2PYOA

Drosophila nucleosome core
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (147-MER)
publication title Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2pyoA00
2HIOB 5B0ZB 2F8NK 4H9OB 4J8WC 3C1CD 4Z2MG 4HGAC 5B32B 3AZGA 3VH6A 3W99D 2AROC 2RVQC 5DNMA 3MGRD 3KSYA 1KX5D 5AV9B 1TAFA 2LY8A 5AVBD 3UTAB 5CPIA 1P3MA 3LZ1B 5C3IB 3KXBC 1N1JB 3AV2C 3W96C 4YS3C 1P3ID 3X1SB 1B6WA 2BYMA 5AV6B 4Z2MH 3MGPB 3UT9B 2YFWB 3AZIB 3REKD 3AV1C 1KX4C 1AOID 1P34C 1P3LA 5B1MC 5E5AB 4X23B 4J8UB 4H9PA 4J8VA 4KUDA 1P3PB 3REIA 4XZQD 5JRGB 3AZLD 2NQBA 5GSUB 5B0YD 1P3AA 5B2IB 1M19A 5CP6C 1R4VA 1TZYC 1F66A 5BO0B 5AV5B 4DRBA 3A6NA 4QLCD 3X1UC 3MNND 5B40A 5B31D 4ZUXD 3AZKA 1U35A 3WTPC 3LELA 4J8XC 2CV5A 4WNNA 4UUZA 4WU8C 3VH5A 5GT0A 3X1VB 5GT3D 1KX3A 4H9SA 3KUYB 3C1BD 3AZMA 1P3OA 4XUJA 1ZLAB 1P3MC 4WV4B 4JJND 1HQ3D 3B0CW 5AY8A 5F99D 3NQUB 1P3BC 4NE6A 3REJB 1M1AA 4R8PA 1P3LC 4Z66A 2HIOA 5B0ZA 3LZ0B 4H9OA 4J8VC 1P3KD 3C1CB 4KUDC 4YM6D 3AZND 5B32A 3W99B 5B32G 4E44A 2NZDA 2NQBC 3MGRB 4J8WD 1P3AC 1KX5B 5AVBB 4Z5TC 3UTBB 5AVCC 3UTAA 3AZEA 2AROD 1M18C 2RVQD 1F66C 5GXQC 3LZ1A 3W98B 1N1JA 1JFIB 3WAAC 3X1SA 3MGPA 1U35C 3UT9A 2YFWA 3REKB 3AZIA 4H9QB 3KXBD 1P3FC 3B6FC 1AOIB 3AV2D 2FJ7C 3W96D 1BH8B 5GT0C 4X23A 5E5AA 1KX3C 4J8UA 3AYWC 3AV1D 1KX4D 3AZMC 1P34D 3AZJA 1P3PA 4XUJC 4H9RA 3R45B 4XZQB 5B1MD 3MVDB 3AZFB 5JRGA 4E45A 3AZLB 5B0YB 5GSUA 3KWQD 5B2IA 3X1TB 5AY8C 2YFVB 5B24B 5BO0A 5AV5A 4QLCB 3MNNB 4R8PC 1EQZC 1P3GD 4Z66C 5B31B 4ZUXB 3B0DB 5G49B 5CP6D 1H3OB 3X1UD 1F1EA 4WU9B 4KGCB 3NQJB 5GT3B 3X1VA 2NZDC 1WWIA 3B6GA 3W97B 3WTPD 3C1BB 4J8XD 4CSRB 3AZEC 4WU8D 4JJNB 3LZ1C 5C3IC 1HQ3B 3TU4D 3LJAB 5CPKA 4AWLB 3UT9C 3AZIC 5B33B 3NQUA 5B2JB 1ID3B 3REJA 3WKJB 1BH9B 3B0BA 5E5AC 4X23C 4J8UC 5BNXA 5B1LA 3LZ0A 3C1CA 4YM6B 3AZNB 1P3BD 1P3PC 3AZJC 3AN2A 1P3LD 4G91B 2PYOD 2JSSA 5FUGB 1S32D 4CAYB 5JRGC 4J8WB 5BS7A 4J8VD 3MGRA 1KX5A 4KUDD 4HGAB 5AVBA 3UTBA 2AROB 2NQBD 3W98A 3VH5T 3RELC 3AZHB 1P3AD 2F8NB 4Z5TD 1JFIA 5AVCD 1M18D 1F66D 3REHC 5GXQD 3KXBB 3MGSC 3REKA 1WWSA 1AOIA 2HUEC 1BH8A 3WAAD 3X1VC 1U35D 5AV8B 4G92C 3B6GC 5CPJA 1P3FD 1KX4B 3B6FD 3O62B 3AZGC 4LD9A 1P34B 5JA4B 5DNNB 2FJ7D 5B1MB 5GT0D 3R45A 4XZQA 3MVDA 3AZFA 5DNMC 1KX3D 3AZLA 5B0YA 3AFAD 3KWQB 3AYWD 2CWEA 5CPIC 3AZMD 5CPKC 4XUJD 3X1TA 2YFVA 5B24A 3MGQB 3WA9A 4QLCA 3MNNA 3REJC 1P3GB 5B31A 4ZUXA 5AY8D 5B31G 5CP6B 5B1LC 1H3OA 3LZ0C 4WZSB 3C1CC 3AN2C 1EQZD 1A7WA 4Z66D 4WU9A 4KGCA 3NQJA 5GT3A 3WTPB 3W97A 4J8XB 3C1BA 3REIC 4CSRA 3UTBC 4WU8B 4JJNA 2NZDD 3TU4B 3W98C 1HQ3A 3LJAA 1M19C 5AV9A 3AZED 3REKC 3A6NC 4EO5B 5B33A 5BT1C 5B2JA 1ID3A 5B40C 1P3IB 3AZKC 5AV6A 3WKJA 1BH9A 3LELC 3UT9D 5CPJC 2CV5C 4LD9C 1P3BB 4YM6A 3AZNA 2PYOB 4YS3D 5FUGA 3MVDC 4X23D 5E5AD 3AZFC 1S32B 4H9SC 4CAYA 4J8UD 4J8VB 4J8WA 1P3OC 3AZJD 1P3PD 3X1TC 4ZBJC 2AROA 5JRGD 5B24C 3WA9C 3MNNC 3AZHA 4Z5TB 5AVCB 2F8NA 2F8NG 1Q9CA 1M18B 5GXQB 5BNVB 3KXBA 1M1AC 3RELD 4WU9C 4KGCC 3WAAB 2HIOC 1U35B 5B0ZC 1TZYD 1ULYA 3W97C 5AV8A 3REHD 3C1BC 3MGSD 1P3FB 3B6FB 3O62A 5B32C 2BYKB 1P34A 2FJ7B 5JA4A 5DNNA 5B1MA 3X1VD 2IO5B 4JJNC 1KX3B 3B6GD 3KUYA 2L5AA 3AFAB 5AV9C 3LJAC 3KWQA 3AYWB 3AZMB 2F8NH 3AZGD 5KDMB 3UTAC 4XUJB 1ZLAA 4AWLC 5DNMD 5B33C 3MGQA 5B2JC 1ID3C 5CPID 1P3GA 5AY8B 5AV6C 3MGPC 5F99B 3X1SC 5CPKD 1P3MD 3WKJC 5CP6A 1HTAA 4YM6C 3AZNC 3REJD 1EQZB 4Z66B 3B0CT 1P3KB 4NE5A 5B1LD 3WTPA 3LZ0D 4J8XA 1B67A 3AN2D 3W99A 4WU8A 2NZDB 1BFMA 5GSUC 3TU4A 3AZHC 5B2IC 3REID 3UTBD 3AZEB 4H9NB 5AV5C 3W98D 1M19D 4KHAB 1P3IA 5AV8C 4H9QA 4M6BA 3A6ND 3AV2B 3O62C 5BT1D 1P3BA 3W96B 2PYOA 4YS3B 5B40D 5DNNC 3AZKD 1S32A 3LELD 3AV1B 3KUYC 5CPJD 2CV5D 3KWQC 4LD9D 3AZJB 3VH6W 4H9RB 1ZLAC 3WTPE 3MVDD 3AZFD 3MGQC 1P3GC 1P3OD 4Z5TA 5CHLB 5AVCA 3X1TD 1M18A 5GXQA 5B24D 5BNVA 3RELB 3WA9D 4NE3A 5G49A 3WAAA 1TZYB 3REHB 4NFTA 3V9RB 3MGSB 1P3FA 1M1AD 3X1UB 3B6FA 4R8PD 2HUEB 3W99C 2BYKA 2FJ7A 4WU9D 4KGCD 2HIOD 5B0ZD 4G92B 3B6GB 5BS7C 3W97D 3MGRC 3TU4C 1KX5C 3AYWA 3AFAA 3AZGB 5AVBC 5B32D 5KDMA 5DNMB 4EO5C 3LJAD 5AV9D 1TAFB 5CPIB 1P3IC 3UTAD 5CPKB 1P3MB 5F99A 4DRAA 3LZ1D 5B33D 1AOIC 5B2JD 1ID3D 1EQZA 2PYOC 2BYMB 3X1SD 5AV6D 3MGPD 3WKJD 1S32C 5BNXB 5B1LB 3AZID 1P3KA 3AN2B 1P3LB 3VH5W 4XZQC 4H9PB 3AZLC 5B0YC 4KUDB 3REIB 4H9NA 2NQBB 1P3AB 5GSUD 4QLCC 1M19B 3AZHD 5B2ID 5B31C 4ZUXC 3B0DC 4KHAA 2F8ND 1F66B 5AV5D 3A6NB 1KU5A 3AV2A 5B40B 3W96A 4YS3A 3AZKB 5GT3C 2IO5C 3LELB 5AV8D 5CPJB 3AV1A 4WNNB 2CV5B 4UUZB 3AFAC 1KX4A 4LD9B 3O62D 5GT0B 5DNND 1HQ3C 3KUYD 1P3OB 1ZLAD 4ZBJB 5F99C 3VH6T 3WA9B 3MGQD 3RELA 1TZYA 1P3KC 3REHA 3MGSA 3V9RA 1M1AB 4R8PB 3X1UA 4G91C
chains in the Genus database with same CATH superfamily
2HIOB 5B0ZB 2F8NK 4H9OB 4J8WC 3C1CD 4Z2MG 4HGAC 5B32B 3AZGA 3VH6A 3W99D 2AROC 2RVQC 2Y2PA 5DNMA 1T3UA 3MGRD 3KSYA 1KX5D 5AV9B 1TAFA 2LY8A 5AVBD 3UTAB 5CPIA 1P3MA 3LZ1B 2ZY4A 5C3IB 3KXBC 1N1JB 3AV2C 3W96C 4YS3C 1P3ID 3X1SB 1B6WA 2BYMA 5AV6B 4Z2MH 3MGPB 3UT9B 2YFWB 3AZIB 3REKD 3AV1C 1KX4C 1AOID 1P34C 1P3LA 5B1MC 5E5AB 4X23B 4J8UB 4H9PA 4J8VA 4KUDA 1P3PB 3REIA 4XZQD 5JRGB 3AZLD 2NQBA 5GSUB 5B0YD 1P3AA 3AL0C 2JE5A 5B2IB 1M19A 2ZY3A 5CP6C 1R4VA 1TZYC 1F66A 5BO0B 5AV5B 4DRBA 3A6NA 4QLCD 3X1UC 3MNND 5B40A 5B31D 4ZUXD 3AZKA 1U35A 3WTPC 3LELA 3H0LC 4J8XC 2CV5A 4WNNA 4UUZA 4WU8C 3VH5A 5GT0A 3X1VB 5GT3D 1KX3A 4H9SA 3KUYB 3C1BD 3AZMA 1P3OA 4XUJA 1ZLAB 1P3MC 4WV4B 4JJND 1HQ3D 3B0CW 5AY8A 5F99D 3NQUB 2DQNC 1P3BC 4NE6A 3REJB 1M1AA 3F6TA 4R8PA 1P3LC 4Z66A 2W8SA 2HIOA 5B0ZA 3LZ0B 4H9OA 4J8VC 1P3KD 3C1CB 4KUDC 4YM6D 3AZND 5B32A 3W99B 5B32G 4E44A 2NZDA 2NQBC 3MGRB 4J8WD 1P3AC 1KX5B 5AVBB 4Z5TC 3UTBB 5AVCC 3UTAA 3AZEA 2AROD 3KFUG 1M18C 2RVQD 1F66C 5GXQC 3LZ1A 3W98B 1PZRA 1N1JA 1JFIB 3WAAC 3X1SA 3MGPA 1U35C 3UT9A 2YFWA 3REKB 3AZIA 4H9QB 3KXBD 1P3FC 3B6FC 1AOIB 3AV2D 3EPHA 2FJ7C 3W96D 1BH8B 5GT0C 4X23A 5E5AA 1KX3C 2Y2MA 4J8UA 3AYWC 3AV1D 1KX4D 3AZMC 1P34D 3AZJA 1P3PA 4XUJC 4H9RA 3R45B 4XZQB 5B1MD 3MVDB 3AZFB 5JRGA 4E45A 3AZLB 5B0YB 5GSUA 3KWQD 5B2IA 3X1TB 5AY8C 2YFVB 3A1IA 5B24B 5BO0A 5AV5A 4QLCB 3MNNB 4R8PC 1EQZC 1P3GD 4Z66C 5B31B 4ZUXB 3B0DB 5G49B 2Y2NA 5CP6D 1H3OB 3X1UD 1F1EA 2ZY5A 4WU9B 3NQJB 4KGCB 5GT3B 3X1VA 2NZDC 1WWIA 3B6GA 3W97B 3WTPD 2UWXA 3C1BB 4J8XD 4CSRB 3AZEC 2ZM5A 4WU8D 4JJNB 3LZ1C 5C3IC 1HQ3B 3TU4D 3LJAB 5CPKA 4AWLB 3UT9C 3AZIC 5B33B 3NQUA 2Y2GA 3EG5B 5B2JB 1ID3B 3REJA 3WKJB 1BH9B 3B0BA 5E5AC 4X23C 4J8UC 5BNXA 2FFFB 5B1LA 3LZ0A 3C1CA 4YM6B 3AZNB 1P3BD 1P3PC 3AZJC 3AN2A 1P3LD 4G91B 2PYOD 2JSSA 5FUGB 1S32D 4CAYB 5JRGC 4J8WB 5BS7A 4J8VD 3MGRA 3EPKA 1KX5A 4KUDD 4HGAB 5AVBA 3UTBA 2AROB 2NQBD 3W98A 3VH5T 3RELC 3AZHB 1P3AD 2VQRA 2F8NB 4Z5TD 1JFIA 5AVCD 2BG1A 1M18D 1F66D 3REHC 5GXQD 3KXBB 3MGSC 3REKA 1WWSA 1AOIA 2HUEC 1BH8A 3WAAD 3X1VC 4DQYB 1U35D 5AV8B 4G92C 3B6GC 5CPJA 1P3FD 1KX4B 3B6FD 3O62B 3AZGC 4LD9A 1P34B 5JA4B 5DNNB 2FJ7D 5B1MB 5GT0D 3R45A 4XZQA 3MVDA 2XD1A 3AZFA 5DNMC 1KX3D 4WJ3C 3AZLA 5B0YA 3AFAD 3KWQB 3AYWD 2CWEA 5CPIC 3AZMD 5CPKC 4XUJD 3X1TA 2YFVA 5B24A 3MGQB 3WA9A 4QLCA 3MNNA 3REJC 1P3GB 5B31A 4ZUXA 5AY8D 2DF4C 5B31G 5CP6B 5B1LC 1H3OA 3LZ0C 4WZSB 3C1CC 3AN2C 1EQZD 1A7WA 4Z66D 4WU9A 4KGCA 3NQJA 5GT3A 3WTPB 3W97A 4J8XB 3C1BA 3REIC 4CSRA 3UTBC 3H0RC 4WU8B 2Y2HA 4JJNA 2NZDD 3TU4B 3W98C 1HQ3A 3LJAA 1M19C 5AV9A 3AZED 3REKC 3A6NC 4EO5B 5B33A 5BT1C 5B2JA 1ID3A 5B40C 1P3IB 3AZKC 2Y2IA 5AV6A 3WKJA 1BH9A 3LELC 3UT9D 5CPJC 2CV5C 4LD9C 1P3BB 4YM6A 3AZNA 2PYOB 4YS3D 2ZY2A 3P5JB 5FUGA 3MVDC 4X23D 5E5AD 3AZFC 1S32B 4H9SC 4CAYA 4J8UD 4J8VB 4J8WA 1P3OC 3AZJD 1P3PD 3X1TC 4ZBJC 2AROA 5JRGD 5B24C 3WA9C 3MNNC 3AZHA 4Z5TB 5AVCB 2XD5A 2F8NA 3A1KA 2F8NG 1Q9CA 2JCHA 1M18B 5GXQB 5BNVB 3KXBA 1M1AC 3RELD 4WU9C 4KGCC 3WAAB 2HIOC 1U35B 5B0ZC 1TZYD 1ULYA 3W97C 5AV8A 2G5IC 3REHD 3C1BC 3MGSD 1P3FB 3B6FB 3O62A 5B32C 2BYKB 1P34A 2FJ7B 5JA4A 5DNNA 5B1MA 3X1VD 2IO5B 4JJNC 1KX3B 3B6GD 3KUYA 2L5AA 3AFAB 5AV9C 3LJAC 2G5HC 3KWQA 3AYWB 3AZMB 3AZGD 5KDMB 2F8NH 3UTAC 4XUJB 1ZLAA 2Y2JA 4AWLC 5DNMD 5B33C 3IP4C 3MGQA 5B2JC 1ID3C 5CPID 1P3GA 1W2EA 5AY8B 5AV6C 5F99B 3MGPC 3X1SC 5CPKD 1P3MD 3WKJC 5CP6A 1HTAA 4YM6C 3AZNC 3REJD 1EQZB 4Z66B 3B0CT 1Z2CB 1P3KB 4NE5A 5B1LD 3WTPA 3LZ0D 3EPJA 4J8XA 1B67A 4UPKA 3AN2D 3W99A 4WU8A 2NZDB 1BFMA 5GSUC 2J8PA 3TU4A 3AZHC 5B2IC 3REID 3UTBD 3AZEB 4H9NB 5AV5C 3W98D 1M19D 2F2AC 4KHAB 1P3IA 5AV8C 4H9QA 4M6BA 3A6ND 3AV2B 3O62C 5BT1D 1P3BA 3W96B 2PYOA 4YS3B 5B40D 5DNNC 3AZKD 2Y2OA 1S32A 3LELD 3AV1B 3KUYC 5CPJD 2CV5D 3KWQC 4LD9D 3AZJB 3VH6W 4H9RB 1ZLAC 3WTPE 3MVDD 3AZFD 3MGQC 1P3GC 1P3OD 4Z5TA 5CHLB 5AVCA 3X1TD 1M18A 5GXQA 5B24D 5BNVA 3RELB 3WA9D 4NE3A 5G49A 3WAAA 1TZYB 3REHB 4NFTA 3V9RB 3MGSB 1P3FA 1M1AD 3X1UB 3B6FA 4R8PD 2HUEB 3W99C 2Y2QA 2BYKA 2FJ7A 2RIQA 4WU9D 4KGCD 2HIOD 5B0ZD 4G92B 3B6GB 5BS7C 3W97D 3MGRC 3TU4C 1KX5C 3AYWA 3AFAA 3AZGB 5AVBC 5B32D 5KDMA 5DNMB 4EO5C 3EPLA 3LJAD 5AV9D 1TAFB 5CPIB 1P3IC 3UTAD 5CPKB 1P3MB 5F99A 4DRAA 3LZ1D 5B33D 1AOIC 5B2JD 1ID3D 1EQZA 2PYOC 2BYMB 2Y2KA 3X1SD 5AV6D 3MGPD 3WKJD 1S32C 5BNXB 5B1LB 3AZID 1P3KA 3AN2B 1P3LB 3VH5W 4XZQC 4H9PB 3AZLC 5B0YC 4KUDB 3REIB 3H0MC 4H9NA 2NQBB 1P3AB 5GSUD 4QLCC 1M19B 3AZHD 5B2ID 5B31C 4ZUXC 3B0DC 4KHAA 2F8ND 1F66B 5AV5D 3A6NB 1KU5A 3FDDA 3AV2A 5B40B 3W96A 4YS3A 3AZKB 5GT3C 2IO5C 3LELB 5AV8D 5CPJB 3AV1A 4WNNB 2CV5B 4UUZB 3AFAC 1KX4A 4LD9B 3O62D 5GT0B 5DNND 1HQ3C 3KUYD 2Y2LA 1P3OB 1ZLAD 4ZBJB 5F99C 3VH6T 3WA9B 3MGQD 3RELA 1TZYA 1P3KC 3REHA 3MGSA 3V9RA 1M1AB 4R8PB 3X1UA 4G91C
chains in the Genus database with same CATH topology
2HIOB 5B0ZB 2F8NK 4H9OB 4J8WC 3C1CD 4Z2MG 4HGAC 5B32B 3AZGA 3VH6A 3W99D 2AROC 2RVQC 2Y2PA 5DNMA 1T3UA 3MGRD 3KSYA 1KX5D 5AV9B 1TAFA 2LY8A 5AVBD 3UTAB 5CPIA 1P3MA 3LZ1B 2ZY4A 5C3IB 3KXBC 1N1JB 3AV2C 3W96C 4YS3C 1P3ID 3X1SB 1B6WA 2BYMA 5AV6B 4Z2MH 3MGPB 3UT9B 2YFWB 3AZIB 3REKD 3AV1C 1KX4C 1AOID 1P34C 1P3LA 5B1MC 5E5AB 4X23B 4J8UB 4H9PA 4J8VA 4KUDA 1P3PB 3REIA 4XZQD 5JRGB 3AZLD 2NQBA 5GSUB 5B0YD 1P3AA 3AL0C 2JE5A 5B2IB 1M19A 2ZY3A 5CP6C 1R4VA 1TZYC 1F66A 5BO0B 5AV5B 4DRBA 3A6NA 4QLCD 3X1UC 3MNND 5B40A 5B31D 4ZUXD 3AZKA 1U35A 3WTPC 3LELA 3H0LC 4J8XC 2CV5A 4WNNA 4UUZA 4WU8C 3VH5A 5GT0A 3X1VB 5GT3D 1KX3A 4H9SA 3KUYB 3C1BD 3AZMA 1P3OA 4XUJA 1ZLAB 1P3MC 4WV4B 4JJND 1HQ3D 3B0CW 5AY8A 5F99D 3NQUB 2DQNC 1P3BC 4NE6A 3REJB 1M1AA 3F6TA 4R8PA 1P3LC 4Z66A 2W8SA 2HIOA 5B0ZA 3LZ0B 4H9OA 4J8VC 1P3KD 3C1CB 4KUDC 4YM6D 3AZND 5B32A 3W99B 5B32G 4E44A 2NZDA 2NQBC 3MGRB 4J8WD 1P3AC 1KX5B 5AVBB 4Z5TC 3UTBB 5AVCC 3UTAA 3AZEA 2AROD 3KFUG 1M18C 2RVQD 1F66C 5GXQC 3LZ1A 3W98B 1PZRA 1N1JA 1JFIB 3WAAC 3X1SA 3MGPA 1U35C 3UT9A 2YFWA 3REKB 3AZIA 4H9QB 3KXBD 1P3FC 3B6FC 1AOIB 3AV2D 3EPHA 2FJ7C 3W96D 1BH8B 5GT0C 4X23A 5E5AA 1KX3C 2Y2MA 4J8UA 3AYWC 3AV1D 1KX4D 3AZMC 1P34D 3AZJA 1P3PA 4XUJC 4H9RA 3R45B 4XZQB 5B1MD 3MVDB 3AZFB 5JRGA 4E45A 3AZLB 5B0YB 5GSUA 3KWQD 5B2IA 3X1TB 5AY8C 2YFVB 3A1IA 5B24B 5BO0A 5AV5A 4QLCB 3MNNB 4R8PC 1EQZC 1P3GD 4Z66C 5B31B 4ZUXB 3B0DB 5G49B 2Y2NA 5CP6D 1H3OB 3X1UD 1F1EA 2ZY5A 4WU9B 3NQJB 4KGCB 5GT3B 3X1VA 2NZDC 1WWIA 3B6GA 3W97B 3WTPD 2UWXA 3C1BB 4J8XD 4CSRB 3AZEC 2ZM5A 4WU8D 4JJNB 3LZ1C 5C3IC 1HQ3B 3TU4D 3LJAB 5CPKA 4AWLB 3UT9C 3AZIC 5B33B 3NQUA 2Y2GA 3EG5B 5B2JB 1ID3B 3REJA 3WKJB 1BH9B 3B0BA 5E5AC 4X23C 4J8UC 5BNXA 2FFFB 5B1LA 3LZ0A 3C1CA 4YM6B 3AZNB 1P3BD 1P3PC 3AZJC 3AN2A 1P3LD 4G91B 2PYOD 2JSSA 5FUGB 1S32D 4CAYB 5JRGC 4J8WB 5BS7A 4J8VD 3MGRA 3EPKA 1KX5A 4KUDD 4HGAB 5AVBA 3UTBA 2AROB 2NQBD 3W98A 3VH5T 3RELC 3AZHB 1P3AD 2VQRA 2F8NB 4Z5TD 1JFIA 5AVCD 2BG1A 1M18D 1F66D 3REHC 5GXQD 3KXBB 3MGSC 3REKA 1WWSA 1AOIA 2HUEC 1BH8A 3WAAD 3X1VC 4DQYB 1U35D 5AV8B 4G92C 3B6GC 5CPJA 1P3FD 1KX4B 3B6FD 3O62B 3AZGC 4LD9A 1P34B 5JA4B 5DNNB 2FJ7D 5B1MB 5GT0D 3R45A 4XZQA 3MVDA 2XD1A 3AZFA 5DNMC 1KX3D 4WJ3C 3AZLA 5B0YA 3AFAD 3KWQB 3AYWD 2CWEA 5CPIC 3AZMD 5CPKC 4XUJD 3X1TA 2YFVA 5B24A 3MGQB 3WA9A 4QLCA 3MNNA 3REJC 1P3GB 5B31A 4ZUXA 5AY8D 2DF4C 5B31G 5CP6B 5B1LC 1H3OA 3LZ0C 4WZSB 3C1CC 3AN2C 1EQZD 1A7WA 4Z66D 4WU9A 4KGCA 3NQJA 5GT3A 3WTPB 3W97A 4J8XB 3C1BA 3REIC 4CSRA 3UTBC 3H0RC 4WU8B 2Y2HA 4JJNA 2NZDD 3TU4B 3W98C 1HQ3A 3LJAA 1M19C 5AV9A 3AZED 3REKC 3A6NC 4EO5B 5B33A 5BT1C 5B2JA 1ID3A 5B40C 1P3IB 3AZKC 2Y2IA 5AV6A 3WKJA 1BH9A 3LELC 3UT9D 5CPJC 2CV5C 4LD9C 1P3BB 4YM6A 3AZNA 2PYOB 4YS3D 2ZY2A 3P5JB 5FUGA 3MVDC 4X23D 5E5AD 3AZFC 1S32B 4H9SC 4CAYA 4J8UD 4J8VB 4J8WA 1P3OC 3AZJD 1P3PD 3X1TC 4ZBJC 2AROA 5JRGD 5B24C 3WA9C 3MNNC 3AZHA 4Z5TB 5AVCB 2XD5A 2F8NA 3A1KA 2F8NG 1Q9CA 2JCHA 1M18B 5GXQB 5BNVB 3KXBA 1M1AC 3RELD 4WU9C 4KGCC 3WAAB 2HIOC 1U35B 5B0ZC 1TZYD 1ULYA 3W97C 5AV8A 2G5IC 3REHD 3C1BC 3MGSD 1P3FB 3B6FB 3O62A 5B32C 2BYKB 1P34A 2FJ7B 5JA4A 5DNNA 5B1MA 3X1VD 2IO5B 4JJNC 1KX3B 3B6GD 3KUYA 2L5AA 3AFAB 5AV9C 3LJAC 2G5HC 3KWQA 3AYWB 3AZMB 3AZGD 5KDMB 2F8NH 3UTAC 4XUJB 1ZLAA 2Y2JA 4AWLC 5DNMD 5B33C 3IP4C 3MGQA 5B2JC 1ID3C 5CPID 1P3GA 1W2EA 5AY8B 5AV6C 5F99B 3MGPC 3X1SC 5CPKD 1P3MD 3WKJC 5CP6A 1HTAA 4YM6C 3AZNC 3REJD 1EQZB 4Z66B 3B0CT 1Z2CB 1P3KB 4NE5A 5B1LD 3WTPA 3LZ0D 3EPJA 4J8XA 1B67A 4UPKA 3AN2D 3W99A 4WU8A 2NZDB 1BFMA 5GSUC 2J8PA 3TU4A 3AZHC 5B2IC 3REID 3UTBD 3AZEB 4H9NB 5AV5C 3W98D 1M19D 2F2AC 4KHAB 1P3IA 5AV8C 4H9QA 4M6BA 3A6ND 3AV2B 3O62C 5BT1D 1P3BA 3W96B 2PYOA 4YS3B 5B40D 5DNNC 3AZKD 2Y2OA 1S32A 3LELD 3AV1B 3KUYC 5CPJD 2CV5D 3KWQC 4LD9D 3AZJB 3VH6W 4H9RB 1ZLAC 3WTPE 3MVDD 3AZFD 3MGQC 1P3GC 1P3OD 4Z5TA 5CHLB 5AVCA 3X1TD 1M18A 5GXQA 5B24D 5BNVA 3RELB 3WA9D 4NE3A 5G49A 3WAAA 1TZYB 3REHB 4NFTA 3V9RB 3MGSB 1P3FA 1M1AD 3X1UB 3B6FA 4R8PD 2HUEB 3W99C 2Y2QA 2BYKA 2FJ7A 2RIQA 4WU9D 4KGCD 2HIOD 5B0ZD 4G92B 3B6GB 5BS7C 3W97D 3MGRC 3TU4C 1KX5C 3AYWA 3AFAA 3AZGB 5AVBC 5B32D 5KDMA 5DNMB 4EO5C 3EPLA 3LJAD 5AV9D 1TAFB 5CPIB 1P3IC 3UTAD 5CPKB 1P3MB 5F99A 4DRAA 3LZ1D 5B33D 1AOIC 5B2JD 1ID3D 1EQZA 2PYOC 2BYMB 2Y2KA 3X1SD 5AV6D 3MGPD 3WKJD 1S32C 5BNXB 5B1LB 3AZID 1P3KA 3AN2B 1P3LB 3VH5W 4XZQC 4H9PB 3AZLC 5B0YC 4KUDB 3REIB 3H0MC 4H9NA 2NQBB 1P3AB 5GSUD 4QLCC 1M19B 3AZHD 5B2ID 5B31C 4ZUXC 3B0DC 4KHAA 2F8ND 1F66B 5AV5D 3A6NB 1KU5A 3FDDA 3AV2A 5B40B 3W96A 4YS3A 3AZKB 5GT3C 2IO5C 3LELB 5AV8D 5CPJB 3AV1A 4WNNB 2CV5B 4UUZB 3AFAC 1KX4A 4LD9B 3O62D 5GT0B 5DNND 1HQ3C 3KUYD 2Y2LA 1P3OB 1ZLAD 4ZBJB 5F99C 3VH6T 3WA9B 3MGQD 3RELA 1TZYA 1P3KC 3REHA 3MGSA 3V9RA 1M1AB 4R8PB 3X1UA 4G91C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO B;  5B0Z B;  2F8N K;  4H9O B;  4J8W C;  3C1C D;  4Z2M G;  4HGA C;  5B32 B;  3AZG A;  3VH6 A;  3W99 D;  2ARO C;  2RVQ C;  5DNM A;  3MGR D;  3KSY A;  1KX5 D;  5AV9 B;  1TAF A;  2LY8 A;  5AVB D;  3UTA B;  5CPI A;  1P3M A;  3LZ1 B;  5C3I B;  3KXB C;  1N1J B;  3AV2 C;  3W96 C;  4YS3 C;  1P3I D;  3X1S B;  1B6W A;  2BYM A;  5AV6 B;  4Z2M H;  3MGP B;  3UT9 B;  2YFW B;  3AZI B;  3REK D;  3AV1 C;  1KX4 C;  1AOI D;  1P34 C;  1P3L A;  5B1M C;  5E5A B;  4X23 B;  4J8U B;  4H9P A;  4J8V A;  4KUD A;  1P3P B;  3REI A;  4XZQ D;  5JRG B;  3AZL D;  2NQB A;  5GSU B;  5B0Y D;  1P3A A;  5B2I B;  1M19 A;  5CP6 C;  1R4V A;  1TZY C;  1F66 A;  5BO0 B;  5AV5 B;  4DRB A;  3A6N A;  4QLC D;  3X1U C;  3MNN D;  5B40 A;  5B31 D;  4ZUX D;  3AZK A;  1U35 A;  3WTP C;  3LEL A;  4J8X C;  2CV5 A;  4WNN A;  4UUZ A;  4WU8 C;  3VH5 A;  5GT0 A;  3X1V B;  5GT3 D;  1KX3 A;  4H9S A;  3KUY B;  3C1B D;  3AZM A;  1P3O A;  4XUJ A;  1ZLA B;  1P3M C;  4WV4 B;  4JJN D;  1HQ3 D;  3B0C W;  5AY8 A;  5F99 D;  3NQU B;  1P3B C;  4NE6 A;  3REJ B;  1M1A A;  4R8P A;  1P3L C;  4Z66 A;  2HIO A;  5B0Z A;  3LZ0 B;  4H9O A;  4J8V C;  1P3K D;  3C1C B;  4KUD C;  4YM6 D;  3AZN D;  5B32 A;  3W99 B;  5B32 G;  4E44 A;  2NZD A;  2NQB C;  3MGR B;  4J8W D;  1P3A C;  1KX5 B;  5AVB B;  4Z5T C;  3UTB B;  5AVC C;  3UTA A;  3AZE A;  2ARO D;  1M18 C;  2RVQ D;  1F66 C;  5GXQ C;  3LZ1 A;  3W98 B;  1N1J A;  1JFI B;  3WAA C;  3X1S A;  3MGP A;  1U35 C;  3UT9 A;  2YFW A;  3REK B;  3AZI A;  4H9Q B;  3KXB D;  1P3F C;  3B6F C;  1AOI B;  3AV2 D;  2FJ7 C;  3W96 D;  1BH8 B;  5GT0 C;  4X23 A;  5E5A A;  1KX3 C;  4J8U A;  3AYW C;  3AV1 D;  1KX4 D;  3AZM C;  1P34 D;  3AZJ A;  1P3P A;  4XUJ C;  4H9R A;  3R45 B;  4XZQ B;  5B1M D;  3MVD B;  3AZF B;  5JRG A;  4E45 A;  3AZL B;  5B0Y B;  5GSU A;  3KWQ D;  5B2I A;  3X1T B;  5AY8 C;  2YFV B;  5B24 B;  5BO0 A;  5AV5 A;  4QLC B;  3MNN B;  4R8P C;  1EQZ C;  1P3G D;  4Z66 C;  5B31 B;  4ZUX B;  3B0D B;  5G49 B;  5CP6 D;  1H3O B;  3X1U D;  1F1E A;  4WU9 B;  4KGC B;  3NQJ B;  5GT3 B;  3X1V A;  2NZD C;  1WWI A;  3B6G A;  3W97 B;  3WTP D;  3C1B B;  4J8X D;  4CSR B;  3AZE C;  4WU8 D;  4JJN B;  3LZ1 C;  5C3I C;  1HQ3 B;  3TU4 D;  3LJA B;  5CPK A;  4AWL B;  3UT9 C;  3AZI C;  5B33 B;  3NQU A;  5B2J B;  1ID3 B;  3REJ A;  3WKJ B;  1BH9 B;  3B0B A;  5E5A C;  4X23 C;  4J8U C;  5BNX A;  5B1L A;  3LZ0 A;  3C1C A;  4YM6 B;  3AZN B;  1P3B D;  1P3P C;  3AZJ C;  3AN2 A;  1P3L D;  4G91 B;  2PYO D;  2JSS A;  5FUG B;  1S32 D;  4CAY B;  5JRG C;  4J8W B;  5BS7 A;  4J8V D;  3MGR A;  1KX5 A;  4KUD D;  4HGA B;  5AVB A;  3UTB A;  2ARO B;  2NQB D;  3W98 A;  3VH5 T;  3REL C;  3AZH B;  1P3A D;  2F8N B;  4Z5T D;  1JFI A;  5AVC D;  1M18 D;  1F66 D;  3REH C;  5GXQ D;  3KXB B;  3MGS C;  3REK A;  1WWS A;  1AOI A;  2HUE C;  1BH8 A;  3WAA D;  3X1V C;  1U35 D;  5AV8 B;  4G92 C;  3B6G C;  5CPJ A;  1P3F D;  1KX4 B;  3B6F D;  3O62 B;  3AZG C;  4LD9 A;  1P34 B;  5JA4 B;  5DNN B;  2FJ7 D;  5B1M B;  5GT0 D;  3R45 A;  4XZQ A;  3MVD A;  3AZF A;  5DNM C;  1KX3 D;  3AZL A;  5B0Y A;  3AFA D;  3KWQ B;  3AYW D;  2CWE A;  5CPI C;  3AZM D;  5CPK C;  4XUJ D;  3X1T A;  2YFV A;  5B24 A;  3MGQ B;  3WA9 A;  4QLC A;  3MNN A;  3REJ C;  1P3G B;  5B31 A;  4ZUX A;  5AY8 D;  5B31 G;  5CP6 B;  5B1L C;  1H3O A;  3LZ0 C;  4WZS B;  3C1C C;  3AN2 C;  1EQZ D;  1A7W A;  4Z66 D;  4WU9 A;  4KGC A;  3NQJ A;  5GT3 A;  3WTP B;  3W97 A;  4J8X B;  3C1B A;  3REI C;  4CSR A;  3UTB C;  4WU8 B;  4JJN A;  2NZD D;  3TU4 B;  3W98 C;  1HQ3 A;  3LJA A;  1M19 C;  5AV9 A;  3AZE D;  3REK C;  3A6N C;  4EO5 B;  5B33 A;  5BT1 C;  5B2J A;  1ID3 A;  5B40 C;  1P3I B;  3AZK C;  5AV6 A;  3WKJ A;  1BH9 A;  3LEL C;  3UT9 D;  5CPJ C;  2CV5 C;  4LD9 C;  1P3B B;  4YM6 A;  3AZN A;  2PYO B;  4YS3 D;  5FUG A;  3MVD C;  4X23 D;  5E5A D;  3AZF C;  1S32 B;  4H9S C;  4CAY A;  4J8U D;  4J8V B;  4J8W A;  1P3O C;  3AZJ D;  1P3P D;  3X1T C;  4ZBJ C;  2ARO A;  5JRG D;  5B24 C;  3WA9 C;  3MNN C;  3AZH A;  4Z5T B;  5AVC B;  2F8N A;  2F8N G;  1Q9C A;  1M18 B;  5GXQ B;  5BNV B;  3KXB A;  1M1A C;  3REL D;  4WU9 C;  4KGC C;  3WAA B;  2HIO C;  1U35 B;  5B0Z C;  1TZY D;  1ULY A;  3W97 C;  5AV8 A;  3REH D;  3C1B C;  3MGS D;  1P3F B;  3B6F B;  3O62 A;  5B32 C;  2BYK B;  1P34 A;  2FJ7 B;  5JA4 A;  5DNN A;  5B1M A;  3X1V D;  2IO5 B;  4JJN C;  1KX3 B;  3B6G D;  3KUY A;  2L5A A;  3AFA B;  5AV9 C;  3LJA C;  3KWQ A;  3AYW B;  3AZM B;  2F8N H;  3AZG D;  5KDM B;  3UTA C;  4XUJ B;  1ZLA A;  4AWL C;  5DNM D;  5B33 C;  3MGQ A;  5B2J C;  1ID3 C;  5CPI D;  1P3G A;  5AY8 B;  5AV6 C;  3MGP C;  5F99 B;  3X1S C;  5CPK D;  1P3M D;  3WKJ C;  5CP6 A;  1HTA A;  4YM6 C;  3AZN C;  3REJ D;  1EQZ B;  4Z66 B;  3B0C T;  1P3K B;  4NE5 A;  5B1L D;  3WTP A;  3LZ0 D;  4J8X A;  1B67 A;  3AN2 D;  3W99 A;  4WU8 A;  2NZD B;  1BFM A;  5GSU C;  3TU4 A;  3AZH C;  5B2I C;  3REI D;  3UTB D;  3AZE B;  4H9N B;  5AV5 C;  3W98 D;  1M19 D;  4KHA B;  1P3I A;  5AV8 C;  4H9Q A;  4M6B A;  3A6N D;  3AV2 B;  3O62 C;  5BT1 D;  1P3B A;  3W96 B;  2PYO A;  4YS3 B;  5B40 D;  5DNN C;  3AZK D;  1S32 A;  3LEL D;  3AV1 B;  3KUY C;  5CPJ D;  2CV5 D;  3KWQ C;  4LD9 D;  3AZJ B;  3VH6 W;  4H9R B;  1ZLA C;  3WTP E;  3MVD D;  3AZF D;  3MGQ C;  1P3G C;  1P3O D;  4Z5T A;  5CHL B;  5AVC A;  3X1T D;  1M18 A;  5GXQ A;  5B24 D;  5BNV A;  3REL B;  3WA9 D;  4NE3 A;  5G49 A;  3WAA A;  1TZY B;  3REH B;  4NFT A;  3V9R B;  3MGS B;  1P3F A;  1M1A D;  3X1U B;  3B6F A;  4R8P D;  2HUE B;  3W99 C;  2BYK A;  2FJ7 A;  4WU9 D;  4KGC D;  2HIO D;  5B0Z D;  4G92 B;  3B6G B;  5BS7 C;  3W97 D;  3MGR C;  3TU4 C;  1KX5 C;  3AYW A;  3AFA A;  3AZG B;  5AVB C;  5B32 D;  5KDM A;  5DNM B;  4EO5 C;  3LJA D;  5AV9 D;  1TAF B;  5CPI B;  1P3I C;  3UTA D;  5CPK B;  1P3M B;  5F99 A;  4DRA A;  3LZ1 D;  5B33 D;  1AOI C;  5B2J D;  1ID3 D;  1EQZ A;  2PYO C;  2BYM B;  3X1S D;  5AV6 D;  3MGP D;  3WKJ D;  1S32 C;  5BNX B;  5B1L B;  3AZI D;  1P3K A;  3AN2 B;  1P3L B;  3VH5 W;  4XZQ C;  4H9P B;  3AZL C;  5B0Y C;  4KUD B;  3REI B;  4H9N A;  2NQB B;  1P3A B;  5GSU D;  4QLC C;  1M19 B;  3AZH D;  5B2I D;  5B31 C;  4ZUX C;  3B0D C;  4KHA A;  2F8N D;  1F66 B;  5AV5 D;  3A6N B;  1KU5 A;  3AV2 A;  5B40 B;  3W96 A;  4YS3 A;  3AZK B;  5GT3 C;  2IO5 C;  3LEL B;  5AV8 D;  5CPJ B;  3AV1 A;  4WNN B;  2CV5 B;  4UUZ B;  3AFA C;  1KX4 A;  4LD9 B;  3O62 D;  5GT0 B;  5DNN D;  1HQ3 C;  3KUY D;  1P3O B;  1ZLA D;  4ZBJ B;  5F99 C;  3VH6 T;  3WA9 B;  3MGQ D;  3REL A;  1TZY A;  1P3K C;  3REH A;  3MGS A;  3V9R A;  1M1A B;  4R8P B;  3X1U A;  4G91 C; 
#chains in the Genus database with same CATH topology
 2HIO B;  5B0Z B;  2F8N K;  4H9O B;  4J8W C;  3C1C D;  4Z2M G;  4HGA C;  5B32 B;  3AZG A;  3VH6 A;  3W99 D;  2ARO C;  2RVQ C;  2Y2P A;  5DNM A;  1T3U A;  3MGR D;  3KSY A;  1KX5 D;  5AV9 B;  1TAF A;  2LY8 A;  5AVB D;  3UTA B;  5CPI A;  1P3M A;  3LZ1 B;  2ZY4 A;  5C3I B;  3KXB C;  1N1J B;  3AV2 C;  3W96 C;  4YS3 C;  1P3I D;  3X1S B;  1B6W A;  2BYM A;  5AV6 B;  4Z2M H;  3MGP B;  3UT9 B;  2YFW B;  3AZI B;  3REK D;  3AV1 C;  1KX4 C;  1AOI D;  1P34 C;  1P3L A;  5B1M C;  5E5A B;  4X23 B;  4J8U B;  4H9P A;  4J8V A;  4KUD A;  1P3P B;  3REI A;  4XZQ D;  5JRG B;  3AZL D;  2NQB A;  5GSU B;  5B0Y D;  1P3A A;  3AL0 C;  2JE5 A;  5B2I B;  1M19 A;  2ZY3 A;  5CP6 C;  1R4V A;  1TZY C;  1F66 A;  5BO0 B;  5AV5 B;  4DRB A;  3A6N A;  4QLC D;  3X1U C;  3MNN D;  5B40 A;  5B31 D;  4ZUX D;  3AZK A;  1U35 A;  3WTP C;  3LEL A;  3H0L C;  4J8X C;  2CV5 A;  4WNN A;  4UUZ A;  4WU8 C;  3VH5 A;  5GT0 A;  3X1V B;  5GT3 D;  1KX3 A;  4H9S A;  3KUY B;  3C1B D;  3AZM A;  1P3O A;  4XUJ A;  1ZLA B;  1P3M C;  4WV4 B;  4JJN D;  1HQ3 D;  3B0C W;  5AY8 A;  5F99 D;  3NQU B;  2DQN C;  1P3B C;  4NE6 A;  3REJ B;  1M1A A;  3F6T A;  4R8P A;  1P3L C;  4Z66 A;  2W8S A;  2HIO A;  5B0Z A;  3LZ0 B;  4H9O A;  4J8V C;  1P3K D;  3C1C B;  4KUD C;  4YM6 D;  3AZN D;  5B32 A;  3W99 B;  5B32 G;  4E44 A;  2NZD A;  2NQB C;  3MGR B;  4J8W D;  1P3A C;  1KX5 B;  5AVB B;  4Z5T C;  3UTB B;  5AVC C;  3UTA A;  3AZE A;  2ARO D;  3KFU G;  1M18 C;  2RVQ D;  1F66 C;  5GXQ C;  3LZ1 A;  3W98 B;  1PZR A;  1N1J A;  1JFI B;  3WAA C;  3X1S A;  3MGP A;  1U35 C;  3UT9 A;  2YFW A;  3REK B;  3AZI A;  4H9Q B;  3KXB D;  1P3F C;  3B6F C;  1AOI B;  3AV2 D;  3EPH A;  2FJ7 C;  3W96 D;  1BH8 B;  5GT0 C;  4X23 A;  5E5A A;  1KX3 C;  2Y2M A;  4J8U A;  3AYW C;  3AV1 D;  1KX4 D;  3AZM C;  1P34 D;  3AZJ A;  1P3P A;  4XUJ C;  4H9R A;  3R45 B;  4XZQ B;  5B1M D;  3MVD B;  3AZF B;  5JRG A;  4E45 A;  3AZL B;  5B0Y B;  5GSU A;  3KWQ D;  5B2I A;  3X1T B;  5AY8 C;  2YFV B;  3A1I A;  5B24 B;  5BO0 A;  5AV5 A;  4QLC B;  3MNN B;  4R8P C;  1EQZ C;  1P3G D;  4Z66 C;  5B31 B;  4ZUX B;  3B0D B;  5G49 B;  2Y2N A;  5CP6 D;  1H3O B;  3X1U D;  1F1E A;  2ZY5 A;  4WU9 B;  3NQJ B;  4KGC B;  5GT3 B;  3X1V A;  2NZD C;  1WWI A;  3B6G A;  3W97 B;  3WTP D;  2UWX A;  3C1B B;  4J8X D;  4CSR B;  3AZE C;  2ZM5 A;  4WU8 D;  4JJN B;  3LZ1 C;  5C3I C;  1HQ3 B;  3TU4 D;  3LJA B;  5CPK A;  4AWL B;  3UT9 C;  3AZI C;  5B33 B;  3NQU A;  2Y2G A;  3EG5 B;  5B2J B;  1ID3 B;  3REJ A;  3WKJ B;  1BH9 B;  3B0B A;  5E5A C;  4X23 C;  4J8U C;  5BNX A;  2FFF B;  5B1L A;  3LZ0 A;  3C1C A;  4YM6 B;  3AZN B;  1P3B D;  1P3P C;  3AZJ C;  3AN2 A;  1P3L D;  4G91 B;  2PYO D;  2JSS A;  5FUG B;  1S32 D;  4CAY B;  5JRG C;  4J8W B;  5BS7 A;  4J8V D;  3MGR A;  3EPK A;  1KX5 A;  4KUD D;  4HGA B;  5AVB A;  3UTB A;  2ARO B;  2NQB D;  3W98 A;  3VH5 T;  3REL C;  3AZH B;  1P3A D;  2VQR A;  2F8N B;  4Z5T D;  1JFI A;  5AVC D;  2BG1 A;  1M18 D;  1F66 D;  3REH C;  5GXQ D;  3KXB B;  3MGS C;  3REK A;  1WWS A;  1AOI A;  2HUE C;  1BH8 A;  3WAA D;  3X1V C;  4DQY B;  1U35 D;  5AV8 B;  4G92 C;  3B6G C;  5CPJ A;  1P3F D;  1KX4 B;  3B6F D;  3O62 B;  3AZG C;  4LD9 A;  1P34 B;  5JA4 B;  5DNN B;  2FJ7 D;  5B1M B;  5GT0 D;  3R45 A;  4XZQ A;  3MVD A;  2XD1 A;  3AZF A;  5DNM C;  1KX3 D;  4WJ3 C;  3AZL A;  5B0Y A;  3AFA D;  3KWQ B;  3AYW D;  2CWE A;  5CPI C;  3AZM D;  5CPK C;  4XUJ D;  3X1T A;  2YFV A;  5B24 A;  3MGQ B;  3WA9 A;  4QLC A;  3MNN A;  3REJ C;  1P3G B;  5B31 A;  4ZUX A;  5AY8 D;  2DF4 C;  5B31 G;  5CP6 B;  5B1L C;  1H3O A;  3LZ0 C;  4WZS B;  3C1C C;  3AN2 C;  1EQZ D;  1A7W A;  4Z66 D;  4WU9 A;  4KGC A;  3NQJ A;  5GT3 A;  3WTP B;  3W97 A;  4J8X B;  3C1B A;  3REI C;  4CSR A;  3UTB C;  3H0R C;  4WU8 B;  2Y2H A;  4JJN A;  2NZD D;  3TU4 B;  3W98 C;  1HQ3 A;  3LJA A;  1M19 C;  5AV9 A;  3AZE D;  3REK C;  3A6N C;  4EO5 B;  5B33 A;  5BT1 C;  5B2J A;  1ID3 A;  5B40 C;  1P3I B;  3AZK C;  2Y2I A;  5AV6 A;  3WKJ A;  1BH9 A;  3LEL C;  3UT9 D;  5CPJ C;  2CV5 C;  4LD9 C;  1P3B B;  4YM6 A;  3AZN A;  2PYO B;  4YS3 D;  2ZY2 A;  3P5J B;  5FUG A;  3MVD C;  4X23 D;  5E5A D;  3AZF C;  1S32 B;  4H9S C;  4CAY A;  4J8U D;  4J8V B;  4J8W A;  1P3O C;  3AZJ D;  1P3P D;  3X1T C;  4ZBJ C;  2ARO A;  5JRG D;  5B24 C;  3WA9 C;  3MNN C;  3AZH A;  4Z5T B;  5AVC B;  2XD5 A;  2F8N A;  3A1K A;  2F8N G;  1Q9C A;  2JCH A;  1M18 B;  5GXQ B;  5BNV B;  3KXB A;  1M1A C;  3REL D;  4WU9 C;  4KGC C;  3WAA B;  2HIO C;  1U35 B;  5B0Z C;  1TZY D;  1ULY A;  3W97 C;  5AV8 A;  2G5I C;  3REH D;  3C1B C;  3MGS D;  1P3F B;  3B6F B;  3O62 A;  5B32 C;  2BYK B;  1P34 A;  2FJ7 B;  5JA4 A;  5DNN A;  5B1M A;  3X1V D;  2IO5 B;  4JJN C;  1KX3 B;  3B6G D;  3KUY A;  2L5A A;  3AFA B;  5AV9 C;  3LJA C;  2G5H C;  3KWQ A;  3AYW B;  3AZM B;  3AZG D;  5KDM B;  2F8N H;  3UTA C;  4XUJ B;  1ZLA A;  2Y2J A;  4AWL C;  5DNM D;  5B33 C;  3IP4 C;  3MGQ A;  5B2J C;  1ID3 C;  5CPI D;  1P3G A;  1W2E A;  5AY8 B;  5AV6 C;  5F99 B;  3MGP C;  3X1S C;  5CPK D;  1P3M D;  3WKJ C;  5CP6 A;  1HTA A;  4YM6 C;  3AZN C;  3REJ D;  1EQZ B;  4Z66 B;  3B0C T;  1Z2C B;  1P3K B;  4NE5 A;  5B1L D;  3WTP A;  3LZ0 D;  3EPJ A;  4J8X A;  1B67 A;  4UPK A;  3AN2 D;  3W99 A;  4WU8 A;  2NZD B;  1BFM A;  5GSU C;  2J8P A;  3TU4 A;  3AZH C;  5B2I C;  3REI D;  3UTB D;  3AZE B;  4H9N B;  5AV5 C;  3W98 D;  1M19 D;  2F2A C;  4KHA B;  1P3I A;  5AV8 C;  4H9Q A;  4M6B A;  3A6N D;  3AV2 B;  3O62 C;  5BT1 D;  1P3B A;  3W96 B;  2PYO A;  4YS3 B;  5B40 D;  5DNN C;  3AZK D;  2Y2O A;  1S32 A;  3LEL D;  3AV1 B;  3KUY C;  5CPJ D;  2CV5 D;  3KWQ C;  4LD9 D;  3AZJ B;  3VH6 W;  4H9R B;  1ZLA C;  3WTP E;  3MVD D;  3AZF D;  3MGQ C;  1P3G C;  1P3O D;  4Z5T A;  5CHL B;  5AVC A;  3X1T D;  1M18 A;  5GXQ A;  5B24 D;  5BNV A;  3REL B;  3WA9 D;  4NE3 A;  5G49 A;  3WAA A;  1TZY B;  3REH B;  4NFT A;  3V9R B;  3MGS B;  1P3F A;  1M1A D;  3X1U B;  3B6F A;  4R8P D;  2HUE B;  3W99 C;  2Y2Q A;  2BYK A;  2FJ7 A;  2RIQ A;  4WU9 D;  4KGC D;  2HIO D;  5B0Z D;  4G92 B;  3B6G B;  5BS7 C;  3W97 D;  3MGR C;  3TU4 C;  1KX5 C;  3AYW A;  3AFA A;  3AZG B;  5AVB C;  5B32 D;  5KDM A;  5DNM B;  4EO5 C;  3EPL A;  3LJA D;  5AV9 D;  1TAF B;  5CPI B;  1P3I C;  3UTA D;  5CPK B;  1P3M B;  5F99 A;  4DRA A;  3LZ1 D;  5B33 D;  1AOI C;  5B2J D;  1ID3 D;  1EQZ A;  2PYO C;  2BYM B;  2Y2K A;  3X1S D;  5AV6 D;  3MGP D;  3WKJ D;  1S32 C;  5BNX B;  5B1L B;  3AZI D;  1P3K A;  3AN2 B;  1P3L B;  3VH5 W;  4XZQ C;  4H9P B;  3AZL C;  5B0Y C;  4KUD B;  3REI B;  3H0M C;  4H9N A;  2NQB B;  1P3A B;  5GSU D;  4QLC C;  1M19 B;  3AZH D;  5B2I D;  5B31 C;  4ZUX C;  3B0D C;  4KHA A;  2F8N D;  1F66 B;  5AV5 D;  3A6N B;  1KU5 A;  3FDD A;  3AV2 A;  5B40 B;  3W96 A;  4YS3 A;  3AZK B;  5GT3 C;  2IO5 C;  3LEL B;  5AV8 D;  5CPJ B;  3AV1 A;  4WNN B;  2CV5 B;  4UUZ B;  3AFA C;  1KX4 A;  4LD9 B;  3O62 D;  5GT0 B;  5DNN D;  1HQ3 C;  3KUY D;  2Y2L A;  1P3O B;  1ZLA D;  4ZBJ B;  5F99 C;  3VH6 T;  3WA9 B;  3MGQ D;  3REL A;  1TZY A;  1P3K C;  3REH A;  3MGS A;  3V9R A;  1M1A B;  4R8P B;  3X1U A;  4G91 C; 
#chains in the Genus database with same CATH homology
 2HIO B;  5B0Z B;  2F8N K;  4H9O B;  4J8W C;  3C1C D;  4Z2M G;  4HGA C;  5B32 B;  3AZG A;  3VH6 A;  3W99 D;  2ARO C;  2RVQ C;  2Y2P A;  5DNM A;  1T3U A;  3MGR D;  3KSY A;  1KX5 D;  5AV9 B;  1TAF A;  2LY8 A;  5AVB D;  3UTA B;  5CPI A;  1P3M A;  3LZ1 B;  2ZY4 A;  5C3I B;  3KXB C;  1N1J B;  3AV2 C;  3W96 C;  4YS3 C;  1P3I D;  3X1S B;  1B6W A;  2BYM A;  5AV6 B;  4Z2M H;  3MGP B;  3UT9 B;  2YFW B;  3AZI B;  3REK D;  3AV1 C;  1KX4 C;  1AOI D;  1P34 C;  1P3L A;  5B1M C;  5E5A B;  4X23 B;  4J8U B;  4H9P A;  4J8V A;  4KUD A;  1P3P B;  3REI A;  4XZQ D;  5JRG B;  3AZL D;  2NQB A;  5GSU B;  5B0Y D;  1P3A A;  3AL0 C;  2JE5 A;  5B2I B;  1M19 A;  2ZY3 A;  5CP6 C;  1R4V A;  1TZY C;  1F66 A;  5BO0 B;  5AV5 B;  4DRB A;  3A6N A;  4QLC D;  3X1U C;  3MNN D;  5B40 A;  5B31 D;  4ZUX D;  3AZK A;  1U35 A;  3WTP C;  3LEL A;  3H0L C;  4J8X C;  2CV5 A;  4WNN A;  4UUZ A;  4WU8 C;  3VH5 A;  5GT0 A;  3X1V B;  5GT3 D;  1KX3 A;  4H9S A;  3KUY B;  3C1B D;  3AZM A;  1P3O A;  4XUJ A;  1ZLA B;  1P3M C;  4WV4 B;  4JJN D;  1HQ3 D;  3B0C W;  5AY8 A;  5F99 D;  3NQU B;  2DQN C;  1P3B C;  4NE6 A;  3REJ B;  1M1A A;  3F6T A;  4R8P A;  1P3L C;  4Z66 A;  2W8S A;  2HIO A;  5B0Z A;  3LZ0 B;  4H9O A;  4J8V C;  1P3K D;  3C1C B;  4KUD C;  4YM6 D;  3AZN D;  5B32 A;  3W99 B;  5B32 G;  4E44 A;  2NZD A;  2NQB C;  3MGR B;  4J8W D;  1P3A C;  1KX5 B;  5AVB B;  4Z5T C;  3UTB B;  5AVC C;  3UTA A;  3AZE A;  2ARO D;  3KFU G;  1M18 C;  2RVQ D;  1F66 C;  5GXQ C;  3LZ1 A;  3W98 B;  1PZR A;  1N1J A;  1JFI B;  3WAA C;  3X1S A;  3MGP A;  1U35 C;  3UT9 A;  2YFW A;  3REK B;  3AZI A;  4H9Q B;  3KXB D;  1P3F C;  3B6F C;  1AOI B;  3AV2 D;  3EPH A;  2FJ7 C;  3W96 D;  1BH8 B;  5GT0 C;  4X23 A;  5E5A A;  1KX3 C;  2Y2M A;  4J8U A;  3AYW C;  3AV1 D;  1KX4 D;  3AZM C;  1P34 D;  3AZJ A;  1P3P A;  4XUJ C;  4H9R A;  3R45 B;  4XZQ B;  5B1M D;  3MVD B;  3AZF B;  5JRG A;  4E45 A;  3AZL B;  5B0Y B;  5GSU A;  3KWQ D;  5B2I A;  3X1T B;  5AY8 C;  2YFV B;  3A1I A;  5B24 B;  5BO0 A;  5AV5 A;  4QLC B;  3MNN B;  4R8P C;  1EQZ C;  1P3G D;  4Z66 C;  5B31 B;  4ZUX B;  3B0D B;  5G49 B;  2Y2N A;  5CP6 D;  1H3O B;  3X1U D;  1F1E A;  2ZY5 A;  4WU9 B;  3NQJ B;  4KGC B;  5GT3 B;  3X1V A;  2NZD C;  1WWI A;  3B6G A;  3W97 B;  3WTP D;  2UWX A;  3C1B B;  4J8X D;  4CSR B;  3AZE C;  2ZM5 A;  4WU8 D;  4JJN B;  3LZ1 C;  5C3I C;  1HQ3 B;  3TU4 D;  3LJA B;  5CPK A;  4AWL B;  3UT9 C;  3AZI C;  5B33 B;  3NQU A;  2Y2G A;  3EG5 B;  5B2J B;  1ID3 B;  3REJ A;  3WKJ B;  1BH9 B;  3B0B A;  5E5A C;  4X23 C;  4J8U C;  5BNX A;  2FFF B;  5B1L A;  3LZ0 A;  3C1C A;  4YM6 B;  3AZN B;  1P3B D;  1P3P C;  3AZJ C;  3AN2 A;  1P3L D;  4G91 B;  2PYO D;  2JSS A;  5FUG B;  1S32 D;  4CAY B;  5JRG C;  4J8W B;  5BS7 A;  4J8V D;  3MGR A;  3EPK A;  1KX5 A;  4KUD D;  4HGA B;  5AVB A;  3UTB A;  2ARO B;  2NQB D;  3W98 A;  3VH5 T;  3REL C;  3AZH B;  1P3A D;  2VQR A;  2F8N B;  4Z5T D;  1JFI A;  5AVC D;  2BG1 A;  1M18 D;  1F66 D;  3REH C;  5GXQ D;  3KXB B;  3MGS C;  3REK A;  1WWS A;  1AOI A;  2HUE C;  1BH8 A;  3WAA D;  3X1V C;  4DQY B;  1U35 D;  5AV8 B;  4G92 C;  3B6G C;  5CPJ A;  1P3F D;  1KX4 B;  3B6F D;  3O62 B;  3AZG C;  4LD9 A;  1P34 B;  5JA4 B;  5DNN B;  2FJ7 D;  5B1M B;  5GT0 D;  3R45 A;  4XZQ A;  3MVD A;  2XD1 A;  3AZF A;  5DNM C;  1KX3 D;  4WJ3 C;  3AZL A;  5B0Y A;  3AFA D;  3KWQ B;  3AYW D;  2CWE A;  5CPI C;  3AZM D;  5CPK C;  4XUJ D;  3X1T A;  2YFV A;  5B24 A;  3MGQ B;  3WA9 A;  4QLC A;  3MNN A;  3REJ C;  1P3G B;  5B31 A;  4ZUX A;  5AY8 D;  2DF4 C;  5B31 G;  5CP6 B;  5B1L C;  1H3O A;  3LZ0 C;  4WZS B;  3C1C C;  3AN2 C;  1EQZ D;  1A7W A;  4Z66 D;  4WU9 A;  4KGC A;  3NQJ A;  5GT3 A;  3WTP B;  3W97 A;  4J8X B;  3C1B A;  3REI C;  4CSR A;  3UTB C;  3H0R C;  4WU8 B;  2Y2H A;  4JJN A;  2NZD D;  3TU4 B;  3W98 C;  1HQ3 A;  3LJA A;  1M19 C;  5AV9 A;  3AZE D;  3REK C;  3A6N C;  4EO5 B;  5B33 A;  5BT1 C;  5B2J A;  1ID3 A;  5B40 C;  1P3I B;  3AZK C;  2Y2I A;  5AV6 A;  3WKJ A;  1BH9 A;  3LEL C;  3UT9 D;  5CPJ C;  2CV5 C;  4LD9 C;  1P3B B;  4YM6 A;  3AZN A;  2PYO B;  4YS3 D;  2ZY2 A;  3P5J B;  5FUG A;  3MVD C;  4X23 D;  5E5A D;  3AZF C;  1S32 B;  4H9S C;  4CAY A;  4J8U D;  4J8V B;  4J8W A;  1P3O C;  3AZJ D;  1P3P D;  3X1T C;  4ZBJ C;  2ARO A;  5JRG D;  5B24 C;  3WA9 C;  3MNN C;  3AZH A;  4Z5T B;  5AVC B;  2XD5 A;  2F8N A;  3A1K A;  2F8N G;  1Q9C A;  2JCH A;  1M18 B;  5GXQ B;  5BNV B;  3KXB A;  1M1A C;  3REL D;  4WU9 C;  4KGC C;  3WAA B;  2HIO C;  1U35 B;  5B0Z C;  1TZY D;  1ULY A;  3W97 C;  5AV8 A;  2G5I C;  3REH D;  3C1B C;  3MGS D;  1P3F B;  3B6F B;  3O62 A;  5B32 C;  2BYK B;  1P34 A;  2FJ7 B;  5JA4 A;  5DNN A;  5B1M A;  3X1V D;  2IO5 B;  4JJN C;  1KX3 B;  3B6G D;  3KUY A;  2L5A A;  3AFA B;  5AV9 C;  3LJA C;  2G5H C;  3KWQ A;  3AYW B;  3AZM B;  3AZG D;  5KDM B;  2F8N H;  3UTA C;  4XUJ B;  1ZLA A;  2Y2J A;  4AWL C;  5DNM D;  5B33 C;  3IP4 C;  3MGQ A;  5B2J C;  1ID3 C;  5CPI D;  1P3G A;  1W2E A;  5AY8 B;  5AV6 C;  5F99 B;  3MGP C;  3X1S C;  5CPK D;  1P3M D;  3WKJ C;  5CP6 A;  1HTA A;  4YM6 C;  3AZN C;  3REJ D;  1EQZ B;  4Z66 B;  3B0C T;  1Z2C B;  1P3K B;  4NE5 A;  5B1L D;  3WTP A;  3LZ0 D;  3EPJ A;  4J8X A;  1B67 A;  4UPK A;  3AN2 D;  3W99 A;  4WU8 A;  2NZD B;  1BFM A;  5GSU C;  2J8P A;  3TU4 A;  3AZH C;  5B2I C;  3REI D;  3UTB D;  3AZE B;  4H9N B;  5AV5 C;  3W98 D;  1M19 D;  2F2A C;  4KHA B;  1P3I A;  5AV8 C;  4H9Q A;  4M6B A;  3A6N D;  3AV2 B;  3O62 C;  5BT1 D;  1P3B A;  3W96 B;  2PYO A;  4YS3 B;  5B40 D;  5DNN C;  3AZK D;  2Y2O A;  1S32 A;  3LEL D;  3AV1 B;  3KUY C;  5CPJ D;  2CV5 D;  3KWQ C;  4LD9 D;  3AZJ B;  3VH6 W;  4H9R B;  1ZLA C;  3WTP E;  3MVD D;  3AZF D;  3MGQ C;  1P3G C;  1P3O D;  4Z5T A;  5CHL B;  5AVC A;  3X1T D;  1M18 A;  5GXQ A;  5B24 D;  5BNV A;  3REL B;  3WA9 D;  4NE3 A;  5G49 A;  3WAA A;  1TZY B;  3REH B;  4NFT A;  3V9R B;  3MGS B;  1P3F A;  1M1A D;  3X1U B;  3B6F A;  4R8P D;  2HUE B;  3W99 C;  2Y2Q A;  2BYK A;  2FJ7 A;  2RIQ A;  4WU9 D;  4KGC D;  2HIO D;  5B0Z D;  4G92 B;  3B6G B;  5BS7 C;  3W97 D;  3MGR C;  3TU4 C;  1KX5 C;  3AYW A;  3AFA A;  3AZG B;  5AVB C;  5B32 D;  5KDM A;  5DNM B;  4EO5 C;  3EPL A;  3LJA D;  5AV9 D;  1TAF B;  5CPI B;  1P3I C;  3UTA D;  5CPK B;  1P3M B;  5F99 A;  4DRA A;  3LZ1 D;  5B33 D;  1AOI C;  5B2J D;  1ID3 D;  1EQZ A;  2PYO C;  2BYM B;  2Y2K A;  3X1S D;  5AV6 D;  3MGP D;  3WKJ D;  1S32 C;  5BNX B;  5B1L B;  3AZI D;  1P3K A;  3AN2 B;  1P3L B;  3VH5 W;  4XZQ C;  4H9P B;  3AZL C;  5B0Y C;  4KUD B;  3REI B;  3H0M C;  4H9N A;  2NQB B;  1P3A B;  5GSU D;  4QLC C;  1M19 B;  3AZH D;  5B2I D;  5B31 C;  4ZUX C;  3B0D C;  4KHA A;  2F8N D;  1F66 B;  5AV5 D;  3A6N B;  1KU5 A;  3FDD A;  3AV2 A;  5B40 B;  3W96 A;  4YS3 A;  3AZK B;  5GT3 C;  2IO5 C;  3LEL B;  5AV8 D;  5CPJ B;  3AV1 A;  4WNN B;  2CV5 B;  4UUZ B;  3AFA C;  1KX4 A;  4LD9 B;  3O62 D;  5GT0 B;  5DNN D;  1HQ3 C;  3KUY D;  2Y2L A;  1P3O B;  1ZLA D;  4ZBJ B;  5F99 C;  3VH6 T;  3WA9 B;  3MGQ D;  3REL A;  1TZY A;  1P3K C;  3REH A;  3MGS A;  3V9R A;  1M1A B;  4R8P B;  3X1U A;  4G91 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...