3AZFB

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfB00
3MNNA 3AZJD 5AY8A 5AV5B 3TU4C 4QLCD 2NZDB 3WTPA 1M19C 3REKB 1KX3A 1ULYA 2IO5B 3B0CW 3AZNC 5BNXB 3AYWD 4X23B 1P3BB 3NQUB 3B6FB 4YS3A 4J8VB 3W98C 3AZID 4Z5TD 3KXBD 2F8NH 4H9OA 5AVCC 3AZHC 3KWQA 4R8PB 3UT9D 5BT1C 5B0YD 3MGQA 3AZKA 4WU8D 5E5AC 4YM6A 4H9PB 3LJAB 3KUYA 3W97D 3W99D 1P3AA 3UTBC 1HQ3A 3A6NA 1P3OB 3AZGA 5AVBD 4WNNA 5JRGA 3REIB 5GSUB 1F66D 2BYMA 3AN2C 4ZUXA 3X1VC 5G49B 1P3KC 1ID3A 5B2JD 4NE5A 2HIOB 4UUZB 1ZLAA 5B31C 3REJC 4CSRA 3NQJB 3VH6W 4XZQD 5AV8B 3B0DC 4QLCA 1H3OB 3UTAD 1P3IA 1P3FC 5BO0A 4KGCC 4H9SC 3AZLB 1P34B 3WA9C 4HGAC 3AV1C 3VH6A 3AYWA 1EQZC 4AWLC 2YFVA 3RELD 3AZMD 5CPKA 1P3PA 4Z5TA 3C1BB 1U35C 3B0BA 1S32A 3UT9A 1R4VA 5B0YA 5B0ZD 3UTBD 3WKJC 3W97A 1M18D 4WU9C 4J8WD 3AZFA 1KX5A 5AVBA 4JJNC 4J8XA 3LZ1A 5F99D 1F66A 3R45A 1TZYC 5AV5C 4KUDA 1KX4B 4H9QA 5B2JA 4H9NA 1M19B 3TU4A 1Q9CA 5B2IC 1P3LC 3X1TD 5FUGA 1AOID 5GXQD 3MGSD 3MGRB 4X23C 1P3BC 3X1SD 3WAAB 3UTAA 3B6FC 3AZNA 4J8VC 5B40B 4Z2MH 5DNNB 4KHAB 5AVCB 5KDMA 2CV5D 2PYOD 4R8PC 3MVDD 1M1AB 5BNVA 2F8NB 3RELA 3AZHA 4J8UD 3LJAC 3C1CD 4ZBJC 5E5AA 4Z66B 1P3OC 3UTBA 3MGPB 1P3GD 3REIC 5GSUC 1P3MB 5AY8D 5B24C 3X1VB 2HIOC 5B31B 3REJB 1KX3D 1P3KA 2NZDD 4DRAA 3REKD 5AV8C 3X1UB 2FJ7D 5CPJB 1P34C 3AZLC 3AV1B 1P3FA 1TAFA 1AOIA 4KGCA 1N1JA 4H9SA 3MGSA 1EQZB 3WA9A 3KWQD 2AROB 3MGQD 3AZKD 4G91C 3KUYD 1P3AD 2CV5A 3MVDA 1BFMA 1U35A 4J8UA 5JRGD 3B0CT 1P3OD 2F8NG 4WU9B 5GSUD 5GT3C 2BYKB 4JJNB 1ZLAD 3REHB 1P3GA 1TZYB 4H9RB 2RVQC 5GT0B 5AV6D 2NQBC 1KX4C 1P3ID 5AV5A 5B2IB 1P3LB 1A7WA 2NZDA 5B31G 4EO5C 1BH8B 5B1MB 3REKA 3MGRC 5C3IC 3WAAC 5BS7C 3AV2B 1JFIB 2FJ7A 5BNXA 5CPKD 1P3BA 1P3PD 3O62C 3NQUA 5B40C 3B6FA 4WV4B 4J8VA 5DNNC 5DNMB 4XUJB 1S32D 3C1BD 3AZEC 1M1AC 3V9RB 4LD9B 3LELC 2L5AA 3VH6T 4ZBJB 4NFTA 4Z66C 4H9PA 3LJAA 3AZFD 1KX5D 3MGPC 4J8XD 4E44A 3LZ1D 1P3OA 1P3MC 4CAYB 5B24B 3WTPE 4KUDD 3W96B 3REIA 5GSUA 5B33B 4NE3A 4H9OB 3TU4D 3B6GC 2HIOA 4UUZA 5AV6A 1M19D 3AFAB 4YM6B 3NQJA 3X1UC 3AZND 5AV8A 5CPJC 1H3OA 3W98D 1P34A 3AZLA 5JA4B 5DNND 5AVCD 2AROC 4ZUXB 5CP6B 5B32B 3AZHD 4G91B 5B1LB 5BT1D 2F8ND 5E5AD 3AZJB 5CPIC 3C1BA 4Z2MG 5GT3B 3AN2D 3X1VD 1P3KD 3REHC 2NQBB 5GT0C 5AV9C 5B31D 3AZIB 3REJD 3KXBB 1HTAA 1KX4A 2CWEA 3UT9B 1M19A 1P3FD 4EO5B 5B0YB 4KGCD 5B1MC 3WA9D 4WU8B 1WWIA 5C3IB 3AV1D 3AV2C 3W99B 1EQZD 3O62B 3W98A 5DNMC 5AVBB 5B40A 4XUJC 3MNNC 3AZEB 5DNNA 1F66B 5AVCA 1U35D 4LD9C 3LELB 4G92B 2F8NA 3WTPC 5B32G 3WKJD 5FUGB 4XZQB 4WU9D 3UTAB 3LZ0B 4YS3C 3MGPA 4JJND 3W96C 1P3MA 1TZYD 5B33C 3AN2A 5AV5D 3X1VA 3B6GB 5B31A 3REJA 5B2ID 3RELB 3AZMB 1P3LD 3AFAC 4YM6C 4X23D 1P3BD 3B6FD 3X1UA 1HQ3C 3A6NC 5B0ZB 4J8VD 5CPJA 3AZGC 3AV1A 4XUJD 4ZUXC 5CP6C 1M18B 1EQZA 5B32C 4R8PD 4J8WB 1ID3C 2AROA 5B1LC 5F99B 5CPIB 3KSYA 3AZJC 3LJAD 2YFWB 4QLCC 3X1TB 3WKJA 3REID 5B24D 5GXQB 4WU9A 3X1SB 5AV9B 2HIOD 2BYKA 4JJNA 3AZIC 2JSSA 2HUEB 4Z5TC 3REHA 1TZYA 4H9RA 3KXBC 2PYOB 5AV8D 3UT9C 5B2IA 1P3LA 5B0YC 4J8UB 1BH9B 3AZLD 4WU8C 1P34D 3VH5W 1BH8A 5B1MA 3W97C 3W99C 3C1CB 4X23A 3AV2A 1JFIA 5AVBC 3VH5A 3MNNB 1P3GB 5AY8B 1F66C 5DNMA 4XUJA 1WWSA 4R8PA 5B2JC 3WTPB 3V9RA 4G92C 4LD9A 1KX3B 4XZQC 5GT3D 3UTAC 1F1EA 3LZ0C 4YS3B 2FJ7B 5CHLB 2NQBD 2RVQD 4CAYA 5B24A 3W96A 1KX4D 5G49A 4DRBA 3KWQB 5B33A 1KU5A 3RELC 3AZMC 3MGQB 3AZKB 3KUYB 1P3AB 3AFAA 3MGRD 3WAAD 1HQ3B 3A6NB 3AZGB 5B0ZC 5B40D 4WNNB 5JRGB 3O62D 2BYMB 5JA4A 1M18C 1ID3B 4J8WC 3AZED 1M1AD 5CP6A 1ZLAB 5B32A 4CSRB 3LELD 5B1LA 5F99C 5AV6B 4QLCB 3AZJA 4Z66D 1P3IB 5BO0B 3MGPD 3X1TC 1P3MD 3LZ0D 1AOIC 5GXQC 3AYWB 3MGSC 3X1SC 5GT3A 2YFVB 3B6GD 5CPKB 1P3PB 4Z5TB 2HUEC 2NQBA 3AZIA 2CV5C 1S32B 2PYOC 3KXBA 3MVDC 3X1UD 5CPJD 4J8UC 3W97B 3MGRA 4WU8A 3C1CC 3WAAA 5BS7A 3AZFB 2AROD 3W99A 1KX5B 3O62A 4J8XB 3LZ1B 1P3GC 3R45B 4KHAA 5AY8C 4KUDB 4WZSB 4H9QB 5B2JB 4H9NB 3AZEA 5CPID 1M1AA 3TU4B 1KX3C 3LELA 2NZDC 3REKC 4Z66A 2IO5C 3AZNB 2FJ7C 4XZQA 3REHD 3LZ0A 5AV9D 5GT0D 3W98B 5KDMB 3KWQC 5BNVB 3B6GA 3AZHB 3MGQC 3AZKC 3KUYC 5B1MD 3AZMA 1P3AC 5E5AB 3AV2D 3UTBB 5JRGC 5DNMD 5B0ZA 3MNND 3AN2B 4LD9D 1M18A 1ZLAC 4NE6A 1P3KB 4J8WA 3WTPD 5AV6C 5F99A 5CPIA 1P3IC 2YFWA 3B0DB 3VH5T 1TAFB 1P3FB 4YS3D 1AOIB 4KGCB 1N1JB 3WA9B 3MGSB 3X1TA 4HGAB 3AYWC 3W96D 5B33D 5GXQA 4E45A 5CPKC 1P3PC 3X1SA 5GT0A 5AV9A 4AWLB 1B6WA 3AFAD 2CV5B 4YM6D 3MVDB 1S32C 2F8NK 3C1BC 1U35B 2PYOA 2LY8A 1B67A 1HQ3D 3A6ND 3AZGD 1BH9A 3WKJB 3AZFC 4ZUXD 4M6BA 5CP6D 3C1CA 5B32D 1KX5C 4J8XC 1ID3D 3LZ1C 5B1LD 4KUDC
chains in the Genus database with same CATH superfamily
3MNNA 3AZJD 5AY8A 5AV5B 3TU4C 4QLCD 2NZDB 3WTPA 1M19C 3REKB 1KX3A 1ULYA 2IO5B 3B0CW 3AZNC 5BNXB 3AYWD 4X23B 1P3BB 3NQUB 3B6FB 4YS3A 4J8VB 3W98C 3AZID 4Z5TD 3KXBD 2F8NH 4H9OA 5AVCC 3AZHC 3KWQA 4R8PB 3UT9D 5BT1C 5B0YD 3MGQA 2G5IC 3AZKA 3EPLA 5E5AC 4YM6A 4WU8D 4H9PB 4UPKA 3LJAB 3KUYA 3W97D 3W99D 1P3AA 3UTBC 1HQ3A 3A6NA 1P3OB 2W8SA 3AZGA 5AVBD 4WNNA 5JRGA 3REIB 5GSUB 1F66D 2BYMA 3AN2C 4ZUXA 3X1VC 2ZY4A 5G49B 1P3KC 1ID3A 5B2JD 4NE5A 2HIOB 4UUZB 1ZLAA 5B31C 2Y2KA 4CSRA 3REJC 3NQJB 3VH6W 4XZQD 5AV8B 3B0DC 4QLCA 1H3OB 3UTAD 1P3IA 1P3FC 5BO0A 4KGCC 4H9SC 3AZLB 1P34B 3WA9C 4HGAC 3AV1C 3VH6A 3AYWA 3EPHA 1EQZC 4AWLC 2YFVA 3A1KA 3RELD 3AZMD 5CPKA 1P3PA 4Z5TA 3C1BB 3FDDA 1U35C 3B0BA 1S32A 3UT9A 1R4VA 5B0YA 5B0ZD 3UTBD 3WKJC 3W97A 1M18D 4WU9C 4J8WD 3AZFA 1KX5A 5AVBA 4JJNC 4J8XA 3LZ1A 5F99D 1F66A 3R45A 1TZYC 5AV5C 4KUDA 1KX4B 4H9QA 5B2JA 4H9NA 1M19B 3TU4A 1Q9CA 5B2IC 1P3LC 3X1TD 5FUGA 1AOID 5GXQD 3MGSD 3MGRB 4X23C 1P3BC 3X1SD 3WAAB 3UTAA 3B6FC 3AZNA 4J8VC 5B40B 4Z2MH 2F2AC 5DNNB 4KHAB 5AVCB 5KDMA 2CV5D 2PYOD 4R8PC 3MVDD 1M1AB 5BNVA 2F8NB 3RELA 3AZHA 4J8UD 3LJAC 3C1CD 4ZBJC 5E5AA 4Z66B 1P3OC 3UTBA 3MGPB 2VQRA 1P3GD 3REIC 5GSUC 1P3MB 5AY8D 5B24C 3X1VB 2HIOC 5B31B 3REJB 1KX3D 1P3KA 2Y2HA 2NZDD 4DRAA 3REKD 5AV8C 3X1UB 2FJ7D 2FFFB 5CPJB 1P34C 3AZLC 3AV1B 1P3FA 1TAFA 1AOIA 4KGCA 1N1JA 4H9SA 3MGSA 1EQZB 3WA9A 3KWQD 2AROB 3MGQD 3AZKD 4G91C 3KUYD 1P3AD 2CV5A 3MVDA 1BFMA 1U35A 4J8UA 5JRGD 3B0CT 3AL0C 1P3OD 2F8NG 4WU9B 5GSUD 5GT3C 2BYKB 4JJNB 1ZLAD 3REHB 1P3GA 1TZYB 4H9RB 2RVQC 5GT0B 5AV6D 2NQBC 1KX4C 3P5JB 1P3ID 5AV5A 5B2IB 1P3LB 2UWXA 1A7WA 2NZDA 5B31G 4EO5C 1BH8B 5B1MB 3REKA 3MGRC 5C3IC 3WAAC 5BS7C 3AV2B 1JFIB 2FJ7A 5BNXA 5CPKD 1P3BA 1P3PD 1T3UA 3NQUA 3O62C 2RIQA 5B40C 4WV4B 3B6FA 4J8VA 5DNNC 5DNMB 4XUJB 1S32D 3C1BD 3AZEC 1M1AC 3V9RB 4LD9B 3LELC 2L5AA 3VH6T 4ZBJB 2J8PA 4NFTA 4Z66C 4H9PA 3LJAA 3AZFD 1KX5D 3MGPC 4J8XD 4E44A 3LZ1D 1P3OA 1P3MC 4CAYB 5B24B 3WTPE 4KUDD 3W96B 3REIA 5GSUA 5B33B 4NE3A 4H9OB 3TU4D 3B6GC 2HIOA 4UUZA 5AV6A 1M19D 3EG5B 3AFAB 4YM6B 3NQJA 3X1UC 3AZND 5AV8A 5CPJC 3H0RC 1H3OA 3KFUG 3W98D 1P34A 4DQYB 3AZLA 5JA4B 5DNND 5AVCD 2AROC 4ZUXB 5CP6B 5B32B 3AZHD 4G91B 5B1LB 5BT1D 2F8ND 5E5AD 3AZJB 5CPIC 3C1BA 4Z2MG 2Y2NA 5GT3B 3AN2D 3X1VD 1P3KD 3REHC 2NQBB 5GT0C 5AV9C 5B31D 3AZIB 3REJD 2JCHA 3KXBB 1HTAA 1KX4A 2CWEA 3UT9B 1M19A 1P3FD 4EO5B 5B0YB 4KGCD 5B1MC 3WA9D 4WU8B 1WWIA 5C3IB 3AV1D 3AV2C 3W99B 1EQZD 3O62B 2ZY5A 3W98A 1PZRA 5DNMC 5AVBB 5B40A 4XUJC 3MNNC 3AZEB 5DNNA 1F66B 5AVCA 1U35D 4LD9C 3LELB 4G92B 2F8NA 3WTPC 5B32G 3WKJD 5FUGB 2Y2OA 4XZQB 4WU9D 3UTAB 3LZ0B 4YS3C 2Y2PA 3MGPA 1Z2CB 4JJND 3W96C 1P3MA 1TZYD 3IP4C 5B33C 5AV5D 3AN2A 3X1VA 3B6GB 5B31A 3REJA 5B2ID 3RELB 3AZMB 1P3LD 2ZM5A 3AFAC 4YM6C 4X23D 1P3BD 3B6FD 3X1UA 1HQ3C 3A6NC 5B0ZB 4J8VD 5CPJA 3AZGC 3AV1A 4XUJD 4ZUXC 5CP6C 1M18B 1EQZA 5B32C 4R8PD 4J8WB 1ID3C 2AROA 5B1LC 5F99B 5CPIB 3KSYA 3AZJC 3LJAD 2YFWB 4QLCC 2Y2MA 3X1TB 3WKJA 3REID 5B24D 5GXQB 4WU9A 3X1SB 5AV9B 2XD1A 2HIOD 2BYKA 4JJNA 3AZIC 2JSSA 2HUEB 4Z5TC 3REHA 1TZYA 4H9RA 2DF4C 3KXBC 2PYOB 5AV8D 3UT9C 5B2IA 1P3LA 5B0YC 4J8UB 1BH9B 3AZLD 4WU8C 1P34D 3VH5W 1BH8A 5B1MA 3W97C 3W99C 3C1CB 4X23A 4WJ3C 3AV2A 1JFIA 2ZY3A 5AVBC 3VH5A 3MNNB 1P3GB 3H0MC 5AY8B 5DNMA 1F66C 4XUJA 1WWSA 4R8PA 5B2JC 3WTPB 3V9RA 4G92C 4LD9A 1KX3B 4XZQC 5GT3D 3UTAC 1F1EA 3LZ0C 4YS3B 2FJ7B 5CHLB 2NQBD 2RVQD 4CAYA 5B24A 3W96A 1KX4D 5G49A 4DRBA 3KWQB 5B33A 1KU5A 3RELC 3AZMC 3MGQB 3AZKB 3KUYB 1P3AB 3AFAA 3MGRD 3F6TA 3WAAD 1HQ3B 3A6NB 3AZGB 5B0ZC 5B40D 4WNNB 5JRGB 3O62D 2BYMB 3H0LC 5JA4A 1M18C 1ID3B 4J8WC 3AZED 1M1AD 5CP6A 1ZLAB 5B32A 4CSRB 3LELD 5B1LA 5F99C 5AV6B 2ZY2A 4QLCB 3AZJA 4Z66D 1P3IB 2Y2LA 5BO0B 3MGPD 3X1TC 1P3MD 3LZ0D 1AOIC 5GXQC 3AYWB 3MGSC 3X1SC 5GT3A 2YFVB 2Y2QA 5CPKB 1P3PB 2JE5A 3B6GD 4Z5TB 2HUEC 2NQBA 3AZIA 2CV5C 1S32B 2PYOC 3KXBA 3MVDC 3X1UD 5CPJD 4J8UC 2DQNC 3W97B 3MGRA 4WU8A 3C1CC 3WAAA 5BS7A 3AZFB 2AROD 3W99A 1KX5B 3O62A 4J8XB 3LZ1B 1P3GC 3R45B 4KHAA 5AY8C 3A1IA 4KUDB 4WZSB 4H9QB 5B2JB 4H9NB 3AZEA 5CPID 1M1AA 3TU4B 1KX3C 3LELA 2NZDC 3REKC 3EPKA 4Z66A 2IO5C 3AZNB 2FJ7C 4XZQA 3REHD 3LZ0A 5AV9D 5GT0D 3W98B 5KDMB 3KWQC 1W2EA 3EPJA 5BNVB 3B6GA 3AZHB 3MGQC 3AZKC 3KUYC 5B1MD 3AZMA 1P3AC 5E5AB 3AV2D 3UTBB 5JRGC 5DNMD 5B0ZA 3MNND 2Y2GA 3AN2B 4LD9D 1M18A 1ZLAC 4NE6A 1P3KB 4J8WA 3WTPD 5AV6C 5F99A 5CPIA 1P3IC 2Y2IA 2YFWA 3B0DB 3VH5T 1TAFB 1P3FB 4YS3D 1AOIB 4KGCB 1N1JB 3WA9B 3MGSB 3X1TA 4HGAB 3AYWC 3W96D 5B33D 5GXQA 4E45A 5CPKC 1P3PC 3X1SA 5GT0A 5AV9A 4AWLB 1B6WA 3AFAD 2CV5B 2XD5A 4YM6D 2Y2JA 3MVDB 1S32C 3C1BC 2BG1A 2F8NK 1U35B 2PYOA 2LY8A 1B67A 1HQ3D 3A6ND 3AZGD 1BH9A 3WKJB 2G5HC 3AZFC 4ZUXD 4M6BA 5CP6D 3C1CA 5B32D 1KX5C 4J8XC 1ID3D 3LZ1C 5B1LD 4KUDC
chains in the Genus database with same CATH topology
3MNNA 3AZJD 5AY8A 5AV5B 3TU4C 4QLCD 2NZDB 3WTPA 1M19C 3REKB 1KX3A 1ULYA 2IO5B 3B0CW 3AZNC 5BNXB 3AYWD 4X23B 1P3BB 3NQUB 3B6FB 4YS3A 4J8VB 3W98C 3AZID 4Z5TD 3KXBD 2F8NH 4H9OA 5AVCC 3AZHC 3KWQA 4R8PB 3UT9D 5BT1C 5B0YD 3MGQA 2G5IC 3AZKA 3EPLA 5E5AC 4YM6A 4WU8D 4H9PB 4UPKA 3LJAB 3KUYA 3W97D 3W99D 1P3AA 3UTBC 1HQ3A 3A6NA 1P3OB 2W8SA 3AZGA 5AVBD 4WNNA 5JRGA 3REIB 5GSUB 1F66D 2BYMA 3AN2C 4ZUXA 3X1VC 2ZY4A 5G49B 1P3KC 1ID3A 5B2JD 4NE5A 2HIOB 4UUZB 1ZLAA 5B31C 2Y2KA 4CSRA 3REJC 3NQJB 3VH6W 4XZQD 5AV8B 3B0DC 4QLCA 1H3OB 3UTAD 1P3IA 1P3FC 5BO0A 4KGCC 4H9SC 3AZLB 1P34B 3WA9C 4HGAC 3AV1C 3VH6A 3AYWA 3EPHA 1EQZC 4AWLC 2YFVA 3A1KA 3RELD 3AZMD 5CPKA 1P3PA 4Z5TA 3C1BB 3FDDA 1U35C 3B0BA 1S32A 3UT9A 1R4VA 5B0YA 5B0ZD 3UTBD 3WKJC 3W97A 1M18D 4WU9C 4J8WD 3AZFA 1KX5A 5AVBA 4JJNC 4J8XA 3LZ1A 5F99D 1F66A 3R45A 1TZYC 5AV5C 4KUDA 1KX4B 4H9QA 5B2JA 4H9NA 1M19B 3TU4A 1Q9CA 5B2IC 1P3LC 3X1TD 5FUGA 1AOID 5GXQD 3MGSD 3MGRB 4X23C 1P3BC 3X1SD 3WAAB 3UTAA 3B6FC 3AZNA 4J8VC 5B40B 4Z2MH 2F2AC 5DNNB 4KHAB 5AVCB 5KDMA 2CV5D 2PYOD 4R8PC 3MVDD 1M1AB 5BNVA 2F8NB 3RELA 3AZHA 4J8UD 3LJAC 3C1CD 4ZBJC 5E5AA 4Z66B 1P3OC 3UTBA 3MGPB 2VQRA 1P3GD 3REIC 5GSUC 1P3MB 5AY8D 5B24C 3X1VB 2HIOC 5B31B 3REJB 1KX3D 1P3KA 2Y2HA 2NZDD 4DRAA 3REKD 5AV8C 3X1UB 2FJ7D 2FFFB 5CPJB 1P34C 3AZLC 3AV1B 1P3FA 1TAFA 1AOIA 4KGCA 1N1JA 4H9SA 3MGSA 1EQZB 3WA9A 3KWQD 2AROB 3MGQD 3AZKD 4G91C 3KUYD 1P3AD 2CV5A 3MVDA 1BFMA 1U35A 4J8UA 5JRGD 3B0CT 3AL0C 1P3OD 2F8NG 4WU9B 5GSUD 5GT3C 2BYKB 4JJNB 1ZLAD 3REHB 1P3GA 1TZYB 4H9RB 2RVQC 5GT0B 5AV6D 2NQBC 1KX4C 3P5JB 1P3ID 5AV5A 5B2IB 1P3LB 2UWXA 1A7WA 2NZDA 5B31G 4EO5C 1BH8B 5B1MB 3REKA 3MGRC 5C3IC 3WAAC 5BS7C 3AV2B 1JFIB 2FJ7A 5BNXA 5CPKD 1P3BA 1P3PD 1T3UA 3NQUA 3O62C 2RIQA 5B40C 4WV4B 3B6FA 4J8VA 5DNNC 5DNMB 4XUJB 1S32D 3C1BD 3AZEC 1M1AC 3V9RB 4LD9B 3LELC 2L5AA 3VH6T 4ZBJB 2J8PA 4NFTA 4Z66C 4H9PA 3LJAA 3AZFD 1KX5D 3MGPC 4J8XD 4E44A 3LZ1D 1P3OA 1P3MC 4CAYB 5B24B 3WTPE 4KUDD 3W96B 3REIA 5GSUA 5B33B 4NE3A 4H9OB 3TU4D 3B6GC 2HIOA 4UUZA 5AV6A 1M19D 3EG5B 3AFAB 4YM6B 3NQJA 3X1UC 3AZND 5AV8A 5CPJC 3H0RC 1H3OA 3KFUG 3W98D 1P34A 4DQYB 3AZLA 5JA4B 5DNND 5AVCD 2AROC 4ZUXB 5CP6B 5B32B 3AZHD 4G91B 5B1LB 5BT1D 2F8ND 5E5AD 3AZJB 5CPIC 3C1BA 4Z2MG 2Y2NA 5GT3B 3AN2D 3X1VD 1P3KD 3REHC 2NQBB 5GT0C 5AV9C 5B31D 3AZIB 3REJD 2JCHA 3KXBB 1HTAA 1KX4A 2CWEA 3UT9B 1M19A 1P3FD 4EO5B 5B0YB 4KGCD 5B1MC 3WA9D 4WU8B 1WWIA 5C3IB 3AV1D 3AV2C 3W99B 1EQZD 3O62B 2ZY5A 3W98A 1PZRA 5DNMC 5AVBB 5B40A 4XUJC 3MNNC 3AZEB 5DNNA 1F66B 5AVCA 1U35D 4LD9C 3LELB 4G92B 2F8NA 3WTPC 5B32G 3WKJD 5FUGB 2Y2OA 4XZQB 4WU9D 3UTAB 3LZ0B 4YS3C 2Y2PA 3MGPA 1Z2CB 4JJND 3W96C 1P3MA 1TZYD 3IP4C 5B33C 5AV5D 3AN2A 3X1VA 3B6GB 5B31A 3REJA 5B2ID 3RELB 3AZMB 1P3LD 2ZM5A 3AFAC 4YM6C 4X23D 1P3BD 3B6FD 3X1UA 1HQ3C 3A6NC 5B0ZB 4J8VD 5CPJA 3AZGC 3AV1A 4XUJD 4ZUXC 5CP6C 1M18B 1EQZA 5B32C 4R8PD 4J8WB 1ID3C 2AROA 5B1LC 5F99B 5CPIB 3KSYA 3AZJC 3LJAD 2YFWB 4QLCC 2Y2MA 3X1TB 3WKJA 3REID 5B24D 5GXQB 4WU9A 3X1SB 5AV9B 2XD1A 2HIOD 2BYKA 4JJNA 3AZIC 2JSSA 2HUEB 4Z5TC 3REHA 1TZYA 4H9RA 2DF4C 3KXBC 2PYOB 5AV8D 3UT9C 5B2IA 1P3LA 5B0YC 4J8UB 1BH9B 3AZLD 4WU8C 1P34D 3VH5W 1BH8A 5B1MA 3W97C 3W99C 3C1CB 4X23A 4WJ3C 3AV2A 1JFIA 2ZY3A 5AVBC 3VH5A 3MNNB 1P3GB 3H0MC 5AY8B 5DNMA 1F66C 4XUJA 1WWSA 4R8PA 5B2JC 3WTPB 3V9RA 4G92C 4LD9A 1KX3B 4XZQC 5GT3D 3UTAC 1F1EA 3LZ0C 4YS3B 2FJ7B 5CHLB 2NQBD 2RVQD 4CAYA 5B24A 3W96A 1KX4D 5G49A 4DRBA 3KWQB 5B33A 1KU5A 3RELC 3AZMC 3MGQB 3AZKB 3KUYB 1P3AB 3AFAA 3MGRD 3F6TA 3WAAD 1HQ3B 3A6NB 3AZGB 5B0ZC 5B40D 4WNNB 5JRGB 3O62D 2BYMB 3H0LC 5JA4A 1M18C 1ID3B 4J8WC 3AZED 1M1AD 5CP6A 1ZLAB 5B32A 4CSRB 3LELD 5B1LA 5F99C 5AV6B 2ZY2A 4QLCB 3AZJA 4Z66D 1P3IB 2Y2LA 5BO0B 3MGPD 3X1TC 1P3MD 3LZ0D 1AOIC 5GXQC 3AYWB 3MGSC 3X1SC 5GT3A 2YFVB 2Y2QA 5CPKB 1P3PB 2JE5A 3B6GD 4Z5TB 2HUEC 2NQBA 3AZIA 2CV5C 1S32B 2PYOC 3KXBA 3MVDC 3X1UD 5CPJD 4J8UC 2DQNC 3W97B 3MGRA 4WU8A 3C1CC 3WAAA 5BS7A 3AZFB 2AROD 3W99A 1KX5B 3O62A 4J8XB 3LZ1B 1P3GC 3R45B 4KHAA 5AY8C 3A1IA 4KUDB 4WZSB 4H9QB 5B2JB 4H9NB 3AZEA 5CPID 1M1AA 3TU4B 1KX3C 3LELA 2NZDC 3REKC 3EPKA 4Z66A 2IO5C 3AZNB 2FJ7C 4XZQA 3REHD 3LZ0A 5AV9D 5GT0D 3W98B 5KDMB 3KWQC 1W2EA 3EPJA 5BNVB 3B6GA 3AZHB 3MGQC 3AZKC 3KUYC 5B1MD 3AZMA 1P3AC 5E5AB 3AV2D 3UTBB 5JRGC 5DNMD 5B0ZA 3MNND 2Y2GA 3AN2B 4LD9D 1M18A 1ZLAC 4NE6A 1P3KB 4J8WA 3WTPD 5AV6C 5F99A 5CPIA 1P3IC 2Y2IA 2YFWA 3B0DB 3VH5T 1TAFB 1P3FB 4YS3D 1AOIB 4KGCB 1N1JB 3WA9B 3MGSB 3X1TA 4HGAB 3AYWC 3W96D 5B33D 5GXQA 4E45A 5CPKC 1P3PC 3X1SA 5GT0A 5AV9A 4AWLB 1B6WA 3AFAD 2CV5B 2XD5A 4YM6D 2Y2JA 3MVDB 1S32C 3C1BC 2BG1A 2F8NK 1U35B 2PYOA 2LY8A 1B67A 1HQ3D 3A6ND 3AZGD 1BH9A 3WKJB 2G5HC 3AZFC 4ZUXD 4M6BA 5CP6D 3C1CA 5B32D 1KX5C 4J8XC 1ID3D 3LZ1C 5B1LD 4KUDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNN A;  3AZJ D;  5AY8 A;  5AV5 B;  3TU4 C;  4QLC D;  2NZD B;  3WTP A;  1M19 C;  3REK B;  1KX3 A;  1ULY A;  2IO5 B;  3B0C W;  3AZN C;  5BNX B;  3AYW D;  4X23 B;  1P3B B;  3NQU B;  3B6F B;  4YS3 A;  4J8V B;  3W98 C;  3AZI D;  4Z5T D;  3KXB D;  2F8N H;  4H9O A;  5AVC C;  3AZH C;  3KWQ A;  4R8P B;  3UT9 D;  5BT1 C;  5B0Y D;  3MGQ A;  3AZK A;  4WU8 D;  5E5A C;  4YM6 A;  4H9P B;  3LJA B;  3KUY A;  3W97 D;  3W99 D;  1P3A A;  3UTB C;  1HQ3 A;  3A6N A;  1P3O B;  3AZG A;  5AVB D;  4WNN A;  5JRG A;  3REI B;  5GSU B;  1F66 D;  2BYM A;  3AN2 C;  4ZUX A;  3X1V C;  5G49 B;  1P3K C;  1ID3 A;  5B2J D;  4NE5 A;  2HIO B;  4UUZ B;  1ZLA A;  5B31 C;  3REJ C;  4CSR A;  3NQJ B;  3VH6 W;  4XZQ D;  5AV8 B;  3B0D C;  4QLC A;  1H3O B;  3UTA D;  1P3I A;  1P3F C;  5BO0 A;  4KGC C;  4H9S C;  3AZL B;  1P34 B;  3WA9 C;  4HGA C;  3AV1 C;  3VH6 A;  3AYW A;  1EQZ C;  4AWL C;  2YFV A;  3REL D;  3AZM D;  5CPK A;  1P3P A;  4Z5T A;  3C1B B;  1U35 C;  3B0B A;  1S32 A;  3UT9 A;  1R4V A;  5B0Y A;  5B0Z D;  3UTB D;  3WKJ C;  3W97 A;  1M18 D;  4WU9 C;  4J8W D;  3AZF A;  1KX5 A;  5AVB A;  4JJN C;  4J8X A;  3LZ1 A;  5F99 D;  1F66 A;  3R45 A;  1TZY C;  5AV5 C;  4KUD A;  1KX4 B;  4H9Q A;  5B2J A;  4H9N A;  1M19 B;  3TU4 A;  1Q9C A;  5B2I C;  1P3L C;  3X1T D;  5FUG A;  1AOI D;  5GXQ D;  3MGS D;  3MGR B;  4X23 C;  1P3B C;  3X1S D;  3WAA B;  3UTA A;  3B6F C;  3AZN A;  4J8V C;  5B40 B;  4Z2M H;  5DNN B;  4KHA B;  5AVC B;  5KDM A;  2CV5 D;  2PYO D;  4R8P C;  3MVD D;  1M1A B;  5BNV A;  2F8N B;  3REL A;  3AZH A;  4J8U D;  3LJA C;  3C1C D;  4ZBJ C;  5E5A A;  4Z66 B;  1P3O C;  3UTB A;  3MGP B;  1P3G D;  3REI C;  5GSU C;  1P3M B;  5AY8 D;  5B24 C;  3X1V B;  2HIO C;  5B31 B;  3REJ B;  1KX3 D;  1P3K A;  2NZD D;  4DRA A;  3REK D;  5AV8 C;  3X1U B;  2FJ7 D;  5CPJ B;  1P34 C;  3AZL C;  3AV1 B;  1P3F A;  1TAF A;  1AOI A;  4KGC A;  1N1J A;  4H9S A;  3MGS A;  1EQZ B;  3WA9 A;  3KWQ D;  2ARO B;  3MGQ D;  3AZK D;  4G91 C;  3KUY D;  1P3A D;  2CV5 A;  3MVD A;  1BFM A;  1U35 A;  4J8U A;  5JRG D;  3B0C T;  1P3O D;  2F8N G;  4WU9 B;  5GSU D;  5GT3 C;  2BYK B;  4JJN B;  1ZLA D;  3REH B;  1P3G A;  1TZY B;  4H9R B;  2RVQ C;  5GT0 B;  5AV6 D;  2NQB C;  1KX4 C;  1P3I D;  5AV5 A;  5B2I B;  1P3L B;  1A7W A;  2NZD A;  5B31 G;  4EO5 C;  1BH8 B;  5B1M B;  3REK A;  3MGR C;  5C3I C;  3WAA C;  5BS7 C;  3AV2 B;  1JFI B;  2FJ7 A;  5BNX A;  5CPK D;  1P3B A;  1P3P D;  3O62 C;  3NQU A;  5B40 C;  3B6F A;  4WV4 B;  4J8V A;  5DNN C;  5DNM B;  4XUJ B;  1S32 D;  3C1B D;  3AZE C;  1M1A C;  3V9R B;  4LD9 B;  3LEL C;  2L5A A;  3VH6 T;  4ZBJ B;  4NFT A;  4Z66 C;  4H9P A;  3LJA A;  3AZF D;  1KX5 D;  3MGP C;  4J8X D;  4E44 A;  3LZ1 D;  1P3O A;  1P3M C;  4CAY B;  5B24 B;  3WTP E;  4KUD D;  3W96 B;  3REI A;  5GSU A;  5B33 B;  4NE3 A;  4H9O B;  3TU4 D;  3B6G C;  2HIO A;  4UUZ A;  5AV6 A;  1M19 D;  3AFA B;  4YM6 B;  3NQJ A;  3X1U C;  3AZN D;  5AV8 A;  5CPJ C;  1H3O A;  3W98 D;  1P34 A;  3AZL A;  5JA4 B;  5DNN D;  5AVC D;  2ARO C;  4ZUX B;  5CP6 B;  5B32 B;  3AZH D;  4G91 B;  5B1L B;  5BT1 D;  2F8N D;  5E5A D;  3AZJ B;  5CPI C;  3C1B A;  4Z2M G;  5GT3 B;  3AN2 D;  3X1V D;  1P3K D;  3REH C;  2NQB B;  5GT0 C;  5AV9 C;  5B31 D;  3AZI B;  3REJ D;  3KXB B;  1HTA A;  1KX4 A;  2CWE A;  3UT9 B;  1M19 A;  1P3F D;  4EO5 B;  5B0Y B;  4KGC D;  5B1M C;  3WA9 D;  4WU8 B;  1WWI A;  5C3I B;  3AV1 D;  3AV2 C;  3W99 B;  1EQZ D;  3O62 B;  3W98 A;  5DNM C;  5AVB B;  5B40 A;  4XUJ C;  3MNN C;  3AZE B;  5DNN A;  1F66 B;  5AVC A;  1U35 D;  4LD9 C;  3LEL B;  4G92 B;  2F8N A;  3WTP C;  5B32 G;  3WKJ D;  5FUG B;  4XZQ B;  4WU9 D;  3UTA B;  3LZ0 B;  4YS3 C;  3MGP A;  4JJN D;  3W96 C;  1P3M A;  1TZY D;  5B33 C;  3AN2 A;  5AV5 D;  3X1V A;  3B6G B;  5B31 A;  3REJ A;  5B2I D;  3REL B;  3AZM B;  1P3L D;  3AFA C;  4YM6 C;  4X23 D;  1P3B D;  3B6F D;  3X1U A;  1HQ3 C;  3A6N C;  5B0Z B;  4J8V D;  5CPJ A;  3AZG C;  3AV1 A;  4XUJ D;  4ZUX C;  5CP6 C;  1M18 B;  1EQZ A;  5B32 C;  4R8P D;  4J8W B;  1ID3 C;  2ARO A;  5B1L C;  5F99 B;  5CPI B;  3KSY A;  3AZJ C;  3LJA D;  2YFW B;  4QLC C;  3X1T B;  3WKJ A;  3REI D;  5B24 D;  5GXQ B;  4WU9 A;  3X1S B;  5AV9 B;  2HIO D;  2BYK A;  4JJN A;  3AZI C;  2JSS A;  2HUE B;  4Z5T C;  3REH A;  1TZY A;  4H9R A;  3KXB C;  2PYO B;  5AV8 D;  3UT9 C;  5B2I A;  1P3L A;  5B0Y C;  4J8U B;  1BH9 B;  3AZL D;  4WU8 C;  1P34 D;  3VH5 W;  1BH8 A;  5B1M A;  3W97 C;  3W99 C;  3C1C B;  4X23 A;  3AV2 A;  1JFI A;  5AVB C;  3VH5 A;  3MNN B;  1P3G B;  5AY8 B;  1F66 C;  5DNM A;  4XUJ A;  1WWS A;  4R8P A;  5B2J C;  3WTP B;  3V9R A;  4G92 C;  4LD9 A;  1KX3 B;  4XZQ C;  5GT3 D;  3UTA C;  1F1E A;  3LZ0 C;  4YS3 B;  2FJ7 B;  5CHL B;  2NQB D;  2RVQ D;  4CAY A;  5B24 A;  3W96 A;  1KX4 D;  5G49 A;  4DRB A;  3KWQ B;  5B33 A;  1KU5 A;  3REL C;  3AZM C;  3MGQ B;  3AZK B;  3KUY B;  1P3A B;  3AFA A;  3MGR D;  3WAA D;  1HQ3 B;  3A6N B;  3AZG B;  5B0Z C;  5B40 D;  4WNN B;  5JRG B;  3O62 D;  2BYM B;  5JA4 A;  1M18 C;  1ID3 B;  4J8W C;  3AZE D;  1M1A D;  5CP6 A;  1ZLA B;  5B32 A;  4CSR B;  3LEL D;  5B1L A;  5F99 C;  5AV6 B;  4QLC B;  3AZJ A;  4Z66 D;  1P3I B;  5BO0 B;  3MGP D;  3X1T C;  1P3M D;  3LZ0 D;  1AOI C;  5GXQ C;  3AYW B;  3MGS C;  3X1S C;  5GT3 A;  2YFV B;  3B6G D;  5CPK B;  1P3P B;  4Z5T B;  2HUE C;  2NQB A;  3AZI A;  2CV5 C;  1S32 B;  2PYO C;  3KXB A;  3MVD C;  3X1U D;  5CPJ D;  4J8U C;  3W97 B;  3MGR A;  4WU8 A;  3C1C C;  3WAA A;  5BS7 A;  3AZF B;  2ARO D;  3W99 A;  1KX5 B;  3O62 A;  4J8X B;  3LZ1 B;  1P3G C;  3R45 B;  4KHA A;  5AY8 C;  4KUD B;  4WZS B;  4H9Q B;  5B2J B;  4H9N B;  3AZE A;  5CPI D;  1M1A A;  3TU4 B;  1KX3 C;  3LEL A;  2NZD C;  3REK C;  4Z66 A;  2IO5 C;  3AZN B;  2FJ7 C;  4XZQ A;  3REH D;  3LZ0 A;  5AV9 D;  5GT0 D;  3W98 B;  5KDM B;  3KWQ C;  5BNV B;  3B6G A;  3AZH B;  3MGQ C;  3AZK C;  3KUY C;  5B1M D;  3AZM A;  1P3A C;  5E5A B;  3AV2 D;  3UTB B;  5JRG C;  5DNM D;  5B0Z A;  3MNN D;  3AN2 B;  4LD9 D;  1M18 A;  1ZLA C;  4NE6 A;  1P3K B;  4J8W A;  3WTP D;  5AV6 C;  5F99 A;  5CPI A;  1P3I C;  2YFW A;  3B0D B;  3VH5 T;  1TAF B;  1P3F B;  4YS3 D;  1AOI B;  4KGC B;  1N1J B;  3WA9 B;  3MGS B;  3X1T A;  4HGA B;  3AYW C;  3W96 D;  5B33 D;  5GXQ A;  4E45 A;  5CPK C;  1P3P C;  3X1S A;  5GT0 A;  5AV9 A;  4AWL B;  1B6W A;  3AFA D;  2CV5 B;  4YM6 D;  3MVD B;  1S32 C;  2F8N K;  3C1B C;  1U35 B;  2PYO A;  2LY8 A;  1B67 A;  1HQ3 D;  3A6N D;  3AZG D;  1BH9 A;  3WKJ B;  3AZF C;  4ZUX D;  4M6B A;  5CP6 D;  3C1C A;  5B32 D;  1KX5 C;  4J8X C;  1ID3 D;  3LZ1 C;  5B1L D;  4KUD C; 
#chains in the Genus database with same CATH topology
 3MNN A;  3AZJ D;  5AY8 A;  5AV5 B;  3TU4 C;  4QLC D;  2NZD B;  3WTP A;  1M19 C;  3REK B;  1KX3 A;  1ULY A;  2IO5 B;  3B0C W;  3AZN C;  5BNX B;  3AYW D;  4X23 B;  1P3B B;  3NQU B;  3B6F B;  4YS3 A;  4J8V B;  3W98 C;  3AZI D;  4Z5T D;  3KXB D;  2F8N H;  4H9O A;  5AVC C;  3AZH C;  3KWQ A;  4R8P B;  3UT9 D;  5BT1 C;  5B0Y D;  3MGQ A;  2G5I C;  3AZK A;  3EPL A;  5E5A C;  4YM6 A;  4WU8 D;  4H9P B;  4UPK A;  3LJA B;  3KUY A;  3W97 D;  3W99 D;  1P3A A;  3UTB C;  1HQ3 A;  3A6N A;  1P3O B;  2W8S A;  3AZG A;  5AVB D;  4WNN A;  5JRG A;  3REI B;  5GSU B;  1F66 D;  2BYM A;  3AN2 C;  4ZUX A;  3X1V C;  2ZY4 A;  5G49 B;  1P3K C;  1ID3 A;  5B2J D;  4NE5 A;  2HIO B;  4UUZ B;  1ZLA A;  5B31 C;  2Y2K A;  4CSR A;  3REJ C;  3NQJ B;  3VH6 W;  4XZQ D;  5AV8 B;  3B0D C;  4QLC A;  1H3O B;  3UTA D;  1P3I A;  1P3F C;  5BO0 A;  4KGC C;  4H9S C;  3AZL B;  1P34 B;  3WA9 C;  4HGA C;  3AV1 C;  3VH6 A;  3AYW A;  3EPH A;  1EQZ C;  4AWL C;  2YFV A;  3A1K A;  3REL D;  3AZM D;  5CPK A;  1P3P A;  4Z5T A;  3C1B B;  3FDD A;  1U35 C;  3B0B A;  1S32 A;  3UT9 A;  1R4V A;  5B0Y A;  5B0Z D;  3UTB D;  3WKJ C;  3W97 A;  1M18 D;  4WU9 C;  4J8W D;  3AZF A;  1KX5 A;  5AVB A;  4JJN C;  4J8X A;  3LZ1 A;  5F99 D;  1F66 A;  3R45 A;  1TZY C;  5AV5 C;  4KUD A;  1KX4 B;  4H9Q A;  5B2J A;  4H9N A;  1M19 B;  3TU4 A;  1Q9C A;  5B2I C;  1P3L C;  3X1T D;  5FUG A;  1AOI D;  5GXQ D;  3MGS D;  3MGR B;  4X23 C;  1P3B C;  3X1S D;  3WAA B;  3UTA A;  3B6F C;  3AZN A;  4J8V C;  5B40 B;  4Z2M H;  2F2A C;  5DNN B;  4KHA B;  5AVC B;  5KDM A;  2CV5 D;  2PYO D;  4R8P C;  3MVD D;  1M1A B;  5BNV A;  2F8N B;  3REL A;  3AZH A;  4J8U D;  3LJA C;  3C1C D;  4ZBJ C;  5E5A A;  4Z66 B;  1P3O C;  3UTB A;  3MGP B;  2VQR A;  1P3G D;  3REI C;  5GSU C;  1P3M B;  5AY8 D;  5B24 C;  3X1V B;  2HIO C;  5B31 B;  3REJ B;  1KX3 D;  1P3K A;  2Y2H A;  2NZD D;  4DRA A;  3REK D;  5AV8 C;  3X1U B;  2FJ7 D;  2FFF B;  5CPJ B;  1P34 C;  3AZL C;  3AV1 B;  1P3F A;  1TAF A;  1AOI A;  4KGC A;  1N1J A;  4H9S A;  3MGS A;  1EQZ B;  3WA9 A;  3KWQ D;  2ARO B;  3MGQ D;  3AZK D;  4G91 C;  3KUY D;  1P3A D;  2CV5 A;  3MVD A;  1BFM A;  1U35 A;  4J8U A;  5JRG D;  3B0C T;  3AL0 C;  1P3O D;  2F8N G;  4WU9 B;  5GSU D;  5GT3 C;  2BYK B;  4JJN B;  1ZLA D;  3REH B;  1P3G A;  1TZY B;  4H9R B;  2RVQ C;  5GT0 B;  5AV6 D;  2NQB C;  1KX4 C;  3P5J B;  1P3I D;  5AV5 A;  5B2I B;  1P3L B;  2UWX A;  1A7W A;  2NZD A;  5B31 G;  4EO5 C;  1BH8 B;  5B1M B;  3REK A;  3MGR C;  5C3I C;  3WAA C;  5BS7 C;  3AV2 B;  1JFI B;  2FJ7 A;  5BNX A;  5CPK D;  1P3B A;  1P3P D;  1T3U A;  3NQU A;  3O62 C;  2RIQ A;  5B40 C;  4WV4 B;  3B6F A;  4J8V A;  5DNN C;  5DNM B;  4XUJ B;  1S32 D;  3C1B D;  3AZE C;  1M1A C;  3V9R B;  4LD9 B;  3LEL C;  2L5A A;  3VH6 T;  4ZBJ B;  2J8P A;  4NFT A;  4Z66 C;  4H9P A;  3LJA A;  3AZF D;  1KX5 D;  3MGP C;  4J8X D;  4E44 A;  3LZ1 D;  1P3O A;  1P3M C;  4CAY B;  5B24 B;  3WTP E;  4KUD D;  3W96 B;  3REI A;  5GSU A;  5B33 B;  4NE3 A;  4H9O B;  3TU4 D;  3B6G C;  2HIO A;  4UUZ A;  5AV6 A;  1M19 D;  3EG5 B;  3AFA B;  4YM6 B;  3NQJ A;  3X1U C;  3AZN D;  5AV8 A;  5CPJ C;  3H0R C;  1H3O A;  3KFU G;  3W98 D;  1P34 A;  4DQY B;  3AZL A;  5JA4 B;  5DNN D;  5AVC D;  2ARO C;  4ZUX B;  5CP6 B;  5B32 B;  3AZH D;  4G91 B;  5B1L B;  5BT1 D;  2F8N D;  5E5A D;  3AZJ B;  5CPI C;  3C1B A;  4Z2M G;  2Y2N A;  5GT3 B;  3AN2 D;  3X1V D;  1P3K D;  3REH C;  2NQB B;  5GT0 C;  5AV9 C;  5B31 D;  3AZI B;  3REJ D;  2JCH A;  3KXB B;  1HTA A;  1KX4 A;  2CWE A;  3UT9 B;  1M19 A;  1P3F D;  4EO5 B;  5B0Y B;  4KGC D;  5B1M C;  3WA9 D;  4WU8 B;  1WWI A;  5C3I B;  3AV1 D;  3AV2 C;  3W99 B;  1EQZ D;  3O62 B;  2ZY5 A;  3W98 A;  1PZR A;  5DNM C;  5AVB B;  5B40 A;  4XUJ C;  3MNN C;  3AZE B;  5DNN A;  1F66 B;  5AVC A;  1U35 D;  4LD9 C;  3LEL B;  4G92 B;  2F8N A;  3WTP C;  5B32 G;  3WKJ D;  5FUG B;  2Y2O A;  4XZQ B;  4WU9 D;  3UTA B;  3LZ0 B;  4YS3 C;  2Y2P A;  3MGP A;  1Z2C B;  4JJN D;  3W96 C;  1P3M A;  1TZY D;  3IP4 C;  5B33 C;  5AV5 D;  3AN2 A;  3X1V A;  3B6G B;  5B31 A;  3REJ A;  5B2I D;  3REL B;  3AZM B;  1P3L D;  2ZM5 A;  3AFA C;  4YM6 C;  4X23 D;  1P3B D;  3B6F D;  3X1U A;  1HQ3 C;  3A6N C;  5B0Z B;  4J8V D;  5CPJ A;  3AZG C;  3AV1 A;  4XUJ D;  4ZUX C;  5CP6 C;  1M18 B;  1EQZ A;  5B32 C;  4R8P D;  4J8W B;  1ID3 C;  2ARO A;  5B1L C;  5F99 B;  5CPI B;  3KSY A;  3AZJ C;  3LJA D;  2YFW B;  4QLC C;  2Y2M A;  3X1T B;  3WKJ A;  3REI D;  5B24 D;  5GXQ B;  4WU9 A;  3X1S B;  5AV9 B;  2XD1 A;  2HIO D;  2BYK A;  4JJN A;  3AZI C;  2JSS A;  2HUE B;  4Z5T C;  3REH A;  1TZY A;  4H9R A;  2DF4 C;  3KXB C;  2PYO B;  5AV8 D;  3UT9 C;  5B2I A;  1P3L A;  5B0Y C;  4J8U B;  1BH9 B;  3AZL D;  4WU8 C;  1P34 D;  3VH5 W;  1BH8 A;  5B1M A;  3W97 C;  3W99 C;  3C1C B;  4X23 A;  4WJ3 C;  3AV2 A;  1JFI A;  2ZY3 A;  5AVB C;  3VH5 A;  3MNN B;  1P3G B;  3H0M C;  5AY8 B;  5DNM A;  1F66 C;  4XUJ A;  1WWS A;  4R8P A;  5B2J C;  3WTP B;  3V9R A;  4G92 C;  4LD9 A;  1KX3 B;  4XZQ C;  5GT3 D;  3UTA C;  1F1E A;  3LZ0 C;  4YS3 B;  2FJ7 B;  5CHL B;  2NQB D;  2RVQ D;  4CAY A;  5B24 A;  3W96 A;  1KX4 D;  5G49 A;  4DRB A;  3KWQ B;  5B33 A;  1KU5 A;  3REL C;  3AZM C;  3MGQ B;  3AZK B;  3KUY B;  1P3A B;  3AFA A;  3MGR D;  3F6T A;  3WAA D;  1HQ3 B;  3A6N B;  3AZG B;  5B0Z C;  5B40 D;  4WNN B;  5JRG B;  3O62 D;  2BYM B;  3H0L C;  5JA4 A;  1M18 C;  1ID3 B;  4J8W C;  3AZE D;  1M1A D;  5CP6 A;  1ZLA B;  5B32 A;  4CSR B;  3LEL D;  5B1L A;  5F99 C;  5AV6 B;  2ZY2 A;  4QLC B;  3AZJ A;  4Z66 D;  1P3I B;  2Y2L A;  5BO0 B;  3MGP D;  3X1T C;  1P3M D;  3LZ0 D;  1AOI C;  5GXQ C;  3AYW B;  3MGS C;  3X1S C;  5GT3 A;  2YFV B;  2Y2Q A;  5CPK B;  1P3P B;  2JE5 A;  3B6G D;  4Z5T B;  2HUE C;  2NQB A;  3AZI A;  2CV5 C;  1S32 B;  2PYO C;  3KXB A;  3MVD C;  3X1U D;  5CPJ D;  4J8U C;  2DQN C;  3W97 B;  3MGR A;  4WU8 A;  3C1C C;  3WAA A;  5BS7 A;  3AZF B;  2ARO D;  3W99 A;  1KX5 B;  3O62 A;  4J8X B;  3LZ1 B;  1P3G C;  3R45 B;  4KHA A;  5AY8 C;  3A1I A;  4KUD B;  4WZS B;  4H9Q B;  5B2J B;  4H9N B;  3AZE A;  5CPI D;  1M1A A;  3TU4 B;  1KX3 C;  3LEL A;  2NZD C;  3REK C;  3EPK A;  4Z66 A;  2IO5 C;  3AZN B;  2FJ7 C;  4XZQ A;  3REH D;  3LZ0 A;  5AV9 D;  5GT0 D;  3W98 B;  5KDM B;  3KWQ C;  1W2E A;  3EPJ A;  5BNV B;  3B6G A;  3AZH B;  3MGQ C;  3AZK C;  3KUY C;  5B1M D;  3AZM A;  1P3A C;  5E5A B;  3AV2 D;  3UTB B;  5JRG C;  5DNM D;  5B0Z A;  3MNN D;  2Y2G A;  3AN2 B;  4LD9 D;  1M18 A;  1ZLA C;  4NE6 A;  1P3K B;  4J8W A;  3WTP D;  5AV6 C;  5F99 A;  5CPI A;  1P3I C;  2Y2I A;  2YFW A;  3B0D B;  3VH5 T;  1TAF B;  1P3F B;  4YS3 D;  1AOI B;  4KGC B;  1N1J B;  3WA9 B;  3MGS B;  3X1T A;  4HGA B;  3AYW C;  3W96 D;  5B33 D;  5GXQ A;  4E45 A;  5CPK C;  1P3P C;  3X1S A;  5GT0 A;  5AV9 A;  4AWL B;  1B6W A;  3AFA D;  2CV5 B;  2XD5 A;  4YM6 D;  2Y2J A;  3MVD B;  1S32 C;  3C1B C;  2BG1 A;  2F8N K;  1U35 B;  2PYO A;  2LY8 A;  1B67 A;  1HQ3 D;  3A6N D;  3AZG D;  1BH9 A;  3WKJ B;  2G5H C;  3AZF C;  4ZUX D;  4M6B A;  5CP6 D;  3C1C A;  5B32 D;  1KX5 C;  4J8X C;  1ID3 D;  3LZ1 C;  5B1L D;  4KUD C; 
#chains in the Genus database with same CATH homology
 3MNN A;  3AZJ D;  5AY8 A;  5AV5 B;  3TU4 C;  4QLC D;  2NZD B;  3WTP A;  1M19 C;  3REK B;  1KX3 A;  1ULY A;  2IO5 B;  3B0C W;  3AZN C;  5BNX B;  3AYW D;  4X23 B;  1P3B B;  3NQU B;  3B6F B;  4YS3 A;  4J8V B;  3W98 C;  3AZI D;  4Z5T D;  3KXB D;  2F8N H;  4H9O A;  5AVC C;  3AZH C;  3KWQ A;  4R8P B;  3UT9 D;  5BT1 C;  5B0Y D;  3MGQ A;  2G5I C;  3AZK A;  3EPL A;  5E5A C;  4YM6 A;  4WU8 D;  4H9P B;  4UPK A;  3LJA B;  3KUY A;  3W97 D;  3W99 D;  1P3A A;  3UTB C;  1HQ3 A;  3A6N A;  1P3O B;  2W8S A;  3AZG A;  5AVB D;  4WNN A;  5JRG A;  3REI B;  5GSU B;  1F66 D;  2BYM A;  3AN2 C;  4ZUX A;  3X1V C;  2ZY4 A;  5G49 B;  1P3K C;  1ID3 A;  5B2J D;  4NE5 A;  2HIO B;  4UUZ B;  1ZLA A;  5B31 C;  2Y2K A;  4CSR A;  3REJ C;  3NQJ B;  3VH6 W;  4XZQ D;  5AV8 B;  3B0D C;  4QLC A;  1H3O B;  3UTA D;  1P3I A;  1P3F C;  5BO0 A;  4KGC C;  4H9S C;  3AZL B;  1P34 B;  3WA9 C;  4HGA C;  3AV1 C;  3VH6 A;  3AYW A;  3EPH A;  1EQZ C;  4AWL C;  2YFV A;  3A1K A;  3REL D;  3AZM D;  5CPK A;  1P3P A;  4Z5T A;  3C1B B;  3FDD A;  1U35 C;  3B0B A;  1S32 A;  3UT9 A;  1R4V A;  5B0Y A;  5B0Z D;  3UTB D;  3WKJ C;  3W97 A;  1M18 D;  4WU9 C;  4J8W D;  3AZF A;  1KX5 A;  5AVB A;  4JJN C;  4J8X A;  3LZ1 A;  5F99 D;  1F66 A;  3R45 A;  1TZY C;  5AV5 C;  4KUD A;  1KX4 B;  4H9Q A;  5B2J A;  4H9N A;  1M19 B;  3TU4 A;  1Q9C A;  5B2I C;  1P3L C;  3X1T D;  5FUG A;  1AOI D;  5GXQ D;  3MGS D;  3MGR B;  4X23 C;  1P3B C;  3X1S D;  3WAA B;  3UTA A;  3B6F C;  3AZN A;  4J8V C;  5B40 B;  4Z2M H;  2F2A C;  5DNN B;  4KHA B;  5AVC B;  5KDM A;  2CV5 D;  2PYO D;  4R8P C;  3MVD D;  1M1A B;  5BNV A;  2F8N B;  3REL A;  3AZH A;  4J8U D;  3LJA C;  3C1C D;  4ZBJ C;  5E5A A;  4Z66 B;  1P3O C;  3UTB A;  3MGP B;  2VQR A;  1P3G D;  3REI C;  5GSU C;  1P3M B;  5AY8 D;  5B24 C;  3X1V B;  2HIO C;  5B31 B;  3REJ B;  1KX3 D;  1P3K A;  2Y2H A;  2NZD D;  4DRA A;  3REK D;  5AV8 C;  3X1U B;  2FJ7 D;  2FFF B;  5CPJ B;  1P34 C;  3AZL C;  3AV1 B;  1P3F A;  1TAF A;  1AOI A;  4KGC A;  1N1J A;  4H9S A;  3MGS A;  1EQZ B;  3WA9 A;  3KWQ D;  2ARO B;  3MGQ D;  3AZK D;  4G91 C;  3KUY D;  1P3A D;  2CV5 A;  3MVD A;  1BFM A;  1U35 A;  4J8U A;  5JRG D;  3B0C T;  3AL0 C;  1P3O D;  2F8N G;  4WU9 B;  5GSU D;  5GT3 C;  2BYK B;  4JJN B;  1ZLA D;  3REH B;  1P3G A;  1TZY B;  4H9R B;  2RVQ C;  5GT0 B;  5AV6 D;  2NQB C;  1KX4 C;  3P5J B;  1P3I D;  5AV5 A;  5B2I B;  1P3L B;  2UWX A;  1A7W A;  2NZD A;  5B31 G;  4EO5 C;  1BH8 B;  5B1M B;  3REK A;  3MGR C;  5C3I C;  3WAA C;  5BS7 C;  3AV2 B;  1JFI B;  2FJ7 A;  5BNX A;  5CPK D;  1P3B A;  1P3P D;  1T3U A;  3NQU A;  3O62 C;  2RIQ A;  5B40 C;  4WV4 B;  3B6F A;  4J8V A;  5DNN C;  5DNM B;  4XUJ B;  1S32 D;  3C1B D;  3AZE C;  1M1A C;  3V9R B;  4LD9 B;  3LEL C;  2L5A A;  3VH6 T;  4ZBJ B;  2J8P A;  4NFT A;  4Z66 C;  4H9P A;  3LJA A;  3AZF D;  1KX5 D;  3MGP C;  4J8X D;  4E44 A;  3LZ1 D;  1P3O A;  1P3M C;  4CAY B;  5B24 B;  3WTP E;  4KUD D;  3W96 B;  3REI A;  5GSU A;  5B33 B;  4NE3 A;  4H9O B;  3TU4 D;  3B6G C;  2HIO A;  4UUZ A;  5AV6 A;  1M19 D;  3EG5 B;  3AFA B;  4YM6 B;  3NQJ A;  3X1U C;  3AZN D;  5AV8 A;  5CPJ C;  3H0R C;  1H3O A;  3KFU G;  3W98 D;  1P34 A;  4DQY B;  3AZL A;  5JA4 B;  5DNN D;  5AVC D;  2ARO C;  4ZUX B;  5CP6 B;  5B32 B;  3AZH D;  4G91 B;  5B1L B;  5BT1 D;  2F8N D;  5E5A D;  3AZJ B;  5CPI C;  3C1B A;  4Z2M G;  2Y2N A;  5GT3 B;  3AN2 D;  3X1V D;  1P3K D;  3REH C;  2NQB B;  5GT0 C;  5AV9 C;  5B31 D;  3AZI B;  3REJ D;  2JCH A;  3KXB B;  1HTA A;  1KX4 A;  2CWE A;  3UT9 B;  1M19 A;  1P3F D;  4EO5 B;  5B0Y B;  4KGC D;  5B1M C;  3WA9 D;  4WU8 B;  1WWI A;  5C3I B;  3AV1 D;  3AV2 C;  3W99 B;  1EQZ D;  3O62 B;  2ZY5 A;  3W98 A;  1PZR A;  5DNM C;  5AVB B;  5B40 A;  4XUJ C;  3MNN C;  3AZE B;  5DNN A;  1F66 B;  5AVC A;  1U35 D;  4LD9 C;  3LEL B;  4G92 B;  2F8N A;  3WTP C;  5B32 G;  3WKJ D;  5FUG B;  2Y2O A;  4XZQ B;  4WU9 D;  3UTA B;  3LZ0 B;  4YS3 C;  2Y2P A;  3MGP A;  1Z2C B;  4JJN D;  3W96 C;  1P3M A;  1TZY D;  3IP4 C;  5B33 C;  5AV5 D;  3AN2 A;  3X1V A;  3B6G B;  5B31 A;  3REJ A;  5B2I D;  3REL B;  3AZM B;  1P3L D;  2ZM5 A;  3AFA C;  4YM6 C;  4X23 D;  1P3B D;  3B6F D;  3X1U A;  1HQ3 C;  3A6N C;  5B0Z B;  4J8V D;  5CPJ A;  3AZG C;  3AV1 A;  4XUJ D;  4ZUX C;  5CP6 C;  1M18 B;  1EQZ A;  5B32 C;  4R8P D;  4J8W B;  1ID3 C;  2ARO A;  5B1L C;  5F99 B;  5CPI B;  3KSY A;  3AZJ C;  3LJA D;  2YFW B;  4QLC C;  2Y2M A;  3X1T B;  3WKJ A;  3REI D;  5B24 D;  5GXQ B;  4WU9 A;  3X1S B;  5AV9 B;  2XD1 A;  2HIO D;  2BYK A;  4JJN A;  3AZI C;  2JSS A;  2HUE B;  4Z5T C;  3REH A;  1TZY A;  4H9R A;  2DF4 C;  3KXB C;  2PYO B;  5AV8 D;  3UT9 C;  5B2I A;  1P3L A;  5B0Y C;  4J8U B;  1BH9 B;  3AZL D;  4WU8 C;  1P34 D;  3VH5 W;  1BH8 A;  5B1M A;  3W97 C;  3W99 C;  3C1C B;  4X23 A;  4WJ3 C;  3AV2 A;  1JFI A;  2ZY3 A;  5AVB C;  3VH5 A;  3MNN B;  1P3G B;  3H0M C;  5AY8 B;  5DNM A;  1F66 C;  4XUJ A;  1WWS A;  4R8P A;  5B2J C;  3WTP B;  3V9R A;  4G92 C;  4LD9 A;  1KX3 B;  4XZQ C;  5GT3 D;  3UTA C;  1F1E A;  3LZ0 C;  4YS3 B;  2FJ7 B;  5CHL B;  2NQB D;  2RVQ D;  4CAY A;  5B24 A;  3W96 A;  1KX4 D;  5G49 A;  4DRB A;  3KWQ B;  5B33 A;  1KU5 A;  3REL C;  3AZM C;  3MGQ B;  3AZK B;  3KUY B;  1P3A B;  3AFA A;  3MGR D;  3F6T A;  3WAA D;  1HQ3 B;  3A6N B;  3AZG B;  5B0Z C;  5B40 D;  4WNN B;  5JRG B;  3O62 D;  2BYM B;  3H0L C;  5JA4 A;  1M18 C;  1ID3 B;  4J8W C;  3AZE D;  1M1A D;  5CP6 A;  1ZLA B;  5B32 A;  4CSR B;  3LEL D;  5B1L A;  5F99 C;  5AV6 B;  2ZY2 A;  4QLC B;  3AZJ A;  4Z66 D;  1P3I B;  2Y2L A;  5BO0 B;  3MGP D;  3X1T C;  1P3M D;  3LZ0 D;  1AOI C;  5GXQ C;  3AYW B;  3MGS C;  3X1S C;  5GT3 A;  2YFV B;  2Y2Q A;  5CPK B;  1P3P B;  2JE5 A;  3B6G D;  4Z5T B;  2HUE C;  2NQB A;  3AZI A;  2CV5 C;  1S32 B;  2PYO C;  3KXB A;  3MVD C;  3X1U D;  5CPJ D;  4J8U C;  2DQN C;  3W97 B;  3MGR A;  4WU8 A;  3C1C C;  3WAA A;  5BS7 A;  3AZF B;  2ARO D;  3W99 A;  1KX5 B;  3O62 A;  4J8X B;  3LZ1 B;  1P3G C;  3R45 B;  4KHA A;  5AY8 C;  3A1I A;  4KUD B;  4WZS B;  4H9Q B;  5B2J B;  4H9N B;  3AZE A;  5CPI D;  1M1A A;  3TU4 B;  1KX3 C;  3LEL A;  2NZD C;  3REK C;  3EPK A;  4Z66 A;  2IO5 C;  3AZN B;  2FJ7 C;  4XZQ A;  3REH D;  3LZ0 A;  5AV9 D;  5GT0 D;  3W98 B;  5KDM B;  3KWQ C;  1W2E A;  3EPJ A;  5BNV B;  3B6G A;  3AZH B;  3MGQ C;  3AZK C;  3KUY C;  5B1M D;  3AZM A;  1P3A C;  5E5A B;  3AV2 D;  3UTB B;  5JRG C;  5DNM D;  5B0Z A;  3MNN D;  2Y2G A;  3AN2 B;  4LD9 D;  1M18 A;  1ZLA C;  4NE6 A;  1P3K B;  4J8W A;  3WTP D;  5AV6 C;  5F99 A;  5CPI A;  1P3I C;  2Y2I A;  2YFW A;  3B0D B;  3VH5 T;  1TAF B;  1P3F B;  4YS3 D;  1AOI B;  4KGC B;  1N1J B;  3WA9 B;  3MGS B;  3X1T A;  4HGA B;  3AYW C;  3W96 D;  5B33 D;  5GXQ A;  4E45 A;  5CPK C;  1P3P C;  3X1S A;  5GT0 A;  5AV9 A;  4AWL B;  1B6W A;  3AFA D;  2CV5 B;  2XD5 A;  4YM6 D;  2Y2J A;  3MVD B;  1S32 C;  3C1B C;  2BG1 A;  2F8N K;  1U35 B;  2PYO A;  2LY8 A;  1B67 A;  1HQ3 D;  3A6N D;  3AZG D;  1BH9 A;  3WKJ B;  2G5H C;  3AZF C;  4ZUX D;  4M6B A;  5CP6 D;  3C1C A;  5B32 D;  1KX5 C;  4J8X C;  1ID3 D;  3LZ1 C;  5B1L D;  4KUD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...