2PYOA

Drosophila nucleosome core
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (147-MER)
publication title Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2pyoA00
4DRAA 3O62C 2FJ7C 1F66D 3WA9B 3MGSD 1M18C 3X1SA 5GT3B 3AZMB 1P3PD 3AYWD 3W97C 4Z5TA 5CPJC 3B6GB 4J8WD 3W96B 2RVQD 3RELD 1KU5A 5B0ZD 2BYKB 3KXBA 5B33B 3WA9C 1KX5B 5B32B 5GT3C 3AZMC 5JRGB 5BO0B 3KUYD 4JJNA 1S32A 2JSSA 5AVBA 5B31A 3B6GC 3WTPB 1M1AD 3W96C 5C3IB 1P3KB 5CP6D 4WU8D 1P34B 2BYMA 5B33C 1KX5C 3MVDA 4WU9B 5BS7A 1KX3B 1TZYA 5JRGC 4KHAA 2CV5B 3W99A 4KGCA 3WTPC 5C3IC 4H9OA 5AV6A 5DNMA 1P3KC 4XUJD 1P34C 1P3IA 1BH8B 5GSUD 3UTBA 4WU9C 1KX3C 5B2IA 3A6NA 2NZDB 1HTAA 5B24B 1M19B 3LELB 4J8UA 2CV5C 3R45B 1P3AC 4M6BA 5CPID 3REKD 3WTPE 3AZEB 3UT9A 1P3MD 1N1JA 5E5AB 4CAYB 3C1BB 5FUGA 3REHD 3MGQB 2NZDC 1HQ3B 5B24C 3LELC 3W98D 5AV5A 2NQBB 2PYOB 3UTAB 4X23D 3WKJB 4H9NA 4QLCA 2AROB 3AZEC 2F8NA 3AZJA 5B40D 3AV1B 3VH5W 5E5AC 5CPKA 3AZHB 3C1BC 3MGPB 3VH6W 2F8NH 3MGQC 1HQ3C 3AZKD 5B1MA 5B1LD 2NQBC 2PYOC 3UTAC 3WKJC 3LZ0B 2AROC 5CHLB 3AZMA 5GT3A 4G91B 3AV1C 3AZHC 4WV4B 1EQZD 3MGPC 5GXQA 2YFWA 5B2JB 3B0CT 5F99B 4H9RA 2BYKA 1P3OD 4J8VB 3LZ0C 2HIOD 3AZIB 3AZFD 1KX5A 3REIB 2HUEB 4R8PD 2F8NK 4G91C 5JRGA 4YM6B 3LJAB 3AFAD 5BNXB 5B2JC 5F99C 1P3BD 1F66B 3MGSB 5AVCA 1P3KA 1P3PB 1P3GA 3AYWB 1P34A 4J8VC 4NE5A 5AV8C 3AZIC 3REIC 2HUEC 4J8WB 4J8XD 3RELB 4YM6C 5B0ZB 3LJAC 1P3LA 4LD9D 1P3AA 1ID3A 3AZLD 4Z66D 2LY8A 3REJB 1P3PC 3AYWC 3KUYB 1BH8A 4WNNA 3X1UA 3MGRD 4J8WC 2RVQC 1M1AB 3RELC 5B0ZC 2NZDA 5CP6B 3LELA 4WU8B 3B6FA 3AV2A 2YFVA 3AZEA 3REJC 1H3OA 4CAYA 4H9SA 1B6WA 5BNVA 4XUJB 5CP6C 5B32G 3MNND 4WU8C 2PYOA 4DRBA 5GSUB 4Z5TD 3NQJB 3AZHA 3KXBD 3REKB 5CPIB 4XUJC 5B0YD 1P3MB 1B67A 1KX4B 5GT0D 4JJND 5GSUC 3X1VB 5B31D 4Z2MG 4ZUXD 1BH9B 3REHB 4KUDD 3W98B 4X23B 5CPIC 3REKC 5AY8D 3MVDD 3V9RB 1U35D 1TZYD 5B40B 1P3MC 1KX4C 1ULYA 3W99D 3X1VC 5AV8A 4KGCD 5AV6D 5DNMD 3AZKB 4YM6A 5B1LB 5B32C 3W98C 4X23C 4YS3D 5BNXA 1P3ID 3UTBD 1JFIB 5B2ID 5B40C 1P3PA 3AYWA 3A6ND 3NQUB 5BT1D 4J8UD 4UUZB 5KDMA 1EQZB 3B0CW 4XZQB 3UT9D 2L5AA 3AZKC 5B1LC 3KSYA 3VH6A 3AZFB 4R8PB 3REJA 1ZLAA 5AV5D 3AFAB 3AZGD 1EQZC 4XZQC 5AV9A 1Q9CA 4QLCD 1P3BB 3AZNA 2F8ND 3AZJD 3WAAD 4WU8A 5CPKD 1M19C 1AOIA 3AZFC 4R8PC 4J8XB 3O62A 2FJ7A 5B1MD 3AN2D 3LZ1D 3AFAC 1M18A 4H9PB 4LD9B 3AZLB 1P3BC 4Z66B 3W97A 4XUJA 5GT3D 5CPJA 1TAFA 3MGRB 4H9QA 4J8XC 5GXQD 3WA9A 1A7WA 5G49B 4LD9C 3AZLC 3B6GA 1P3MA 1KX4A 5JRGD 3W96A 5DNND 3X1TD 4CSRB 3X1VA 5B31G 3MGRC 5B33A 5AVCD 1P3GD 5B32A 3MNNB 1P34D 4X23A 5BO0A 4Z5TB 3WTPA 1P3LD 4AWLB 1P3AD 3KXBB 1ID3D 4ZBJB 5B0YB 3MNNC 3KWQD 4WU9A 5GT0B 1KX3A 4JJNB 3TU4D 1P3FD 5B31B 4Z5TC 3C1CD 3X1UD 2CV5A 1JFIA 4ZUXB 1F66C 4KUDB 3MGSC 3B6FD 4AWLC 3AV2D 3KXBC 4XZQA 4Z2MH 5AY8B 3MVDB 4ZBJC 5B0YC 1U35B 1TZYB 5GT0C 4JJNC 4KHAB 5B24A 3W99B 1M19A 5B31C 4KGCB 3R45A 4R8PA 4ZUXC 4H9OB 5AV6B 5DNMB 4KUDC 3AFAA 2PYOD 4YS3B 3KUYC 1P3IB 5AY8C 5E5AA 3UTBB 5B2IB 1U35C 1M1AC 3C1BA 3MGQA 3X1SD 1HQ3A 3W99C 4J8UB 4KGCC 2NQBA 3UTAA 5DNMC 3UT9B 3WKJA 2AROA 1F1EA 4H9PA 4YS3C 3AV1A 1P3IC 3UTBC 3B0BA 5B2IC 5FUGB 3MGPA 5BT1C 4J8UC 5AV5B 3AZGB 4H9NB 4QLCB 1S32D 3LZ0A 5AVBD 2F8NB 3AZJB 3WAAB 5CPKB 5JA4B 5AV8D 5F99A 5B1MB 5B2JA 3AN2B 3LZ1B 4CSRA 3AZGC 4QLCC 4J8VA 4EO5B 3AZJC 3AZIA 3REIA 3WAAC 3MNNA 3REHC 4NFTA 5CPKC 3LJAD 3LJAA 5GXQB 2YFWB 1F66A 5B1MC 4H9RB 3AN2C 3LZ1C 3MGSA 3B0DB 4EO5C 3REJD 1BFMA 5B0YA 1ZLAD 4J8WA 5DNNB 5GT0A 3X1TB 3RELA 3VH5A 5B0ZA 4E44A 1P3OB 5AV9D 5GXQC 3AZND 4ZUXA 2HIOB 5AVCB 4KUDA 1P3GB 3B0DC 1AOID 3KUYA 5AY8A 1U35A 3O62D 1M1AA 5DNNC 2FJ7D 3X1TC 1P3LB 1M18D 4HGAB 5CP6A 1P3OC 1P3AB 1ID3B 2HIOC 5AVCC 3W97D 4G92B 1P3GC 5CPJD 3KWQB 3TU4B 4YS3A 1P3FB 3C1CB 4WNNB 3X1UB 4E45A 1P3LC 3WA9D 4HGAC 3AZMD 3B6FB 3AV2B 2YFVB 1ID3C 5GSUA 4G92C 3B6GD 3KWQC 1KX4D 3NQJA 3W96D 3TU4C 1P3FC 3X1VD 1H3OB 3X1UC 3C1CC 5CPIA 5BNVB 3REKA 4Z66C 5B33D 1KX5D 5B32D 3B6FC 3AV2C 4NE3A 3AZGA 3WTPD 3WAAA 1BH9A 3REHA 1P3KD 3X1SB 5JA4A 4WZSB 3W98A 4H9SC 1WWIA 3AN2A 4WU9D 3LZ1A 3V9RA 1KX3D 5B40A 1WWSA 2CV5D 3X1SC 3AZKA 5B1LA 4XZQD 1S32B 5AVBB 2NZDD 5B24D 3NQUA 5AV8B 1M19D 4NE6A 3LELD 4UUZA 2BYMB 1EQZA 5DNNA 3AZED 3X1TA 1P3OA 5E5AD 1S32C 5AVBC 2HIOA 3AZFA 3C1BD 3MGQD 1HQ3D 5KDMB 2NQBD 3UTAD 3WKJD 1P3BA 2AROD 3MVDC 5BS7C 2F8NG 1TZYC 3A6NB 3AV1D 2CWEA 3VH5T 3AZHD 3MGPD 3KWQA 4J8XA 5AV6C 1ZLAB 3VH6T 3TU4A 1P3FA 1N1JB 2IO5B 5AV9B 3C1CA 4LD9A 3AZNB 3LZ0D 3AZLA 4Z66A 3A6NC 1AOIB 3MGRA 3O62B 1ZLAC 2FJ7B 5F99D 5B2JD 3UT9C 1R4VA 1M18B 5G49A 2IO5C 5AV9C 4J8VD 3AZNC 3W97B 3AZID 3REID 5CPJB 1TAFB 4YM6D 1AOIC 5AV5C 4H9QB
chains in the Genus database with same CATH superfamily
4DRAA 3O62C 2FJ7C 1F66D 3WA9B 3MGSD 1M18C 3X1SA 5GT3B 3AZMB 1P3PD 3AYWD 3W97C 4Z5TA 5CPJC 3B6GB 4J8WD 3W96B 2RVQD 3RELD 1KU5A 5B0ZD 2BYKB 3KXBA 5B33B 3WA9C 1KX5B 5B32B 2JCHA 5GT3C 3AZMC 5JRGB 5BO0B 3KUYD 4JJNA 1S32A 2JSSA 5AVBA 5B31A 3B6GC 3WTPB 1M1AD 3W96C 5C3IB 1P3KB 4UPKA 5CP6D 4WU8D 1P34B 2BYMA 5B33C 1KX5C 3MVDA 4WU9B 5BS7A 1KX3B 1TZYA 5JRGC 4KHAA 2CV5B 3W99A 4KGCA 3WTPC 5C3IC 4H9OA 5AV6A 5DNMA 1P3KC 4XUJD 1P34C 1P3IA 1BH8B 5GSUD 3UTBA 4WU9C 1KX3C 5B2IA 3A6NA 2NZDB 1HTAA 5B24B 2Y2LA 1M19B 3LELB 4J8UA 2CV5C 3R45B 1P3AC 4M6BA 5CPID 3REKD 3WTPE 3AZEB 2Y2MA 3UT9A 1P3MD 1N1JA 5E5AB 2Y2JA 4CAYB 3C1BB 5FUGA 3REHD 3MGQB 2NZDC 1HQ3B 5B24C 3LELC 3W98D 5AV5A 2NQBB 2PYOB 3UTAB 4X23D 3WKJB 4H9NA 4QLCA 2AROB 3AZEC 2F8NA 3AZJA 5B40D 3AV1B 3VH5W 5E5AC 5CPKA 3AZHB 3C1BC 3MGPB 3VH6W 2F8NH 3MGQC 1HQ3C 3AZKD 5B1MA 5B1LD 2NQBC 2PYOC 2Y2HA 3UTAC 3WKJC 3LZ0B 2AROC 5CHLB 3AZMA 5GT3A 4G91B 3AV1C 3AZHC 4WV4B 1EQZD 3MGPC 5GXQA 2YFWA 5B2JB 3B0CT 5F99B 4H9RA 2BYKA 1P3OD 4J8VB 2RIQA 3LZ0C 2HIOD 3AZIB 3AZFD 1KX5A 3REIB 2HUEB 4R8PD 2F8NK 4G91C 5JRGA 4YM6B 3LJAB 3AFAD 1PZRA 5BNXB 3IP4C 5B2JC 5F99C 1P3BD 1F66B 3MGSB 5AVCA 1P3KA 1P3PB 1P3GA 3AYWB 1P34A 4J8VC 4NE5A 5AV8C 3AZIC 3REIC 2HUEC 4J8WB 4J8XD 3RELB 4YM6C 5B0ZB 3LJAC 1P3LA 4LD9D 1P3AA 2J8PA 3AZLD 1ID3A 4Z66D 2LY8A 3REJB 1P3PC 3AYWC 3KUYB 1BH8A 4WNNA 3X1UA 3MGRD 4J8WC 2RVQC 1M1AB 3RELC 1W2EA 5B0ZC 2NZDA 3KFUG 5CP6B 3LELA 4WU8B 3B6FA 3AV2A 2YFVA 3AZEA 3REJC 2VQRA 3AL0C 3F6TA 1H3OA 4CAYA 4H9SA 1B6WA 5BNVA 4XUJB 5CP6C 5B32G 3MNND 4WU8C 3H0RC 2PYOA 4DRBA 5GSUB 4Z5TD 3NQJB 3A1KA 3AZHA 3KXBD 3REKB 5CPIB 4XUJC 5B0YD 1P3MB 1B67A 1KX4B 5GT0D 4JJND 2ZY3A 5GSUC 3X1VB 5B31D 4Z2MG 4ZUXD 1BH9B 3REHB 4KUDD 3W98B 4DQYB 4X23B 5CPIC 3H0MC 3REKC 5AY8D 3MVDD 2ZY2A 3V9RB 1U35D 1TZYD 5B40B 1P3MC 1KX4C 1ULYA 3W99D 3X1VC 5AV8A 4KGCD 3A1IA 5AV6D 5DNMD 3AZKB 2Y2KA 5B1LB 5B32C 4YM6A 3W98C 4X23C 4YS3D 5BNXA 1P3ID 3UTBD 1JFIB 5B2ID 5B40C 1P3PA 3AYWA 3A6ND 3NQUB 5BT1D 4J8UD 4UUZB 5KDMA 2Y2QA 1EQZB 3B0CW 4XZQB 3UT9D 2L5AA 3AZKC 5B1LC 3KSYA 2G5IC 3VH6A 2Y2PA 2ZM5A 3AZFB 4R8PB 3REJA 1ZLAA 5AV5D 3AFAB 3AZGD 1EQZC 4XZQC 5AV9A 1Q9CA 4QLCD 1P3BB 3AZNA 2F8ND 3AZJD 2Y2OA 3WAAD 4WU8A 5CPKD 1M19C 1AOIA 3AZFC 4R8PC 4J8XB 3O62A 2FJ7A 5B1MD 3AN2D 3LZ1D 3AFAC 1M18A 4H9PB 4LD9B 2DF4C 3AZLB 1P3BC 4Z66B 3W97A 4XUJA 5GT3D 5CPJA 1TAFA 3MGRB 4H9QA 4J8XC 5GXQD 3WA9A 1A7WA 5G49B 4WJ3C 2Y2NA 4LD9C 3AZLC 3B6GA 1P3MA 1KX4A 5JRGD 3W96A 5DNND 3X1TD 4CSRB 3EPJA 3X1VA 5B31G 2XD1A 3MGRC 3EPLA 5B33A 5AVCD 1P3GD 5B32A 3MNNB 1P34D 4X23A 5BO0A 4Z5TB 3WTPA 1P3LD 4AWLB 1P3AD 3KXBB 1ID3D 4ZBJB 5B0YB 3MNNC 3KWQD 4WU9A 5GT0B 1KX3A 4JJNB 3TU4D 1P3FD 5B31B 2F2AC 4Z5TC 2W8SA 3X1UD 3C1CD 2CV5A 1JFIA 4ZUXB 1F66C 4KUDB 3MGSC 3B6FD 1Z2CB 4AWLC 3AV2D 3KXBC 4XZQA 4Z2MH 5AY8B 3MVDB 4ZBJC 5B0YC 1U35B 1TZYB 3EG5B 5GT0C 4JJNC 2XD5A 4KHAB 5B24A 3W99B 1M19A 5B31C 4KGCB 3R45A 4R8PA 4ZUXC 4H9OB 5AV6B 2ZY5A 5DNMB 4KUDC 3AFAA 2PYOD 4YS3B 3KUYC 1P3IB 5AY8C 5E5AA 3UTBB 5B2IB 1U35C 1M1AC 3C1BA 3MGQA 3X1SD 1HQ3A 3W99C 4J8UB 4KGCC 2NQBA 3UTAA 5DNMC 3UT9B 3WKJA 2AROA 1F1EA 4H9PA 4YS3C 3AV1A 1P3IC 3UTBC 3B0BA 5B2IC 5FUGB 3MGPA 5BT1C 4J8UC 5AV5B 3AZGB 4H9NB 4QLCB 1S32D 3LZ0A 5AVBD 2F8NB 3AZJB 3WAAB 5CPKB 5JA4B 5AV8D 5F99A 5B1MB 5B2JA 3AN2B 3LZ1B 4CSRA 3AZGC 3FDDA 4QLCC 4J8VA 4EO5B 3AZJC 3AZIA 3REIA 3WAAC 3MNNA 3REHC 4NFTA 5CPKC 3LJAD 3LJAA 5GXQB 2YFWB 1F66A 5B1MC 4H9RB 3AN2C 2UWXA 3LZ1C 3MGSA 2JE5A 3B0DB 4EO5C 2ZY4A 3REJD 2DQNC 1BFMA 5B0YA 1ZLAD 4J8WA 5DNNB 5GT0A 1T3UA 2Y2GA 3RELA 3VH5A 5B0ZA 3X1TB 4E44A 1P3OB 5AV9D 5GXQC 3EPHA 3AZND 4ZUXA 2HIOB 5AVCB 4KUDA 1P3GB 3B0DC 1AOID 3KUYA 5AY8A 1U35A 3O62D 1M1AA 5DNNC 2FJ7D 3X1TC 1P3LB 1M18D 4HGAB 5CP6A 1P3OC 1P3AB 1ID3B 2HIOC 5AVCC 3W97D 3H0LC 4G92B 1P3GC 5CPJD 3KWQB 3TU4B 4YS3A 1P3FB 3C1CB 4WNNB 3X1UB 4E45A 1P3LC 3WA9D 4HGAC 3AZMD 3B6FB 3AV2B 2YFVB 1ID3C 5GSUA 4G92C 3B6GD 3KWQC 1KX4D 3NQJA 3W96D 3TU4C 1P3FC 3X1VD 1H3OB 2FFFB 3X1UC 3C1CC 5CPIA 5BNVB 3REKA 4Z66C 5B33D 1KX5D 5B32D 3B6FC 3P5JB 3AV2C 4NE3A 3AZGA 3WTPD 3WAAA 1BH9A 3REHA 1P3KD 3X1SB 5JA4A 4WZSB 3W98A 4H9SC 1WWIA 3AN2A 4WU9D 3LZ1A 3V9RA 1KX3D 5B40A 1WWSA 2CV5D 3X1SC 3AZKA 5B1LA 4XZQD 1S32B 5AVBB 2NZDD 5B24D 3NQUA 5AV8B 1M19D 4NE6A 3LELD 4UUZA 2BYMB 1EQZA 2Y2IA 5DNNA 3AZED 3X1TA 1P3OA 5E5AD 1S32C 5AVBC 2HIOA 3AZFA 3C1BD 3MGQD 1HQ3D 5KDMB 2NQBD 3UTAD 3WKJD 1P3BA 2AROD 3MVDC 5BS7C 2F8NG 1TZYC 3A6NB 3AV1D 2CWEA 3VH5T 3AZHD 3MGPD 3KWQA 4J8XA 5AV6C 1ZLAB 3VH6T 3TU4A 1P3FA 1N1JB 2IO5B 5AV9B 3C1CA 4LD9A 3AZNB 3LZ0D 3AZLA 2BG1A 4Z66A 3A6NC 1AOIB 3MGRA 3O62B 1ZLAC 2FJ7B 2G5HC 5F99D 5B2JD 1R4VA 3UT9C 1M18B 5G49A 2IO5C 5AV9C 4J8VD 3AZNC 3W97B 3AZID 3REID 5CPJB 3EPKA 1TAFB 4YM6D 1AOIC 5AV5C 4H9QB
chains in the Genus database with same CATH topology
4DRAA 3O62C 2FJ7C 1F66D 3WA9B 3MGSD 1M18C 3X1SA 5GT3B 3AZMB 1P3PD 3AYWD 3W97C 4Z5TA 5CPJC 3B6GB 4J8WD 3W96B 2RVQD 3RELD 1KU5A 5B0ZD 2BYKB 3KXBA 5B33B 3WA9C 1KX5B 5B32B 2JCHA 5GT3C 3AZMC 5JRGB 5BO0B 3KUYD 4JJNA 1S32A 2JSSA 5AVBA 5B31A 3B6GC 3WTPB 1M1AD 3W96C 5C3IB 1P3KB 4UPKA 5CP6D 4WU8D 1P34B 2BYMA 5B33C 1KX5C 3MVDA 4WU9B 5BS7A 1KX3B 1TZYA 5JRGC 4KHAA 2CV5B 3W99A 4KGCA 3WTPC 5C3IC 4H9OA 5AV6A 5DNMA 1P3KC 4XUJD 1P34C 1P3IA 1BH8B 5GSUD 3UTBA 4WU9C 1KX3C 5B2IA 3A6NA 2NZDB 1HTAA 5B24B 2Y2LA 1M19B 3LELB 4J8UA 2CV5C 3R45B 1P3AC 4M6BA 5CPID 3REKD 3WTPE 3AZEB 2Y2MA 3UT9A 1P3MD 1N1JA 5E5AB 2Y2JA 4CAYB 3C1BB 5FUGA 3REHD 3MGQB 2NZDC 1HQ3B 5B24C 3LELC 3W98D 5AV5A 2NQBB 2PYOB 3UTAB 4X23D 3WKJB 4H9NA 4QLCA 2AROB 3AZEC 2F8NA 3AZJA 5B40D 3AV1B 3VH5W 5E5AC 5CPKA 3AZHB 3C1BC 3MGPB 3VH6W 2F8NH 3MGQC 1HQ3C 3AZKD 5B1MA 5B1LD 2NQBC 2PYOC 2Y2HA 3UTAC 3WKJC 3LZ0B 2AROC 5CHLB 3AZMA 5GT3A 4G91B 3AV1C 3AZHC 4WV4B 1EQZD 3MGPC 5GXQA 2YFWA 5B2JB 3B0CT 5F99B 4H9RA 2BYKA 1P3OD 4J8VB 2RIQA 3LZ0C 2HIOD 3AZIB 3AZFD 1KX5A 3REIB 2HUEB 4R8PD 2F8NK 4G91C 5JRGA 4YM6B 3LJAB 3AFAD 1PZRA 5BNXB 3IP4C 5B2JC 5F99C 1P3BD 1F66B 3MGSB 5AVCA 1P3KA 1P3PB 1P3GA 3AYWB 1P34A 4J8VC 4NE5A 5AV8C 3AZIC 3REIC 2HUEC 4J8WB 4J8XD 3RELB 4YM6C 5B0ZB 3LJAC 1P3LA 4LD9D 1P3AA 2J8PA 3AZLD 1ID3A 4Z66D 2LY8A 3REJB 1P3PC 3AYWC 3KUYB 1BH8A 4WNNA 3X1UA 3MGRD 4J8WC 2RVQC 1M1AB 3RELC 1W2EA 5B0ZC 2NZDA 3KFUG 5CP6B 3LELA 4WU8B 3B6FA 3AV2A 2YFVA 3AZEA 3REJC 2VQRA 3AL0C 3F6TA 1H3OA 4CAYA 4H9SA 1B6WA 5BNVA 4XUJB 5CP6C 5B32G 3MNND 4WU8C 3H0RC 2PYOA 4DRBA 5GSUB 4Z5TD 3NQJB 3A1KA 3AZHA 3KXBD 3REKB 5CPIB 4XUJC 5B0YD 1P3MB 1B67A 1KX4B 5GT0D 4JJND 2ZY3A 5GSUC 3X1VB 5B31D 4Z2MG 4ZUXD 1BH9B 3REHB 4KUDD 3W98B 4DQYB 4X23B 5CPIC 3H0MC 3REKC 5AY8D 3MVDD 2ZY2A 3V9RB 1U35D 1TZYD 5B40B 1P3MC 1KX4C 1ULYA 3W99D 3X1VC 5AV8A 4KGCD 3A1IA 5AV6D 5DNMD 3AZKB 2Y2KA 5B1LB 5B32C 4YM6A 3W98C 4X23C 4YS3D 5BNXA 1P3ID 3UTBD 1JFIB 5B2ID 5B40C 1P3PA 3AYWA 3A6ND 3NQUB 5BT1D 4J8UD 4UUZB 5KDMA 2Y2QA 1EQZB 3B0CW 4XZQB 3UT9D 2L5AA 3AZKC 5B1LC 3KSYA 2G5IC 3VH6A 2Y2PA 2ZM5A 3AZFB 4R8PB 3REJA 1ZLAA 5AV5D 3AFAB 3AZGD 1EQZC 4XZQC 5AV9A 1Q9CA 4QLCD 1P3BB 3AZNA 2F8ND 3AZJD 2Y2OA 3WAAD 4WU8A 5CPKD 1M19C 1AOIA 3AZFC 4R8PC 4J8XB 3O62A 2FJ7A 5B1MD 3AN2D 3LZ1D 3AFAC 1M18A 4H9PB 4LD9B 2DF4C 3AZLB 1P3BC 4Z66B 3W97A 4XUJA 5GT3D 5CPJA 1TAFA 3MGRB 4H9QA 4J8XC 5GXQD 3WA9A 1A7WA 5G49B 4WJ3C 2Y2NA 4LD9C 3AZLC 3B6GA 1P3MA 1KX4A 5JRGD 3W96A 5DNND 3X1TD 4CSRB 3EPJA 3X1VA 5B31G 2XD1A 3MGRC 3EPLA 5B33A 5AVCD 1P3GD 5B32A 3MNNB 1P34D 4X23A 5BO0A 4Z5TB 3WTPA 1P3LD 4AWLB 1P3AD 3KXBB 1ID3D 4ZBJB 5B0YB 3MNNC 3KWQD 4WU9A 5GT0B 1KX3A 4JJNB 3TU4D 1P3FD 5B31B 2F2AC 4Z5TC 2W8SA 3X1UD 3C1CD 2CV5A 1JFIA 4ZUXB 1F66C 4KUDB 3MGSC 3B6FD 1Z2CB 4AWLC 3AV2D 3KXBC 4XZQA 4Z2MH 5AY8B 3MVDB 4ZBJC 5B0YC 1U35B 1TZYB 3EG5B 5GT0C 4JJNC 2XD5A 4KHAB 5B24A 3W99B 1M19A 5B31C 4KGCB 3R45A 4R8PA 4ZUXC 4H9OB 5AV6B 2ZY5A 5DNMB 4KUDC 3AFAA 2PYOD 4YS3B 3KUYC 1P3IB 5AY8C 5E5AA 3UTBB 5B2IB 1U35C 1M1AC 3C1BA 3MGQA 3X1SD 1HQ3A 3W99C 4J8UB 4KGCC 2NQBA 3UTAA 5DNMC 3UT9B 3WKJA 2AROA 1F1EA 4H9PA 4YS3C 3AV1A 1P3IC 3UTBC 3B0BA 5B2IC 5FUGB 3MGPA 5BT1C 4J8UC 5AV5B 3AZGB 4H9NB 4QLCB 1S32D 3LZ0A 5AVBD 2F8NB 3AZJB 3WAAB 5CPKB 5JA4B 5AV8D 5F99A 5B1MB 5B2JA 3AN2B 3LZ1B 4CSRA 3AZGC 3FDDA 4QLCC 4J8VA 4EO5B 3AZJC 3AZIA 3REIA 3WAAC 3MNNA 3REHC 4NFTA 5CPKC 3LJAD 3LJAA 5GXQB 2YFWB 1F66A 5B1MC 4H9RB 3AN2C 2UWXA 3LZ1C 3MGSA 2JE5A 3B0DB 4EO5C 2ZY4A 3REJD 2DQNC 1BFMA 5B0YA 1ZLAD 4J8WA 5DNNB 5GT0A 1T3UA 2Y2GA 3RELA 3VH5A 5B0ZA 3X1TB 4E44A 1P3OB 5AV9D 5GXQC 3EPHA 3AZND 4ZUXA 2HIOB 5AVCB 4KUDA 1P3GB 3B0DC 1AOID 3KUYA 5AY8A 1U35A 3O62D 1M1AA 5DNNC 2FJ7D 3X1TC 1P3LB 1M18D 4HGAB 5CP6A 1P3OC 1P3AB 1ID3B 2HIOC 5AVCC 3W97D 3H0LC 4G92B 1P3GC 5CPJD 3KWQB 3TU4B 4YS3A 1P3FB 3C1CB 4WNNB 3X1UB 4E45A 1P3LC 3WA9D 4HGAC 3AZMD 3B6FB 3AV2B 2YFVB 1ID3C 5GSUA 4G92C 3B6GD 3KWQC 1KX4D 3NQJA 3W96D 3TU4C 1P3FC 3X1VD 1H3OB 2FFFB 3X1UC 3C1CC 5CPIA 5BNVB 3REKA 4Z66C 5B33D 1KX5D 5B32D 3B6FC 3P5JB 3AV2C 4NE3A 3AZGA 3WTPD 3WAAA 1BH9A 3REHA 1P3KD 3X1SB 5JA4A 4WZSB 3W98A 4H9SC 1WWIA 3AN2A 4WU9D 3LZ1A 3V9RA 1KX3D 5B40A 1WWSA 2CV5D 3X1SC 3AZKA 5B1LA 4XZQD 1S32B 5AVBB 2NZDD 5B24D 3NQUA 5AV8B 1M19D 4NE6A 3LELD 4UUZA 2BYMB 1EQZA 2Y2IA 5DNNA 3AZED 3X1TA 1P3OA 5E5AD 1S32C 5AVBC 2HIOA 3AZFA 3C1BD 3MGQD 1HQ3D 5KDMB 2NQBD 3UTAD 3WKJD 1P3BA 2AROD 3MVDC 5BS7C 2F8NG 1TZYC 3A6NB 3AV1D 2CWEA 3VH5T 3AZHD 3MGPD 3KWQA 4J8XA 5AV6C 1ZLAB 3VH6T 3TU4A 1P3FA 1N1JB 2IO5B 5AV9B 3C1CA 4LD9A 3AZNB 3LZ0D 3AZLA 2BG1A 4Z66A 3A6NC 1AOIB 3MGRA 3O62B 1ZLAC 2FJ7B 2G5HC 5F99D 5B2JD 1R4VA 3UT9C 1M18B 5G49A 2IO5C 5AV9C 4J8VD 3AZNC 3W97B 3AZID 3REID 5CPJB 3EPKA 1TAFB 4YM6D 1AOIC 5AV5C 4H9QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRA A;  3O62 C;  2FJ7 C;  1F66 D;  3WA9 B;  3MGS D;  1M18 C;  3X1S A;  5GT3 B;  3AZM B;  1P3P D;  3AYW D;  3W97 C;  4Z5T A;  5CPJ C;  3B6G B;  4J8W D;  3W96 B;  2RVQ D;  3REL D;  1KU5 A;  5B0Z D;  2BYK B;  3KXB A;  5B33 B;  3WA9 C;  1KX5 B;  5B32 B;  5GT3 C;  3AZM C;  5JRG B;  5BO0 B;  3KUY D;  4JJN A;  1S32 A;  2JSS A;  5AVB A;  5B31 A;  3B6G C;  3WTP B;  1M1A D;  3W96 C;  5C3I B;  1P3K B;  5CP6 D;  4WU8 D;  1P34 B;  2BYM A;  5B33 C;  1KX5 C;  3MVD A;  4WU9 B;  5BS7 A;  1KX3 B;  1TZY A;  5JRG C;  4KHA A;  2CV5 B;  3W99 A;  4KGC A;  3WTP C;  5C3I C;  4H9O A;  5AV6 A;  5DNM A;  1P3K C;  4XUJ D;  1P34 C;  1P3I A;  1BH8 B;  5GSU D;  3UTB A;  4WU9 C;  1KX3 C;  5B2I A;  3A6N A;  2NZD B;  1HTA A;  5B24 B;  1M19 B;  3LEL B;  4J8U A;  2CV5 C;  3R45 B;  1P3A C;  4M6B A;  5CPI D;  3REK D;  3WTP E;  3AZE B;  3UT9 A;  1P3M D;  1N1J A;  5E5A B;  4CAY B;  3C1B B;  5FUG A;  3REH D;  3MGQ B;  2NZD C;  1HQ3 B;  5B24 C;  3LEL C;  3W98 D;  5AV5 A;  2NQB B;  2PYO B;  3UTA B;  4X23 D;  3WKJ B;  4H9N A;  4QLC A;  2ARO B;  3AZE C;  2F8N A;  3AZJ A;  5B40 D;  3AV1 B;  3VH5 W;  5E5A C;  5CPK A;  3AZH B;  3C1B C;  3MGP B;  3VH6 W;  2F8N H;  3MGQ C;  1HQ3 C;  3AZK D;  5B1M A;  5B1L D;  2NQB C;  2PYO C;  3UTA C;  3WKJ C;  3LZ0 B;  2ARO C;  5CHL B;  3AZM A;  5GT3 A;  4G91 B;  3AV1 C;  3AZH C;  4WV4 B;  1EQZ D;  3MGP C;  5GXQ A;  2YFW A;  5B2J B;  3B0C T;  5F99 B;  4H9R A;  2BYK A;  1P3O D;  4J8V B;  3LZ0 C;  2HIO D;  3AZI B;  3AZF D;  1KX5 A;  3REI B;  2HUE B;  4R8P D;  2F8N K;  4G91 C;  5JRG A;  4YM6 B;  3LJA B;  3AFA D;  5BNX B;  5B2J C;  5F99 C;  1P3B D;  1F66 B;  3MGS B;  5AVC A;  1P3K A;  1P3P B;  1P3G A;  3AYW B;  1P34 A;  4J8V C;  4NE5 A;  5AV8 C;  3AZI C;  3REI C;  2HUE C;  4J8W B;  4J8X D;  3REL B;  4YM6 C;  5B0Z B;  3LJA C;  1P3L A;  4LD9 D;  1P3A A;  1ID3 A;  3AZL D;  4Z66 D;  2LY8 A;  3REJ B;  1P3P C;  3AYW C;  3KUY B;  1BH8 A;  4WNN A;  3X1U A;  3MGR D;  4J8W C;  2RVQ C;  1M1A B;  3REL C;  5B0Z C;  2NZD A;  5CP6 B;  3LEL A;  4WU8 B;  3B6F A;  3AV2 A;  2YFV A;  3AZE A;  3REJ C;  1H3O A;  4CAY A;  4H9S A;  1B6W A;  5BNV A;  4XUJ B;  5CP6 C;  5B32 G;  3MNN D;  4WU8 C;  2PYO A;  4DRB A;  5GSU B;  4Z5T D;  3NQJ B;  3AZH A;  3KXB D;  3REK B;  5CPI B;  4XUJ C;  5B0Y D;  1P3M B;  1B67 A;  1KX4 B;  5GT0 D;  4JJN D;  5GSU C;  3X1V B;  5B31 D;  4Z2M G;  4ZUX D;  1BH9 B;  3REH B;  4KUD D;  3W98 B;  4X23 B;  5CPI C;  3REK C;  5AY8 D;  3MVD D;  3V9R B;  1U35 D;  1TZY D;  5B40 B;  1P3M C;  1KX4 C;  1ULY A;  3W99 D;  3X1V C;  5AV8 A;  4KGC D;  5AV6 D;  5DNM D;  3AZK B;  4YM6 A;  5B1L B;  5B32 C;  3W98 C;  4X23 C;  4YS3 D;  5BNX A;  1P3I D;  3UTB D;  1JFI B;  5B2I D;  5B40 C;  1P3P A;  3AYW A;  3A6N D;  3NQU B;  5BT1 D;  4J8U D;  4UUZ B;  5KDM A;  1EQZ B;  3B0C W;  4XZQ B;  3UT9 D;  2L5A A;  3AZK C;  5B1L C;  3KSY A;  3VH6 A;  3AZF B;  4R8P B;  3REJ A;  1ZLA A;  5AV5 D;  3AFA B;  3AZG D;  1EQZ C;  4XZQ C;  5AV9 A;  1Q9C A;  4QLC D;  1P3B B;  3AZN A;  2F8N D;  3AZJ D;  3WAA D;  4WU8 A;  5CPK D;  1M19 C;  1AOI A;  3AZF C;  4R8P C;  4J8X B;  3O62 A;  2FJ7 A;  5B1M D;  3AN2 D;  3LZ1 D;  3AFA C;  1M18 A;  4H9P B;  4LD9 B;  3AZL B;  1P3B C;  4Z66 B;  3W97 A;  4XUJ A;  5GT3 D;  5CPJ A;  1TAF A;  3MGR B;  4H9Q A;  4J8X C;  5GXQ D;  3WA9 A;  1A7W A;  5G49 B;  4LD9 C;  3AZL C;  3B6G A;  1P3M A;  1KX4 A;  5JRG D;  3W96 A;  5DNN D;  3X1T D;  4CSR B;  3X1V A;  5B31 G;  3MGR C;  5B33 A;  5AVC D;  1P3G D;  5B32 A;  3MNN B;  1P34 D;  4X23 A;  5BO0 A;  4Z5T B;  3WTP A;  1P3L D;  4AWL B;  1P3A D;  3KXB B;  1ID3 D;  4ZBJ B;  5B0Y B;  3MNN C;  3KWQ D;  4WU9 A;  5GT0 B;  1KX3 A;  4JJN B;  3TU4 D;  1P3F D;  5B31 B;  4Z5T C;  3C1C D;  3X1U D;  2CV5 A;  1JFI A;  4ZUX B;  1F66 C;  4KUD B;  3MGS C;  3B6F D;  4AWL C;  3AV2 D;  3KXB C;  4XZQ A;  4Z2M H;  5AY8 B;  3MVD B;  4ZBJ C;  5B0Y C;  1U35 B;  1TZY B;  5GT0 C;  4JJN C;  4KHA B;  5B24 A;  3W99 B;  1M19 A;  5B31 C;  4KGC B;  3R45 A;  4R8P A;  4ZUX C;  4H9O B;  5AV6 B;  5DNM B;  4KUD C;  3AFA A;  2PYO D;  4YS3 B;  3KUY C;  1P3I B;  5AY8 C;  5E5A A;  3UTB B;  5B2I B;  1U35 C;  1M1A C;  3C1B A;  3MGQ A;  3X1S D;  1HQ3 A;  3W99 C;  4J8U B;  4KGC C;  2NQB A;  3UTA A;  5DNM C;  3UT9 B;  3WKJ A;  2ARO A;  1F1E A;  4H9P A;  4YS3 C;  3AV1 A;  1P3I C;  3UTB C;  3B0B A;  5B2I C;  5FUG B;  3MGP A;  5BT1 C;  4J8U C;  5AV5 B;  3AZG B;  4H9N B;  4QLC B;  1S32 D;  3LZ0 A;  5AVB D;  2F8N B;  3AZJ B;  3WAA B;  5CPK B;  5JA4 B;  5AV8 D;  5F99 A;  5B1M B;  5B2J A;  3AN2 B;  3LZ1 B;  4CSR A;  3AZG C;  4QLC C;  4J8V A;  4EO5 B;  3AZJ C;  3AZI A;  3REI A;  3WAA C;  3MNN A;  3REH C;  4NFT A;  5CPK C;  3LJA D;  3LJA A;  5GXQ B;  2YFW B;  1F66 A;  5B1M C;  4H9R B;  3AN2 C;  3LZ1 C;  3MGS A;  3B0D B;  4EO5 C;  3REJ D;  1BFM A;  5B0Y A;  1ZLA D;  4J8W A;  5DNN B;  5GT0 A;  3X1T B;  3REL A;  3VH5 A;  5B0Z A;  4E44 A;  1P3O B;  5AV9 D;  5GXQ C;  3AZN D;  4ZUX A;  2HIO B;  5AVC B;  4KUD A;  1P3G B;  3B0D C;  1AOI D;  3KUY A;  5AY8 A;  1U35 A;  3O62 D;  1M1A A;  5DNN C;  2FJ7 D;  3X1T C;  1P3L B;  1M18 D;  4HGA B;  5CP6 A;  1P3O C;  1P3A B;  1ID3 B;  2HIO C;  5AVC C;  3W97 D;  4G92 B;  1P3G C;  5CPJ D;  3KWQ B;  3TU4 B;  4YS3 A;  1P3F B;  3C1C B;  4WNN B;  3X1U B;  4E45 A;  1P3L C;  3WA9 D;  4HGA C;  3AZM D;  3B6F B;  3AV2 B;  2YFV B;  1ID3 C;  5GSU A;  4G92 C;  3B6G D;  3KWQ C;  1KX4 D;  3NQJ A;  3W96 D;  3TU4 C;  1P3F C;  3X1V D;  1H3O B;  3X1U C;  3C1C C;  5CPI A;  5BNV B;  3REK A;  4Z66 C;  5B33 D;  1KX5 D;  5B32 D;  3B6F C;  3AV2 C;  4NE3 A;  3AZG A;  3WTP D;  3WAA A;  1BH9 A;  3REH A;  1P3K D;  3X1S B;  5JA4 A;  4WZS B;  3W98 A;  4H9S C;  1WWI A;  3AN2 A;  4WU9 D;  3LZ1 A;  3V9R A;  1KX3 D;  5B40 A;  1WWS A;  2CV5 D;  3X1S C;  3AZK A;  5B1L A;  4XZQ D;  1S32 B;  5AVB B;  2NZD D;  5B24 D;  3NQU A;  5AV8 B;  1M19 D;  4NE6 A;  3LEL D;  4UUZ A;  2BYM B;  1EQZ A;  5DNN A;  3AZE D;  3X1T A;  1P3O A;  5E5A D;  1S32 C;  5AVB C;  2HIO A;  3AZF A;  3C1B D;  3MGQ D;  1HQ3 D;  5KDM B;  2NQB D;  3UTA D;  3WKJ D;  1P3B A;  2ARO D;  3MVD C;  5BS7 C;  2F8N G;  1TZY C;  3A6N B;  3AV1 D;  2CWE A;  3VH5 T;  3AZH D;  3MGP D;  3KWQ A;  4J8X A;  5AV6 C;  1ZLA B;  3VH6 T;  3TU4 A;  1P3F A;  1N1J B;  2IO5 B;  5AV9 B;  3C1C A;  4LD9 A;  3AZN B;  3LZ0 D;  3AZL A;  4Z66 A;  3A6N C;  1AOI B;  3MGR A;  3O62 B;  1ZLA C;  2FJ7 B;  5F99 D;  5B2J D;  3UT9 C;  1R4V A;  1M18 B;  5G49 A;  2IO5 C;  5AV9 C;  4J8V D;  3AZN C;  3W97 B;  3AZI D;  3REI D;  5CPJ B;  1TAF B;  4YM6 D;  1AOI C;  5AV5 C;  4H9Q B; 
#chains in the Genus database with same CATH topology
 4DRA A;  3O62 C;  2FJ7 C;  1F66 D;  3WA9 B;  3MGS D;  1M18 C;  3X1S A;  5GT3 B;  3AZM B;  1P3P D;  3AYW D;  3W97 C;  4Z5T A;  5CPJ C;  3B6G B;  4J8W D;  3W96 B;  2RVQ D;  3REL D;  1KU5 A;  5B0Z D;  2BYK B;  3KXB A;  5B33 B;  3WA9 C;  1KX5 B;  5B32 B;  2JCH A;  5GT3 C;  3AZM C;  5JRG B;  5BO0 B;  3KUY D;  4JJN A;  1S32 A;  2JSS A;  5AVB A;  5B31 A;  3B6G C;  3WTP B;  1M1A D;  3W96 C;  5C3I B;  1P3K B;  4UPK A;  5CP6 D;  4WU8 D;  1P34 B;  2BYM A;  5B33 C;  1KX5 C;  3MVD A;  4WU9 B;  5BS7 A;  1KX3 B;  1TZY A;  5JRG C;  4KHA A;  2CV5 B;  3W99 A;  4KGC A;  3WTP C;  5C3I C;  4H9O A;  5AV6 A;  5DNM A;  1P3K C;  4XUJ D;  1P34 C;  1P3I A;  1BH8 B;  5GSU D;  3UTB A;  4WU9 C;  1KX3 C;  5B2I A;  3A6N A;  2NZD B;  1HTA A;  5B24 B;  2Y2L A;  1M19 B;  3LEL B;  4J8U A;  2CV5 C;  3R45 B;  1P3A C;  4M6B A;  5CPI D;  3REK D;  3WTP E;  3AZE B;  2Y2M A;  3UT9 A;  1P3M D;  1N1J A;  5E5A B;  2Y2J A;  4CAY B;  3C1B B;  5FUG A;  3REH D;  3MGQ B;  2NZD C;  1HQ3 B;  5B24 C;  3LEL C;  3W98 D;  5AV5 A;  2NQB B;  2PYO B;  3UTA B;  4X23 D;  3WKJ B;  4H9N A;  4QLC A;  2ARO B;  3AZE C;  2F8N A;  3AZJ A;  5B40 D;  3AV1 B;  3VH5 W;  5E5A C;  5CPK A;  3AZH B;  3C1B C;  3MGP B;  3VH6 W;  2F8N H;  3MGQ C;  1HQ3 C;  3AZK D;  5B1M A;  5B1L D;  2NQB C;  2PYO C;  2Y2H A;  3UTA C;  3WKJ C;  3LZ0 B;  2ARO C;  5CHL B;  3AZM A;  5GT3 A;  4G91 B;  3AV1 C;  3AZH C;  4WV4 B;  1EQZ D;  3MGP C;  5GXQ A;  2YFW A;  5B2J B;  3B0C T;  5F99 B;  4H9R A;  2BYK A;  1P3O D;  4J8V B;  2RIQ A;  3LZ0 C;  2HIO D;  3AZI B;  3AZF D;  1KX5 A;  3REI B;  2HUE B;  4R8P D;  2F8N K;  4G91 C;  5JRG A;  4YM6 B;  3LJA B;  3AFA D;  1PZR A;  5BNX B;  3IP4 C;  5B2J C;  5F99 C;  1P3B D;  1F66 B;  3MGS B;  5AVC A;  1P3K A;  1P3P B;  1P3G A;  3AYW B;  1P34 A;  4J8V C;  4NE5 A;  5AV8 C;  3AZI C;  3REI C;  2HUE C;  4J8W B;  4J8X D;  3REL B;  4YM6 C;  5B0Z B;  3LJA C;  1P3L A;  4LD9 D;  1P3A A;  2J8P A;  3AZL D;  1ID3 A;  4Z66 D;  2LY8 A;  3REJ B;  1P3P C;  3AYW C;  3KUY B;  1BH8 A;  4WNN A;  3X1U A;  3MGR D;  4J8W C;  2RVQ C;  1M1A B;  3REL C;  1W2E A;  5B0Z C;  2NZD A;  3KFU G;  5CP6 B;  3LEL A;  4WU8 B;  3B6F A;  3AV2 A;  2YFV A;  3AZE A;  3REJ C;  2VQR A;  3AL0 C;  3F6T A;  1H3O A;  4CAY A;  4H9S A;  1B6W A;  5BNV A;  4XUJ B;  5CP6 C;  5B32 G;  3MNN D;  4WU8 C;  3H0R C;  2PYO A;  4DRB A;  5GSU B;  4Z5T D;  3NQJ B;  3A1K A;  3AZH A;  3KXB D;  3REK B;  5CPI B;  4XUJ C;  5B0Y D;  1P3M B;  1B67 A;  1KX4 B;  5GT0 D;  4JJN D;  2ZY3 A;  5GSU C;  3X1V B;  5B31 D;  4Z2M G;  4ZUX D;  1BH9 B;  3REH B;  4KUD D;  3W98 B;  4DQY B;  4X23 B;  5CPI C;  3H0M C;  3REK C;  5AY8 D;  3MVD D;  2ZY2 A;  3V9R B;  1U35 D;  1TZY D;  5B40 B;  1P3M C;  1KX4 C;  1ULY A;  3W99 D;  3X1V C;  5AV8 A;  4KGC D;  3A1I A;  5AV6 D;  5DNM D;  3AZK B;  2Y2K A;  5B1L B;  5B32 C;  4YM6 A;  3W98 C;  4X23 C;  4YS3 D;  5BNX A;  1P3I D;  3UTB D;  1JFI B;  5B2I D;  5B40 C;  1P3P A;  3AYW A;  3A6N D;  3NQU B;  5BT1 D;  4J8U D;  4UUZ B;  5KDM A;  2Y2Q A;  1EQZ B;  3B0C W;  4XZQ B;  3UT9 D;  2L5A A;  3AZK C;  5B1L C;  3KSY A;  2G5I C;  3VH6 A;  2Y2P A;  2ZM5 A;  3AZF B;  4R8P B;  3REJ A;  1ZLA A;  5AV5 D;  3AFA B;  3AZG D;  1EQZ C;  4XZQ C;  5AV9 A;  1Q9C A;  4QLC D;  1P3B B;  3AZN A;  2F8N D;  3AZJ D;  2Y2O A;  3WAA D;  4WU8 A;  5CPK D;  1M19 C;  1AOI A;  3AZF C;  4R8P C;  4J8X B;  3O62 A;  2FJ7 A;  5B1M D;  3AN2 D;  3LZ1 D;  3AFA C;  1M18 A;  4H9P B;  4LD9 B;  2DF4 C;  3AZL B;  1P3B C;  4Z66 B;  3W97 A;  4XUJ A;  5GT3 D;  5CPJ A;  1TAF A;  3MGR B;  4H9Q A;  4J8X C;  5GXQ D;  3WA9 A;  1A7W A;  5G49 B;  4WJ3 C;  2Y2N A;  4LD9 C;  3AZL C;  3B6G A;  1P3M A;  1KX4 A;  5JRG D;  3W96 A;  5DNN D;  3X1T D;  4CSR B;  3EPJ A;  3X1V A;  5B31 G;  2XD1 A;  3MGR C;  3EPL A;  5B33 A;  5AVC D;  1P3G D;  5B32 A;  3MNN B;  1P34 D;  4X23 A;  5BO0 A;  4Z5T B;  3WTP A;  1P3L D;  4AWL B;  1P3A D;  3KXB B;  1ID3 D;  4ZBJ B;  5B0Y B;  3MNN C;  3KWQ D;  4WU9 A;  5GT0 B;  1KX3 A;  4JJN B;  3TU4 D;  1P3F D;  5B31 B;  2F2A C;  4Z5T C;  2W8S A;  3X1U D;  3C1C D;  2CV5 A;  1JFI A;  4ZUX B;  1F66 C;  4KUD B;  3MGS C;  3B6F D;  1Z2C B;  4AWL C;  3AV2 D;  3KXB C;  4XZQ A;  4Z2M H;  5AY8 B;  3MVD B;  4ZBJ C;  5B0Y C;  1U35 B;  1TZY B;  3EG5 B;  5GT0 C;  4JJN C;  2XD5 A;  4KHA B;  5B24 A;  3W99 B;  1M19 A;  5B31 C;  4KGC B;  3R45 A;  4R8P A;  4ZUX C;  4H9O B;  5AV6 B;  2ZY5 A;  5DNM B;  4KUD C;  3AFA A;  2PYO D;  4YS3 B;  3KUY C;  1P3I B;  5AY8 C;  5E5A A;  3UTB B;  5B2I B;  1U35 C;  1M1A C;  3C1B A;  3MGQ A;  3X1S D;  1HQ3 A;  3W99 C;  4J8U B;  4KGC C;  2NQB A;  3UTA A;  5DNM C;  3UT9 B;  3WKJ A;  2ARO A;  1F1E A;  4H9P A;  4YS3 C;  3AV1 A;  1P3I C;  3UTB C;  3B0B A;  5B2I C;  5FUG B;  3MGP A;  5BT1 C;  4J8U C;  5AV5 B;  3AZG B;  4H9N B;  4QLC B;  1S32 D;  3LZ0 A;  5AVB D;  2F8N B;  3AZJ B;  3WAA B;  5CPK B;  5JA4 B;  5AV8 D;  5F99 A;  5B1M B;  5B2J A;  3AN2 B;  3LZ1 B;  4CSR A;  3AZG C;  3FDD A;  4QLC C;  4J8V A;  4EO5 B;  3AZJ C;  3AZI A;  3REI A;  3WAA C;  3MNN A;  3REH C;  4NFT A;  5CPK C;  3LJA D;  3LJA A;  5GXQ B;  2YFW B;  1F66 A;  5B1M C;  4H9R B;  3AN2 C;  2UWX A;  3LZ1 C;  3MGS A;  2JE5 A;  3B0D B;  4EO5 C;  2ZY4 A;  3REJ D;  2DQN C;  1BFM A;  5B0Y A;  1ZLA D;  4J8W A;  5DNN B;  5GT0 A;  1T3U A;  2Y2G A;  3REL A;  3VH5 A;  5B0Z A;  3X1T B;  4E44 A;  1P3O B;  5AV9 D;  5GXQ C;  3EPH A;  3AZN D;  4ZUX A;  2HIO B;  5AVC B;  4KUD A;  1P3G B;  3B0D C;  1AOI D;  3KUY A;  5AY8 A;  1U35 A;  3O62 D;  1M1A A;  5DNN C;  2FJ7 D;  3X1T C;  1P3L B;  1M18 D;  4HGA B;  5CP6 A;  1P3O C;  1P3A B;  1ID3 B;  2HIO C;  5AVC C;  3W97 D;  3H0L C;  4G92 B;  1P3G C;  5CPJ D;  3KWQ B;  3TU4 B;  4YS3 A;  1P3F B;  3C1C B;  4WNN B;  3X1U B;  4E45 A;  1P3L C;  3WA9 D;  4HGA C;  3AZM D;  3B6F B;  3AV2 B;  2YFV B;  1ID3 C;  5GSU A;  4G92 C;  3B6G D;  3KWQ C;  1KX4 D;  3NQJ A;  3W96 D;  3TU4 C;  1P3F C;  3X1V D;  1H3O B;  2FFF B;  3X1U C;  3C1C C;  5CPI A;  5BNV B;  3REK A;  4Z66 C;  5B33 D;  1KX5 D;  5B32 D;  3B6F C;  3P5J B;  3AV2 C;  4NE3 A;  3AZG A;  3WTP D;  3WAA A;  1BH9 A;  3REH A;  1P3K D;  3X1S B;  5JA4 A;  4WZS B;  3W98 A;  4H9S C;  1WWI A;  3AN2 A;  4WU9 D;  3LZ1 A;  3V9R A;  1KX3 D;  5B40 A;  1WWS A;  2CV5 D;  3X1S C;  3AZK A;  5B1L A;  4XZQ D;  1S32 B;  5AVB B;  2NZD D;  5B24 D;  3NQU A;  5AV8 B;  1M19 D;  4NE6 A;  3LEL D;  4UUZ A;  2BYM B;  1EQZ A;  2Y2I A;  5DNN A;  3AZE D;  3X1T A;  1P3O A;  5E5A D;  1S32 C;  5AVB C;  2HIO A;  3AZF A;  3C1B D;  3MGQ D;  1HQ3 D;  5KDM B;  2NQB D;  3UTA D;  3WKJ D;  1P3B A;  2ARO D;  3MVD C;  5BS7 C;  2F8N G;  1TZY C;  3A6N B;  3AV1 D;  2CWE A;  3VH5 T;  3AZH D;  3MGP D;  3KWQ A;  4J8X A;  5AV6 C;  1ZLA B;  3VH6 T;  3TU4 A;  1P3F A;  1N1J B;  2IO5 B;  5AV9 B;  3C1C A;  4LD9 A;  3AZN B;  3LZ0 D;  3AZL A;  2BG1 A;  4Z66 A;  3A6N C;  1AOI B;  3MGR A;  3O62 B;  1ZLA C;  2FJ7 B;  2G5H C;  5F99 D;  5B2J D;  1R4V A;  3UT9 C;  1M18 B;  5G49 A;  2IO5 C;  5AV9 C;  4J8V D;  3AZN C;  3W97 B;  3AZI D;  3REI D;  5CPJ B;  3EPK A;  1TAF B;  4YM6 D;  1AOI C;  5AV5 C;  4H9Q B; 
#chains in the Genus database with same CATH homology
 4DRA A;  3O62 C;  2FJ7 C;  1F66 D;  3WA9 B;  3MGS D;  1M18 C;  3X1S A;  5GT3 B;  3AZM B;  1P3P D;  3AYW D;  3W97 C;  4Z5T A;  5CPJ C;  3B6G B;  4J8W D;  3W96 B;  2RVQ D;  3REL D;  1KU5 A;  5B0Z D;  2BYK B;  3KXB A;  5B33 B;  3WA9 C;  1KX5 B;  5B32 B;  2JCH A;  5GT3 C;  3AZM C;  5JRG B;  5BO0 B;  3KUY D;  4JJN A;  1S32 A;  2JSS A;  5AVB A;  5B31 A;  3B6G C;  3WTP B;  1M1A D;  3W96 C;  5C3I B;  1P3K B;  4UPK A;  5CP6 D;  4WU8 D;  1P34 B;  2BYM A;  5B33 C;  1KX5 C;  3MVD A;  4WU9 B;  5BS7 A;  1KX3 B;  1TZY A;  5JRG C;  4KHA A;  2CV5 B;  3W99 A;  4KGC A;  3WTP C;  5C3I C;  4H9O A;  5AV6 A;  5DNM A;  1P3K C;  4XUJ D;  1P34 C;  1P3I A;  1BH8 B;  5GSU D;  3UTB A;  4WU9 C;  1KX3 C;  5B2I A;  3A6N A;  2NZD B;  1HTA A;  5B24 B;  2Y2L A;  1M19 B;  3LEL B;  4J8U A;  2CV5 C;  3R45 B;  1P3A C;  4M6B A;  5CPI D;  3REK D;  3WTP E;  3AZE B;  2Y2M A;  3UT9 A;  1P3M D;  1N1J A;  5E5A B;  2Y2J A;  4CAY B;  3C1B B;  5FUG A;  3REH D;  3MGQ B;  2NZD C;  1HQ3 B;  5B24 C;  3LEL C;  3W98 D;  5AV5 A;  2NQB B;  2PYO B;  3UTA B;  4X23 D;  3WKJ B;  4H9N A;  4QLC A;  2ARO B;  3AZE C;  2F8N A;  3AZJ A;  5B40 D;  3AV1 B;  3VH5 W;  5E5A C;  5CPK A;  3AZH B;  3C1B C;  3MGP B;  3VH6 W;  2F8N H;  3MGQ C;  1HQ3 C;  3AZK D;  5B1M A;  5B1L D;  2NQB C;  2PYO C;  2Y2H A;  3UTA C;  3WKJ C;  3LZ0 B;  2ARO C;  5CHL B;  3AZM A;  5GT3 A;  4G91 B;  3AV1 C;  3AZH C;  4WV4 B;  1EQZ D;  3MGP C;  5GXQ A;  2YFW A;  5B2J B;  3B0C T;  5F99 B;  4H9R A;  2BYK A;  1P3O D;  4J8V B;  2RIQ A;  3LZ0 C;  2HIO D;  3AZI B;  3AZF D;  1KX5 A;  3REI B;  2HUE B;  4R8P D;  2F8N K;  4G91 C;  5JRG A;  4YM6 B;  3LJA B;  3AFA D;  1PZR A;  5BNX B;  3IP4 C;  5B2J C;  5F99 C;  1P3B D;  1F66 B;  3MGS B;  5AVC A;  1P3K A;  1P3P B;  1P3G A;  3AYW B;  1P34 A;  4J8V C;  4NE5 A;  5AV8 C;  3AZI C;  3REI C;  2HUE C;  4J8W B;  4J8X D;  3REL B;  4YM6 C;  5B0Z B;  3LJA C;  1P3L A;  4LD9 D;  1P3A A;  2J8P A;  3AZL D;  1ID3 A;  4Z66 D;  2LY8 A;  3REJ B;  1P3P C;  3AYW C;  3KUY B;  1BH8 A;  4WNN A;  3X1U A;  3MGR D;  4J8W C;  2RVQ C;  1M1A B;  3REL C;  1W2E A;  5B0Z C;  2NZD A;  3KFU G;  5CP6 B;  3LEL A;  4WU8 B;  3B6F A;  3AV2 A;  2YFV A;  3AZE A;  3REJ C;  2VQR A;  3AL0 C;  3F6T A;  1H3O A;  4CAY A;  4H9S A;  1B6W A;  5BNV A;  4XUJ B;  5CP6 C;  5B32 G;  3MNN D;  4WU8 C;  3H0R C;  2PYO A;  4DRB A;  5GSU B;  4Z5T D;  3NQJ B;  3A1K A;  3AZH A;  3KXB D;  3REK B;  5CPI B;  4XUJ C;  5B0Y D;  1P3M B;  1B67 A;  1KX4 B;  5GT0 D;  4JJN D;  2ZY3 A;  5GSU C;  3X1V B;  5B31 D;  4Z2M G;  4ZUX D;  1BH9 B;  3REH B;  4KUD D;  3W98 B;  4DQY B;  4X23 B;  5CPI C;  3H0M C;  3REK C;  5AY8 D;  3MVD D;  2ZY2 A;  3V9R B;  1U35 D;  1TZY D;  5B40 B;  1P3M C;  1KX4 C;  1ULY A;  3W99 D;  3X1V C;  5AV8 A;  4KGC D;  3A1I A;  5AV6 D;  5DNM D;  3AZK B;  2Y2K A;  5B1L B;  5B32 C;  4YM6 A;  3W98 C;  4X23 C;  4YS3 D;  5BNX A;  1P3I D;  3UTB D;  1JFI B;  5B2I D;  5B40 C;  1P3P A;  3AYW A;  3A6N D;  3NQU B;  5BT1 D;  4J8U D;  4UUZ B;  5KDM A;  2Y2Q A;  1EQZ B;  3B0C W;  4XZQ B;  3UT9 D;  2L5A A;  3AZK C;  5B1L C;  3KSY A;  2G5I C;  3VH6 A;  2Y2P A;  2ZM5 A;  3AZF B;  4R8P B;  3REJ A;  1ZLA A;  5AV5 D;  3AFA B;  3AZG D;  1EQZ C;  4XZQ C;  5AV9 A;  1Q9C A;  4QLC D;  1P3B B;  3AZN A;  2F8N D;  3AZJ D;  2Y2O A;  3WAA D;  4WU8 A;  5CPK D;  1M19 C;  1AOI A;  3AZF C;  4R8P C;  4J8X B;  3O62 A;  2FJ7 A;  5B1M D;  3AN2 D;  3LZ1 D;  3AFA C;  1M18 A;  4H9P B;  4LD9 B;  2DF4 C;  3AZL B;  1P3B C;  4Z66 B;  3W97 A;  4XUJ A;  5GT3 D;  5CPJ A;  1TAF A;  3MGR B;  4H9Q A;  4J8X C;  5GXQ D;  3WA9 A;  1A7W A;  5G49 B;  4WJ3 C;  2Y2N A;  4LD9 C;  3AZL C;  3B6G A;  1P3M A;  1KX4 A;  5JRG D;  3W96 A;  5DNN D;  3X1T D;  4CSR B;  3EPJ A;  3X1V A;  5B31 G;  2XD1 A;  3MGR C;  3EPL A;  5B33 A;  5AVC D;  1P3G D;  5B32 A;  3MNN B;  1P34 D;  4X23 A;  5BO0 A;  4Z5T B;  3WTP A;  1P3L D;  4AWL B;  1P3A D;  3KXB B;  1ID3 D;  4ZBJ B;  5B0Y B;  3MNN C;  3KWQ D;  4WU9 A;  5GT0 B;  1KX3 A;  4JJN B;  3TU4 D;  1P3F D;  5B31 B;  2F2A C;  4Z5T C;  2W8S A;  3X1U D;  3C1C D;  2CV5 A;  1JFI A;  4ZUX B;  1F66 C;  4KUD B;  3MGS C;  3B6F D;  1Z2C B;  4AWL C;  3AV2 D;  3KXB C;  4XZQ A;  4Z2M H;  5AY8 B;  3MVD B;  4ZBJ C;  5B0Y C;  1U35 B;  1TZY B;  3EG5 B;  5GT0 C;  4JJN C;  2XD5 A;  4KHA B;  5B24 A;  3W99 B;  1M19 A;  5B31 C;  4KGC B;  3R45 A;  4R8P A;  4ZUX C;  4H9O B;  5AV6 B;  2ZY5 A;  5DNM B;  4KUD C;  3AFA A;  2PYO D;  4YS3 B;  3KUY C;  1P3I B;  5AY8 C;  5E5A A;  3UTB B;  5B2I B;  1U35 C;  1M1A C;  3C1B A;  3MGQ A;  3X1S D;  1HQ3 A;  3W99 C;  4J8U B;  4KGC C;  2NQB A;  3UTA A;  5DNM C;  3UT9 B;  3WKJ A;  2ARO A;  1F1E A;  4H9P A;  4YS3 C;  3AV1 A;  1P3I C;  3UTB C;  3B0B A;  5B2I C;  5FUG B;  3MGP A;  5BT1 C;  4J8U C;  5AV5 B;  3AZG B;  4H9N B;  4QLC B;  1S32 D;  3LZ0 A;  5AVB D;  2F8N B;  3AZJ B;  3WAA B;  5CPK B;  5JA4 B;  5AV8 D;  5F99 A;  5B1M B;  5B2J A;  3AN2 B;  3LZ1 B;  4CSR A;  3AZG C;  3FDD A;  4QLC C;  4J8V A;  4EO5 B;  3AZJ C;  3AZI A;  3REI A;  3WAA C;  3MNN A;  3REH C;  4NFT A;  5CPK C;  3LJA D;  3LJA A;  5GXQ B;  2YFW B;  1F66 A;  5B1M C;  4H9R B;  3AN2 C;  2UWX A;  3LZ1 C;  3MGS A;  2JE5 A;  3B0D B;  4EO5 C;  2ZY4 A;  3REJ D;  2DQN C;  1BFM A;  5B0Y A;  1ZLA D;  4J8W A;  5DNN B;  5GT0 A;  1T3U A;  2Y2G A;  3REL A;  3VH5 A;  5B0Z A;  3X1T B;  4E44 A;  1P3O B;  5AV9 D;  5GXQ C;  3EPH A;  3AZN D;  4ZUX A;  2HIO B;  5AVC B;  4KUD A;  1P3G B;  3B0D C;  1AOI D;  3KUY A;  5AY8 A;  1U35 A;  3O62 D;  1M1A A;  5DNN C;  2FJ7 D;  3X1T C;  1P3L B;  1M18 D;  4HGA B;  5CP6 A;  1P3O C;  1P3A B;  1ID3 B;  2HIO C;  5AVC C;  3W97 D;  3H0L C;  4G92 B;  1P3G C;  5CPJ D;  3KWQ B;  3TU4 B;  4YS3 A;  1P3F B;  3C1C B;  4WNN B;  3X1U B;  4E45 A;  1P3L C;  3WA9 D;  4HGA C;  3AZM D;  3B6F B;  3AV2 B;  2YFV B;  1ID3 C;  5GSU A;  4G92 C;  3B6G D;  3KWQ C;  1KX4 D;  3NQJ A;  3W96 D;  3TU4 C;  1P3F C;  3X1V D;  1H3O B;  2FFF B;  3X1U C;  3C1C C;  5CPI A;  5BNV B;  3REK A;  4Z66 C;  5B33 D;  1KX5 D;  5B32 D;  3B6F C;  3P5J B;  3AV2 C;  4NE3 A;  3AZG A;  3WTP D;  3WAA A;  1BH9 A;  3REH A;  1P3K D;  3X1S B;  5JA4 A;  4WZS B;  3W98 A;  4H9S C;  1WWI A;  3AN2 A;  4WU9 D;  3LZ1 A;  3V9R A;  1KX3 D;  5B40 A;  1WWS A;  2CV5 D;  3X1S C;  3AZK A;  5B1L A;  4XZQ D;  1S32 B;  5AVB B;  2NZD D;  5B24 D;  3NQU A;  5AV8 B;  1M19 D;  4NE6 A;  3LEL D;  4UUZ A;  2BYM B;  1EQZ A;  2Y2I A;  5DNN A;  3AZE D;  3X1T A;  1P3O A;  5E5A D;  1S32 C;  5AVB C;  2HIO A;  3AZF A;  3C1B D;  3MGQ D;  1HQ3 D;  5KDM B;  2NQB D;  3UTA D;  3WKJ D;  1P3B A;  2ARO D;  3MVD C;  5BS7 C;  2F8N G;  1TZY C;  3A6N B;  3AV1 D;  2CWE A;  3VH5 T;  3AZH D;  3MGP D;  3KWQ A;  4J8X A;  5AV6 C;  1ZLA B;  3VH6 T;  3TU4 A;  1P3F A;  1N1J B;  2IO5 B;  5AV9 B;  3C1C A;  4LD9 A;  3AZN B;  3LZ0 D;  3AZL A;  2BG1 A;  4Z66 A;  3A6N C;  1AOI B;  3MGR A;  3O62 B;  1ZLA C;  2FJ7 B;  2G5H C;  5F99 D;  5B2J D;  1R4V A;  3UT9 C;  1M18 B;  5G49 A;  2IO5 C;  5AV9 C;  4J8V D;  3AZN C;  3W97 B;  3AZI D;  3REI D;  5CPJ B;  3EPK A;  1TAF B;  4YM6 D;  1AOI C;  5AV5 C;  4H9Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...