2PYOA

Drosophila nucleosome core
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (147-MER)
publication title Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2pyoA00
5CPJD 5GT0D 2AROD 2HUEC 1N1JA 2FJ7B 3REKC 4LD9A 5FUGB 3KUYC 3W98A 5BT1D 1HQ3C 5B31G 5B2ID 4Z66D 4H9NA 4J8UB 1P3AB 2L5AA 4WU8B 5CP6D 1BH8B 1P3GA 4H9QA 5B31D 1HTAA 3B0DC 4XUJD 3R45B 4J8XA 3REJD 5AV6C 3LZ1B 5B32G 3REHC 1N1JB 3AZNB 4ZBJC 4LD9B 3AN2D 4KUDD 5BNXA 4YS3D 5B32D 1P3BD 5AVCA 1ZLAD 3W97D 1P34A 3W98B 1KX5A 2CV5C 4H9NB 3X1SA 3B6FC 1P3KC 2NZDA 2RVQD 5B1MC 5F99D 5AVBD 5C3IB 1P3GB 4H9QB 4QLCD 1P3MC 3MGPA 3X1TC 4J8XB 2YFWA 5AY8A 3AZJC 5AV5D 1EQZC 2LY8A 4Z5TA 5AV8A 1TZYD 3UTAC 3AZLA 3B0CT 5DNMC 1U35D 3WKJA 3AZMA 3X1UC 1F66D 5BNXB 5AVCB 1P34B 1KX5B 5B1LC 4J8WA 3X1SB 3TU4D 2NZDB 3X1VC 1P3FA 3AZKA 5B40C 5CPKC 3MGPB 3WTPD 4NE3A 1ULYA 2YFWB 5AY8B 1R4VA 4YM6A 1KX3A 3AZID 4Z5TB 5AV8B 3AZGC 1ID3C 3AZLB 5B0YC 3WKJB 3AZMB 3MGSA 3UTBD 5CPID 1S32D 1P3IC 3REIC 4X23C 4H9SA 4J8WB 3RELA 3LELD 3AV2A 3AZHD 5JRGD 5B0ZA 1P3FB 4WV4B 4E44A 3C1BC 3AZKB 4XZQD 2F8ND 1M1AA 2PYOA 3B6FB 3KWQD 2FJ7C 3MGQD 1P3KB 3MGRA 4YM6B 4WZSB 3AFAA 4ZUXA 4J8UC 3REKD 1P3AC 1P3LD 4WU8C 3KXBD 2HIOA 4UUZB 3MGSB 1KX4D 1P3PA 3AV2B 5CPJA 5GT0A 2AROA 3LZ1C 4WU9D 3WAAD 1M1AB 5B2IA 4Z66A 4G92B 4LD9C 3REHD 3C1CD 3W98C 5B2JD 3AFAB 4ZUXB 4CSRA 5B31A 3LZ0A 5AV9A 4XUJA 5C3IC 2HIOB 1P3GC 5B1MD 1M19A 3VH6A 3AV1D 4J8XC 3AZGB 1P3PB 5CPJB 5GT0B 2AROB 3X1TD 1BH9A 1M18A 3AN2A 3W99D 4KUDA 3O62D 2NQBD 3W97A 3AZJD 2JSSA 3UT9D 1EQZD 5B2IB 4Z66B 3UTAD 5F99A 5AVCC 1P34C 1KX5C 3X1UD 4CSRB 5BO0A 3X1SC 3LZ0B 1JFIB 1P3OD 5AV9B 4XUJB 2NZDC 5B1LD 1M19B 3AZFD 3MGPC 3LJAA 5B40D 1TZYA 5AY8C 3MNNA 1BH9B 1M18B 1F66A 4Z5TC 5AV8C 3AN2B 4KUDB 3AZLC 4Z2MG 5JA4A 3W97B 3WKJC 1AOID 3AZMC 3B6GD 5F99B 5B0YD 4J8WC 5BO0B 1P3ID 3WTPA 1P3FC 4X23D 5BS7A 3AZKC 4DRAA 1WWIA 3LJAB 3C1BD 3AZIA 3AZED 1TZYB 4YM6C 3MNNB 5GXQA 1F66B 5CPIA 1S32A 5JA4B 4J8UD 1P3AD 3MGSC 3LELA 3AZHA 4WU8D 4J8VD 5JRGA 1WWSA 5GSUA 5GT3A 5DNNA 4H9SC 4XZQA 3AV2C 2F8NA 4KGCD 3MGQA 3LZ1D 1M1AC 1P3LA 3AZIB 4G91B 4G92C 5E5AD 3KXBA 3V9RA 3AZND 3AFAC 4ZUXC 5GXQB 4LD9D 3WA9D 4WNNA 5CPIB 3MVDA 1KX4A 2HIOC 3LELB 3WTPE 3A6ND 4WU9A 3WAAA 3AYWD 5GSUB 5GT3B 1P3PC 5DNNB 4XZQB 4R8PD 5CPJC 1P3GD 5GT0C 2F8NB 2AROC 4JJNA 3MGQB 1KU5A 3C1CA 3W96A 4NE5A 5B2JA 4H9PA 5B2IC 1Q9CA 5B24A 4Z66C 4M6BA 1P3LB 4AWLB 3KXBB 3VH5A 3LZ0C 4WNNB 5AV9C 4XUJC 3AV1A 3MVDB 1KX4B 1P34D 1KX5D 1M19C 1H3OA 1KX3B 3WAAB 3KUYD 3W99A 1HQ3D 3O62A 2NQBA 3MGPD 5B33A 4JJNB 3UT9A 1M18C 3AN2C 4KUDC 3W96B 3RELB 3W97C 5B2JB 4H9PB 3X1UA 5B0ZB 5B24B 5AV8D 2BYKA 1P3OA 5F99C 5AV6D 2PYOB 3KSYA 3AZFA 3AV1B 4J8WD 3MGRB 5CP6A 2YFVA 2F8NK 1BFMA 1H3OB 3LJAC 3NQUA 1TZYC 3W99B 2F8NH 4H9RA 3B0BA 3REJA 3O62B 2CV5D 3B6FD 3MNNC 2NQBB 5B33B 3UT9B 1P3KD 1AOIA 1F66C 3B6GA 4YM6D 2BYMA 1P3MD 2BYKB 1P3OB 5BNVA 4YS3A 2IO5B 5B32A 3MGSD 1P3BA 1ZLAA 4DRBA 3AZFB 3WTPC 3C1BA 5BS7C 5AVBA 5DNMD 5CP6B 3AZEA 3AV2D 2YFVB 4QLCA 5B31B 3NQUB 5FUGA 4G91C 3AZIC 4H9RB 1M1AD 3REJB 5KDMA 1AOIB 3X1VD 5GXQC 4J8VA 5AV5A 3B6GB 5CPIC 1S32C 2BYMB 5CPKD 3LELC 1U35A 5JRGC 4KGCA 5BNVB 1B67A 5GT3C 5GSUC 2HIOD 5DNNC 4HGAB 4XZQC 5B32B 4YS3B 1P3BB 1ZLAB 1ID3D 3AZGD 3TU4A 3MGQC 5AVBB 3AZEB 5E5AA 3AZNA 4QLCB 1P3LC 3REID 4AWLC 3WA9A 3KXBC 5KDMB 4J8VB 5AV5B 3MVDC 3A6NA 1KX4C 3AYWA 4R8PA 3LZ0D 1U35B 2FJ7D 5AV9D 1A7WA 5G49A 1KX3C 4KGCB 3UTBA 3WAAC 4WU9C 4H9OA 2CWEA 1TAFA 1M19D 4JJNC 5CHLB 3TU4B 3NQJA 3C1CC 3W96C 5E5AB 3RELC 1M18D 5B2JC 5B0ZC 5B24C 3VH6W 4EO5C 3KWQA 3WA9B 3WTPB 2PYOC 3REKA 3AV1C 3A6NB 3KUYA 4Z2MH 3AYWB 3MGRC 4R8PB 1HQ3A 5G49B 3UTBB 3W98D 4H9OB 1S32B 3W99C 1TAFB 3O62C 2NQBC 5B33C 3LJAD 3UT9C 3AZHB 5JRGB 3NQJB 5AV6A 3MNND 4J8XD 3KWQB 1P3OC 3REHA 2IO5C 2HUEB 5BT1C 3REKB 3VH5T 3AZFC 3KUYB 5CP6C 3V9RB 1HQ3B 2CV5A 3B6FA 5B31C 1P3KA 5B1MA 5AVCD 4CAYA 3REJC 3X1SD 1P3MA 1AOIC 2NZDD 3B0DB 3X1TA 3B6GC 4WU9B 5AV6B 4UUZA 5GXQD 3AZJA 1F1EA 1EQZA 3UTAA 3REHB 5AY8D 3C1CB 4YS3C 5B32C 5DNMA 4HGAC 1P3BC 1ZLAC 2F8NG 4ZBJB 4Z5TD 4EO5B 4E45A 5GSUD 2RVQC 5GT3D 5DNND 3AZLD 5AVBC 3AZEC 3WKJD 5B1LA 3AZMD 2CV5B 4KHAA 4QLCC 3X1VA 5B1MB 4CAYB 5B40A 1P3MB 5CPKA 3X1TB 1P3FD 4J8VC 5AV5C 3AZKD 3VH6T 3AZJB 1U35C 1EQZB 4KGCC 3MVDD 1ID3A 3AZGA 3UTAB 5B0YA 5DNMB 1KX3D 3X1UB 3TU4C 1P3IA 3REIA 4X23A 5B1LB 5E5AC 4KHAB 4JJND 3AZNC 3X1VB 4NE6A 3WA9C 3W96D 5B40B 3RELD 1B6WA 5B0ZD 5B24D 5CPKB 2FJ7A 1JFIA 3B0CW 3A6NC 3AYWC 2PYOD 4R8PC 4J8UA 1P3AA 1ID3B 4WU8A 3UTBC 3MGRD 1BH8A 5B0YB 3AFAD 3VH5W 4ZUXD 4NFTA 3AZHC 3R45A 1P3IB 3REIB 4X23B 5B33D 3LZ1A 3KWQC 3C1BB 1P3PD
chains in the Genus database with same CATH superfamily
5CPJD 5GT0D 2AROD 2HUEC 1N1JA 2FJ7B 3REKC 4LD9A 5FUGB 3KUYC 3W98A 5BT1D 1HQ3C 5B31G 5B2ID 2BG1A 4H9NA 4Z66D 4J8UB 1P3AB 2L5AA 4WU8B 5CP6D 1BH8B 2VQRA 1P3GA 4H9QA 5B31D 1HTAA 3A1KA 3B0DC 4XUJD 3R45B 4J8XA 3REJD 3EPHA 5AV6C 3LZ1B 2Y2NA 5B32G 3REHC 1N1JB 3AZNB 4ZBJC 4LD9B 1W2EA 3AN2D 4KUDD 5BNXA 4YS3D 5B32D 1P3BD 5AVCA 1ZLAD 3W97D 1P34A 3W98B 1KX5A 2CV5C 4H9NB 3X1SA 3B6FC 1P3KC 2NZDA 2RVQD 5B1MC 5F99D 5AVBD 5C3IB 1P3GB 4H9QB 4QLCD 1P3MC 3MGPA 3X1TC 4J8XB 2YFWA 2J8PA 5AY8A 3AZJC 5AV5D 1EQZC 2LY8A 4Z5TA 5AV8A 1TZYD 3UTAC 3AZLA 3B0CT 5DNMC 1U35D 3WKJA 3AZMA 3X1UC 1F66D 5BNXB 5AVCB 1P34B 1KX5B 5B1LC 4J8WA 4UPKA 3X1SB 3TU4D 2NZDB 3X1VC 1P3FA 3AZKA 5B40C 5CPKC 3MGPB 3WTPD 4NE3A 1ULYA 2YFWB 2Y2LA 5AY8B 1R4VA 3KFUG 4YM6A 2DF4C 1KX3A 3AZID 4Z5TB 5AV8B 3AZGC 1ID3C 3AZLB 5B0YC 3WKJB 3AZMB 3MGSA 3UTBD 5CPID 1S32D 1P3IC 3REIC 4X23C 4H9SA 4J8WB 3RELA 3LELD 3AV2A 3AZHD 5JRGD 5B0ZA 1P3FB 4WV4B 4E44A 3C1BC 3AZKB 4XZQD 2F8ND 1M1AA 2PYOA 3B6FB 3KWQD 2FJ7C 3MGQD 1P3KB 3MGRA 2W8SA 4YM6B 4WZSB 3AFAA 4ZUXA 4J8UC 3REKD 1P3AC 1P3LD 4WU8C 3KXBD 2HIOA 4UUZB 3MGSB 1KX4D 1P3PA 3AV2B 5CPJA 5GT0A 2AROA 3LZ1C 4WU9D 1Z2CB 3WAAD 1M1AB 5B2IA 4Z66A 4G92B 4LD9C 3REHD 3C1CD 3W98C 5B2JD 3AFAB 4ZUXB 4CSRA 5B31A 3LZ0A 2Y2GA 4XUJA 5AV9A 5C3IC 2HIOB 1P3GC 5B1MD 1M19A 3VH6A 3AV1D 4J8XC 3AZGB 1P3PB 5CPJB 5GT0B 2AROB 3X1TD 1BH9A 2DQNC 1M18A 3AN2A 3W99D 4KUDA 3O62D 2NQBD 3W97A 3AZJD 2JSSA 3UT9D 1EQZD 5B2IB 4Z66B 3UTAD 5F99A 5AVCC 1P34C 1KX5C 3X1UD 4CSRB 5BO0A 3X1SC 3LZ0B 3IP4C 1P3OD 5AV9B 4XUJB 1JFIB 2NZDC 5B1LD 1M19B 3AZFD 3MGPC 3LJAA 5B40D 1TZYA 5AY8C 3MNNA 1BH9B 1M18B 1F66A 5AV8C 4Z5TC 3AN2B 4KUDB 3A1IA 3AZLC 4Z2MG 5JA4A 3W97B 3WKJC 1AOID 3AZMC 3B6GD 2XD1A 5F99B 5B0YD 2ZY3A 4DQYB 4J8WC 5BO0B 1P3ID 3EPKA 2JE5A 3WTPA 1P3FC 4X23D 5BS7A 3AZKC 4DRAA 1WWIA 3LJAB 3C1BD 3AZIA 3AZED 1TZYB 4YM6C 3MNNB 5GXQA 1F66B 5CPIA 1S32A 5JA4B 4J8UD 3H0RC 1P3AD 3EPLA 3MGSC 3LELA 3AZHA 4WU8D 4J8VD 5JRGA 3EG5B 1WWSA 5GSUA 5GT3A 5DNNA 4H9SC 4XZQA 3AV2C 2F8NA 4KGCD 3MGQA 3LZ1D 1M1AC 1P3LA 3AZIB 4G91B 4G92C 5E5AD 3KXBA 1PZRA 3V9RA 3AZND 3AFAC 4ZUXC 5GXQB 4LD9D 3WA9D 4WNNA 5CPIB 3MVDA 1KX4A 2HIOC 3LELB 3WTPE 3A6ND 4WU9A 3H0LC 3WAAA 3AYWD 5GSUB 5GT3B 1P3PC 5DNNB 4XZQB 4R8PD 2Y2KA 5CPJC 5GT0C 1P3GD 2AROC 2F8NB 4JJNA 3MGQB 1KU5A 3C1CA 3W96A 4NE5A 5B2JA 4H9PA 5B2IC 1Q9CA 4M6BA 5B24A 4Z66C 1P3LB 4AWLB 3KXBB 3VH5A 3LZ0C 4WNNB 5AV9C 4XUJC 3AV1A 3MVDB 1KX4B 1P34D 1KX5D 1M19C 1H3OA 1KX3B 3WAAB 3KUYD 3W99A 1HQ3D 3O62A 2NQBA 3MGPD 2Y2MA 5B33A 4JJNB 3UT9A 1M18C 3AN2C 4KUDC 2F2AC 3W96B 3RELB 3W97C 5B2JB 4H9PB 3X1UA 5B0ZB 5B24B 5AV8D 2BYKA 1P3OA 5F99C 5AV6D 2PYOB 3KSYA 3AZFA 3AV1B 3P5JB 4J8WD 3MGRB 5CP6A 2YFVA 2Y2JA 2F8NK 1BFMA 1H3OB 3LJAC 3NQUA 1TZYC 3W99B 2F8NH 4H9RA 3B0BA 3REJA 3O62B 2CV5D 3B6FD 3MNNC 2NQBB 5B33B 3UT9B 1P3KD 1AOIA 1F66C 3B6GA 4YM6D 2BYMA 1P3MD 2FFFB 2BYKB 1P3OB 5BNVA 4YS3A 2IO5B 5B32A 3MGSD 1P3BA 1ZLAA 4DRBA 3AZFB 3WTPC 3C1BA 5BS7C 5AVBA 5DNMD 5CP6B 3AZEA 3AV2D 2YFVB 4QLCA 5B31B 2ZM5A 3NQUB 5FUGA 4G91C 3AZIC 4H9RB 1M1AD 3REJB 5KDMA 1AOIB 3X1VD 5GXQC 4J8VA 5AV5A 3B6GB 5CPIC 1S32C 2BYMB 3FDDA 5CPKD 3LELC 1U35A 5JRGC 4KGCA 5BNVB 1B67A 5GT3C 5GSUC 5B32B 2HIOD 5DNNC 4HGAB 4XZQC 2G5HC 4YS3B 2Y2OA 1P3BB 1ZLAB 1ID3D 3AZGD 2G5IC 3TU4A 3MGQC 5AVBB 2ZY4A 3AZEB 5E5AA 3AZNA 4QLCB 1P3LC 3REID 4AWLC 3WA9A 3KXBC 5KDMB 4J8VB 5AV5B 3MVDC 3A6NA 1KX4C 2UWXA 3AYWA 4R8PA 3LZ0D 1U35B 2FJ7D 5AV9D 1A7WA 5G49A 1KX3C 4KGCB 3UTBA 3WAAC 4WU9C 3F6TA 4H9OA 2CWEA 1TAFA 1M19D 4JJNC 5CHLB 3TU4B 3NQJA 3C1CC 3W96C 5E5AB 3RELC 1M18D 5B2JC 3VH6W 5B24C 5B0ZC 4EO5C 3KWQA 3WA9B 3WTPB 3EPJA 2ZY2A 2PYOC 3REKA 3AV1C 3A6NB 3KUYA 4Z2MH 3AYWB 3MGRC 4R8PB 1HQ3A 5G49B 3UTBB 2RIQA 3W98D 4H9OB 1S32B 3W99C 1TAFB 3O62C 2NQBC 5B33C 3LJAD 3UT9C 3AZHB 5JRGB 3NQJB 5AV6A 3MNND 4J8XD 3KWQB 1P3OC 3REHA 2XD5A 2IO5C 2HUEB 5BT1C 2Y2PA 3REKB 3VH5T 3AZFC 3KUYB 5CP6C 3V9RB 1HQ3B 2CV5A 3B6FA 5B31C 1P3KA 5B1MA 5AVCD 4CAYA 3REJC 3X1SD 1P3MA 1AOIC 2NZDD 3B0DB 3X1TA 3B6GC 2JCHA 4WU9B 4WJ3C 5AV6B 4UUZA 5GXQD 3AZJA 1F1EA 1EQZA 3UTAA 3REHB 5AY8D 3C1CB 4YS3C 5B32C 5DNMA 4HGAC 1P3BC 1ZLAC 2F8NG 4ZBJB 4Z5TD 4EO5B 4E45A 5GSUD 2RVQC 5GT3D 5DNND 3AZLD 5AVBC 3AZEC 3WKJD 2Y2QA 5B1LA 3AZMD 2CV5B 4KHAA 4QLCC 3X1VA 5B1MB 4CAYB 5B40A 1P3MB 5CPKA 3X1TB 1P3FD 4J8VC 5AV5C 3AZKD 3VH6T 3AZJB 1U35C 1EQZB 4KGCC 3MVDD 1ID3A 3AZGA 3UTAB 5B0YA 5DNMB 1KX3D 3X1UB 3TU4C 1P3IA 3REIA 2Y2IA 4X23A 5B1LB 5E5AC 4KHAB 4JJND 3AZNC 3X1VB 2Y2HA 4NE6A 3WA9C 3W96D 5B40B 3RELD 1B6WA 5B0ZD 5B24D 3AL0C 5CPKB 2FJ7A 1JFIA 3B0CW 3A6NC 3AYWC 2PYOD 4R8PC 4J8UA 1P3AA 1ID3B 4WU8A 3UTBC 3MGRD 3H0MC 1BH8A 5B0YB 1T3UA 3VH5W 4ZUXD 3AFAD 4NFTA 2ZY5A 3AZHC 3R45A 1P3IB 3REIB 4X23B 5B33D 3LZ1A 3KWQC 3C1BB 1P3PD
chains in the Genus database with same CATH topology
5CPJD 5GT0D 2AROD 2HUEC 1N1JA 2FJ7B 3REKC 4LD9A 5FUGB 3KUYC 3W98A 5BT1D 1HQ3C 5B31G 5B2ID 2BG1A 4H9NA 4Z66D 4J8UB 1P3AB 2L5AA 4WU8B 5CP6D 1BH8B 2VQRA 1P3GA 4H9QA 5B31D 1HTAA 3A1KA 3B0DC 4XUJD 3R45B 4J8XA 3REJD 3EPHA 5AV6C 3LZ1B 2Y2NA 5B32G 3REHC 1N1JB 3AZNB 4ZBJC 4LD9B 1W2EA 3AN2D 4KUDD 5BNXA 4YS3D 5B32D 1P3BD 5AVCA 1ZLAD 3W97D 1P34A 3W98B 1KX5A 2CV5C 4H9NB 3X1SA 3B6FC 1P3KC 2NZDA 2RVQD 5B1MC 5F99D 5AVBD 5C3IB 1P3GB 4H9QB 4QLCD 1P3MC 3MGPA 3X1TC 4J8XB 2YFWA 2J8PA 5AY8A 3AZJC 5AV5D 1EQZC 2LY8A 4Z5TA 5AV8A 1TZYD 3UTAC 3AZLA 3B0CT 5DNMC 1U35D 3WKJA 3AZMA 3X1UC 1F66D 5BNXB 5AVCB 1P34B 1KX5B 5B1LC 4J8WA 4UPKA 3X1SB 3TU4D 2NZDB 3X1VC 1P3FA 3AZKA 5B40C 5CPKC 3MGPB 3WTPD 4NE3A 1ULYA 2YFWB 2Y2LA 5AY8B 1R4VA 3KFUG 4YM6A 2DF4C 1KX3A 3AZID 4Z5TB 5AV8B 3AZGC 1ID3C 3AZLB 5B0YC 3WKJB 3AZMB 3MGSA 3UTBD 5CPID 1S32D 1P3IC 3REIC 4X23C 4H9SA 4J8WB 3RELA 3LELD 3AV2A 3AZHD 5JRGD 5B0ZA 1P3FB 4WV4B 4E44A 3C1BC 3AZKB 4XZQD 2F8ND 1M1AA 2PYOA 3B6FB 3KWQD 2FJ7C 3MGQD 1P3KB 3MGRA 2W8SA 4YM6B 4WZSB 3AFAA 4ZUXA 4J8UC 3REKD 1P3AC 1P3LD 4WU8C 3KXBD 2HIOA 4UUZB 3MGSB 1KX4D 1P3PA 3AV2B 5CPJA 5GT0A 2AROA 3LZ1C 4WU9D 1Z2CB 3WAAD 1M1AB 5B2IA 4Z66A 4G92B 4LD9C 3REHD 3C1CD 3W98C 5B2JD 3AFAB 4ZUXB 4CSRA 5B31A 3LZ0A 2Y2GA 4XUJA 5AV9A 5C3IC 2HIOB 1P3GC 5B1MD 1M19A 3VH6A 3AV1D 4J8XC 3AZGB 1P3PB 5CPJB 5GT0B 2AROB 3X1TD 1BH9A 2DQNC 1M18A 3AN2A 3W99D 4KUDA 3O62D 2NQBD 3W97A 3AZJD 2JSSA 3UT9D 1EQZD 5B2IB 4Z66B 3UTAD 5F99A 5AVCC 1P34C 1KX5C 3X1UD 4CSRB 5BO0A 3X1SC 3LZ0B 3IP4C 1P3OD 5AV9B 4XUJB 1JFIB 2NZDC 5B1LD 1M19B 3AZFD 3MGPC 3LJAA 5B40D 1TZYA 5AY8C 3MNNA 1BH9B 1M18B 1F66A 5AV8C 4Z5TC 3AN2B 4KUDB 3A1IA 3AZLC 4Z2MG 5JA4A 3W97B 3WKJC 1AOID 3AZMC 3B6GD 2XD1A 5F99B 5B0YD 2ZY3A 4DQYB 4J8WC 5BO0B 1P3ID 3EPKA 2JE5A 3WTPA 1P3FC 4X23D 5BS7A 3AZKC 4DRAA 1WWIA 3LJAB 3C1BD 3AZIA 3AZED 1TZYB 4YM6C 3MNNB 5GXQA 1F66B 5CPIA 1S32A 5JA4B 4J8UD 3H0RC 1P3AD 3EPLA 3MGSC 3LELA 3AZHA 4WU8D 4J8VD 5JRGA 3EG5B 1WWSA 5GSUA 5GT3A 5DNNA 4H9SC 4XZQA 3AV2C 2F8NA 4KGCD 3MGQA 3LZ1D 1M1AC 1P3LA 3AZIB 4G91B 4G92C 5E5AD 3KXBA 1PZRA 3V9RA 3AZND 3AFAC 4ZUXC 5GXQB 4LD9D 3WA9D 4WNNA 5CPIB 3MVDA 1KX4A 2HIOC 3LELB 3WTPE 3A6ND 4WU9A 3H0LC 3WAAA 3AYWD 5GSUB 5GT3B 1P3PC 5DNNB 4XZQB 4R8PD 2Y2KA 5CPJC 5GT0C 1P3GD 2AROC 2F8NB 4JJNA 3MGQB 1KU5A 3C1CA 3W96A 4NE5A 5B2JA 4H9PA 5B2IC 1Q9CA 4M6BA 5B24A 4Z66C 1P3LB 4AWLB 3KXBB 3VH5A 3LZ0C 4WNNB 5AV9C 4XUJC 3AV1A 3MVDB 1KX4B 1P34D 1KX5D 1M19C 1H3OA 1KX3B 3WAAB 3KUYD 3W99A 1HQ3D 3O62A 2NQBA 3MGPD 2Y2MA 5B33A 4JJNB 3UT9A 1M18C 3AN2C 4KUDC 2F2AC 3W96B 3RELB 3W97C 5B2JB 4H9PB 3X1UA 5B0ZB 5B24B 5AV8D 2BYKA 1P3OA 5F99C 5AV6D 2PYOB 3KSYA 3AZFA 3AV1B 3P5JB 4J8WD 3MGRB 5CP6A 2YFVA 2Y2JA 2F8NK 1BFMA 1H3OB 3LJAC 3NQUA 1TZYC 3W99B 2F8NH 4H9RA 3B0BA 3REJA 3O62B 2CV5D 3B6FD 3MNNC 2NQBB 5B33B 3UT9B 1P3KD 1AOIA 1F66C 3B6GA 4YM6D 2BYMA 1P3MD 2FFFB 2BYKB 1P3OB 5BNVA 4YS3A 2IO5B 5B32A 3MGSD 1P3BA 1ZLAA 4DRBA 3AZFB 3WTPC 3C1BA 5BS7C 5AVBA 5DNMD 5CP6B 3AZEA 3AV2D 2YFVB 4QLCA 5B31B 2ZM5A 3NQUB 5FUGA 4G91C 3AZIC 4H9RB 1M1AD 3REJB 5KDMA 1AOIB 3X1VD 5GXQC 4J8VA 5AV5A 3B6GB 5CPIC 1S32C 2BYMB 3FDDA 5CPKD 3LELC 1U35A 5JRGC 4KGCA 5BNVB 1B67A 5GT3C 5GSUC 5B32B 2HIOD 5DNNC 4HGAB 4XZQC 2G5HC 4YS3B 2Y2OA 1P3BB 1ZLAB 1ID3D 3AZGD 2G5IC 3TU4A 3MGQC 5AVBB 2ZY4A 3AZEB 5E5AA 3AZNA 4QLCB 1P3LC 3REID 4AWLC 3WA9A 3KXBC 5KDMB 4J8VB 5AV5B 3MVDC 3A6NA 1KX4C 2UWXA 3AYWA 4R8PA 3LZ0D 1U35B 2FJ7D 5AV9D 1A7WA 5G49A 1KX3C 4KGCB 3UTBA 3WAAC 4WU9C 3F6TA 4H9OA 2CWEA 1TAFA 1M19D 4JJNC 5CHLB 3TU4B 3NQJA 3C1CC 3W96C 5E5AB 3RELC 1M18D 5B2JC 3VH6W 5B24C 5B0ZC 4EO5C 3KWQA 3WA9B 3WTPB 3EPJA 2ZY2A 2PYOC 3REKA 3AV1C 3A6NB 3KUYA 4Z2MH 3AYWB 3MGRC 4R8PB 1HQ3A 5G49B 3UTBB 2RIQA 3W98D 4H9OB 1S32B 3W99C 1TAFB 3O62C 2NQBC 5B33C 3LJAD 3UT9C 3AZHB 5JRGB 3NQJB 5AV6A 3MNND 4J8XD 3KWQB 1P3OC 3REHA 2XD5A 2IO5C 2HUEB 5BT1C 2Y2PA 3REKB 3VH5T 3AZFC 3KUYB 5CP6C 3V9RB 1HQ3B 2CV5A 3B6FA 5B31C 1P3KA 5B1MA 5AVCD 4CAYA 3REJC 3X1SD 1P3MA 1AOIC 2NZDD 3B0DB 3X1TA 3B6GC 2JCHA 4WU9B 4WJ3C 5AV6B 4UUZA 5GXQD 3AZJA 1F1EA 1EQZA 3UTAA 3REHB 5AY8D 3C1CB 4YS3C 5B32C 5DNMA 4HGAC 1P3BC 1ZLAC 2F8NG 4ZBJB 4Z5TD 4EO5B 4E45A 5GSUD 2RVQC 5GT3D 5DNND 3AZLD 5AVBC 3AZEC 3WKJD 2Y2QA 5B1LA 3AZMD 2CV5B 4KHAA 4QLCC 3X1VA 5B1MB 4CAYB 5B40A 1P3MB 5CPKA 3X1TB 1P3FD 4J8VC 5AV5C 3AZKD 3VH6T 3AZJB 1U35C 1EQZB 4KGCC 3MVDD 1ID3A 3AZGA 3UTAB 5B0YA 5DNMB 1KX3D 3X1UB 3TU4C 1P3IA 3REIA 2Y2IA 4X23A 5B1LB 5E5AC 4KHAB 4JJND 3AZNC 3X1VB 2Y2HA 4NE6A 3WA9C 3W96D 5B40B 3RELD 1B6WA 5B0ZD 5B24D 3AL0C 5CPKB 2FJ7A 1JFIA 3B0CW 3A6NC 3AYWC 2PYOD 4R8PC 4J8UA 1P3AA 1ID3B 4WU8A 3UTBC 3MGRD 3H0MC 1BH8A 5B0YB 1T3UA 3VH5W 4ZUXD 3AFAD 4NFTA 2ZY5A 3AZHC 3R45A 1P3IB 3REIB 4X23B 5B33D 3LZ1A 3KWQC 3C1BB 1P3PD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ D;  5GT0 D;  2ARO D;  2HUE C;  1N1J A;  2FJ7 B;  3REK C;  4LD9 A;  5FUG B;  3KUY C;  3W98 A;  5BT1 D;  1HQ3 C;  5B31 G;  5B2I D;  4Z66 D;  4H9N A;  4J8U B;  1P3A B;  2L5A A;  4WU8 B;  5CP6 D;  1BH8 B;  1P3G A;  4H9Q A;  5B31 D;  1HTA A;  3B0D C;  4XUJ D;  3R45 B;  4J8X A;  3REJ D;  5AV6 C;  3LZ1 B;  5B32 G;  3REH C;  1N1J B;  3AZN B;  4ZBJ C;  4LD9 B;  3AN2 D;  4KUD D;  5BNX A;  4YS3 D;  5B32 D;  1P3B D;  5AVC A;  1ZLA D;  3W97 D;  1P34 A;  3W98 B;  1KX5 A;  2CV5 C;  4H9N B;  3X1S A;  3B6F C;  1P3K C;  2NZD A;  2RVQ D;  5B1M C;  5F99 D;  5AVB D;  5C3I B;  1P3G B;  4H9Q B;  4QLC D;  1P3M C;  3MGP A;  3X1T C;  4J8X B;  2YFW A;  5AY8 A;  3AZJ C;  5AV5 D;  1EQZ C;  2LY8 A;  4Z5T A;  5AV8 A;  1TZY D;  3UTA C;  3AZL A;  3B0C T;  5DNM C;  1U35 D;  3WKJ A;  3AZM A;  3X1U C;  1F66 D;  5BNX B;  5AVC B;  1P34 B;  1KX5 B;  5B1L C;  4J8W A;  3X1S B;  3TU4 D;  2NZD B;  3X1V C;  1P3F A;  3AZK A;  5B40 C;  5CPK C;  3MGP B;  3WTP D;  4NE3 A;  1ULY A;  2YFW B;  5AY8 B;  1R4V A;  4YM6 A;  1KX3 A;  3AZI D;  4Z5T B;  5AV8 B;  3AZG C;  1ID3 C;  3AZL B;  5B0Y C;  3WKJ B;  3AZM B;  3MGS A;  3UTB D;  5CPI D;  1S32 D;  1P3I C;  3REI C;  4X23 C;  4H9S A;  4J8W B;  3REL A;  3LEL D;  3AV2 A;  3AZH D;  5JRG D;  5B0Z A;  1P3F B;  4WV4 B;  4E44 A;  3C1B C;  3AZK B;  4XZQ D;  2F8N D;  1M1A A;  2PYO A;  3B6F B;  3KWQ D;  2FJ7 C;  3MGQ D;  1P3K B;  3MGR A;  4YM6 B;  4WZS B;  3AFA A;  4ZUX A;  4J8U C;  3REK D;  1P3A C;  1P3L D;  4WU8 C;  3KXB D;  2HIO A;  4UUZ B;  3MGS B;  1KX4 D;  1P3P A;  3AV2 B;  5CPJ A;  5GT0 A;  2ARO A;  3LZ1 C;  4WU9 D;  3WAA D;  1M1A B;  5B2I A;  4Z66 A;  4G92 B;  4LD9 C;  3REH D;  3C1C D;  3W98 C;  5B2J D;  3AFA B;  4ZUX B;  4CSR A;  5B31 A;  3LZ0 A;  5AV9 A;  4XUJ A;  5C3I C;  2HIO B;  1P3G C;  5B1M D;  1M19 A;  3VH6 A;  3AV1 D;  4J8X C;  3AZG B;  1P3P B;  5CPJ B;  5GT0 B;  2ARO B;  3X1T D;  1BH9 A;  1M18 A;  3AN2 A;  3W99 D;  4KUD A;  3O62 D;  2NQB D;  3W97 A;  3AZJ D;  2JSS A;  3UT9 D;  1EQZ D;  5B2I B;  4Z66 B;  3UTA D;  5F99 A;  5AVC C;  1P34 C;  1KX5 C;  3X1U D;  4CSR B;  5BO0 A;  3X1S C;  3LZ0 B;  1JFI B;  1P3O D;  5AV9 B;  4XUJ B;  2NZD C;  5B1L D;  1M19 B;  3AZF D;  3MGP C;  3LJA A;  5B40 D;  1TZY A;  5AY8 C;  3MNN A;  1BH9 B;  1M18 B;  1F66 A;  4Z5T C;  5AV8 C;  3AN2 B;  4KUD B;  3AZL C;  4Z2M G;  5JA4 A;  3W97 B;  3WKJ C;  1AOI D;  3AZM C;  3B6G D;  5F99 B;  5B0Y D;  4J8W C;  5BO0 B;  1P3I D;  3WTP A;  1P3F C;  4X23 D;  5BS7 A;  3AZK C;  4DRA A;  1WWI A;  3LJA B;  3C1B D;  3AZI A;  3AZE D;  1TZY B;  4YM6 C;  3MNN B;  5GXQ A;  1F66 B;  5CPI A;  1S32 A;  5JA4 B;  4J8U D;  1P3A D;  3MGS C;  3LEL A;  3AZH A;  4WU8 D;  4J8V D;  5JRG A;  1WWS A;  5GSU A;  5GT3 A;  5DNN A;  4H9S C;  4XZQ A;  3AV2 C;  2F8N A;  4KGC D;  3MGQ A;  3LZ1 D;  1M1A C;  1P3L A;  3AZI B;  4G91 B;  4G92 C;  5E5A D;  3KXB A;  3V9R A;  3AZN D;  3AFA C;  4ZUX C;  5GXQ B;  4LD9 D;  3WA9 D;  4WNN A;  5CPI B;  3MVD A;  1KX4 A;  2HIO C;  3LEL B;  3WTP E;  3A6N D;  4WU9 A;  3WAA A;  3AYW D;  5GSU B;  5GT3 B;  1P3P C;  5DNN B;  4XZQ B;  4R8P D;  5CPJ C;  1P3G D;  5GT0 C;  2F8N B;  2ARO C;  4JJN A;  3MGQ B;  1KU5 A;  3C1C A;  3W96 A;  4NE5 A;  5B2J A;  4H9P A;  5B2I C;  1Q9C A;  5B24 A;  4Z66 C;  4M6B A;  1P3L B;  4AWL B;  3KXB B;  3VH5 A;  3LZ0 C;  4WNN B;  5AV9 C;  4XUJ C;  3AV1 A;  3MVD B;  1KX4 B;  1P34 D;  1KX5 D;  1M19 C;  1H3O A;  1KX3 B;  3WAA B;  3KUY D;  3W99 A;  1HQ3 D;  3O62 A;  2NQB A;  3MGP D;  5B33 A;  4JJN B;  3UT9 A;  1M18 C;  3AN2 C;  4KUD C;  3W96 B;  3REL B;  3W97 C;  5B2J B;  4H9P B;  3X1U A;  5B0Z B;  5B24 B;  5AV8 D;  2BYK A;  1P3O A;  5F99 C;  5AV6 D;  2PYO B;  3KSY A;  3AZF A;  3AV1 B;  4J8W D;  3MGR B;  5CP6 A;  2YFV A;  2F8N K;  1BFM A;  1H3O B;  3LJA C;  3NQU A;  1TZY C;  3W99 B;  2F8N H;  4H9R A;  3B0B A;  3REJ A;  3O62 B;  2CV5 D;  3B6F D;  3MNN C;  2NQB B;  5B33 B;  3UT9 B;  1P3K D;  1AOI A;  1F66 C;  3B6G A;  4YM6 D;  2BYM A;  1P3M D;  2BYK B;  1P3O B;  5BNV A;  4YS3 A;  2IO5 B;  5B32 A;  3MGS D;  1P3B A;  1ZLA A;  4DRB A;  3AZF B;  3WTP C;  3C1B A;  5BS7 C;  5AVB A;  5DNM D;  5CP6 B;  3AZE A;  3AV2 D;  2YFV B;  4QLC A;  5B31 B;  3NQU B;  5FUG A;  4G91 C;  3AZI C;  4H9R B;  1M1A D;  3REJ B;  5KDM A;  1AOI B;  3X1V D;  5GXQ C;  4J8V A;  5AV5 A;  3B6G B;  5CPI C;  1S32 C;  2BYM B;  5CPK D;  3LEL C;  1U35 A;  5JRG C;  4KGC A;  5BNV B;  1B67 A;  5GT3 C;  5GSU C;  2HIO D;  5DNN C;  4HGA B;  4XZQ C;  5B32 B;  4YS3 B;  1P3B B;  1ZLA B;  1ID3 D;  3AZG D;  3TU4 A;  3MGQ C;  5AVB B;  3AZE B;  5E5A A;  3AZN A;  4QLC B;  1P3L C;  3REI D;  4AWL C;  3WA9 A;  3KXB C;  5KDM B;  4J8V B;  5AV5 B;  3MVD C;  3A6N A;  1KX4 C;  3AYW A;  4R8P A;  3LZ0 D;  1U35 B;  2FJ7 D;  5AV9 D;  1A7W A;  5G49 A;  1KX3 C;  4KGC B;  3UTB A;  3WAA C;  4WU9 C;  4H9O A;  2CWE A;  1TAF A;  1M19 D;  4JJN C;  5CHL B;  3TU4 B;  3NQJ A;  3C1C C;  3W96 C;  5E5A B;  3REL C;  1M18 D;  5B2J C;  5B0Z C;  5B24 C;  3VH6 W;  4EO5 C;  3KWQ A;  3WA9 B;  3WTP B;  2PYO C;  3REK A;  3AV1 C;  3A6N B;  3KUY A;  4Z2M H;  3AYW B;  3MGR C;  4R8P B;  1HQ3 A;  5G49 B;  3UTB B;  3W98 D;  4H9O B;  1S32 B;  3W99 C;  1TAF B;  3O62 C;  2NQB C;  5B33 C;  3LJA D;  3UT9 C;  3AZH B;  5JRG B;  3NQJ B;  5AV6 A;  3MNN D;  4J8X D;  3KWQ B;  1P3O C;  3REH A;  2IO5 C;  2HUE B;  5BT1 C;  3REK B;  3VH5 T;  3AZF C;  3KUY B;  5CP6 C;  3V9R B;  1HQ3 B;  2CV5 A;  3B6F A;  5B31 C;  1P3K A;  5B1M A;  5AVC D;  4CAY A;  3REJ C;  3X1S D;  1P3M A;  1AOI C;  2NZD D;  3B0D B;  3X1T A;  3B6G C;  4WU9 B;  5AV6 B;  4UUZ A;  5GXQ D;  3AZJ A;  1F1E A;  1EQZ A;  3UTA A;  3REH B;  5AY8 D;  3C1C B;  4YS3 C;  5B32 C;  5DNM A;  4HGA C;  1P3B C;  1ZLA C;  2F8N G;  4ZBJ B;  4Z5T D;  4EO5 B;  4E45 A;  5GSU D;  2RVQ C;  5GT3 D;  5DNN D;  3AZL D;  5AVB C;  3AZE C;  3WKJ D;  5B1L A;  3AZM D;  2CV5 B;  4KHA A;  4QLC C;  3X1V A;  5B1M B;  4CAY B;  5B40 A;  1P3M B;  5CPK A;  3X1T B;  1P3F D;  4J8V C;  5AV5 C;  3AZK D;  3VH6 T;  3AZJ B;  1U35 C;  1EQZ B;  4KGC C;  3MVD D;  1ID3 A;  3AZG A;  3UTA B;  5B0Y A;  5DNM B;  1KX3 D;  3X1U B;  3TU4 C;  1P3I A;  3REI A;  4X23 A;  5B1L B;  5E5A C;  4KHA B;  4JJN D;  3AZN C;  3X1V B;  4NE6 A;  3WA9 C;  3W96 D;  5B40 B;  3REL D;  1B6W A;  5B0Z D;  5B24 D;  5CPK B;  2FJ7 A;  1JFI A;  3B0C W;  3A6N C;  3AYW C;  2PYO D;  4R8P C;  4J8U A;  1P3A A;  1ID3 B;  4WU8 A;  3UTB C;  3MGR D;  1BH8 A;  5B0Y B;  3AFA D;  3VH5 W;  4ZUX D;  4NFT A;  3AZH C;  3R45 A;  1P3I B;  3REI B;  4X23 B;  5B33 D;  3LZ1 A;  3KWQ C;  3C1B B;  1P3P D; 
#chains in the Genus database with same CATH topology
 5CPJ D;  5GT0 D;  2ARO D;  2HUE C;  1N1J A;  2FJ7 B;  3REK C;  4LD9 A;  5FUG B;  3KUY C;  3W98 A;  5BT1 D;  1HQ3 C;  5B31 G;  5B2I D;  2BG1 A;  4H9N A;  4Z66 D;  4J8U B;  1P3A B;  2L5A A;  4WU8 B;  5CP6 D;  1BH8 B;  2VQR A;  1P3G A;  4H9Q A;  5B31 D;  1HTA A;  3A1K A;  3B0D C;  4XUJ D;  3R45 B;  4J8X A;  3REJ D;  3EPH A;  5AV6 C;  3LZ1 B;  2Y2N A;  5B32 G;  3REH C;  1N1J B;  3AZN B;  4ZBJ C;  4LD9 B;  1W2E A;  3AN2 D;  4KUD D;  5BNX A;  4YS3 D;  5B32 D;  1P3B D;  5AVC A;  1ZLA D;  3W97 D;  1P34 A;  3W98 B;  1KX5 A;  2CV5 C;  4H9N B;  3X1S A;  3B6F C;  1P3K C;  2NZD A;  2RVQ D;  5B1M C;  5F99 D;  5AVB D;  5C3I B;  1P3G B;  4H9Q B;  4QLC D;  1P3M C;  3MGP A;  3X1T C;  4J8X B;  2YFW A;  2J8P A;  5AY8 A;  3AZJ C;  5AV5 D;  1EQZ C;  2LY8 A;  4Z5T A;  5AV8 A;  1TZY D;  3UTA C;  3AZL A;  3B0C T;  5DNM C;  1U35 D;  3WKJ A;  3AZM A;  3X1U C;  1F66 D;  5BNX B;  5AVC B;  1P34 B;  1KX5 B;  5B1L C;  4J8W A;  4UPK A;  3X1S B;  3TU4 D;  2NZD B;  3X1V C;  1P3F A;  3AZK A;  5B40 C;  5CPK C;  3MGP B;  3WTP D;  4NE3 A;  1ULY A;  2YFW B;  2Y2L A;  5AY8 B;  1R4V A;  3KFU G;  4YM6 A;  2DF4 C;  1KX3 A;  3AZI D;  4Z5T B;  5AV8 B;  3AZG C;  1ID3 C;  3AZL B;  5B0Y C;  3WKJ B;  3AZM B;  3MGS A;  3UTB D;  5CPI D;  1S32 D;  1P3I C;  3REI C;  4X23 C;  4H9S A;  4J8W B;  3REL A;  3LEL D;  3AV2 A;  3AZH D;  5JRG D;  5B0Z A;  1P3F B;  4WV4 B;  4E44 A;  3C1B C;  3AZK B;  4XZQ D;  2F8N D;  1M1A A;  2PYO A;  3B6F B;  3KWQ D;  2FJ7 C;  3MGQ D;  1P3K B;  3MGR A;  2W8S A;  4YM6 B;  4WZS B;  3AFA A;  4ZUX A;  4J8U C;  3REK D;  1P3A C;  1P3L D;  4WU8 C;  3KXB D;  2HIO A;  4UUZ B;  3MGS B;  1KX4 D;  1P3P A;  3AV2 B;  5CPJ A;  5GT0 A;  2ARO A;  3LZ1 C;  4WU9 D;  1Z2C B;  3WAA D;  1M1A B;  5B2I A;  4Z66 A;  4G92 B;  4LD9 C;  3REH D;  3C1C D;  3W98 C;  5B2J D;  3AFA B;  4ZUX B;  4CSR A;  5B31 A;  3LZ0 A;  2Y2G A;  4XUJ A;  5AV9 A;  5C3I C;  2HIO B;  1P3G C;  5B1M D;  1M19 A;  3VH6 A;  3AV1 D;  4J8X C;  3AZG B;  1P3P B;  5CPJ B;  5GT0 B;  2ARO B;  3X1T D;  1BH9 A;  2DQN C;  1M18 A;  3AN2 A;  3W99 D;  4KUD A;  3O62 D;  2NQB D;  3W97 A;  3AZJ D;  2JSS A;  3UT9 D;  1EQZ D;  5B2I B;  4Z66 B;  3UTA D;  5F99 A;  5AVC C;  1P34 C;  1KX5 C;  3X1U D;  4CSR B;  5BO0 A;  3X1S C;  3LZ0 B;  3IP4 C;  1P3O D;  5AV9 B;  4XUJ B;  1JFI B;  2NZD C;  5B1L D;  1M19 B;  3AZF D;  3MGP C;  3LJA A;  5B40 D;  1TZY A;  5AY8 C;  3MNN A;  1BH9 B;  1M18 B;  1F66 A;  5AV8 C;  4Z5T C;  3AN2 B;  4KUD B;  3A1I A;  3AZL C;  4Z2M G;  5JA4 A;  3W97 B;  3WKJ C;  1AOI D;  3AZM C;  3B6G D;  2XD1 A;  5F99 B;  5B0Y D;  2ZY3 A;  4DQY B;  4J8W C;  5BO0 B;  1P3I D;  3EPK A;  2JE5 A;  3WTP A;  1P3F C;  4X23 D;  5BS7 A;  3AZK C;  4DRA A;  1WWI A;  3LJA B;  3C1B D;  3AZI A;  3AZE D;  1TZY B;  4YM6 C;  3MNN B;  5GXQ A;  1F66 B;  5CPI A;  1S32 A;  5JA4 B;  4J8U D;  3H0R C;  1P3A D;  3EPL A;  3MGS C;  3LEL A;  3AZH A;  4WU8 D;  4J8V D;  5JRG A;  3EG5 B;  1WWS A;  5GSU A;  5GT3 A;  5DNN A;  4H9S C;  4XZQ A;  3AV2 C;  2F8N A;  4KGC D;  3MGQ A;  3LZ1 D;  1M1A C;  1P3L A;  3AZI B;  4G91 B;  4G92 C;  5E5A D;  3KXB A;  1PZR A;  3V9R A;  3AZN D;  3AFA C;  4ZUX C;  5GXQ B;  4LD9 D;  3WA9 D;  4WNN A;  5CPI B;  3MVD A;  1KX4 A;  2HIO C;  3LEL B;  3WTP E;  3A6N D;  4WU9 A;  3H0L C;  3WAA A;  3AYW D;  5GSU B;  5GT3 B;  1P3P C;  5DNN B;  4XZQ B;  4R8P D;  2Y2K A;  5CPJ C;  5GT0 C;  1P3G D;  2ARO C;  2F8N B;  4JJN A;  3MGQ B;  1KU5 A;  3C1C A;  3W96 A;  4NE5 A;  5B2J A;  4H9P A;  5B2I C;  1Q9C A;  4M6B A;  5B24 A;  4Z66 C;  1P3L B;  4AWL B;  3KXB B;  3VH5 A;  3LZ0 C;  4WNN B;  5AV9 C;  4XUJ C;  3AV1 A;  3MVD B;  1KX4 B;  1P34 D;  1KX5 D;  1M19 C;  1H3O A;  1KX3 B;  3WAA B;  3KUY D;  3W99 A;  1HQ3 D;  3O62 A;  2NQB A;  3MGP D;  2Y2M A;  5B33 A;  4JJN B;  3UT9 A;  1M18 C;  3AN2 C;  4KUD C;  2F2A C;  3W96 B;  3REL B;  3W97 C;  5B2J B;  4H9P B;  3X1U A;  5B0Z B;  5B24 B;  5AV8 D;  2BYK A;  1P3O A;  5F99 C;  5AV6 D;  2PYO B;  3KSY A;  3AZF A;  3AV1 B;  3P5J B;  4J8W D;  3MGR B;  5CP6 A;  2YFV A;  2Y2J A;  2F8N K;  1BFM A;  1H3O B;  3LJA C;  3NQU A;  1TZY C;  3W99 B;  2F8N H;  4H9R A;  3B0B A;  3REJ A;  3O62 B;  2CV5 D;  3B6F D;  3MNN C;  2NQB B;  5B33 B;  3UT9 B;  1P3K D;  1AOI A;  1F66 C;  3B6G A;  4YM6 D;  2BYM A;  1P3M D;  2FFF B;  2BYK B;  1P3O B;  5BNV A;  4YS3 A;  2IO5 B;  5B32 A;  3MGS D;  1P3B A;  1ZLA A;  4DRB A;  3AZF B;  3WTP C;  3C1B A;  5BS7 C;  5AVB A;  5DNM D;  5CP6 B;  3AZE A;  3AV2 D;  2YFV B;  4QLC A;  5B31 B;  2ZM5 A;  3NQU B;  5FUG A;  4G91 C;  3AZI C;  4H9R B;  1M1A D;  3REJ B;  5KDM A;  1AOI B;  3X1V D;  5GXQ C;  4J8V A;  5AV5 A;  3B6G B;  5CPI C;  1S32 C;  2BYM B;  3FDD A;  5CPK D;  3LEL C;  1U35 A;  5JRG C;  4KGC A;  5BNV B;  1B67 A;  5GT3 C;  5GSU C;  5B32 B;  2HIO D;  5DNN C;  4HGA B;  4XZQ C;  2G5H C;  4YS3 B;  2Y2O A;  1P3B B;  1ZLA B;  1ID3 D;  3AZG D;  2G5I C;  3TU4 A;  3MGQ C;  5AVB B;  2ZY4 A;  3AZE B;  5E5A A;  3AZN A;  4QLC B;  1P3L C;  3REI D;  4AWL C;  3WA9 A;  3KXB C;  5KDM B;  4J8V B;  5AV5 B;  3MVD C;  3A6N A;  1KX4 C;  2UWX A;  3AYW A;  4R8P A;  3LZ0 D;  1U35 B;  2FJ7 D;  5AV9 D;  1A7W A;  5G49 A;  1KX3 C;  4KGC B;  3UTB A;  3WAA C;  4WU9 C;  3F6T A;  4H9O A;  2CWE A;  1TAF A;  1M19 D;  4JJN C;  5CHL B;  3TU4 B;  3NQJ A;  3C1C C;  3W96 C;  5E5A B;  3REL C;  1M18 D;  5B2J C;  3VH6 W;  5B24 C;  5B0Z C;  4EO5 C;  3KWQ A;  3WA9 B;  3WTP B;  3EPJ A;  2ZY2 A;  2PYO C;  3REK A;  3AV1 C;  3A6N B;  3KUY A;  4Z2M H;  3AYW B;  3MGR C;  4R8P B;  1HQ3 A;  5G49 B;  3UTB B;  2RIQ A;  3W98 D;  4H9O B;  1S32 B;  3W99 C;  1TAF B;  3O62 C;  2NQB C;  5B33 C;  3LJA D;  3UT9 C;  3AZH B;  5JRG B;  3NQJ B;  5AV6 A;  3MNN D;  4J8X D;  3KWQ B;  1P3O C;  3REH A;  2XD5 A;  2IO5 C;  2HUE B;  5BT1 C;  2Y2P A;  3REK B;  3VH5 T;  3AZF C;  3KUY B;  5CP6 C;  3V9R B;  1HQ3 B;  2CV5 A;  3B6F A;  5B31 C;  1P3K A;  5B1M A;  5AVC D;  4CAY A;  3REJ C;  3X1S D;  1P3M A;  1AOI C;  2NZD D;  3B0D B;  3X1T A;  3B6G C;  2JCH A;  4WU9 B;  4WJ3 C;  5AV6 B;  4UUZ A;  5GXQ D;  3AZJ A;  1F1E A;  1EQZ A;  3UTA A;  3REH B;  5AY8 D;  3C1C B;  4YS3 C;  5B32 C;  5DNM A;  4HGA C;  1P3B C;  1ZLA C;  2F8N G;  4ZBJ B;  4Z5T D;  4EO5 B;  4E45 A;  5GSU D;  2RVQ C;  5GT3 D;  5DNN D;  3AZL D;  5AVB C;  3AZE C;  3WKJ D;  2Y2Q A;  5B1L A;  3AZM D;  2CV5 B;  4KHA A;  4QLC C;  3X1V A;  5B1M B;  4CAY B;  5B40 A;  1P3M B;  5CPK A;  3X1T B;  1P3F D;  4J8V C;  5AV5 C;  3AZK D;  3VH6 T;  3AZJ B;  1U35 C;  1EQZ B;  4KGC C;  3MVD D;  1ID3 A;  3AZG A;  3UTA B;  5B0Y A;  5DNM B;  1KX3 D;  3X1U B;  3TU4 C;  1P3I A;  3REI A;  2Y2I A;  4X23 A;  5B1L B;  5E5A C;  4KHA B;  4JJN D;  3AZN C;  3X1V B;  2Y2H A;  4NE6 A;  3WA9 C;  3W96 D;  5B40 B;  3REL D;  1B6W A;  5B0Z D;  5B24 D;  3AL0 C;  5CPK B;  2FJ7 A;  1JFI A;  3B0C W;  3A6N C;  3AYW C;  2PYO D;  4R8P C;  4J8U A;  1P3A A;  1ID3 B;  4WU8 A;  3UTB C;  3MGR D;  3H0M C;  1BH8 A;  5B0Y B;  1T3U A;  3VH5 W;  4ZUX D;  3AFA D;  4NFT A;  2ZY5 A;  3AZH C;  3R45 A;  1P3I B;  3REI B;  4X23 B;  5B33 D;  3LZ1 A;  3KWQ C;  3C1B B;  1P3P D; 
#chains in the Genus database with same CATH homology
 5CPJ D;  5GT0 D;  2ARO D;  2HUE C;  1N1J A;  2FJ7 B;  3REK C;  4LD9 A;  5FUG B;  3KUY C;  3W98 A;  5BT1 D;  1HQ3 C;  5B31 G;  5B2I D;  2BG1 A;  4H9N A;  4Z66 D;  4J8U B;  1P3A B;  2L5A A;  4WU8 B;  5CP6 D;  1BH8 B;  2VQR A;  1P3G A;  4H9Q A;  5B31 D;  1HTA A;  3A1K A;  3B0D C;  4XUJ D;  3R45 B;  4J8X A;  3REJ D;  3EPH A;  5AV6 C;  3LZ1 B;  2Y2N A;  5B32 G;  3REH C;  1N1J B;  3AZN B;  4ZBJ C;  4LD9 B;  1W2E A;  3AN2 D;  4KUD D;  5BNX A;  4YS3 D;  5B32 D;  1P3B D;  5AVC A;  1ZLA D;  3W97 D;  1P34 A;  3W98 B;  1KX5 A;  2CV5 C;  4H9N B;  3X1S A;  3B6F C;  1P3K C;  2NZD A;  2RVQ D;  5B1M C;  5F99 D;  5AVB D;  5C3I B;  1P3G B;  4H9Q B;  4QLC D;  1P3M C;  3MGP A;  3X1T C;  4J8X B;  2YFW A;  2J8P A;  5AY8 A;  3AZJ C;  5AV5 D;  1EQZ C;  2LY8 A;  4Z5T A;  5AV8 A;  1TZY D;  3UTA C;  3AZL A;  3B0C T;  5DNM C;  1U35 D;  3WKJ A;  3AZM A;  3X1U C;  1F66 D;  5BNX B;  5AVC B;  1P34 B;  1KX5 B;  5B1L C;  4J8W A;  4UPK A;  3X1S B;  3TU4 D;  2NZD B;  3X1V C;  1P3F A;  3AZK A;  5B40 C;  5CPK C;  3MGP B;  3WTP D;  4NE3 A;  1ULY A;  2YFW B;  2Y2L A;  5AY8 B;  1R4V A;  3KFU G;  4YM6 A;  2DF4 C;  1KX3 A;  3AZI D;  4Z5T B;  5AV8 B;  3AZG C;  1ID3 C;  3AZL B;  5B0Y C;  3WKJ B;  3AZM B;  3MGS A;  3UTB D;  5CPI D;  1S32 D;  1P3I C;  3REI C;  4X23 C;  4H9S A;  4J8W B;  3REL A;  3LEL D;  3AV2 A;  3AZH D;  5JRG D;  5B0Z A;  1P3F B;  4WV4 B;  4E44 A;  3C1B C;  3AZK B;  4XZQ D;  2F8N D;  1M1A A;  2PYO A;  3B6F B;  3KWQ D;  2FJ7 C;  3MGQ D;  1P3K B;  3MGR A;  2W8S A;  4YM6 B;  4WZS B;  3AFA A;  4ZUX A;  4J8U C;  3REK D;  1P3A C;  1P3L D;  4WU8 C;  3KXB D;  2HIO A;  4UUZ B;  3MGS B;  1KX4 D;  1P3P A;  3AV2 B;  5CPJ A;  5GT0 A;  2ARO A;  3LZ1 C;  4WU9 D;  1Z2C B;  3WAA D;  1M1A B;  5B2I A;  4Z66 A;  4G92 B;  4LD9 C;  3REH D;  3C1C D;  3W98 C;  5B2J D;  3AFA B;  4ZUX B;  4CSR A;  5B31 A;  3LZ0 A;  2Y2G A;  4XUJ A;  5AV9 A;  5C3I C;  2HIO B;  1P3G C;  5B1M D;  1M19 A;  3VH6 A;  3AV1 D;  4J8X C;  3AZG B;  1P3P B;  5CPJ B;  5GT0 B;  2ARO B;  3X1T D;  1BH9 A;  2DQN C;  1M18 A;  3AN2 A;  3W99 D;  4KUD A;  3O62 D;  2NQB D;  3W97 A;  3AZJ D;  2JSS A;  3UT9 D;  1EQZ D;  5B2I B;  4Z66 B;  3UTA D;  5F99 A;  5AVC C;  1P34 C;  1KX5 C;  3X1U D;  4CSR B;  5BO0 A;  3X1S C;  3LZ0 B;  3IP4 C;  1P3O D;  5AV9 B;  4XUJ B;  1JFI B;  2NZD C;  5B1L D;  1M19 B;  3AZF D;  3MGP C;  3LJA A;  5B40 D;  1TZY A;  5AY8 C;  3MNN A;  1BH9 B;  1M18 B;  1F66 A;  5AV8 C;  4Z5T C;  3AN2 B;  4KUD B;  3A1I A;  3AZL C;  4Z2M G;  5JA4 A;  3W97 B;  3WKJ C;  1AOI D;  3AZM C;  3B6G D;  2XD1 A;  5F99 B;  5B0Y D;  2ZY3 A;  4DQY B;  4J8W C;  5BO0 B;  1P3I D;  3EPK A;  2JE5 A;  3WTP A;  1P3F C;  4X23 D;  5BS7 A;  3AZK C;  4DRA A;  1WWI A;  3LJA B;  3C1B D;  3AZI A;  3AZE D;  1TZY B;  4YM6 C;  3MNN B;  5GXQ A;  1F66 B;  5CPI A;  1S32 A;  5JA4 B;  4J8U D;  3H0R C;  1P3A D;  3EPL A;  3MGS C;  3LEL A;  3AZH A;  4WU8 D;  4J8V D;  5JRG A;  3EG5 B;  1WWS A;  5GSU A;  5GT3 A;  5DNN A;  4H9S C;  4XZQ A;  3AV2 C;  2F8N A;  4KGC D;  3MGQ A;  3LZ1 D;  1M1A C;  1P3L A;  3AZI B;  4G91 B;  4G92 C;  5E5A D;  3KXB A;  1PZR A;  3V9R A;  3AZN D;  3AFA C;  4ZUX C;  5GXQ B;  4LD9 D;  3WA9 D;  4WNN A;  5CPI B;  3MVD A;  1KX4 A;  2HIO C;  3LEL B;  3WTP E;  3A6N D;  4WU9 A;  3H0L C;  3WAA A;  3AYW D;  5GSU B;  5GT3 B;  1P3P C;  5DNN B;  4XZQ B;  4R8P D;  2Y2K A;  5CPJ C;  5GT0 C;  1P3G D;  2ARO C;  2F8N B;  4JJN A;  3MGQ B;  1KU5 A;  3C1C A;  3W96 A;  4NE5 A;  5B2J A;  4H9P A;  5B2I C;  1Q9C A;  4M6B A;  5B24 A;  4Z66 C;  1P3L B;  4AWL B;  3KXB B;  3VH5 A;  3LZ0 C;  4WNN B;  5AV9 C;  4XUJ C;  3AV1 A;  3MVD B;  1KX4 B;  1P34 D;  1KX5 D;  1M19 C;  1H3O A;  1KX3 B;  3WAA B;  3KUY D;  3W99 A;  1HQ3 D;  3O62 A;  2NQB A;  3MGP D;  2Y2M A;  5B33 A;  4JJN B;  3UT9 A;  1M18 C;  3AN2 C;  4KUD C;  2F2A C;  3W96 B;  3REL B;  3W97 C;  5B2J B;  4H9P B;  3X1U A;  5B0Z B;  5B24 B;  5AV8 D;  2BYK A;  1P3O A;  5F99 C;  5AV6 D;  2PYO B;  3KSY A;  3AZF A;  3AV1 B;  3P5J B;  4J8W D;  3MGR B;  5CP6 A;  2YFV A;  2Y2J A;  2F8N K;  1BFM A;  1H3O B;  3LJA C;  3NQU A;  1TZY C;  3W99 B;  2F8N H;  4H9R A;  3B0B A;  3REJ A;  3O62 B;  2CV5 D;  3B6F D;  3MNN C;  2NQB B;  5B33 B;  3UT9 B;  1P3K D;  1AOI A;  1F66 C;  3B6G A;  4YM6 D;  2BYM A;  1P3M D;  2FFF B;  2BYK B;  1P3O B;  5BNV A;  4YS3 A;  2IO5 B;  5B32 A;  3MGS D;  1P3B A;  1ZLA A;  4DRB A;  3AZF B;  3WTP C;  3C1B A;  5BS7 C;  5AVB A;  5DNM D;  5CP6 B;  3AZE A;  3AV2 D;  2YFV B;  4QLC A;  5B31 B;  2ZM5 A;  3NQU B;  5FUG A;  4G91 C;  3AZI C;  4H9R B;  1M1A D;  3REJ B;  5KDM A;  1AOI B;  3X1V D;  5GXQ C;  4J8V A;  5AV5 A;  3B6G B;  5CPI C;  1S32 C;  2BYM B;  3FDD A;  5CPK D;  3LEL C;  1U35 A;  5JRG C;  4KGC A;  5BNV B;  1B67 A;  5GT3 C;  5GSU C;  5B32 B;  2HIO D;  5DNN C;  4HGA B;  4XZQ C;  2G5H C;  4YS3 B;  2Y2O A;  1P3B B;  1ZLA B;  1ID3 D;  3AZG D;  2G5I C;  3TU4 A;  3MGQ C;  5AVB B;  2ZY4 A;  3AZE B;  5E5A A;  3AZN A;  4QLC B;  1P3L C;  3REI D;  4AWL C;  3WA9 A;  3KXB C;  5KDM B;  4J8V B;  5AV5 B;  3MVD C;  3A6N A;  1KX4 C;  2UWX A;  3AYW A;  4R8P A;  3LZ0 D;  1U35 B;  2FJ7 D;  5AV9 D;  1A7W A;  5G49 A;  1KX3 C;  4KGC B;  3UTB A;  3WAA C;  4WU9 C;  3F6T A;  4H9O A;  2CWE A;  1TAF A;  1M19 D;  4JJN C;  5CHL B;  3TU4 B;  3NQJ A;  3C1C C;  3W96 C;  5E5A B;  3REL C;  1M18 D;  5B2J C;  3VH6 W;  5B24 C;  5B0Z C;  4EO5 C;  3KWQ A;  3WA9 B;  3WTP B;  3EPJ A;  2ZY2 A;  2PYO C;  3REK A;  3AV1 C;  3A6N B;  3KUY A;  4Z2M H;  3AYW B;  3MGR C;  4R8P B;  1HQ3 A;  5G49 B;  3UTB B;  2RIQ A;  3W98 D;  4H9O B;  1S32 B;  3W99 C;  1TAF B;  3O62 C;  2NQB C;  5B33 C;  3LJA D;  3UT9 C;  3AZH B;  5JRG B;  3NQJ B;  5AV6 A;  3MNN D;  4J8X D;  3KWQ B;  1P3O C;  3REH A;  2XD5 A;  2IO5 C;  2HUE B;  5BT1 C;  2Y2P A;  3REK B;  3VH5 T;  3AZF C;  3KUY B;  5CP6 C;  3V9R B;  1HQ3 B;  2CV5 A;  3B6F A;  5B31 C;  1P3K A;  5B1M A;  5AVC D;  4CAY A;  3REJ C;  3X1S D;  1P3M A;  1AOI C;  2NZD D;  3B0D B;  3X1T A;  3B6G C;  2JCH A;  4WU9 B;  4WJ3 C;  5AV6 B;  4UUZ A;  5GXQ D;  3AZJ A;  1F1E A;  1EQZ A;  3UTA A;  3REH B;  5AY8 D;  3C1C B;  4YS3 C;  5B32 C;  5DNM A;  4HGA C;  1P3B C;  1ZLA C;  2F8N G;  4ZBJ B;  4Z5T D;  4EO5 B;  4E45 A;  5GSU D;  2RVQ C;  5GT3 D;  5DNN D;  3AZL D;  5AVB C;  3AZE C;  3WKJ D;  2Y2Q A;  5B1L A;  3AZM D;  2CV5 B;  4KHA A;  4QLC C;  3X1V A;  5B1M B;  4CAY B;  5B40 A;  1P3M B;  5CPK A;  3X1T B;  1P3F D;  4J8V C;  5AV5 C;  3AZK D;  3VH6 T;  3AZJ B;  1U35 C;  1EQZ B;  4KGC C;  3MVD D;  1ID3 A;  3AZG A;  3UTA B;  5B0Y A;  5DNM B;  1KX3 D;  3X1U B;  3TU4 C;  1P3I A;  3REI A;  2Y2I A;  4X23 A;  5B1L B;  5E5A C;  4KHA B;  4JJN D;  3AZN C;  3X1V B;  2Y2H A;  4NE6 A;  3WA9 C;  3W96 D;  5B40 B;  3REL D;  1B6W A;  5B0Z D;  5B24 D;  3AL0 C;  5CPK B;  2FJ7 A;  1JFI A;  3B0C W;  3A6N C;  3AYW C;  2PYO D;  4R8P C;  4J8U A;  1P3A A;  1ID3 B;  4WU8 A;  3UTB C;  3MGR D;  3H0M C;  1BH8 A;  5B0Y B;  1T3U A;  3VH5 W;  4ZUX D;  3AFA D;  4NFT A;  2ZY5 A;  3AZH C;  3R45 A;  1P3I B;  3REI B;  4X23 B;  5B33 D;  3LZ1 A;  3KWQ C;  3C1B B;  1P3P D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...