34C 5B2JA 3KUYB 2RVQC 1ZLAD 1KX4A 1B6WA 3AN2D 5AV5C 4E45A 4YM6D 3KUYC 3AZJB 4YM6A 5AVCA 4J8VA 5AVBC 2DF4C 1P3KB 3AZJC 5CPKB 5AV8D 1P3PD 3NQUB 2BYKB 5AV8A 3B6FC 4WU8C 2CV5B 4WJ3C 2YFVB 1BH8A 4QLCC 2ZM5A 4H9RA 2ZY5A 1N1JA 3UT9D 2FJ7D 3TU4A 5AY8D 1P3LB 3MGQC 5CHLB 5GT3A 5DNMA 3REHB 3MGSB 3WA9D 1U35B 1P3MC 3AZID 4R8PC 3W97B 3WA9A 3W98D 4KGCC 5B32D 5KDMA 5B24A 4J8WC 5B32A 5B40A 3AFAD 1HTAA 4XZQC 3O62D 2AROB 3AV2D 1M1AB 1P3GA 2NQBC 3X1SA 3AV2A 3B0BA 1Q9CA 3LELB 3AZHC 4ZUXA 5BT1C 5CP6B 3NQJA 2F2AC 4X23A 1KX4C 4NFTA 1KX5B 1EQZD 3WKJD 3B6GA 1S32D 3H0RC 4WNNA 4YM6C 2XD5A 5AVCC 4J8VC 4Z66B 4H9QA 3X1VA 1M18A 1F66D 3C1CC 1P3BA 5AV8C 1M19B 2BYMA 5B2IB 3MGRA 4J8XA 5AV9D 1ID3B 5DNND 3AZFB 5DNNA 1B67A 4ZBJC 1TZYB 3TU4C 5GT3C 5DNMC 5F99D 3VH6T 3AZLB 5F99A 5B1MB 3AV1B 3UTAA 5B24C 3AZLC 5B32C 3KXBD 2Y2LA 5B40C 1BH9A 3KXBA 1P3OD 3AV1C 1P3OA 3WAAD 3IP4C 4Z5TB 3W96D 1P3GC 3X1SC 1F1EA 4ZUXC 3UTBA 3KWQA 4JJNB 3AZMB 5B1LB 4X23C 3MVDB 1P34D 3AZKA 3LZ1B 5GXQB 2RVQD 3VH5A 3B6GC 5BO0B 5AV5D 3X1VC 3KUYD 1M18C 3KUYA 1P3BC 3AZJD 4J8XC 3MGRC 2IO5C 3AZJA 1P3KD 3B6FD 5JRGB 2G5HC 1P3KA 5DNNC 4QLCD 3A1KA 3REJB 5B0ZB 5CPKA 1T3UA 3NQUA 2BYKA 4HGAB 5B33B 2CV5A 2YFVA 3AYWB 3MGQD 5BS7A 5B33C 3UTAC 1P3MD 4KGCD 4R8PD 2Y2MA 2G5IC 1P3LA 3AZEB 3KXBC 3V9RB 2Y2KA 3MGSA 3REHA 3W97D 1U35A 3W97A 4XZQD 1HQ3B 3UTBC 2NQBD 3KWQC 2CWEA 3AZHD 3F6TA 4H9OB 5BT1D 3AZKC 2AROA 2F8NG 3B0DB 4LD9B 1M1AA 1KX4D 3KSYA 3LELD 3EG5B 1TAFB 3LELA 5CP6D 2NZDB 5AVCD 4J8VD 3X1TB 5CP6A 1KX5A 3C1CD 3C1CA 4Z66A 1P3KC 2ZY2A 5CPKC 1Z2CB 1M19D 3TU4D 3REIB 2CV5C 1M19A 1AOIB 5B2IA 3C1BB 5GT3D 5DNMD 5CPIB 1ID3A 3AZFA 5BS7C 3REIC 1AOIC 3WTPE 3RELB 2HUEB 1TZYA 1P3LC 3KFUG 5B24D 3AZLD 3REHC 3MGSC 5B40D 3AZLA 4G92B 4XUJB 1U35C 3W97C 5B1MD 3AV1D 4YS3B 5B1MA 3AV1A 4M6BA 3R45B 4XUJC 5AV6B 1P3GD 3VH5T 3X1SD 3MNNB 5GSUB 4ZUXD 4Z5TD 2W8SA 2AROC 2XD1A 4CAYB 1M1AC 4Z5TA 2DQNC 4X23D 5GSUC 4UUZB 2Y2OA 3LELC 2ZY3A 1H3OB 5B31B 3B6GD 1WWSA 3WTPB 3MVDD 4JJNA 3AZMA 5CP6C 3X1VD 5B1LA 1M18D 3MVDA 1KX5C 3LZ1A 5GXQA 3B0CT 3WTPC 3P5JB 4WU9B 1P3BD 2L5AA 5BO0A 4J8UB 4Z66C 4J8XD 3MGRD 5B31G 2Y2JA 4Z2MH 5CPJB 3AZGB 3X1UB 3MGPB 4KUDB 1M19C 5B2IC 5JRGD 3H0LC 1ID3C 1JFIB 3AZFC 1ZLAB 4KHAB 5JRGA 5GT0B 3EPLA 5B0YB 3AN2B 3REJA 1TZYC 5B0ZA 5B33D 3UTAD 1P3IB 5B33A 3H0MC 3AYWA 1P3PB 2YFWB 1P3IC 5B1MC 5FUGB 3REKB 3AZEA 4EO5B 2PYOB 3V9RA 1PZRA 3UT9B 3UTBD 2HIOB 3KWQD 3REKC 2FJ7B 5AY8B 4H9SA 4Z5TC 2PYOC 1HQ3D 4CSRB 3AZKD 3WA9B 1HQ3A 3AZIB 3W98B 4H9PB 5E5AB 4JJNC 2Y2QA 3AZMC 5B1LC 4WZSB 3MVDC 3VH6W 4H9OA 3LZ1C 4LD9A 5GXQC 5E5AC 3AFAB 4NE5A 3AL0C 1TAFA 3O62B 2NZDA 5B32G 3X1TA 5CPKD 4DQYB 2CV5D 5JRGC 4AWLB 1EQZB 3WKJB 3REJC 5B0ZC 1S32B 3REID 1AOID 2FFFB 4HGAC 1WWIA 2Y2NA 3REIA 1AOIA 1P3LD 1F66B 1ULYA 3C1BA 3AYWC 5CPIA 3REHD 3MGSD 4G91B 1U35D 3RELA 2JSSA 5AV9B 3AZEC 2F8NB 4XUJD 3A6NB 4XUJA 4YS3A 2Y2PA 4H9SC 3A6NC 5AV6A 3R45A 5F99B 2AROD 1HQ3C 1KU5A 1M1AD 1KX3B 5C3IB 5GSUD 4NE6A 2UWXA 3MNNA 5GSUA 5BNVB 3LJAB 1KX3C 2Y2HA 4LD9C 3B0DC 4CAYA 3W99B 1KX5D 3EPJA 3LJAC 3WAAB 4UUZA 3WTPD 5B31A 1H3OA 2NZDC 3WTPA 3X1TC 4Z66D 2JE5A 3W96B 4J8UD 4WU9A 4J8UA 1P34B 2Y2GA 5B2ID 5CPJD 1ID3D 4H9NB 3AZFD 3LZ0B 5CPJA 3AZGA 5BNXB 3X1UA 5AV5B 1BFMA 3MGPA 4KUDA 1TZYD 3LZ0C 3C1BC 5GT0D 5CPIC 5AVBB 5B0YD 1JFIA 1ZLAA 4KHAA 5GT0A 5JA4B 5B0YA 3AN2A 3RELC 2HUEC 1P3ID 1A7WA 3B6FB 4WU8B 1P3IA 4G92C 4QLCB 4YS3C 1P3PA 2YFWA 1P3FB 5AV6C 3REKD 1P3AB 5FUGA 3MGQB 3REKA 2PYOD 3MNNC 2HIOD 1P3FC 2PYOA 1R4VA 1P3AC 3UT9A 1P3MB 4R8PB 4KGCB 2HIOA 2FJ7A 4JJND 5AY8A 3AZMD 4J8WB 5B1LD 4CSRA 3LZ1D 5GXQD 5E5AD 3AZIA 3W98A 2VQRA 5B31C 4H9PA 5E5AA 4XZQB 2NQBB 2ZY4A 3A1IA 3AFAA 4WU9C 3AZNB 5G49B 3AZHB 4J8UC 3O62A 5B2JB 3EPKA 2F8NK 1KX4B 3VH5W
chains in the Genus database with same CATH topology
4WV4B 3AZNC 5CPJC 3AZGC 5B2JC 3X1UC 3MGPC 3REJD 5B0ZD 4KUDC 4YM6B 5AVCB 4J8VB 1ZLAC 3C1CB 5GT0C 3AYWD 5B0YC 3AN2C 1EQZA 3WKJA 1S32A 5AV8B 4UPKA 4E44A 3AZED 1BH8B 1F66A 3B0CW 4H9RB 1P3PC 1N1JB 3FDDA 4ZBJB 4Z2MG 3TU4B 2F8ND 5AV9A 5GT3B 3A6ND 5DNMB 2F8NA 2J8PA 4EO5C 3A6NA 3UT9C 2HIOC 2FJ7C 5AY8C 5KDMB 5B24B 4DRAA 5B32B 1KX3D 3WA9C 4LD9D 5B40B 1KX3A 3AZIC 3W98C 3LJAD 1W2EA 3W99D 5BNVA 3LJAA 2NZDD 3X1TD 1P3GB 3W99A 3X1SB 3AFAC 3AV2B 3WAAA 4ZUXB 3O62C 2LY8A 3AV2C 3NQJB 3W96A 4X23B 4NE3A 2JCHA 3B6GB 4WNNB 4H9QB 3X1VB 1M18B 1P34A 3LZ0D 3C1BD 4AWLC 5CPID 4H9NA 4DRBA 1EQZC 3WKJC 3LZ0A 1P3BB 1S32C 5BNXA 5AV5A 3RELD 2BYMB 3MGRB 4J8XB 5AVBD 2IO5B 1F66C 5AVBA 4G91C 5DNNB 5JA4A 4YS3D 4WU8D 5AV9C 5AV6D 3B6FA 4WU8A 4QLCA 2F8NH 3MNND 1P3FD 1P3AD 3UTAB 1P3FA 5F99C 1P3AA 1BH9B 3KXBB 3MGQA 5C3IC 1P3OB 1P3MA 4KGCA 4R8PA 5B31D 4J8WD 3W99C 4J8WA 1P3OC 3VH6A 3WAAC 3UTBB 2RIQA 3KWQB 2Y2IA 4WU9D 4XZQA 3W96C 3AZKB 2BG1A 3EPHA 3AZND 2NQBA 3AZGD 5B2JD 3X1UD 3AZNA 5G49A 3MGPD 3AZHA 4KUDD 1P34C 5B2JA 3KUYB 2RVQC 1ZLAD 1KX4A 1B6WA 3AN2D 5AV5C 4E45A 4YM6D 3KUYC 3AZJB 4YM6A 5AVCA 4J8VA 5AVBC 2DF4C 1P3KB 3AZJC 5CPKB 5AV8D 1P3PD 3NQUB 2BYKB 5AV8A 3B6FC 4WU8C 2CV5B 4WJ3C 2YFVB 1BH8A 4QLCC 2ZM5A 4H9RA 2ZY5A 1N1JA 3UT9D 2FJ7D 3TU4A 5AY8D 1P3LB 3MGQC 5CHLB 5GT3A 5DNMA 3REHB 3MGSB 3WA9D 1U35B 1P3MC 3AZID 4R8PC 3W97B 3WA9A 3W98D 4KGCC 5B32D 5KDMA 5B24A 4J8WC 5B32A 5B40A 3AFAD 1HTAA 4XZQC 3O62D 2AROB 3AV2D 1M1AB 1P3GA 2NQBC 3X1SA 3AV2A 3B0BA 1Q9CA 3LELB 3AZHC 4ZUXA 5BT1C 5CP6B 3NQJA 2F2AC 4X23A 1KX4C 4NFTA 1KX5B 1EQZD 3WKJD 3B6GA 1S32D 3H0RC 4WNNA 4YM6C 2XD5A 5AVCC 4J8VC 4Z66B 4H9QA 3X1VA 1M18A 1F66D 3C1CC 1P3BA 5AV8C 1M19B 2BYMA 5B2IB 3MGRA 4J8XA 5AV9D 1ID3B 5DNND 3AZFB 5DNNA 1B67A 4ZBJC 1TZYB 3TU4C 5GT3C 5DNMC 5F99D 3VH6T 3AZLB 5F99A 5B1MB 3AV1B 3UTAA 5B24C 3AZLC 5B32C 3KXBD 2Y2LA 5B40C 1BH9A 3KXBA 1P3OD 3AV1C 1P3OA 3WAAD 3IP4C 4Z5TB 3W96D 1P3GC 3X1SC 1F1EA 4ZUXC 3UTBA 3KWQA 4JJNB 3AZMB 5B1LB 4X23C 3MVDB 1P34D 3AZKA 3LZ1B 5GXQB 2RVQD 3VH5A 3B6GC 5BO0B 5AV5D 3X1VC 3KUYD 1M18C 3KUYA 1P3BC 3AZJD 4J8XC 3MGRC 2IO5C 3AZJA 1P3KD 3B6FD 5JRGB 2G5HC 1P3KA 5DNNC 4QLCD 3A1KA 3REJB 5B0ZB 5CPKA 1T3UA 3NQUA 2BYKA 4HGAB 5B33B 2CV5A 2YFVA 3AYWB 3MGQD 5BS7A 5B33C 3UTAC 1P3MD 4KGCD 4R8PD 2Y2MA 2G5IC 1P3LA 3AZEB 3KXBC 3V9RB 2Y2KA 3MGSA 3REHA 3W97D 1U35A 3W97A 4XZQD 1HQ3B 3UTBC 2NQBD 3KWQC 2CWEA 3AZHD 3F6TA 4H9OB 5BT1D 3AZKC 2AROA 2F8NG 3B0DB 4LD9B 1M1AA 1KX4D 3KSYA 3LELD 3EG5B 1TAFB 3LELA 5CP6D 2NZDB 5AVCD 4J8VD 3X1TB 5CP6A 1KX5A 3C1CD 3C1CA 4Z66A 1P3KC 2ZY2A 5CPKC 1Z2CB 1M19D 3TU4D 3REIB 2CV5C 1M19A 1AOIB 5B2IA 3C1BB 5GT3D 5DNMD 5CPIB 1ID3A 3AZFA 5BS7C 3REIC 1AOIC 3WTPE 3RELB 2HUEB 1TZYA 1P3LC 3KFUG 5B24D 3AZLD 3REHC 3MGSC 5B40D 3AZLA 4G92B 4XUJB 1U35C 3W97C 5B1MD 3AV1D 4YS3B 5B1MA 3AV1A 4M6BA 3R45B 4XUJC 5AV6B 1P3GD 3VH5T 3X1SD 3MNNB 5GSUB 4ZUXD 4Z5TD 2W8SA 2AROC 2XD1A 4CAYB 1M1AC 4Z5TA 2DQNC 4X23D 5GSUC 4UUZB 2Y2OA 3LELC 2ZY3A 1H3OB 5B31B 3B6GD 1WWSA 3WTPB 3MVDD 4JJNA 3AZMA 5CP6C 3X1VD 5B1LA 1M18D 3MVDA 1KX5C 3LZ1A 5GXQA 3B0CT 3WTPC 3P5JB 4WU9B 1P3BD 2L5AA 5BO0A 4J8UB 4Z66C 4J8XD 3MGRD 5B31G 2Y2JA 4Z2MH 5CPJB 3AZGB 3X1UB 3MGPB 4KUDB 1M19C 5B2IC 5JRGD 3H0LC 1ID3C 1JFIB 3AZFC 1ZLAB 4KHAB 5JRGA 5GT0B 3EPLA 5B0YB 3AN2B 3REJA 1TZYC 5B0ZA 5B33D 3UTAD 1P3IB 5B33A 3H0MC 3AYWA 1P3PB 2YFWB 1P3IC 5B1MC 5FUGB 3REKB 3AZEA 4EO5B 2PYOB 3V9RA 1PZRA 3UT9B 3UTBD 2HIOB 3KWQD 3REKC 2FJ7B 5AY8B 4H9SA 4Z5TC 2PYOC 1HQ3D 4CSRB 3AZKD 3WA9B 1HQ3A 3AZIB 3W98B 4H9PB 5E5AB 4JJNC 2Y2QA 3AZMC 5B1LC 4WZSB 3MVDC 3VH6W 4H9OA 3LZ1C 4LD9A 5GXQC 5E5AC 3AFAB 4NE5A 3AL0C 1TAFA 3O62B 2NZDA 5B32G 3X1TA 5CPKD 4DQYB 2CV5D 5JRGC 4AWLB 1EQZB 3WKJB 3REJC 5B0ZC 1S32B 3REID 1AOID 2FFFB 4HGAC 1WWIA 2Y2NA 3REIA 1AOIA 1P3LD 1F66B 1ULYA 3C1BA 3AYWC 5CPIA 3REHD 3MGSD 4G91B 1U35D 3RELA 2JSSA 5AV9B 3AZEC 2F8NB 4XUJD 3A6NB 4XUJA 4YS3A 2Y2PA 4H9SC 3A6NC 5AV6A 3R45A 5F99B 2AROD 1HQ3C 1KU5A 1M1AD 1KX3B 5C3IB 5GSUD 4NE6A 2UWXA 3MNNA 5GSUA 5BNVB 3LJAB 1KX3C 2Y2HA 4LD9C 3B0DC 4CAYA 3W99B 1KX5D 3EPJA 3LJAC 3WAAB 4UUZA 3WTPD 5B31A 1H3OA 2NZDC 3WTPA 3X1TC 4Z66D 2JE5A 3W96B 4J8UD 4WU9A 4J8UA 1P34B 2Y2GA 5B2ID 5CPJD 1ID3D 4H9NB 3AZFD 3LZ0B 5CPJA 3AZGA 5BNXB 3X1UA 5AV5B 1BFMA 3MGPA 4KUDA 1TZYD 3LZ0C 3C1BC 5GT0D 5CPIC 5AVBB 5B0YD 1JFIA 1ZLAA 4KHAA 5GT0A 5JA4B 5B0YA 3AN2A 3RELC 2HUEC 1P3ID 1A7WA 3B6FB 4WU8B 1P3IA 4G92C 4QLCB 4YS3C 1P3PA 2YFWA 1P3FB 5AV6C 3REKD 1P3AB 5FUGA 3MGQB 3REKA 2PYOD 3MNNC 2HIOD 1P3FC 2PYOA 1R4VA 1P3AC 3UT9A 1P3MB 4R8PB 4KGCB 2HIOA 2FJ7A 4JJND 5AY8A 3AZMD 4J8WB 5B1LD 4CSRA 3LZ1D 5GXQD 5E5AD 3AZIA 3W98A 2VQRA 5B31C 4H9PA 5E5AA 4XZQB 2NQBB 2ZY4A 3A1IA 3AFAA 4WU9C 3AZNB 5G49B 3AZHB 4J8UC 3O62A 5B2JB 3EPKA 2F8NK 1KX4B 3VH5W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WV4 B;  3AZN C;  5CPJ C;  3AZG C;  5B2J C;  3X1U C;  3MGP C;  3REJ D;  5B0Z D;  4KUD C;  4YM6 B;  5AVC B;  4J8V B;  1ZLA C;  3C1C B;  5GT0 C;  3AYW D;  5B0Y C;  3AN2 C;  1EQZ A;  3WKJ A;  1S32 A;  5AV8 B;  4E44 A;  3AZE D;  1BH8 B;  1F66 A;  3B0C W;  4H9R B;  1P3P C;  1N1J B;  4ZBJ B;  4Z2M G;  3TU4 B;  2F8N D;  5AV9 A;  5GT3 B;  3A6N D;  5DNM B;  2F8N A;  4EO5 C;  3A6N A;  3UT9 C;  2HIO C;  2FJ7 C;  5AY8 C;  5KDM B;  5B24 B;  4DRA A;  5B32 B;  1KX3 D;  3WA9 C;  4LD9 D;  5B40 B;  1KX3 A;  3AZI C;  3W98 C;  3LJA D;  3W99 D;  5BNV A;  3LJA A;  2NZD D;  3X1T D;  1P3G B;  3W99 A;  3X1S B;  3AFA C;  3AV2 B;  3WAA A;  4ZUX B;  3O62 C;  2LY8 A;  3AV2 C;  3NQJ B;  3W96 A;  4X23 B;  4NE3 A;  3B6G B;  4WNN B;  4H9Q B;  3X1V B;  1M18 B;  1P34 A;  3LZ0 D;  3C1B D;  4AWL C;  5CPI D;  4H9N A;  4DRB A;  1EQZ C;  3WKJ C;  3LZ0 A;  1P3B B;  1S32 C;  5BNX A;  5AV5 A;  3REL D;  2BYM B;  3MGR B;  4J8X B;  5AVB D;  2IO5 B;  1F66 C;  5AVB A;  4G91 C;  5DNN B;  5JA4 A;  4YS3 D;  4WU8 D;  5AV9 C;  5AV6 D;  3B6F A;  4WU8 A;  4QLC A;  2F8N H;  3MNN D;  1P3F D;  1P3A D;  3UTA B;  1P3F A;  5F99 C;  1P3A A;  1BH9 B;  3KXB B;  3MGQ A;  5C3I C;  1P3O B;  1P3M A;  4KGC A;  4R8P A;  5B31 D;  4J8W D;  3W99 C;  4J8W A;  1P3O C;  3VH6 A;  3WAA C;  3UTB B;  3KWQ B;  4WU9 D;  4XZQ A;  3W96 C;  3AZK B;  3AZN D;  2NQB A;  3AZG D;  5B2J D;  3X1U D;  3AZN A;  5G49 A;  3MGP D;  3AZH A;  4KUD D;  1P34 C;  5B2J A;  3KUY B;  2RVQ C;  1ZLA D;  1KX4 A;  1B6W A;  3AN2 D;  5AV5 C;  4E45 A;  4YM6 D;  3KUY C;  3AZJ B;  4YM6 A;  5AVC A;  4J8V A;  5AVB C;  1P3K B;  3AZJ C;  5CPK B;  5AV8 D;  1P3P D;  3NQU B;  2BYK B;  5AV8 A;  3B6F C;  4WU8 C;  2CV5 B;  2YFV B;  1BH8 A;  4QLC C;  4H9R A;  1N1J A;  3UT9 D;  2FJ7 D;  3TU4 A;  5AY8 D;  1P3L B;  3MGQ C;  5CHL B;  5GT3 A;  5DNM A;  3REH B;  3MGS B;  3WA9 D;  1U35 B;  1P3M C;  3AZI D;  4R8P C;  3W97 B;  3WA9 A;  3W98 D;  4KGC C;  5B32 D;  5KDM A;  5B24 A;  4J8W C;  5B32 A;  5B40 A;  3AFA D;  1HTA A;  4XZQ C;  3O62 D;  2ARO B;  3AV2 D;  1M1A B;  1P3G A;  2NQB C;  3X1S A;  3AV2 A;  3B0B A;  1Q9C A;  3LEL B;  3AZH C;  4ZUX A;  5BT1 C;  5CP6 B;  3NQJ A;  1KX4 C;  4X23 A;  1KX5 B;  4NFT A;  1EQZ D;  3WKJ D;  3B6G A;  1S32 D;  4WNN A;  4YM6 C;  5AVC C;  4J8V C;  4Z66 B;  4H9Q A;  3X1V A;  1M18 A;  1F66 D;  3C1C C;  1P3B A;  5AV8 C;  1M19 B;  2BYM A;  5B2I B;  3MGR A;  4J8X A;  5AV9 D;  1ID3 B;  5DNN D;  3AZF B;  5DNN A;  1B67 A;  4ZBJ C;  1TZY B;  3TU4 C;  5GT3 C;  5DNM C;  5F99 D;  3VH6 T;  3AZL B;  5F99 A;  5B1M B;  3AV1 B;  3UTA A;  5B24 C;  3AZL C;  5B32 C;  3KXB D;  5B40 C;  1BH9 A;  3KXB A;  1P3O D;  3AV1 C;  1P3O A;  3WAA D;  4Z5T B;  3W96 D;  1P3G C;  3X1S C;  1F1E A;  4ZUX C;  3UTB A;  3KWQ A;  4JJN B;  3AZM B;  5B1L B;  4X23 C;  3MVD B;  1P34 D;  3AZK A;  3LZ1 B;  5GXQ B;  2RVQ D;  3VH5 A;  3B6G C;  5BO0 B;  5AV5 D;  3X1V C;  3KUY D;  1M18 C;  3KUY A;  1P3B C;  3AZJ D;  4J8X C;  3MGR C;  2IO5 C;  3AZJ A;  1P3K D;  3B6F D;  5JRG B;  1P3K A;  5DNN C;  4QLC D;  3REJ B;  5B0Z B;  5CPK A;  3NQU A;  2BYK A;  4HGA B;  5B33 B;  2CV5 A;  2YFV A;  3AYW B;  3MGQ D;  5BS7 A;  5B33 C;  3UTA C;  1P3M D;  4KGC D;  4R8P D;  1P3L A;  3AZE B;  3KXB C;  3V9R B;  3MGS A;  3REH A;  3W97 D;  1U35 A;  3W97 A;  4XZQ D;  1HQ3 B;  3UTB C;  2NQB D;  3KWQ C;  2CWE A;  3AZH D;  4H9O B;  3AZK C;  5BT1 D;  4LD9 B;  2ARO A;  2F8N G;  3B0D B;  1M1A A;  1KX4 D;  3KSY A;  3LEL D;  1TAF B;  3LEL A;  5CP6 D;  2NZD B;  5AVC D;  4J8V D;  3X1T B;  5CP6 A;  1KX5 A;  3C1C D;  3C1C A;  4Z66 A;  1P3K C;  5CPK C;  1M19 D;  3TU4 D;  3REI B;  2CV5 C;  1M19 A;  1AOI B;  5B2I A;  3C1B B;  5GT3 D;  5DNM D;  5CPI B;  1ID3 A;  3AZF A;  5BS7 C;  3REI C;  1AOI C;  3WTP E;  3REL B;  2HUE B;  1TZY A;  1P3L C;  5B24 D;  3AZL D;  3REH C;  3MGS C;  5B40 D;  3AZL A;  4G92 B;  4XUJ B;  1U35 C;  3W97 C;  5B1M D;  3AV1 D;  4YS3 B;  5B1M A;  3AV1 A;  4M6B A;  3R45 B;  4XUJ C;  5AV6 B;  1P3G D;  3VH5 T;  3X1S D;  3MNN B;  5GSU B;  4ZUX D;  4Z5T D;  2ARO C;  4CAY B;  1M1A C;  4Z5T A;  4X23 D;  5GSU C;  4UUZ B;  3LEL C;  5B31 B;  1H3O B;  3B6G D;  1WWS A;  3WTP B;  3MVD D;  4JJN A;  3AZM A;  5CP6 C;  3X1V D;  5B1L A;  1M18 D;  3MVD A;  1KX5 C;  3LZ1 A;  5GXQ A;  3B0C T;  3WTP C;  4WU9 B;  1P3B D;  2L5A A;  5BO0 A;  4J8U B;  4Z66 C;  4J8X D;  3MGR D;  5B31 G;  4Z2M H;  5CPJ B;  3AZG B;  3X1U B;  3MGP B;  4KUD B;  1M19 C;  5B2I C;  5JRG D;  1ID3 C;  1JFI B;  3AZF C;  1ZLA B;  4KHA B;  5JRG A;  5GT0 B;  5B0Y B;  3AN2 B;  3REJ A;  1TZY C;  5B0Z A;  5B33 D;  3UTA D;  1P3I B;  5B33 A;  3AYW A;  1P3P B;  2YFW B;  1P3I C;  5B1M C;  5FUG B;  3REK B;  3AZE A;  4EO5 B;  2PYO B;  3V9R A;  3UT9 B;  3UTB D;  2HIO B;  3KWQ D;  3REK C;  2FJ7 B;  5AY8 B;  4H9S A;  4Z5T C;  2PYO C;  1HQ3 D;  4CSR B;  3AZK D;  3WA9 B;  1HQ3 A;  3AZI B;  3W98 B;  4H9P B;  5E5A B;  4JJN C;  3AZM C;  5B1L C;  4WZS B;  3MVD C;  3VH6 W;  4H9O A;  3LZ1 C;  4LD9 A;  5GXQ C;  5E5A C;  3AFA B;  4NE5 A;  1TAF A;  3O62 B;  2NZD A;  5B32 G;  3X1T A;  5CPK D;  2CV5 D;  5JRG C;  4AWL B;  1EQZ B;  3WKJ B;  3REJ C;  5B0Z C;  1S32 B;  3REI D;  1AOI D;  4HGA C;  1WWI A;  3REI A;  1AOI A;  1P3L D;  1F66 B;  1ULY A;  3C1B A;  3AYW C;  5CPI A;  3REH D;  3MGS D;  4G91 B;  1U35 D;  3REL A;  2JSS A;  5AV9 B;  3AZE C;  2F8N B;  4XUJ D;  3A6N B;  4XUJ A;  4YS3 A;  4H9S C;  3A6N C;  5AV6 A;  3R45 A;  5F99 B;  2ARO D;  1HQ3 C;  1KU5 A;  1M1A D;  1KX3 B;  5C3I B;  5GSU D;  4NE6 A;  3MNN A;  5GSU A;  5BNV B;  3LJA B;  1KX3 C;  4LD9 C;  3B0D C;  4CAY A;  3W99 B;  1KX5 D;  3LJA C;  3WAA B;  4UUZ A;  3WTP D;  5B31 A;  1H3O A;  2NZD C;  3WTP A;  3X1T C;  4Z66 D;  3W96 B;  4J8U D;  4WU9 A;  4J8U A;  1P34 B;  5B2I D;  5CPJ D;  1ID3 D;  4H9N B;  3AZF D;  3LZ0 B;  5CPJ A;  3AZG A;  5BNX B;  3X1U A;  5AV5 B;  1BFM A;  3MGP A;  4KUD A;  1TZY D;  3LZ0 C;  3C1B C;  5GT0 D;  5CPI C;  5AVB B;  5B0Y D;  1JFI A;  1ZLA A;  4KHA A;  5GT0 A;  5JA4 B;  5B0Y A;  3AN2 A;  3REL C;  2HUE C;  1P3I D;  1A7W A;  3B6F B;  4WU8 B;  1P3I A;  4G92 C;  4QLC B;  4YS3 C;  1P3P A;  2YFW A;  1P3F B;  5AV6 C;  3REK D;  1P3A B;  5FUG A;  3MGQ B;  3REK A;  2PYO D;  3MNN C;  2HIO D;  1P3F C;  2PYO A;  1R4V A;  1P3A C;  3UT9 A;  1P3M B;  4R8P B;  4KGC B;  2HIO A;  2FJ7 A;  4JJN D;  5AY8 A;  3AZM D;  4J8W B;  5B1L D;  4CSR A;  3LZ1 D;  5GXQ D;  5E5A D;  3AZI A;  3W98 A;  5B31 C;  4H9P A;  5E5A A;  4XZQ B;  2NQB B;  3AFA A;  4WU9 C;  3AZN B;  5G49 B;  3AZH B;  4J8U C;  3O62 A;  5B2J B;  2F8N K;  1KX4 B;  3VH5 W; 
#chains in the Genus database with same CATH topology
 4WV4 B;  3AZN C;  5CPJ C;  3AZG C;  5B2J C;  3X1U C;  3MGP C;  3REJ D;  5B0Z D;  4KUD C;  4YM6 B;  5AVC B;  4J8V B;  1ZLA C;  3C1C B;  5GT0 C;  3AYW D;  5B0Y C;  3AN2 C;  1EQZ A;  3WKJ A;  1S32 A;  5AV8 B;  4UPK A;  4E44 A;  3AZE D;  1BH8 B;  1F66 A;  3B0C W;  4H9R B;  1P3P C;  1N1J B;  3FDD A;  4ZBJ B;  4Z2M G;  3TU4 B;  2F8N D;  5AV9 A;  5GT3 B;  3A6N D;  5DNM B;  2F8N A;  2J8P A;  4EO5 C;  3A6N A;  3UT9 C;  2HIO C;  2FJ7 C;  5AY8 C;  5KDM B;  5B24 B;  4DRA A;  5B32 B;  1KX3 D;  3WA9 C;  4LD9 D;  5B40 B;  1KX3 A;  3AZI C;  3W98 C;  3LJA D;  1W2E A;  3W99 D;  5BNV A;  3LJA A;  2NZD D;  3X1T D;  1P3G B;  3W99 A;  3X1S B;  3AFA C;  3AV2 B;  3WAA A;  4ZUX B;  3O62 C;  2LY8 A;  3AV2 C;  3NQJ B;  3W96 A;  4X23 B;  4NE3 A;  2JCH A;  3B6G B;  4WNN B;  4H9Q B;  3X1V B;  1M18 B;  1P34 A;  3LZ0 D;  3C1B D;  4AWL C;  5CPI D;  4H9N A;  4DRB A;  1EQZ C;  3WKJ C;  3LZ0 A;  1P3B B;  1S32 C;  5BNX A;  5AV5 A;  3REL D;  2BYM B;  3MGR B;  4J8X B;  5AVB D;  2IO5 B;  1F66 C;  5AVB A;  4G91 C;  5DNN B;  5JA4 A;  4YS3 D;  4WU8 D;  5AV9 C;  5AV6 D;  3B6F A;  4WU8 A;  4QLC A;  2F8N H;  3MNN D;  1P3F D;  1P3A D;  3UTA B;  1P3F A;  5F99 C;  1P3A A;  1BH9 B;  3KXB B;  3MGQ A;  5C3I C;  1P3O B;  1P3M A;  4KGC A;  4R8P A;  5B31 D;  4J8W D;  3W99 C;  4J8W A;  1P3O C;  3VH6 A;  3WAA C;  3UTB B;  2RIQ A;  3KWQ B;  2Y2I A;  4WU9 D;  4XZQ A;  3W96 C;  3AZK B;  2BG1 A;  3EPH A;  3AZN D;  2NQB A;  3AZG D;  5B2J D;  3X1U D;  3AZN A;  5G49 A;  3MGP D;  3AZH A;  4KUD D;  1P34 C;  5B2J A;  3KUY B;  2RVQ C;  1ZLA D;  1KX4 A;  1B6W A;  3AN2 D;  5AV5 C;  4E45 A;  4YM6 D;  3KUY C;  3AZJ B;  4YM6 A;  5AVC A;  4J8V A;  5AVB C;  2DF4 C;  1P3K B;  3AZJ C;  5CPK B;  5AV8 D;  1P3P D;  3NQU B;  2BYK B;  5AV8 A;  3B6F C;  4WU8 C;  2CV5 B;  4WJ3 C;  2YFV B;  1BH8 A;  4QLC C;  2ZM5 A;  4H9R A;  2ZY5 A;  1N1J A;  3UT9 D;  2FJ7 D;  3TU4 A;  5AY8 D;  1P3L B;  3MGQ C;  5CHL B;  5GT3 A;  5DNM A;  3REH B;  3MGS B;  3WA9 D;  1U35 B;  1P3M C;  3AZI D;  4R8P C;  3W97 B;  3WA9 A;  3W98 D;  4KGC C;  5B32 D;  5KDM A;  5B24 A;  4J8W C;  5B32 A;  5B40 A;  3AFA D;  1HTA A;  4XZQ C;  3O62 D;  2ARO B;  3AV2 D;  1M1A B;  1P3G A;  2NQB C;  3X1S A;  3AV2 A;  3B0B A;  1Q9C A;  3LEL B;  3AZH C;  4ZUX A;  5BT1 C;  5CP6 B;  3NQJ A;  2F2A C;  4X23 A;  1KX4 C;  4NFT A;  1KX5 B;  1EQZ D;  3WKJ D;  3B6G A;  1S32 D;  3H0R C;  4WNN A;  4YM6 C;  2XD5 A;  5AVC C;  4J8V C;  4Z66 B;  4H9Q A;  3X1V A;  1M18 A;  1F66 D;  3C1C C;  1P3B A;  5AV8 C;  1M19 B;  2BYM A;  5B2I B;  3MGR A;  4J8X A;  5AV9 D;  1ID3 B;  5DNN D;  3AZF B;  5DNN A;  1B67 A;  4ZBJ C;  1TZY B;  3TU4 C;  5GT3 C;  5DNM C;  5F99 D;  3VH6 T;  3AZL B;  5F99 A;  5B1M B;  3AV1 B;  3UTA A;  5B24 C;  3AZL C;  5B32 C;  3KXB D;  2Y2L A;  5B40 C;  1BH9 A;  3KXB A;  1P3O D;  3AV1 C;  1P3O A;  3WAA D;  3IP4 C;  4Z5T B;  3W96 D;  1P3G C;  3X1S C;  1F1E A;  4ZUX C;  3UTB A;  3KWQ A;  4JJN B;  3AZM B;  5B1L B;  4X23 C;  3MVD B;  1P34 D;  3AZK A;  3LZ1 B;  5GXQ B;  2RVQ D;  3VH5 A;  3B6G C;  5BO0 B;  5AV5 D;  3X1V C;  3KUY D;  1M18 C;  3KUY A;  1P3B C;  3AZJ D;  4J8X C;  3MGR C;  2IO5 C;  3AZJ A;  1P3K D;  3B6F D;  5JRG B;  2G5H C;  1P3K A;  5DNN C;  4QLC D;  3A1K A;  3REJ B;  5B0Z B;  5CPK A;  1T3U A;  3NQU A;  2BYK A;  4HGA B;  5B33 B;  2CV5 A;  2YFV A;  3AYW B;  3MGQ D;  5BS7 A;  5B33 C;  3UTA C;  1P3M D;  4KGC D;  4R8P D;  2Y2M A;  2G5I C;  1P3L A;  3AZE B;  3KXB C;  3V9R B;  2Y2K A;  3MGS A;  3REH A;  3W97 D;  1U35 A;  3W97 A;  4XZQ D;  1HQ3 B;  3UTB C;  2NQB D;  3KWQ C;  2CWE A;  3AZH D;  3F6T A;  4H9O B;  5BT1 D;  3AZK C;  2ARO A;  2F8N G;  3B0D B;  4LD9 B;  1M1A A;  1KX4 D;  3KSY A;  3LEL D;  3EG5 B;  1TAF B;  3LEL A;  5CP6 D;  2NZD B;  5AVC D;  4J8V D;  3X1T B;  5CP6 A;  1KX5 A;  3C1C D;  3C1C A;  4Z66 A;  1P3K C;  2ZY2 A;  5CPK C;  1Z2C B;  1M19 D;  3TU4 D;  3REI B;  2CV5 C;  1M19 A;  1AOI B;  5B2I A;  3C1B B;  5GT3 D;  5DNM D;  5CPI B;  1ID3 A;  3AZF A;  5BS7 C;  3REI C;  1AOI C;  3WTP E;  3REL B;  2HUE B;  1TZY A;  1P3L C;  3KFU G;  5B24 D;  3AZL D;  3REH C;  3MGS C;  5B40 D;  3AZL A;  4G92 B;  4XUJ B;  1U35 C;  3W97 C;  5B1M D;  3AV1 D;  4YS3 B;  5B1M A;  3AV1 A;  4M6B A;  3R45 B;  4XUJ C;  5AV6 B;  1P3G D;  3VH5 T;  3X1S D;  3MNN B;  5GSU B;  4ZUX D;  4Z5T D;  2W8S A;  2ARO C;  2XD1 A;  4CAY B;  1M1A C;  4Z5T A;  2DQN C;  4X23 D;  5GSU C;  4UUZ B;  2Y2O A;  3LEL C;  2ZY3 A;  1H3O B;  5B31 B;  3B6G D;  1WWS A;  3WTP B;  3MVD D;  4JJN A;  3AZM A;  5CP6 C;  3X1V D;  5B1L A;  1M18 D;  3MVD A;  1KX5 C;  3LZ1 A;  5GXQ A;  3B0C T;  3WTP C;  3P5J B;  4WU9 B;  1P3B D;  2L5A A;  5BO0 A;  4J8U B;  4Z66 C;  4J8X D;  3MGR D;  5B31 G;  2Y2J A;  4Z2M H;  5CPJ B;  3AZG B;  3X1U B;  3MGP B;  4KUD B;  1M19 C;  5B2I C;  5JRG D;  3H0L C;  1ID3 C;  1JFI B;  3AZF C;  1ZLA B;  4KHA B;  5JRG A;  5GT0 B;  3EPL A;  5B0Y B;  3AN2 B;  3REJ A;  1TZY C;  5B0Z A;  5B33 D;  3UTA D;  1P3I B;  5B33 A;  3H0M C;  3AYW A;  1P3P B;  2YFW B;  1P3I C;  5B1M C;  5FUG B;  3REK B;  3AZE A;  4EO5 B;  2PYO B;  3V9R A;  1PZR A;  3UT9 B;  3UTB D;  2HIO B;  3KWQ D;  3REK C;  2FJ7 B;  5AY8 B;  4H9S A;  4Z5T C;  2PYO C;  1HQ3 D;  4CSR B;  3AZK D;  3WA9 B;  1HQ3 A;  3AZI B;  3W98 B;  4H9P B;  5E5A B;  4JJN C;  2Y2Q A;  3AZM C;  5B1L C;  4WZS B;  3MVD C;  3VH6 W;  4H9O A;  3LZ1 C;  4LD9 A;  5GXQ C;  5E5A C;  3AFA B;  4NE5 A;  3AL0 C;  1TAF A;  3O62 B;  2NZD A;  5B32 G;  3X1T A;  5CPK D;  4DQY B;  2CV5 D;  5JRG C;  4AWL B;  1EQZ B;  3WKJ B;  3REJ C;  5B0Z C;  1S32 B;  3REI D;  1AOI D;  2FFF B;  4HGA C;  1WWI A;  2Y2N A;  3REI A;  1AOI A;  1P3L D;  1F66 B;  1ULY A;  3C1B A;  3AYW C;  5CPI A;  3REH D;  3MGS D;  4G91 B;  1U35 D;  3REL A;  2JSS A;  5AV9 B;  3AZE C;  2F8N B;  4XUJ D;  3A6N B;  4XUJ A;  4YS3 A;  2Y2P A;  4H9S C;  3A6N C;  5AV6 A;  3R45 A;  5F99 B;  2ARO D;  1HQ3 C;  1KU5 A;  1M1A D;  1KX3 B;  5C3I B;  5GSU D;  4NE6 A;  2UWX A;  3MNN A;  5GSU A;  5BNV B;  3LJA B;  1KX3 C;  2Y2H A;  4LD9 C;  3B0D C;  4CAY A;  3W99 B;  1KX5 D;  3EPJ A;  3LJA C;  3WAA B;  4UUZ A;  3WTP D;  5B31 A;  1H3O A;  2NZD C;  3WTP A;  3X1T C;  4Z66 D;  2JE5 A;  3W96 B;  4J8U D;  4WU9 A;  4J8U A;  1P34 B;  2Y2G A;  5B2I D;  5CPJ D;  1ID3 D;  4H9N B;  3AZF D;  3LZ0 B;  5CPJ A;  3AZG A;  5BNX B;  3X1U A;  5AV5 B;  1BFM A;  3MGP A;  4KUD A;  1TZY D;  3LZ0 C;  3C1B C;  5GT0 D;  5CPI C;  5AVB B;  5B0Y D;  1JFI A;  1ZLA A;  4KHA A;  5GT0 A;  5JA4 B;  5B0Y A;  3AN2 A;  3REL C;  2HUE C;  1P3I D;  1A7W A;  3B6F B;  4WU8 B;  1P3I A;  4G92 C;  4QLC B;  4YS3 C;  1P3P A;  2YFW A;  1P3F B;  5AV6 C;  3REK D;  1P3A B;  5FUG A;  3MGQ B;  3REK A;  2PYO D;  3MNN C;  2HIO D;  1P3F C;  2PYO A;  1R4V A;  1P3A C;  3UT9 A;  1P3M B;  4R8P B;  4KGC B;  2HIO A;  2FJ7 A;  4JJN D;  5AY8 A;  3AZM D;  4J8W B;  5B1L D;  4CSR A;  3LZ1 D;  5GXQ D;  5E5A D;  3AZI A;  3W98 A;  2VQR A;  5B31 C;  4H9P A;  5E5A A;  4XZQ B;  2NQB B;  2ZY4 A;  3A1I A;  3AFA A;  4WU9 C;  3AZN B;  5G49 B;  3AZH B;  4J8U C;  3O62 A;  5B2J B;  3EPK A;  2F8N K;  1KX4 B;  3VH5 W; 
#chains in the Genus database with same CATH homology
 4WV4 B;  3AZN C;  5CPJ C;  3AZG C;  5B2J C;  3X1U C;  3MGP C;  3REJ D;  5B0Z D;  4KUD C;  4YM6 B;  5AVC B;  4J8V B;  1ZLA C;  3C1C B;  5GT0 C;  3AYW D;  5B0Y C;  3AN2 C;  1EQZ A;  3WKJ A;  1S32 A;  5AV8 B;  4UPK A;  4E44 A;  3AZE D;  1BH8 B;  1F66 A;  3B0C W;  4H9R B;  1P3P C;  1N1J B;  3FDD A;  4ZBJ B;  4Z2M G;  3TU4 B;  2F8N D;  5AV9 A;  5GT3 B;  3A6N D;  5DNM B;  2F8N A;  2J8P A;  4EO5 C;  3A6N A;  3UT9 C;  2HIO C;  2FJ7 C;  5AY8 C;  5KDM B;  5B24 B;  4DRA A;  5B32 B;  1KX3 D;  3WA9 C;  4LD9 D;  5B40 B;  1KX3 A;  3AZI C;  3W98 C;  3LJA D;  1W2E A;  3W99 D;  5BNV A;  3LJA A;  2NZD D;  3X1T D;  1P3G B;  3W99 A;  3X1S B;  3AFA C;  3AV2 B;  3WAA A;  4ZUX B;  3O62 C;  2LY8 A;  3AV2 C;  3NQJ B;  3W96 A;  4X23 B;  4NE3 A;  2JCH A;  3B6G B;  4WNN B;  4H9Q B;  3X1V B;  1M18 B;  1P34 A;  3LZ0 D;  3C1B D;  4AWL C;  5CPI D;  4H9N A;  4DRB A;  1EQZ C;  3WKJ C;  3LZ0 A;  1P3B B;  1S32 C;  5BNX A;  5AV5 A;  3REL D;  2BYM B;  3MGR B;  4J8X B;  5AVB D;  2IO5 B;  1F66 C;  5AVB A;  4G91 C;  5DNN B;  5JA4 A;  4YS3 D;  4WU8 D;  5AV9 C;  5AV6 D;  3B6F A;  4WU8 A;  4QLC A;  2F8N H;  3MNN D;  1P3F D;  1P3A D;  3UTA B;  1P3F A;  5F99 C;  1P3A A;  1BH9 B;  3KXB B;  3MGQ A;  5C3I C;  1P3O B;  1P3M A;  4KGC A;  4R8P A;  5B31 D;  4J8W D;  3W99 C;  4J8W A;  1P3O C;  3VH6 A;  3WAA C;  3UTB B;  2RIQ A;  3KWQ B;  2Y2I A;  4WU9 D;  4XZQ A;  3W96 C;  3AZK B;  2BG1 A;  3EPH A;  3AZN D;  2NQB A;  3AZG D;  5B2J D;  3X1U D;  3AZN A;  5G49 A;  3MGP D;  3AZH A;  4KUD D;  1P34 C;  5B2J A;  3KUY B;  2RVQ C;  1ZLA D;  1KX4 A;  1B6W A;  3AN2 D;  5AV5 C;  4E45 A;  4YM6 D;  3KUY C;  3AZJ B;  4YM6 A;  5AVC A;  4J8V A;  5AVB C;  2DF4 C;  1P3K B;  3AZJ C;  5CPK B;  5AV8 D;  1P3P D;  3NQU B;  2BYK B;  5AV8 A;  3B6F C;  4WU8 C;  2CV5 B;  4WJ3 C;  2YFV B;  1BH8 A;  4QLC C;  2ZM5 A;  4H9R A;  2ZY5 A;  1N1J A;  3UT9 D;  2FJ7 D;  3TU4 A;  5AY8 D;  1P3L B;  3MGQ C;  5CHL B;  5GT3 A;  5DNM A;  3REH B;  3MGS B;  3WA9 D;  1U35 B;  1P3M C;  3AZI D;  4R8P C;  3W97 B;  3WA9 A;  3W98 D;  4KGC C;  5B32 D;  5KDM A;  5B24 A;  4J8W C;  5B32 A;  5B40 A;  3AFA D;  1HTA A;  4XZQ C;  3O62 D;  2ARO B;  3AV2 D;  1M1A B;  1P3G A;  2NQB C;  3X1S A;  3AV2 A;  3B0B A;  1Q9C A;  3LEL B;  3AZH C;  4ZUX A;  5BT1 C;  5CP6 B;  3NQJ A;  2F2A C;  4X23 A;  1KX4 C;  4NFT A;  1KX5 B;  1EQZ D;  3WKJ D;  3B6G A;  1S32 D;  3H0R C;  4WNN A;  4YM6 C;  2XD5 A;  5AVC C;  4J8V C;  4Z66 B;  4H9Q A;  3X1V A;  1M18 A;  1F66 D;  3C1C C;  1P3B A;  5AV8 C;  1M19 B;  2BYM A;  5B2I B;  3MGR A;  4J8X A;  5AV9 D;  1ID3 B;  5DNN D;  3AZF B;  5DNN A;  1B67 A;  4ZBJ C;  1TZY B;  3TU4 C;  5GT3 C;  5DNM C;  5F99 D;  3VH6 T;  3AZL B;  5F99 A;  5B1M B;  3AV1 B;  3UTA A;  5B24 C;  3AZL C;  5B32 C;  3KXB D;  2Y2L A;  5B40 C;  1BH9 A;  3KXB A;  1P3O D;  3AV1 C;  1P3O A;  3WAA D;  3IP4 C;  4Z5T B;  3W96 D;  1P3G C;  3X1S C;  1F1E A;  4ZUX C;  3UTB A;  3KWQ A;  4JJN B;  3AZM B;  5B1L B;  4X23 C;  3MVD B;  1P34 D;  3AZK A;  3LZ1 B;  5GXQ B;  2RVQ D;  3VH5 A;  3B6G C;  5BO0 B;  5AV5 D;  3X1V C;  3KUY D;  1M18 C;  3KUY A;  1P3B C;  3AZJ D;  4J8X C;  3MGR C;  2IO5 C;  3AZJ A;  1P3K D;  3B6F D;  5JRG B;  2G5H C;  1P3K A;  5DNN C;  4QLC D;  3A1K A;  3REJ B;  5B0Z B;  5CPK A;  1T3U A;  3NQU A;  2BYK A;  4HGA B;  5B33 B;  2CV5 A;  2YFV A;  3AYW B;  3MGQ D;  5BS7 A;  5B33 C;  3UTA C;  1P3M D;  4KGC D;  4R8P D;  2Y2M A;  2G5I C;  1P3L A;  3AZE B;  3KXB C;  3V9R B;  2Y2K A;  3MGS A;  3REH A;  3W97 D;  1U35 A;  3W97 A;  4XZQ D;  1HQ3 B;  3UTB C;  2NQB D;  3KWQ C;  2CWE A;  3AZH D;  3F6T A;  4H9O B;  5BT1 D;  3AZK C;  2ARO A;  2F8N G;  3B0D B;  4LD9 B;  1M1A A;  1KX4 D;  3KSY A;  3LEL D;  3EG5 B;  1TAF B;  3LEL A;  5CP6 D;  2NZD B;  5AVC D;  4J8V D;  3X1T B;  5CP6 A;  1KX5 A;  3C1C D;  3C1C A;  4Z66 A;  1P3K C;  2ZY2 A;  5CPK C;  1Z2C B;  1M19 D;  3TU4 D;  3REI B;  2CV5 C;  1M19 A;  1AOI B;  5B2I A;  3C1B B;  5GT3 D;  5DNM D;  5CPI B;  1ID3 A;  3AZF A;  5BS7 C;  3REI C;  1AOI C;  3WTP E;  3REL B;  2HUE B;  1TZY A;  1P3L C;  3KFU G;  5B24 D;  3AZL D;  3REH C;  3MGS C;  5B40 D;  3AZL A;  4G92 B;  4XUJ B;  1U35 C;  3W97 C;  5B1M D;  3AV1 D;  4YS3 B;  5B1M A;  3AV1 A;  4M6B A;  3R45 B;  4XUJ C;  5AV6 B;  1P3G D;  3VH5 T;  3X1S D;  3MNN B;  5GSU B;  4ZUX D;  4Z5T D;  2W8S A;  2ARO C;  2XD1 A;  4CAY B;  1M1A C;  4Z5T A;  2DQN C;  4X23 D;  5GSU C;  4UUZ B;  2Y2O A;  3LEL C;  2ZY3 A;  1H3O B;  5B31 B;  3B6G D;  1WWS A;  3WTP B;  3MVD D;  4JJN A;  3AZM A;  5CP6 C;  3X1V D;  5B1L A;  1M18 D;  3MVD A;  1KX5 C;  3LZ1 A;  5GXQ A;  3B0C T;  3WTP C;  3P5J B;  4WU9 B;  1P3B D;  2L5A A;  5BO0 A;  4J8U B;  4Z66 C;  4J8X D;  3MGR D;  5B31 G;  2Y2J A;  4Z2M H;  5CPJ B;  3AZG B;  3X1U B;  3MGP B;  4KUD B;  1M19 C;  5B2I C;  5JRG D;  3H0L C;  1ID3 C;  1JFI B;  3AZF C;  1ZLA B;  4KHA B;  5JRG A;  5GT0 B;  3EPL A;  5B0Y B;  3AN2 B;  3REJ A;  1TZY C;  5B0Z A;  5B33 D;  3UTA D;  1P3I B;  5B33 A;  3H0M C;  3AYW A;  1P3P B;  2YFW B;  1P3I C;  5B1M C;  5FUG B;  3REK B;  3AZE A;  4EO5 B;  2PYO B;  3V9R A;  1PZR A;  3UT9 B;  3UTB D;  2HIO B;  3KWQ D;  3REK C;  2FJ7 B;  5AY8 B;  4H9S A;  4Z5T C;  2PYO C;  1HQ3 D;  4CSR B;  3AZK D;  3WA9 B;  1HQ3 A;  3AZI B;  3W98 B;  4H9P B;  5E5A B;  4JJN C;  2Y2Q A;  3AZM C;  5B1L C;  4WZS B;  3MVD C;  3VH6 W;  4H9O A;  3LZ1 C;  4LD9 A;  5GXQ C;  5E5A C;  3AFA B;  4NE5 A;  3AL0 C;  1TAF A;  3O62 B;  2NZD A;  5B32 G;  3X1T A;  5CPK D;  4DQY B;  2CV5 D;  5JRG C;  4AWL B;  1EQZ B;  3WKJ B;  3REJ C;  5B0Z C;  1S32 B;  3REI D;  1AOI D;  2FFF B;  4HGA C;  1WWI A;  2Y2N A;  3REI A;  1AOI A;  1P3L D;  1F66 B;  1ULY A;  3C1B A;  3AYW C;  5CPI A;  3REH D;  3MGS D;  4G91 B;  1U35 D;  3REL A;  2JSS A;  5AV9 B;  3AZE C;  2F8N B;  4XUJ D;  3A6N B;  4XUJ A;  4YS3 A;  2Y2P A;  4H9S C;  3A6N C;  5AV6 A;  3R45 A;  5F99 B;  2ARO D;  1HQ3 C;  1KU5 A;  1M1A D;  1KX3 B;  5C3I B;  5GSU D;  4NE6 A;  2UWX A;  3MNN A;  5GSU A;  5BNV B;  3LJA B;  1KX3 C;  2Y2H A;  4LD9 C;  3B0D C;  4CAY A;  3W99 B;  1KX5 D;  3EPJ A;  3LJA C;  3WAA B;  4UUZ A;  3WTP D;  5B31 A;  1H3O A;  2NZD C;  3WTP A;  3X1T C;  4Z66 D;  2JE5 A;  3W96 B;  4J8U D;  4WU9 A;  4J8U A;  1P34 B;  2Y2G A;  5B2I D;  5CPJ D;  1ID3 D;  4H9N B;  3AZF D;  3LZ0 B;  5CPJ A;  3AZG A;  5BNX B;  3X1U A;  5AV5 B;  1BFM A;  3MGP A;  4KUD A;  1TZY D;  3LZ0 C;  3C1B C;  5GT0 D;  5CPI C;  5AVB B;  5B0Y D;  1JFI A;  1ZLA A;  4KHA A;  5GT0 A;  5JA4 B;  5B0Y A;  3AN2 A;  3REL C;  2HUE C;  1P3I D;  1A7W A;  3B6F B;  4WU8 B;  1P3I A;  4G92 C;  4QLC B;  4YS3 C;  1P3P A;  2YFW A;  1P3F B;  5AV6 C;  3REK D;  1P3A B;  5FUG A;  3MGQ B;  3REK A;  2PYO D;  3MNN C;  2HIO D;  1P3F C;  2PYO A;  1R4V A;  1P3A C;  3UT9 A;  1P3M B;  4R8P B;  4KGC B;  2HIO A;  2FJ7 A;  4JJN D;  5AY8 A;  3AZM D;  4J8W B;  5B1L D;  4CSR A;  3LZ1 D;  5GXQ D;  5E5A D;  3AZI A;  3W98 A;  2VQR A;  5B31 C;  4H9P A;  5E5A A;  4XZQ B;  2NQB B;  2ZY4 A;  3A1I A;  3AFA A;  4WU9 C;  3AZN B;  5G49 B;  3AZH B;  4J8U C;  3O62 A;  5B2J B;  3EPK A;  2F8N K;  1KX4 B;  3VH5 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...