3AZFB

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 29
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfB00
4KUDD 5DNNA 5GT0B 5BNXB 4M6BA 3VH6T 4JJNB 1AOIB 2CV5D 3UT9B 5C3IB 2F8NK 3B0DC 3NQUB 3X1UA 3AZEC 5B33B 5DNMA 5B1MA 3WTPC 1ID3A 2F8NB 3AZKB 2NQBB 2HIOC 5B2IC 3C1CC 1P3PB 3C1BC 5B24B 3AZHC 4G91B 2BYKA 3V9RA 4CSRB 3AZMB 4AWLB 1M1AA 3UTBA 5AV8B 3MVDA 1S32C 4XZQB 3A6NB 1BH9A 3AV1C 3O62C 3MGPB 5JRGD 5B31B 1WWSA 3X1SC 3REHA 1B67A 2RVQC 1KU5A 1KX5B 4X23A 3AN2B 1HQ3B 5B40A 5CP6A 3MGQB 5GT3C 5B0ZD 5AVBD 4QLCC 3KWQB 3AYWD 3REIB 3AZJA 3W98C 1P34D 1ZLAC 1P3IA 5DNNB 3X1TA 3LZ0C 3WKJD 5AV6A 3W96C 3MGSC 5B32A 5G49A 3AZNC 3W99A 1P3OA 1M18C 5E5AA 3W97C 4XUJA 3X1UB 5B33C 5DNMB 4WV4B 5B1MB 1P3BB 1ID3B 3KSYA 3AZED 3WA9B 2BYKB 3V9RB 3AV2C 3WTPD 1M1AB 3UTBB 4DRBA 3AZFA 3LZ1C 2HIOD 3MVDB 5B2ID 1P3KA 5AV5C 3C1CD 5GSUA 3C1BD 1BH9B 3AZHD 1S32D 4DRAA 3AV1D 3O62D 4X23B 1WWIA 3LELC 5B40B 5CP6B 3X1SD 4LD9C 2RVQD 1U35A 4ZUXA 3WAAC 5CPJC 4Z2MH 4WZSB 3AZJB 5GT3D 1P3IB 3X1TB 4NE6A 4QLCD 5AV6B 3AFAA 5B32B 3B6GB 3W98D 3W99B 1ZLAD 1P3OB 1P3FA 5E5AB 4J8XC 4XUJB 5F99C 5DNMC 3W96D 3MGSD 3AZIA 1P3BC 3AZND 1M18D 3W97D 5B33D 5CPKA 3WA9C 4YS3C 3X1VC 3AZFB 4H9QA 4YM6C 1P3KB 2LY8A 5GSUB 1P3GC 5GXQA 4ZBJC 3AV2D 4R8PA 3LZ1D 2HUEC 5AV5D 3B0BA 4Z66A 2CWEA 5B1LB 2NZDC 4WU9A 1U35B 4ZUXB 3MNNB 3RELB 1EQZA 1KX3A 2PYOA 3LELD 3TU4C 3B6FC 4LD9D 5AVCC 3LJAA 5CPJD 3WAAD 5AY8C 3AFAB 3B6GC 4UUZA 3KXBC 3REJC 1P3FB 2IO5C 3KUYA 3REKC 4H9SA 5BNVB 4WU8C 4J8XD 5F99D 5CPKB 5DNMD 5B0YA 1P3BD 4EO5B 3VH6W 4H9QB 3UTAC 2AROA 3MGRA 3WA9D 4YS3D 5GXQB 4H9PA 3X1VD 4J8UC 4R8PB 3AZGC 4YM6D 4Z66B 1P3GD 1TZYA 4J8VC 1P3LA 5B1LC 4Z5TA 3AZLA 4ZUXC 4WU9B 1P3AB 3MNNC 3RELC 1EQZB 4KGCA 1KX3B 2PYOB 4NFTA 5CPIC 1M19A 2NZDD 4KHAA 1F66A 3LJAB 2JSSA 5FUGA 3TU4D 4UUZB 4KUDA 3B6FD 5AV9B 3X1TD 2F8NG 5AVCD 3WTPE 3KUYB 4G92C 1P3MC 4H9OA 5AY8D 2CV5A 1KX4C 3B6GD 2BYMA 2FJ7B 3KXBD 3REJD 2L5AA 5GT0C 5B0YB 3REKD 1AOIC 4JJNC 4WU8D 3B0CW 3B0CT 3UT9C 5C3IC 3MGRB 5BS7C 4J8WA 4H9PB 5KDMA 3AZKC 3UTAD 2NQBC 3R45A 1P3PC 5B24C 1TZYB 5JRGA 4G91C 3AZMC 4J8UD 4AWLC 1P3LB 4Z5TB 3AZLB 1P3AC 5AV8C 3AZGD 4XZQC 3VH5A 3A6NC 4KGCB 4NE5A 3MGPC 4J8VD 5B1LD 5B31C 1M19B 4ZUXD 5B0ZA 3REHB 3MNND 5AVBA 3RELD 1F66B 3AYWA 4WNNA 5FUGB 1KX5C 3AN2C 1P34A 1HQ3C 5AV9C 4KUDB 5CPID 3MGQC 3WKJA 4H9RA 4H9OB 2CV5B 3KWQC 1BFMA 3REIC 2BYMB 2FJ7C 5DNNC 1P3MD 1KX4D 5G49B 3AZEA 5CHLB 1ULYA 5GT0D 3X1UC 3WTPA 4J8WB 1AOID 4JJND 5B1MC 2HIOA 4E45A 5B2IA 3UT9D 3C1CA 1ID3C 3C1BA 3AZHA 3R45B 5JRGB 1S32A 1M1AC 3UTBC 3VH5T 2F8ND 3AZKD 2NQBD 3AV1A 3MVDC 3O62A 1P3PD 5B24D 3X1SA 3AZMD 1BH8A 4HGAB 3REHC 1P3AD 5AV8D 1Q9CA 5AVBB 4XZQD 3A6ND 2YFWA 3AYWB 4WNNB 4X23C 3MGPD 1P34B 5GT3A 5B40C 5B31D 5CP6C 3W98B 3WKJB 4QLCA 4H9RB 1KX5D 3AN2D 1ZLAA 1HQ3D 5AV9D 3AZJC 3LZ0A 3MGQD 1P3IC 3X1TC 3W96A 3MGSA 5B2JA 3AZNA 5AV6C 3KWQD 5B32C 3REID 1M18A 2FJ7D 3W97A 3W99C 3B0DB 3AZEB 5DNND 1P3OC 5E5AC 4XUJC 4J8WC 3WTPB 3AZIB 2HIOB 5B2IB 3C1CB 3C1BB 3AZHB 4CSRA 3X1UD 3AV2A 3LZ1A 5B1MD 1S32B 1ID3D 5AV5A 3AZFC 3AV1B 1P3KC 5GSUC 3X1SB 1BH8B 1M1AD 3UTBD 3MVDD 4CAYA 2YFWB 3LELA 4LD9A 5GT3B 3REHD 3WAAA 5CPJA 1U35C 4QLCB 3NQJA 4X23D 1JFIA 1ZLAB 5B40D 5CP6D 3LZ0B 2YFVA 3W96B 3MGSB 5B2JB 3AZNB 3AFAC 3AZJD 1M18B 3W97B 4J8XA 1P3ID 5F99A 1P3FC 1P3BA 5AV6D 5B32D 3AZIC 3W99D 1P3OD 3WA9A 5E5AD 4YS3A 4XUJD 5CPKC 4J8WD 3X1VA 3AV2B 4EO5C 3LZ1B 4YM6A 5B31G 5AV5B 1B6WA 1P3GA 2AROB 5GXQC 4R8PC 2F8NH 3AZFD 1P3KD 4CAYB 1H3OA 5GSUD 3LELB 4Z66C 4LD9B 2NZDA 5JA4A 1F1EA 5CPJB 3WAAB 4WU9C 1EQZC 3TU4A 1KX3C 3NQJB 1JFIB 2PYOC 3B6FA 5AVCA 2YFVB 1U35D 4KHAB 5BT1C 3LJAC 5AY8A 3B6GA 5B2JC 3KXBA 3REJA 1R4VA 4J8XB 5F99B 3KUYC 3REKA 4WU8A 1TAFA 3AFAD 4H9SC 1N1JA 1A7WA 1P3FD 4YS3B 4Z2MG 3X1VB 4H9NA 5B0YC 3AZID 4YM6B 3UTAA 1P3GB 2AROC 3MGRC 5CPKD 4ZBJB 4J8UA 3AZGA 2HUEB 5KDMB 1H3OB 4J8VA 1TZYC 5B1LA 5GXQD 2NZDB 5JA4B 1P3LC 4R8PD 3MNNA 4Z5TC 3RELA 3AZLC 3VH5W 5BO0A 4Z66D 3TU4B 4KGCC 3B6FB 5CPIA 5B32G 5AVCB 1M19C 4WU9D 1F66C 5B0ZB 5AY8B 1EQZD 1KX3D 2PYOD 3LZ0D 3KXBB 3REJB 4KUDC 2IO5B 4NE3A 1P3MA 3LJAD 5BT1D 5B2JD 1KX4A 3REKB 5BNVA 3W98A 2CV5C 4WU8B 1TAFB 1N1JB 5GT0A 5BNXA 3KUYD 1AOIA 4JJNA 4H9NB 3UT9A 3VH6A 3UTAB 3NQUA 5BS7A 5B33A 4J8UB 5B0YD 2F8NA 3AZKA 3AZGB 2NQBA 4E44A 1P3PA 2AROD 5B24A 3MGRD 4J8VB 3AZMA 5JRGC 1P3AA 5AV8A 4XZQA 3A6NA 5BO0B 3MGPA 3O62B 1TZYD 5B31A 5CPIB 1P3LD 4Z5TD 4HGAC 3AZLD 5B0ZC 5AVBC 1KX5A 3AN2A 4KGCD 3AYWC 1HQ3A 1HTAA 5AV9A 3MGQA 1P34C 1M19D 4G92B 1P3MB 1F66D 3WKJC 3KWQA 1KX4B 3REIA 2FJ7A
chains in the Genus database with same CATH superfamily
4KUDD 5DNNA 5GT0B 5BNXB 4M6BA 3VH6T 4JJNB 1AOIB 2CV5D 3UT9B 5C3IB 2F8NK 3B0DC 3NQUB 3X1UA 3AZEC 5B33B 5DNMA 5B1MA 3WTPC 1ID3A 2F8NB 3AZKB 2NQBB 2HIOC 5B2IC 3C1CC 1P3PB 3C1BC 5B24B 3AZHC 4G91B 2BYKA 3V9RA 4CSRB 3AZMB 4AWLB 1M1AA 3UTBA 5AV8B 2JCHA 3MVDA 1S32C 4XZQB 3A6NB 1BH9A 3AV1C 3O62C 3MGPB 5JRGD 5B31B 1WWSA 3X1SC 3REHA 1B67A 2RVQC 1KU5A 1KX5B 4X23A 3AN2B 1HQ3B 5B40A 5CP6A 3MGQB 5GT3C 5B0ZD 5AVBD 3A1IA 4QLCC 3KWQB 3AYWD 3REIB 3AZJA 3W98C 1P34D 1ZLAC 1P3IA 5DNNB 3X1TA 3LZ0C 3WKJD 5AV6A 3W96C 3MGSC 5B32A 5G49A 3AZNC 3W99A 1P3OA 1M18C 5E5AA 3W97C 3KFUG 4XUJA 3X1UB 5B33C 5DNMB 2ZY5A 4WV4B 5B1MB 1P3BB 1ID3B 3KSYA 3AZED 3WA9B 2BYKB 3V9RB 3AV2C 3WTPD 1M1AB 3UTBB 4DRBA 3AZFA 3LZ1C 2HIOD 3MVDB 5B2ID 1P3KA 5AV5C 3C1CD 5GSUA 3C1BD 1BH9B 3AZHD 3EPJA 1S32D 2ZY2A 4DRAA 3AV1D 3O62D 4X23B 1WWIA 3LELC 5B40B 5CP6B 3X1SD 4LD9C 2RVQD 1U35A 4ZUXA 3WAAC 5CPJC 4Z2MH 4WZSB 3AZJB 2ZY3A 5GT3D 1P3IB 3X1TB 4NE6A 3EG5B 4QLCD 5AV6B 3AFAA 5B32B 3B6GB 3W98D 3W99B 1ZLAD 1P3OB 1P3FA 5E5AB 4J8XC 4XUJB 5F99C 5DNMC 3W96D 3MGSD 3AZIA 1P3BC 3AZND 1M18D 1W2EA 3W97D 5B33D 3EPKA 5CPKA 4YS3C 3WA9C 3X1VC 3AZFB 4H9QA 4YM6C 1P3KB 2LY8A 5GSUB 1P3GC 5GXQA 4ZBJC 3AV2D 4R8PA 3LZ1D 3EPHA 2HUEC 5AV5D 3B0BA 4Z66A 2CWEA 5B1LB 2NZDC 4WU9A 1U35B 4ZUXB 3MNNB 3RELB 1EQZA 1KX3A 2PYOA 3LELD 3TU4C 3B6FC 4LD9D 5AVCC 3LJAA 5CPJD 3WAAD 2ZM5A 5AY8C 3AFAB 3B6GC 4UUZA 2Y2JA 3KXBC 3REJC 1P3FB 2IO5C 3KUYA 3REKC 4H9SA 5BNVB 4WU8C 2XD5A 4J8XD 5F99D 5CPKB 5DNMD 5B0YA 2Y2QA 1P3BD 4EO5B 3VH6W 2Y2OA 4H9QB 3UTAC 2AROA 3MGRA 3WA9D 4YS3D 5GXQB 4H9PA 3X1VD 4J8UC 4R8PB 3AZGC 4YM6D 4Z66B 1P3GD 1TZYA 4J8VC 1P3LA 5B1LC 4Z5TA 3AZLA 4ZUXC 4WU9B 1P3AB 3MNNC 3RELC 1EQZB 4KGCA 1KX3B 2PYOB 2Y2MA 4NFTA 5CPIC 1M19A 1PZRA 2NZDD 4KHAA 1F66A 2Y2GA 3LJAB 2JSSA 5FUGA 3TU4D 4UUZB 4KUDA 3B6FD 5AV9B 3X1TD 2F8NG 5AVCD 3WTPE 3KUYB 4G92C 1P3MC 4H9OA 5AY8D 2CV5A 1KX4C 3B6GD 2BYMA 3IP4C 2FJ7B 3KXBD 3REJD 2L5AA 5GT0C 5B0YB 3REKD 1AOIC 4JJNC 4WU8D 3B0CW 3B0CT 3UT9C 5C3IC 3MGRB 5BS7C 4J8WA 4H9PB 5KDMA 3AZKC 3UTAD 2NQBC 3R45A 3FDDA 2Y2NA 1P3PC 5B24C 1TZYB 5JRGA 4G91C 3AZMC 4J8UD 4AWLC 1P3LB 4Z5TB 3AZLB 1P3AC 5AV8C 3AZGD 4XZQC 3VH5A 3A6NC 4KGCB 4NE5A 3MGPC 4J8VD 5B1LD 5B31C 1M19B 4ZUXD 5B0ZA 3REHB 3MNND 5AVBA 3RELD 1F66B 2Y2HA 3AYWA 4WNNA 5FUGB 1KX5C 3AN2C 1P34A 1HQ3C 5AV9C 4KUDB 5CPID 3MGQC 3WKJA 4H9RA 4H9OB 2CV5B 3KWQC 1BFMA 3REIC 2BYMB 2FJ7C 2G5IC 5DNNC 1P3MD 1KX4D 5G49B 3AZEA 5CHLB 1ULYA 5GT0D 3X1UC 3WTPA 4J8WB 1AOID 4JJND 5B1MC 2HIOA 4E45A 5B2IA 3UT9D 3C1CA 1ID3C 3C1BA 3AZHA 3R45B 2FFFB 5JRGB 1S32A 1M1AC 3UTBC 3VH5T 1Z2CB 3AZKD 2F8ND 3AV1A 3MVDC 2NQBD 3O62A 1P3PD 5B24D 3X1SA 3AZMD 1BH8A 2DQNC 4HGAB 3REHC 1P3AD 5AV8D 1Q9CA 5AVBB 4XZQD 3A6ND 2YFWA 2VQRA 4WNNB 3AYWB 4X23C 3MGPD 1P34B 5GT3A 5B40C 5B31D 5CP6C 3W98B 2DF4C 2RIQA 3WKJB 4QLCA 4H9RB 1KX5D 3AN2D 1ZLAA 1HQ3D 5AV9D 3AZJC 3LZ0A 3MGQD 1P3IC 3X1TC 3W96A 3MGSA 5B2JA 3AZNA 5AV6C 3KWQD 5B32C 3REID 1M18A 2FJ7D 3W97A 3W99C 3B0DB 3F6TA 3AZEB 5DNND 1P3OC 5E5AC 4XUJC 4J8WC 3WTPB 3AZIB 2HIOB 5B2IB 3C1CB 3C1BB 3AZHB 4CSRA 3X1UD 3AV2A 3LZ1A 5B1MD 1S32B 1ID3D 5AV5A 3AZFC 3AV1B 2Y2LA 3A1KA 1P3KC 5GSUC 3H0LC 3X1SB 1BH8B 1M1AD 3UTBD 3MVDD 4CAYA 2YFWB 3LELA 4LD9A 5GT3B 3REHD 3WAAA 5CPJA 1U35C 2G5HC 4QLCB 2W8SA 3NQJA 4X23D 1JFIA 1ZLAB 5B40D 5CP6D 3LZ0B 2YFVA 3W96B 3MGSB 5B2JB 3AZNB 3AFAC 3AZJD 3H0RC 1M18B 3W97B 4J8XA 1P3ID 5F99A 1P3FC 1P3BA 5AV6D 5B32D 3AZIC 3W99D 1P3OD 3WA9A 5E5AD 4YS3A 2BG1A 4XUJD 5CPKC 4J8WD 3X1VA 3AV2B 4EO5C 3LZ1B 4YM6A 5B31G 5AV5B 1B6WA 1P3GA 2AROB 2XD1A 5GXQC 4R8PC 2F8NH 3AZFD 2JE5A 2ZY4A 4CAYB 1P3KD 1H3OA 5GSUD 3LELB 4Z66C 2UWXA 4LD9B 2Y2IA 2NZDA 5JA4A 1F1EA 5CPJB 3WAAB 4WU9C 1EQZC 3TU4A 1KX3C 3NQJB 1JFIB 2PYOC 3B6FA 5AVCA 2YFVB 1U35D 4KHAB 5BT1C 3LJAC 5AY8A 3B6GA 5B2JC 3P5JB 3KXBA 3REJA 1R4VA 4J8XB 5F99B 3KUYC 3REKA 4WJ3C 4WU8A 1TAFA 3AFAD 4H9SC 1N1JA 1A7WA 1P3FD 4YS3B 4Z2MG 3H0MC 3X1VB 4H9NA 5B0YC 3AZID 4UPKA 4YM6B 3UTAA 1P3GB 2AROC 3MGRC 5CPKD 4ZBJB 4J8UA 3AZGA 2HUEB 5KDMB 1H3OB 4J8VA 1TZYC 5B1LA 5GXQD 2NZDB 5JA4B 1P3LC 4R8PD 3MNNA 4Z5TC 3RELA 3AZLC 3VH5W 5BO0A 4Z66D 4DQYB 3TU4B 4KGCC 3B6FB 5CPIA 3AL0C 5B32G 5AVCB 1M19C 4WU9D 1F66C 5B0ZB 5AY8B 1EQZD 1KX3D 2PYOD 3LZ0D 3KXBB 3REJB 4KUDC 2IO5B 4NE3A 1T3UA 1P3MA 3LJAD 5BT1D 5B2JD 1KX4A 3REKB 5BNVA 3W98A 2CV5C 4WU8B 1TAFB 1N1JB 5GT0A 5BNXA 3KUYD 1AOIA 4JJNA 4H9NB 3UT9A 3VH6A 3UTAB 3NQUA 5BS7A 5B33A 4J8UB 5B0YD 2F8NA 3AZKA 3AZGB 2NQBA 4E44A 1P3PA 2AROD 5B24A 3MGRD 4J8VB 3AZMA 5JRGC 1P3AA 5AV8A 2F2AC 2Y2KA 4XZQA 3EPLA 3A6NA 5BO0B 3MGPA 3O62B 1TZYD 2Y2PA 5B31A 5CPIB 1P3LD 4Z5TD 4HGAC 3AZLD 2J8PA 5B0ZC 5AVBC 1KX5A 3AN2A 4KGCD 3AYWC 1HQ3A 1HTAA 5AV9A 3MGQA 1P34C 1M19D 4G92B 1P3MB 1F66D 3WKJC 3KWQA 1KX4B 3REIA 2FJ7A
chains in the Genus database with same CATH topology
4KUDD 5DNNA 5GT0B 5BNXB 4M6BA 3VH6T 4JJNB 1AOIB 2CV5D 3UT9B 5C3IB 2F8NK 3B0DC 3NQUB 3X1UA 3AZEC 5B33B 5DNMA 5B1MA 3WTPC 1ID3A 2F8NB 3AZKB 2NQBB 2HIOC 5B2IC 3C1CC 1P3PB 3C1BC 5B24B 3AZHC 4G91B 2BYKA 3V9RA 4CSRB 3AZMB 4AWLB 1M1AA 3UTBA 5AV8B 2JCHA 3MVDA 1S32C 4XZQB 3A6NB 1BH9A 3AV1C 3O62C 3MGPB 5JRGD 5B31B 1WWSA 3X1SC 3REHA 1B67A 2RVQC 1KU5A 1KX5B 4X23A 3AN2B 1HQ3B 5B40A 5CP6A 3MGQB 5GT3C 5B0ZD 5AVBD 3A1IA 4QLCC 3KWQB 3AYWD 3REIB 3AZJA 3W98C 1P34D 1ZLAC 1P3IA 5DNNB 3X1TA 3LZ0C 3WKJD 5AV6A 3W96C 3MGSC 5B32A 5G49A 3AZNC 3W99A 1P3OA 1M18C 5E5AA 3W97C 3KFUG 4XUJA 3X1UB 5B33C 5DNMB 2ZY5A 4WV4B 5B1MB 1P3BB 1ID3B 3KSYA 3AZED 3WA9B 2BYKB 3V9RB 3AV2C 3WTPD 1M1AB 3UTBB 4DRBA 3AZFA 3LZ1C 2HIOD 3MVDB 5B2ID 1P3KA 5AV5C 3C1CD 5GSUA 3C1BD 1BH9B 3AZHD 3EPJA 1S32D 2ZY2A 4DRAA 3AV1D 3O62D 4X23B 1WWIA 3LELC 5B40B 5CP6B 3X1SD 4LD9C 2RVQD 1U35A 4ZUXA 3WAAC 5CPJC 4Z2MH 4WZSB 3AZJB 2ZY3A 5GT3D 1P3IB 3X1TB 4NE6A 3EG5B 4QLCD 5AV6B 3AFAA 5B32B 3B6GB 3W98D 3W99B 1ZLAD 1P3OB 1P3FA 5E5AB 4J8XC 4XUJB 5F99C 5DNMC 3W96D 3MGSD 3AZIA 1P3BC 3AZND 1M18D 1W2EA 3W97D 5B33D 3EPKA 5CPKA 4YS3C 3WA9C 3X1VC 3AZFB 4H9QA 4YM6C 1P3KB 2LY8A 5GSUB 1P3GC 5GXQA 4ZBJC 3AV2D 4R8PA 3LZ1D 3EPHA 2HUEC 5AV5D 3B0BA 4Z66A 2CWEA 5B1LB 2NZDC 4WU9A 1U35B 4ZUXB 3MNNB 3RELB 1EQZA 1KX3A 2PYOA 3LELD 3TU4C 3B6FC 4LD9D 5AVCC 3LJAA 5CPJD 3WAAD 2ZM5A 5AY8C 3AFAB 3B6GC 4UUZA 2Y2JA 3KXBC 3REJC 1P3FB 2IO5C 3KUYA 3REKC 4H9SA 5BNVB 4WU8C 2XD5A 4J8XD 5F99D 5CPKB 5DNMD 5B0YA 2Y2QA 1P3BD 4EO5B 3VH6W 2Y2OA 4H9QB 3UTAC 2AROA 3MGRA 3WA9D 4YS3D 5GXQB 4H9PA 3X1VD 4J8UC 4R8PB 3AZGC 4YM6D 4Z66B 1P3GD 1TZYA 4J8VC 1P3LA 5B1LC 4Z5TA 3AZLA 4ZUXC 4WU9B 1P3AB 3MNNC 3RELC 1EQZB 4KGCA 1KX3B 2PYOB 2Y2MA 4NFTA 5CPIC 1M19A 1PZRA 2NZDD 4KHAA 1F66A 2Y2GA 3LJAB 2JSSA 5FUGA 3TU4D 4UUZB 4KUDA 3B6FD 5AV9B 3X1TD 2F8NG 5AVCD 3WTPE 3KUYB 4G92C 1P3MC 4H9OA 5AY8D 2CV5A 1KX4C 3B6GD 2BYMA 3IP4C 2FJ7B 3KXBD 3REJD 2L5AA 5GT0C 5B0YB 3REKD 1AOIC 4JJNC 4WU8D 3B0CW 3B0CT 3UT9C 5C3IC 3MGRB 5BS7C 4J8WA 4H9PB 5KDMA 3AZKC 3UTAD 2NQBC 3R45A 3FDDA 2Y2NA 1P3PC 5B24C 1TZYB 5JRGA 4G91C 3AZMC 4J8UD 4AWLC 1P3LB 4Z5TB 3AZLB 1P3AC 5AV8C 3AZGD 4XZQC 3VH5A 3A6NC 4KGCB 4NE5A 3MGPC 4J8VD 5B1LD 5B31C 1M19B 4ZUXD 5B0ZA 3REHB 3MNND 5AVBA 3RELD 1F66B 2Y2HA 3AYWA 4WNNA 5FUGB 1KX5C 3AN2C 1P34A 1HQ3C 5AV9C 4KUDB 5CPID 3MGQC 3WKJA 4H9RA 4H9OB 2CV5B 3KWQC 1BFMA 3REIC 2BYMB 2FJ7C 2G5IC 5DNNC 1P3MD 1KX4D 5G49B 3AZEA 5CHLB 1ULYA 5GT0D 3X1UC 3WTPA 4J8WB 1AOID 4JJND 5B1MC 2HIOA 4E45A 5B2IA 3UT9D 3C1CA 1ID3C 3C1BA 3AZHA 3R45B 2FFFB 5JRGB 1S32A 1M1AC 3UTBC 3VH5T 1Z2CB 3AZKD 2F8ND 3AV1A 3MVDC 2NQBD 3O62A 1P3PD 5B24D 3X1SA 3AZMD 1BH8A 2DQNC 4HGAB 3REHC 1P3AD 5AV8D 1Q9CA 5AVBB 4XZQD 3A6ND 2YFWA 2VQRA 4WNNB 3AYWB 4X23C 3MGPD 1P34B 5GT3A 5B40C 5B31D 5CP6C 3W98B 2DF4C 2RIQA 3WKJB 4QLCA 4H9RB 1KX5D 3AN2D 1ZLAA 1HQ3D 5AV9D 3AZJC 3LZ0A 3MGQD 1P3IC 3X1TC 3W96A 3MGSA 5B2JA 3AZNA 5AV6C 3KWQD 5B32C 3REID 1M18A 2FJ7D 3W97A 3W99C 3B0DB 3F6TA 3AZEB 5DNND 1P3OC 5E5AC 4XUJC 4J8WC 3WTPB 3AZIB 2HIOB 5B2IB 3C1CB 3C1BB 3AZHB 4CSRA 3X1UD 3AV2A 3LZ1A 5B1MD 1S32B 1ID3D 5AV5A 3AZFC 3AV1B 2Y2LA 3A1KA 1P3KC 5GSUC 3H0LC 3X1SB 1BH8B 1M1AD 3UTBD 3MVDD 4CAYA 2YFWB 3LELA 4LD9A 5GT3B 3REHD 3WAAA 5CPJA 1U35C 2G5HC 4QLCB 2W8SA 3NQJA 4X23D 1JFIA 1ZLAB 5B40D 5CP6D 3LZ0B 2YFVA 3W96B 3MGSB 5B2JB 3AZNB 3AFAC 3AZJD 3H0RC 1M18B 3W97B 4J8XA 1P3ID 5F99A 1P3FC 1P3BA 5AV6D 5B32D 3AZIC 3W99D 1P3OD 3WA9A 5E5AD 4YS3A 2BG1A 4XUJD 5CPKC 4J8WD 3X1VA 3AV2B 4EO5C 3LZ1B 4YM6A 5B31G 5AV5B 1B6WA 1P3GA 2AROB 2XD1A 5GXQC 4R8PC 2F8NH 3AZFD 2JE5A 2ZY4A 4CAYB 1P3KD 1H3OA 5GSUD 3LELB 4Z66C 2UWXA 4LD9B 2Y2IA 2NZDA 5JA4A 1F1EA 5CPJB 3WAAB 4WU9C 1EQZC 3TU4A 1KX3C 3NQJB 1JFIB 2PYOC 3B6FA 5AVCA 2YFVB 1U35D 4KHAB 5BT1C 3LJAC 5AY8A 3B6GA 5B2JC 3P5JB 3KXBA 3REJA 1R4VA 4J8XB 5F99B 3KUYC 3REKA 4WJ3C 4WU8A 1TAFA 3AFAD 4H9SC 1N1JA 1A7WA 1P3FD 4YS3B 4Z2MG 3H0MC 3X1VB 4H9NA 5B0YC 3AZID 4UPKA 4YM6B 3UTAA 1P3GB 2AROC 3MGRC 5CPKD 4ZBJB 4J8UA 3AZGA 2HUEB 5KDMB 1H3OB 4J8VA 1TZYC 5B1LA 5GXQD 2NZDB 5JA4B 1P3LC 4R8PD 3MNNA 4Z5TC 3RELA 3AZLC 3VH5W 5BO0A 4Z66D 4DQYB 3TU4B 4KGCC 3B6FB 5CPIA 3AL0C 5B32G 5AVCB 1M19C 4WU9D 1F66C 5B0ZB 5AY8B 1EQZD 1KX3D 2PYOD 3LZ0D 3KXBB 3REJB 4KUDC 2IO5B 4NE3A 1T3UA 1P3MA 3LJAD 5BT1D 5B2JD 1KX4A 3REKB 5BNVA 3W98A 2CV5C 4WU8B 1TAFB 1N1JB 5GT0A 5BNXA 3KUYD 1AOIA 4JJNA 4H9NB 3UT9A 3VH6A 3UTAB 3NQUA 5BS7A 5B33A 4J8UB 5B0YD 2F8NA 3AZKA 3AZGB 2NQBA 4E44A 1P3PA 2AROD 5B24A 3MGRD 4J8VB 3AZMA 5JRGC 1P3AA 5AV8A 2F2AC 2Y2KA 4XZQA 3EPLA 3A6NA 5BO0B 3MGPA 3O62B 1TZYD 2Y2PA 5B31A 5CPIB 1P3LD 4Z5TD 4HGAC 3AZLD 2J8PA 5B0ZC 5AVBC 1KX5A 3AN2A 4KGCD 3AYWC 1HQ3A 1HTAA 5AV9A 3MGQA 1P34C 1M19D 4G92B 1P3MB 1F66D 3WKJC 3KWQA 1KX4B 3REIA 2FJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUD D;  5DNN A;  5GT0 B;  5BNX B;  4M6B A;  3VH6 T;  4JJN B;  1AOI B;  2CV5 D;  3UT9 B;  5C3I B;  2F8N K;  3B0D C;  3NQU B;  3X1U A;  3AZE C;  5B33 B;  5DNM A;  5B1M A;  3WTP C;  1ID3 A;  2F8N B;  3AZK B;  2NQB B;  2HIO C;  5B2I C;  3C1C C;  1P3P B;  3C1B C;  5B24 B;  3AZH C;  4G91 B;  2BYK A;  3V9R A;  4CSR B;  3AZM B;  4AWL B;  1M1A A;  3UTB A;  5AV8 B;  3MVD A;  1S32 C;  4XZQ B;  3A6N B;  1BH9 A;  3AV1 C;  3O62 C;  3MGP B;  5JRG D;  5B31 B;  1WWS A;  3X1S C;  3REH A;  1B67 A;  2RVQ C;  1KU5 A;  1KX5 B;  4X23 A;  3AN2 B;  1HQ3 B;  5B40 A;  5CP6 A;  3MGQ B;  5GT3 C;  5B0Z D;  5AVB D;  4QLC C;  3KWQ B;  3AYW D;  3REI B;  3AZJ A;  3W98 C;  1P34 D;  1ZLA C;  1P3I A;  5DNN B;  3X1T A;  3LZ0 C;  3WKJ D;  5AV6 A;  3W96 C;  3MGS C;  5B32 A;  5G49 A;  3AZN C;  3W99 A;  1P3O A;  1M18 C;  5E5A A;  3W97 C;  4XUJ A;  3X1U B;  5B33 C;  5DNM B;  4WV4 B;  5B1M B;  1P3B B;  1ID3 B;  3KSY A;  3AZE D;  3WA9 B;  2BYK B;  3V9R B;  3AV2 C;  3WTP D;  1M1A B;  3UTB B;  4DRB A;  3AZF A;  3LZ1 C;  2HIO D;  3MVD B;  5B2I D;  1P3K A;  5AV5 C;  3C1C D;  5GSU A;  3C1B D;  1BH9 B;  3AZH D;  1S32 D;  4DRA A;  3AV1 D;  3O62 D;  4X23 B;  1WWI A;  3LEL C;  5B40 B;  5CP6 B;  3X1S D;  4LD9 C;  2RVQ D;  1U35 A;  4ZUX A;  3WAA C;  5CPJ C;  4Z2M H;  4WZS B;  3AZJ B;  5GT3 D;  1P3I B;  3X1T B;  4NE6 A;  4QLC D;  5AV6 B;  3AFA A;  5B32 B;  3B6G B;  3W98 D;  3W99 B;  1ZLA D;  1P3O B;  1P3F A;  5E5A B;  4J8X C;  4XUJ B;  5F99 C;  5DNM C;  3W96 D;  3MGS D;  3AZI A;  1P3B C;  3AZN D;  1M18 D;  3W97 D;  5B33 D;  5CPK A;  3WA9 C;  4YS3 C;  3X1V C;  3AZF B;  4H9Q A;  4YM6 C;  1P3K B;  2LY8 A;  5GSU B;  1P3G C;  5GXQ A;  4ZBJ C;  3AV2 D;  4R8P A;  3LZ1 D;  2HUE C;  5AV5 D;  3B0B A;  4Z66 A;  2CWE A;  5B1L B;  2NZD C;  4WU9 A;  1U35 B;  4ZUX B;  3MNN B;  3REL B;  1EQZ A;  1KX3 A;  2PYO A;  3LEL D;  3TU4 C;  3B6F C;  4LD9 D;  5AVC C;  3LJA A;  5CPJ D;  3WAA D;  5AY8 C;  3AFA B;  3B6G C;  4UUZ A;  3KXB C;  3REJ C;  1P3F B;  2IO5 C;  3KUY A;  3REK C;  4H9S A;  5BNV B;  4WU8 C;  4J8X D;  5F99 D;  5CPK B;  5DNM D;  5B0Y A;  1P3B D;  4EO5 B;  3VH6 W;  4H9Q B;  3UTA C;  2ARO A;  3MGR A;  3WA9 D;  4YS3 D;  5GXQ B;  4H9P A;  3X1V D;  4J8U C;  4R8P B;  3AZG C;  4YM6 D;  4Z66 B;  1P3G D;  1TZY A;  4J8V C;  1P3L A;  5B1L C;  4Z5T A;  3AZL A;  4ZUX C;  4WU9 B;  1P3A B;  3MNN C;  3REL C;  1EQZ B;  4KGC A;  1KX3 B;  2PYO B;  4NFT A;  5CPI C;  1M19 A;  2NZD D;  4KHA A;  1F66 A;  3LJA B;  2JSS A;  5FUG A;  3TU4 D;  4UUZ B;  4KUD A;  3B6F D;  5AV9 B;  3X1T D;  2F8N G;  5AVC D;  3WTP E;  3KUY B;  4G92 C;  1P3M C;  4H9O A;  5AY8 D;  2CV5 A;  1KX4 C;  3B6G D;  2BYM A;  2FJ7 B;  3KXB D;  3REJ D;  2L5A A;  5GT0 C;  5B0Y B;  3REK D;  1AOI C;  4JJN C;  4WU8 D;  3B0C W;  3B0C T;  3UT9 C;  5C3I C;  3MGR B;  5BS7 C;  4J8W A;  4H9P B;  5KDM A;  3AZK C;  3UTA D;  2NQB C;  3R45 A;  1P3P C;  5B24 C;  1TZY B;  5JRG A;  4G91 C;  3AZM C;  4J8U D;  4AWL C;  1P3L B;  4Z5T B;  3AZL B;  1P3A C;  5AV8 C;  3AZG D;  4XZQ C;  3VH5 A;  3A6N C;  4KGC B;  4NE5 A;  3MGP C;  4J8V D;  5B1L D;  5B31 C;  1M19 B;  4ZUX D;  5B0Z A;  3REH B;  3MNN D;  5AVB A;  3REL D;  1F66 B;  3AYW A;  4WNN A;  5FUG B;  1KX5 C;  3AN2 C;  1P34 A;  1HQ3 C;  5AV9 C;  4KUD B;  5CPI D;  3MGQ C;  3WKJ A;  4H9R A;  4H9O B;  2CV5 B;  3KWQ C;  1BFM A;  3REI C;  2BYM B;  2FJ7 C;  5DNN C;  1P3M D;  1KX4 D;  5G49 B;  3AZE A;  5CHL B;  1ULY A;  5GT0 D;  3X1U C;  3WTP A;  4J8W B;  1AOI D;  4JJN D;  5B1M C;  2HIO A;  4E45 A;  5B2I A;  3UT9 D;  3C1C A;  1ID3 C;  3C1B A;  3AZH A;  3R45 B;  5JRG B;  1S32 A;  1M1A C;  3UTB C;  3VH5 T;  2F8N D;  3AZK D;  2NQB D;  3AV1 A;  3MVD C;  3O62 A;  1P3P D;  5B24 D;  3X1S A;  3AZM D;  1BH8 A;  4HGA B;  3REH C;  1P3A D;  5AV8 D;  1Q9C A;  5AVB B;  4XZQ D;  3A6N D;  2YFW A;  3AYW B;  4WNN B;  4X23 C;  3MGP D;  1P34 B;  5GT3 A;  5B40 C;  5B31 D;  5CP6 C;  3W98 B;  3WKJ B;  4QLC A;  4H9R B;  1KX5 D;  3AN2 D;  1ZLA A;  1HQ3 D;  5AV9 D;  3AZJ C;  3LZ0 A;  3MGQ D;  1P3I C;  3X1T C;  3W96 A;  3MGS A;  5B2J A;  3AZN A;  5AV6 C;  3KWQ D;  5B32 C;  3REI D;  1M18 A;  2FJ7 D;  3W97 A;  3W99 C;  3B0D B;  3AZE B;  5DNN D;  1P3O C;  5E5A C;  4XUJ C;  4J8W C;  3WTP B;  3AZI B;  2HIO B;  5B2I B;  3C1C B;  3C1B B;  3AZH B;  4CSR A;  3X1U D;  3AV2 A;  3LZ1 A;  5B1M D;  1S32 B;  1ID3 D;  5AV5 A;  3AZF C;  3AV1 B;  1P3K C;  5GSU C;  3X1S B;  1BH8 B;  1M1A D;  3UTB D;  3MVD D;  4CAY A;  2YFW B;  3LEL A;  4LD9 A;  5GT3 B;  3REH D;  3WAA A;  5CPJ A;  1U35 C;  4QLC B;  3NQJ A;  4X23 D;  1JFI A;  1ZLA B;  5B40 D;  5CP6 D;  3LZ0 B;  2YFV A;  3W96 B;  3MGS B;  5B2J B;  3AZN B;  3AFA C;  3AZJ D;  1M18 B;  3W97 B;  4J8X A;  1P3I D;  5F99 A;  1P3F C;  1P3B A;  5AV6 D;  5B32 D;  3AZI C;  3W99 D;  1P3O D;  3WA9 A;  5E5A D;  4YS3 A;  4XUJ D;  5CPK C;  4J8W D;  3X1V A;  3AV2 B;  4EO5 C;  3LZ1 B;  4YM6 A;  5B31 G;  5AV5 B;  1B6W A;  1P3G A;  2ARO B;  5GXQ C;  4R8P C;  2F8N H;  3AZF D;  1P3K D;  4CAY B;  1H3O A;  5GSU D;  3LEL B;  4Z66 C;  4LD9 B;  2NZD A;  5JA4 A;  1F1E A;  5CPJ B;  3WAA B;  4WU9 C;  1EQZ C;  3TU4 A;  1KX3 C;  3NQJ B;  1JFI B;  2PYO C;  3B6F A;  5AVC A;  2YFV B;  1U35 D;  4KHA B;  5BT1 C;  3LJA C;  5AY8 A;  3B6G A;  5B2J C;  3KXB A;  3REJ A;  1R4V A;  4J8X B;  5F99 B;  3KUY C;  3REK A;  4WU8 A;  1TAF A;  3AFA D;  4H9S C;  1N1J A;  1A7W A;  1P3F D;  4YS3 B;  4Z2M G;  3X1V B;  4H9N A;  5B0Y C;  3AZI D;  4YM6 B;  3UTA A;  1P3G B;  2ARO C;  3MGR C;  5CPK D;  4ZBJ B;  4J8U A;  3AZG A;  2HUE B;  5KDM B;  1H3O B;  4J8V A;  1TZY C;  5B1L A;  5GXQ D;  2NZD B;  5JA4 B;  1P3L C;  4R8P D;  3MNN A;  4Z5T C;  3REL A;  3AZL C;  3VH5 W;  5BO0 A;  4Z66 D;  3TU4 B;  4KGC C;  3B6F B;  5CPI A;  5B32 G;  5AVC B;  1M19 C;  4WU9 D;  1F66 C;  5B0Z B;  5AY8 B;  1EQZ D;  1KX3 D;  2PYO D;  3LZ0 D;  3KXB B;  3REJ B;  4KUD C;  2IO5 B;  4NE3 A;  1P3M A;  3LJA D;  5BT1 D;  5B2J D;  1KX4 A;  3REK B;  5BNV A;  3W98 A;  2CV5 C;  4WU8 B;  1TAF B;  1N1J B;  5GT0 A;  5BNX A;  3KUY D;  1AOI A;  4JJN A;  4H9N B;  3UT9 A;  3VH6 A;  3UTA B;  3NQU A;  5BS7 A;  5B33 A;  4J8U B;  5B0Y D;  2F8N A;  3AZK A;  3AZG B;  2NQB A;  4E44 A;  1P3P A;  2ARO D;  5B24 A;  3MGR D;  4J8V B;  3AZM A;  5JRG C;  1P3A A;  5AV8 A;  4XZQ A;  3A6N A;  5BO0 B;  3MGP A;  3O62 B;  1TZY D;  5B31 A;  5CPI B;  1P3L D;  4Z5T D;  4HGA C;  3AZL D;  5B0Z C;  5AVB C;  1KX5 A;  3AN2 A;  4KGC D;  3AYW C;  1HQ3 A;  1HTA A;  5AV9 A;  3MGQ A;  1P34 C;  1M19 D;  4G92 B;  1P3M B;  1F66 D;  3WKJ C;  3KWQ A;  1KX4 B;  3REI A;  2FJ7 A; 
#chains in the Genus database with same CATH topology
 4KUD D;  5DNN A;  5GT0 B;  5BNX B;  4M6B A;  3VH6 T;  4JJN B;  1AOI B;  2CV5 D;  3UT9 B;  5C3I B;  2F8N K;  3B0D C;  3NQU B;  3X1U A;  3AZE C;  5B33 B;  5DNM A;  5B1M A;  3WTP C;  1ID3 A;  2F8N B;  3AZK B;  2NQB B;  2HIO C;  5B2I C;  3C1C C;  1P3P B;  3C1B C;  5B24 B;  3AZH C;  4G91 B;  2BYK A;  3V9R A;  4CSR B;  3AZM B;  4AWL B;  1M1A A;  3UTB A;  5AV8 B;  2JCH A;  3MVD A;  1S32 C;  4XZQ B;  3A6N B;  1BH9 A;  3AV1 C;  3O62 C;  3MGP B;  5JRG D;  5B31 B;  1WWS A;  3X1S C;  3REH A;  1B67 A;  2RVQ C;  1KU5 A;  1KX5 B;  4X23 A;  3AN2 B;  1HQ3 B;  5B40 A;  5CP6 A;  3MGQ B;  5GT3 C;  5B0Z D;  5AVB D;  3A1I A;  4QLC C;  3KWQ B;  3AYW D;  3REI B;  3AZJ A;  3W98 C;  1P34 D;  1ZLA C;  1P3I A;  5DNN B;  3X1T A;  3LZ0 C;  3WKJ D;  5AV6 A;  3W96 C;  3MGS C;  5B32 A;  5G49 A;  3AZN C;  3W99 A;  1P3O A;  1M18 C;  5E5A A;  3W97 C;  3KFU G;  4XUJ A;  3X1U B;  5B33 C;  5DNM B;  2ZY5 A;  4WV4 B;  5B1M B;  1P3B B;  1ID3 B;  3KSY A;  3AZE D;  3WA9 B;  2BYK B;  3V9R B;  3AV2 C;  3WTP D;  1M1A B;  3UTB B;  4DRB A;  3AZF A;  3LZ1 C;  2HIO D;  3MVD B;  5B2I D;  1P3K A;  5AV5 C;  3C1C D;  5GSU A;  3C1B D;  1BH9 B;  3AZH D;  3EPJ A;  1S32 D;  2ZY2 A;  4DRA A;  3AV1 D;  3O62 D;  4X23 B;  1WWI A;  3LEL C;  5B40 B;  5CP6 B;  3X1S D;  4LD9 C;  2RVQ D;  1U35 A;  4ZUX A;  3WAA C;  5CPJ C;  4Z2M H;  4WZS B;  3AZJ B;  2ZY3 A;  5GT3 D;  1P3I B;  3X1T B;  4NE6 A;  3EG5 B;  4QLC D;  5AV6 B;  3AFA A;  5B32 B;  3B6G B;  3W98 D;  3W99 B;  1ZLA D;  1P3O B;  1P3F A;  5E5A B;  4J8X C;  4XUJ B;  5F99 C;  5DNM C;  3W96 D;  3MGS D;  3AZI A;  1P3B C;  3AZN D;  1M18 D;  1W2E A;  3W97 D;  5B33 D;  3EPK A;  5CPK A;  4YS3 C;  3WA9 C;  3X1V C;  3AZF B;  4H9Q A;  4YM6 C;  1P3K B;  2LY8 A;  5GSU B;  1P3G C;  5GXQ A;  4ZBJ C;  3AV2 D;  4R8P A;  3LZ1 D;  3EPH A;  2HUE C;  5AV5 D;  3B0B A;  4Z66 A;  2CWE A;  5B1L B;  2NZD C;  4WU9 A;  1U35 B;  4ZUX B;  3MNN B;  3REL B;  1EQZ A;  1KX3 A;  2PYO A;  3LEL D;  3TU4 C;  3B6F C;  4LD9 D;  5AVC C;  3LJA A;  5CPJ D;  3WAA D;  2ZM5 A;  5AY8 C;  3AFA B;  3B6G C;  4UUZ A;  2Y2J A;  3KXB C;  3REJ C;  1P3F B;  2IO5 C;  3KUY A;  3REK C;  4H9S A;  5BNV B;  4WU8 C;  2XD5 A;  4J8X D;  5F99 D;  5CPK B;  5DNM D;  5B0Y A;  2Y2Q A;  1P3B D;  4EO5 B;  3VH6 W;  2Y2O A;  4H9Q B;  3UTA C;  2ARO A;  3MGR A;  3WA9 D;  4YS3 D;  5GXQ B;  4H9P A;  3X1V D;  4J8U C;  4R8P B;  3AZG C;  4YM6 D;  4Z66 B;  1P3G D;  1TZY A;  4J8V C;  1P3L A;  5B1L C;  4Z5T A;  3AZL A;  4ZUX C;  4WU9 B;  1P3A B;  3MNN C;  3REL C;  1EQZ B;  4KGC A;  1KX3 B;  2PYO B;  2Y2M A;  4NFT A;  5CPI C;  1M19 A;  1PZR A;  2NZD D;  4KHA A;  1F66 A;  2Y2G A;  3LJA B;  2JSS A;  5FUG A;  3TU4 D;  4UUZ B;  4KUD A;  3B6F D;  5AV9 B;  3X1T D;  2F8N G;  5AVC D;  3WTP E;  3KUY B;  4G92 C;  1P3M C;  4H9O A;  5AY8 D;  2CV5 A;  1KX4 C;  3B6G D;  2BYM A;  3IP4 C;  2FJ7 B;  3KXB D;  3REJ D;  2L5A A;  5GT0 C;  5B0Y B;  3REK D;  1AOI C;  4JJN C;  4WU8 D;  3B0C W;  3B0C T;  3UT9 C;  5C3I C;  3MGR B;  5BS7 C;  4J8W A;  4H9P B;  5KDM A;  3AZK C;  3UTA D;  2NQB C;  3R45 A;  3FDD A;  2Y2N A;  1P3P C;  5B24 C;  1TZY B;  5JRG A;  4G91 C;  3AZM C;  4J8U D;  4AWL C;  1P3L B;  4Z5T B;  3AZL B;  1P3A C;  5AV8 C;  3AZG D;  4XZQ C;  3VH5 A;  3A6N C;  4KGC B;  4NE5 A;  3MGP C;  4J8V D;  5B1L D;  5B31 C;  1M19 B;  4ZUX D;  5B0Z A;  3REH B;  3MNN D;  5AVB A;  3REL D;  1F66 B;  2Y2H A;  3AYW A;  4WNN A;  5FUG B;  1KX5 C;  3AN2 C;  1P34 A;  1HQ3 C;  5AV9 C;  4KUD B;  5CPI D;  3MGQ C;  3WKJ A;  4H9R A;  4H9O B;  2CV5 B;  3KWQ C;  1BFM A;  3REI C;  2BYM B;  2FJ7 C;  2G5I C;  5DNN C;  1P3M D;  1KX4 D;  5G49 B;  3AZE A;  5CHL B;  1ULY A;  5GT0 D;  3X1U C;  3WTP A;  4J8W B;  1AOI D;  4JJN D;  5B1M C;  2HIO A;  4E45 A;  5B2I A;  3UT9 D;  3C1C A;  1ID3 C;  3C1B A;  3AZH A;  3R45 B;  2FFF B;  5JRG B;  1S32 A;  1M1A C;  3UTB C;  3VH5 T;  1Z2C B;  3AZK D;  2F8N D;  3AV1 A;  3MVD C;  2NQB D;  3O62 A;  1P3P D;  5B24 D;  3X1S A;  3AZM D;  1BH8 A;  2DQN C;  4HGA B;  3REH C;  1P3A D;  5AV8 D;  1Q9C A;  5AVB B;  4XZQ D;  3A6N D;  2YFW A;  2VQR A;  4WNN B;  3AYW B;  4X23 C;  3MGP D;  1P34 B;  5GT3 A;  5B40 C;  5B31 D;  5CP6 C;  3W98 B;  2DF4 C;  2RIQ A;  3WKJ B;  4QLC A;  4H9R B;  1KX5 D;  3AN2 D;  1ZLA A;  1HQ3 D;  5AV9 D;  3AZJ C;  3LZ0 A;  3MGQ D;  1P3I C;  3X1T C;  3W96 A;  3MGS A;  5B2J A;  3AZN A;  5AV6 C;  3KWQ D;  5B32 C;  3REI D;  1M18 A;  2FJ7 D;  3W97 A;  3W99 C;  3B0D B;  3F6T A;  3AZE B;  5DNN D;  1P3O C;  5E5A C;  4XUJ C;  4J8W C;  3WTP B;  3AZI B;  2HIO B;  5B2I B;  3C1C B;  3C1B B;  3AZH B;  4CSR A;  3X1U D;  3AV2 A;  3LZ1 A;  5B1M D;  1S32 B;  1ID3 D;  5AV5 A;  3AZF C;  3AV1 B;  2Y2L A;  3A1K A;  1P3K C;  5GSU C;  3H0L C;  3X1S B;  1BH8 B;  1M1A D;  3UTB D;  3MVD D;  4CAY A;  2YFW B;  3LEL A;  4LD9 A;  5GT3 B;  3REH D;  3WAA A;  5CPJ A;  1U35 C;  2G5H C;  4QLC B;  2W8S A;  3NQJ A;  4X23 D;  1JFI A;  1ZLA B;  5B40 D;  5CP6 D;  3LZ0 B;  2YFV A;  3W96 B;  3MGS B;  5B2J B;  3AZN B;  3AFA C;  3AZJ D;  3H0R C;  1M18 B;  3W97 B;  4J8X A;  1P3I D;  5F99 A;  1P3F C;  1P3B A;  5AV6 D;  5B32 D;  3AZI C;  3W99 D;  1P3O D;  3WA9 A;  5E5A D;  4YS3 A;  2BG1 A;  4XUJ D;  5CPK C;  4J8W D;  3X1V A;  3AV2 B;  4EO5 C;  3LZ1 B;  4YM6 A;  5B31 G;  5AV5 B;  1B6W A;  1P3G A;  2ARO B;  2XD1 A;  5GXQ C;  4R8P C;  2F8N H;  3AZF D;  2JE5 A;  2ZY4 A;  4CAY B;  1P3K D;  1H3O A;  5GSU D;  3LEL B;  4Z66 C;  2UWX A;  4LD9 B;  2Y2I A;  2NZD A;  5JA4 A;  1F1E A;  5CPJ B;  3WAA B;  4WU9 C;  1EQZ C;  3TU4 A;  1KX3 C;  3NQJ B;  1JFI B;  2PYO C;  3B6F A;  5AVC A;  2YFV B;  1U35 D;  4KHA B;  5BT1 C;  3LJA C;  5AY8 A;  3B6G A;  5B2J C;  3P5J B;  3KXB A;  3REJ A;  1R4V A;  4J8X B;  5F99 B;  3KUY C;  3REK A;  4WJ3 C;  4WU8 A;  1TAF A;  3AFA D;  4H9S C;  1N1J A;  1A7W A;  1P3F D;  4YS3 B;  4Z2M G;  3H0M C;  3X1V B;  4H9N A;  5B0Y C;  3AZI D;  4UPK A;  4YM6 B;  3UTA A;  1P3G B;  2ARO C;  3MGR C;  5CPK D;  4ZBJ B;  4J8U A;  3AZG A;  2HUE B;  5KDM B;  1H3O B;  4J8V A;  1TZY C;  5B1L A;  5GXQ D;  2NZD B;  5JA4 B;  1P3L C;  4R8P D;  3MNN A;  4Z5T C;  3REL A;  3AZL C;  3VH5 W;  5BO0 A;  4Z66 D;  4DQY B;  3TU4 B;  4KGC C;  3B6F B;  5CPI A;  3AL0 C;  5B32 G;  5AVC B;  1M19 C;  4WU9 D;  1F66 C;  5B0Z B;  5AY8 B;  1EQZ D;  1KX3 D;  2PYO D;  3LZ0 D;  3KXB B;  3REJ B;  4KUD C;  2IO5 B;  4NE3 A;  1T3U A;  1P3M A;  3LJA D;  5BT1 D;  5B2J D;  1KX4 A;  3REK B;  5BNV A;  3W98 A;  2CV5 C;  4WU8 B;  1TAF B;  1N1J B;  5GT0 A;  5BNX A;  3KUY D;  1AOI A;  4JJN A;  4H9N B;  3UT9 A;  3VH6 A;  3UTA B;  3NQU A;  5BS7 A;  5B33 A;  4J8U B;  5B0Y D;  2F8N A;  3AZK A;  3AZG B;  2NQB A;  4E44 A;  1P3P A;  2ARO D;  5B24 A;  3MGR D;  4J8V B;  3AZM A;  5JRG C;  1P3A A;  5AV8 A;  2F2A C;  2Y2K A;  4XZQ A;  3EPL A;  3A6N A;  5BO0 B;  3MGP A;  3O62 B;  1TZY D;  2Y2P A;  5B31 A;  5CPI B;  1P3L D;  4Z5T D;  4HGA C;  3AZL D;  2J8P A;  5B0Z C;  5AVB C;  1KX5 A;  3AN2 A;  4KGC D;  3AYW C;  1HQ3 A;  1HTA A;  5AV9 A;  3MGQ A;  1P34 C;  1M19 D;  4G92 B;  1P3M B;  1F66 D;  3WKJ C;  3KWQ A;  1KX4 B;  3REI A;  2FJ7 A; 
#chains in the Genus database with same CATH homology
 4KUD D;  5DNN A;  5GT0 B;  5BNX B;  4M6B A;  3VH6 T;  4JJN B;  1AOI B;  2CV5 D;  3UT9 B;  5C3I B;  2F8N K;  3B0D C;  3NQU B;  3X1U A;  3AZE C;  5B33 B;  5DNM A;  5B1M A;  3WTP C;  1ID3 A;  2F8N B;  3AZK B;  2NQB B;  2HIO C;  5B2I C;  3C1C C;  1P3P B;  3C1B C;  5B24 B;  3AZH C;  4G91 B;  2BYK A;  3V9R A;  4CSR B;  3AZM B;  4AWL B;  1M1A A;  3UTB A;  5AV8 B;  2JCH A;  3MVD A;  1S32 C;  4XZQ B;  3A6N B;  1BH9 A;  3AV1 C;  3O62 C;  3MGP B;  5JRG D;  5B31 B;  1WWS A;  3X1S C;  3REH A;  1B67 A;  2RVQ C;  1KU5 A;  1KX5 B;  4X23 A;  3AN2 B;  1HQ3 B;  5B40 A;  5CP6 A;  3MGQ B;  5GT3 C;  5B0Z D;  5AVB D;  3A1I A;  4QLC C;  3KWQ B;  3AYW D;  3REI B;  3AZJ A;  3W98 C;  1P34 D;  1ZLA C;  1P3I A;  5DNN B;  3X1T A;  3LZ0 C;  3WKJ D;  5AV6 A;  3W96 C;  3MGS C;  5B32 A;  5G49 A;  3AZN C;  3W99 A;  1P3O A;  1M18 C;  5E5A A;  3W97 C;  3KFU G;  4XUJ A;  3X1U B;  5B33 C;  5DNM B;  2ZY5 A;  4WV4 B;  5B1M B;  1P3B B;  1ID3 B;  3KSY A;  3AZE D;  3WA9 B;  2BYK B;  3V9R B;  3AV2 C;  3WTP D;  1M1A B;  3UTB B;  4DRB A;  3AZF A;  3LZ1 C;  2HIO D;  3MVD B;  5B2I D;  1P3K A;  5AV5 C;  3C1C D;  5GSU A;  3C1B D;  1BH9 B;  3AZH D;  3EPJ A;  1S32 D;  2ZY2 A;  4DRA A;  3AV1 D;  3O62 D;  4X23 B;  1WWI A;  3LEL C;  5B40 B;  5CP6 B;  3X1S D;  4LD9 C;  2RVQ D;  1U35 A;  4ZUX A;  3WAA C;  5CPJ C;  4Z2M H;  4WZS B;  3AZJ B;  2ZY3 A;  5GT3 D;  1P3I B;  3X1T B;  4NE6 A;  3EG5 B;  4QLC D;  5AV6 B;  3AFA A;  5B32 B;  3B6G B;  3W98 D;  3W99 B;  1ZLA D;  1P3O B;  1P3F A;  5E5A B;  4J8X C;  4XUJ B;  5F99 C;  5DNM C;  3W96 D;  3MGS D;  3AZI A;  1P3B C;  3AZN D;  1M18 D;  1W2E A;  3W97 D;  5B33 D;  3EPK A;  5CPK A;  4YS3 C;  3WA9 C;  3X1V C;  3AZF B;  4H9Q A;  4YM6 C;  1P3K B;  2LY8 A;  5GSU B;  1P3G C;  5GXQ A;  4ZBJ C;  3AV2 D;  4R8P A;  3LZ1 D;  3EPH A;  2HUE C;  5AV5 D;  3B0B A;  4Z66 A;  2CWE A;  5B1L B;  2NZD C;  4WU9 A;  1U35 B;  4ZUX B;  3MNN B;  3REL B;  1EQZ A;  1KX3 A;  2PYO A;  3LEL D;  3TU4 C;  3B6F C;  4LD9 D;  5AVC C;  3LJA A;  5CPJ D;  3WAA D;  2ZM5 A;  5AY8 C;  3AFA B;  3B6G C;  4UUZ A;  2Y2J A;  3KXB C;  3REJ C;  1P3F B;  2IO5 C;  3KUY A;  3REK C;  4H9S A;  5BNV B;  4WU8 C;  2XD5 A;  4J8X D;  5F99 D;  5CPK B;  5DNM D;  5B0Y A;  2Y2Q A;  1P3B D;  4EO5 B;  3VH6 W;  2Y2O A;  4H9Q B;  3UTA C;  2ARO A;  3MGR A;  3WA9 D;  4YS3 D;  5GXQ B;  4H9P A;  3X1V D;  4J8U C;  4R8P B;  3AZG C;  4YM6 D;  4Z66 B;  1P3G D;  1TZY A;  4J8V C;  1P3L A;  5B1L C;  4Z5T A;  3AZL A;  4ZUX C;  4WU9 B;  1P3A B;  3MNN C;  3REL C;  1EQZ B;  4KGC A;  1KX3 B;  2PYO B;  2Y2M A;  4NFT A;  5CPI C;  1M19 A;  1PZR A;  2NZD D;  4KHA A;  1F66 A;  2Y2G A;  3LJA B;  2JSS A;  5FUG A;  3TU4 D;  4UUZ B;  4KUD A;  3B6F D;  5AV9 B;  3X1T D;  2F8N G;  5AVC D;  3WTP E;  3KUY B;  4G92 C;  1P3M C;  4H9O A;  5AY8 D;  2CV5 A;  1KX4 C;  3B6G D;  2BYM A;  3IP4 C;  2FJ7 B;  3KXB D;  3REJ D;  2L5A A;  5GT0 C;  5B0Y B;  3REK D;  1AOI C;  4JJN C;  4WU8 D;  3B0C W;  3B0C T;  3UT9 C;  5C3I C;  3MGR B;  5BS7 C;  4J8W A;  4H9P B;  5KDM A;  3AZK C;  3UTA D;  2NQB C;  3R45 A;  3FDD A;  2Y2N A;  1P3P C;  5B24 C;  1TZY B;  5JRG A;  4G91 C;  3AZM C;  4J8U D;  4AWL C;  1P3L B;  4Z5T B;  3AZL B;  1P3A C;  5AV8 C;  3AZG D;  4XZQ C;  3VH5 A;  3A6N C;  4KGC B;  4NE5 A;  3MGP C;  4J8V D;  5B1L D;  5B31 C;  1M19 B;  4ZUX D;  5B0Z A;  3REH B;  3MNN D;  5AVB A;  3REL D;  1F66 B;  2Y2H A;  3AYW A;  4WNN A;  5FUG B;  1KX5 C;  3AN2 C;  1P34 A;  1HQ3 C;  5AV9 C;  4KUD B;  5CPI D;  3MGQ C;  3WKJ A;  4H9R A;  4H9O B;  2CV5 B;  3KWQ C;  1BFM A;  3REI C;  2BYM B;  2FJ7 C;  2G5I C;  5DNN C;  1P3M D;  1KX4 D;  5G49 B;  3AZE A;  5CHL B;  1ULY A;  5GT0 D;  3X1U C;  3WTP A;  4J8W B;  1AOI D;  4JJN D;  5B1M C;  2HIO A;  4E45 A;  5B2I A;  3UT9 D;  3C1C A;  1ID3 C;  3C1B A;  3AZH A;  3R45 B;  2FFF B;  5JRG B;  1S32 A;  1M1A C;  3UTB C;  3VH5 T;  1Z2C B;  3AZK D;  2F8N D;  3AV1 A;  3MVD C;  2NQB D;  3O62 A;  1P3P D;  5B24 D;  3X1S A;  3AZM D;  1BH8 A;  2DQN C;  4HGA B;  3REH C;  1P3A D;  5AV8 D;  1Q9C A;  5AVB B;  4XZQ D;  3A6N D;  2YFW A;  2VQR A;  4WNN B;  3AYW B;  4X23 C;  3MGP D;  1P34 B;  5GT3 A;  5B40 C;  5B31 D;  5CP6 C;  3W98 B;  2DF4 C;  2RIQ A;  3WKJ B;  4QLC A;  4H9R B;  1KX5 D;  3AN2 D;  1ZLA A;  1HQ3 D;  5AV9 D;  3AZJ C;  3LZ0 A;  3MGQ D;  1P3I C;  3X1T C;  3W96 A;  3MGS A;  5B2J A;  3AZN A;  5AV6 C;  3KWQ D;  5B32 C;  3REI D;  1M18 A;  2FJ7 D;  3W97 A;  3W99 C;  3B0D B;  3F6T A;  3AZE B;  5DNN D;  1P3O C;  5E5A C;  4XUJ C;  4J8W C;  3WTP B;  3AZI B;  2HIO B;  5B2I B;  3C1C B;  3C1B B;  3AZH B;  4CSR A;  3X1U D;  3AV2 A;  3LZ1 A;  5B1M D;  1S32 B;  1ID3 D;  5AV5 A;  3AZF C;  3AV1 B;  2Y2L A;  3A1K A;  1P3K C;  5GSU C;  3H0L C;  3X1S B;  1BH8 B;  1M1A D;  3UTB D;  3MVD D;  4CAY A;  2YFW B;  3LEL A;  4LD9 A;  5GT3 B;  3REH D;  3WAA A;  5CPJ A;  1U35 C;  2G5H C;  4QLC B;  2W8S A;  3NQJ A;  4X23 D;  1JFI A;  1ZLA B;  5B40 D;  5CP6 D;  3LZ0 B;  2YFV A;  3W96 B;  3MGS B;  5B2J B;  3AZN B;  3AFA C;  3AZJ D;  3H0R C;  1M18 B;  3W97 B;  4J8X A;  1P3I D;  5F99 A;  1P3F C;  1P3B A;  5AV6 D;  5B32 D;  3AZI C;  3W99 D;  1P3O D;  3WA9 A;  5E5A D;  4YS3 A;  2BG1 A;  4XUJ D;  5CPK C;  4J8W D;  3X1V A;  3AV2 B;  4EO5 C;  3LZ1 B;  4YM6 A;  5B31 G;  5AV5 B;  1B6W A;  1P3G A;  2ARO B;  2XD1 A;  5GXQ C;  4R8P C;  2F8N H;  3AZF D;  2JE5 A;  2ZY4 A;  4CAY B;  1P3K D;  1H3O A;  5GSU D;  3LEL B;  4Z66 C;  2UWX A;  4LD9 B;  2Y2I A;  2NZD A;  5JA4 A;  1F1E A;  5CPJ B;  3WAA B;  4WU9 C;  1EQZ C;  3TU4 A;  1KX3 C;  3NQJ B;  1JFI B;  2PYO C;  3B6F A;  5AVC A;  2YFV B;  1U35 D;  4KHA B;  5BT1 C;  3LJA C;  5AY8 A;  3B6G A;  5B2J C;  3P5J B;  3KXB A;  3REJ A;  1R4V A;  4J8X B;  5F99 B;  3KUY C;  3REK A;  4WJ3 C;  4WU8 A;  1TAF A;  3AFA D;  4H9S C;  1N1J A;  1A7W A;  1P3F D;  4YS3 B;  4Z2M G;  3H0M C;  3X1V B;  4H9N A;  5B0Y C;  3AZI D;  4UPK A;  4YM6 B;  3UTA A;  1P3G B;  2ARO C;  3MGR C;  5CPK D;  4ZBJ B;  4J8U A;  3AZG A;  2HUE B;  5KDM B;  1H3O B;  4J8V A;  1TZY C;  5B1L A;  5GXQ D;  2NZD B;  5JA4 B;  1P3L C;  4R8P D;  3MNN A;  4Z5T C;  3REL A;  3AZL C;  3VH5 W;  5BO0 A;  4Z66 D;  4DQY B;  3TU4 B;  4KGC C;  3B6F B;  5CPI A;  3AL0 C;  5B32 G;  5AVC B;  1M19 C;  4WU9 D;  1F66 C;  5B0Z B;  5AY8 B;  1EQZ D;  1KX3 D;  2PYO D;  3LZ0 D;  3KXB B;  3REJ B;  4KUD C;  2IO5 B;  4NE3 A;  1T3U A;  1P3M A;  3LJA D;  5BT1 D;  5B2J D;  1KX4 A;  3REK B;  5BNV A;  3W98 A;  2CV5 C;  4WU8 B;  1TAF B;  1N1J B;  5GT0 A;  5BNX A;  3KUY D;  1AOI A;  4JJN A;  4H9N B;  3UT9 A;  3VH6 A;  3UTA B;  3NQU A;  5BS7 A;  5B33 A;  4J8U B;  5B0Y D;  2F8N A;  3AZK A;  3AZG B;  2NQB A;  4E44 A;  1P3P A;  2ARO D;  5B24 A;  3MGR D;  4J8V B;  3AZM A;  5JRG C;  1P3A A;  5AV8 A;  2F2A C;  2Y2K A;  4XZQ A;  3EPL A;  3A6N A;  5BO0 B;  3MGP A;  3O62 B;  1TZY D;  2Y2P A;  5B31 A;  5CPI B;  1P3L D;  4Z5T D;  4HGA C;  3AZL D;  2J8P A;  5B0Z C;  5AVB C;  1KX5 A;  3AN2 A;  4KGC D;  3AYW C;  1HQ3 A;  1HTA A;  5AV9 A;  3MGQ A;  1P34 C;  1M19 D;  4G92 B;  1P3M B;  1F66 D;  3WKJ C;  3KWQ A;  1KX4 B;  3REI A;  2FJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...