4X23A

Crystal structure of cenp-c in complex with the nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
95
structure length
95
Chain Sequence
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (147-MER)
publication title A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 95
sequence length 95
chains with identical sequence E, K, O
ec nomenclature
pdb deposition date 2014-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4x23A00
4WU8D 5AV5D 3W99B 5CP6C 3REKD 3AZNC 5E5AB 2NQBD 3UTAB 3LZ0D 4WZSB 3AV1B 3B6GC 5G49B 1P3GC 3NQUA 4AWLC 2HUEC 3AZKC 1S32A 3LZ1C 4XZQA 3X1VC 3A6ND 3VH5T 3AZLB 1TZYD 4E45A 4H9OA 4JJNB 5AV9B 4H9NA 2YFWA 2FJ7C 3O62C 4J8XD 3WTPE 5AV6B 2NZDB 4H9QB 5GT3D 5B1LB 4EO5B 5C3IC 3LELC 3UTBB 1P3AC 3B0CT 4WU9B 1ZLAC 1P3KA 3REJD 1P3OA 5AVCA 3WKJC 5AVBD 3AZMC 1KX5C 5B2JC 5GSUD 1KX3A 3W96D 3X1SD 5B0YA 1P3PC 3W98D 4CSRA 3X1UB 1S32B 5B24A 2NQBA 1HTAA 5CPJD 3LZ0A 5AY8C 5F99D 1EQZA 4KHAA 4H9OB 5BT1C 3KUYC 3MGQB 3AZGD 3REHC 3TU4D 1KU5A 5AV8D 3LJAC 4J8WA 4NFTA 3B0DC 4X23D 1P3LD 1TZYA 4QLCD 1P3KB 3KXBD 5B31G 1M1AA 4ZUXC 5AVCB 4G92C 2BYMA 5FUGA 1P34D 3AV2D 4KUDC 3MNNA 4J8VC 2PYOC 1KX3B 3VH5W 3AZJC 3W97B 3RELA 3A6NC 3W99D 4CSRB 5B1MA 5BO0A 5E5AD 5B24B 2NQBB 3UTAD 3MGPC 5GSUA 1EQZB 3AV1D 4KHAB 4G91C 4J8XC 3W96A 3AN2A 3B0CW 3NQJA 5B0ZA 3WTPC 5B2IB 1F66A 1U35A 4NE5A 4J8WB 3AFAA 5CPJA 5BNXA 3AZLD 5F99A 5B31B 3AZHA 5BNVA 4NE6A 4JJND 5AVBC 5AV9D 1M1AB 2HIOD 2BYMB 5FUGB 2BYKA 3VH5A 3MNNB 5AV6D 4Z66C 2NZDD 1R4VA 3C1CB 3RELB 4X23A 3UTBD 3UT9B 4J8UD 4WU9D 5CHLB 5B1MB 3AZFC 4LD9C 3KWQC 3AV2A 4CAYA 5B40C 3W96B 1TAFA 3AN2B 3R45A 4YS3B 1P3MC 3NQJB 5B0ZB 5JRGA 3X1UD 1F66B 1U35B 2AROC 3MVDC 3AFAB 3UTAA 2F8NA 5BNXB 2F8NG 3AZIC 5F99B 3AZHB 5BNVB 1P34C 3KSYA 3MGQD 4YM6C 1P3IA 2BYKB 1ID3A 5CPKA 5DNNC 3VH6W 4X23B 2RVQD 1P3KD 2HIOA 5AVCD 2CV5C 3B6FC 4CAYB 2CWEA 4NE3A 1KX3D 3W97D 5GT0C 4J8UA 4WU9A 1KX4C 5JRGB 5B32D 5B24D 1ULYA 3X1TC 2F8NB 3WA9B 4XUJA 5B33C 1HQ3C 1EQZD 3AZNA 1M18B 1P3IB 1ID3B 1WWIA 1P3FA 2NZDC 4H9SC 3X1UA 5B1LC 3VH6A 5B2ID 3REIC 5CPKB 3MGSB 4J8WD 4R8PB 1P3GA 1M19C 3WAAD 5B31D 2HIOB 3AZKA 1M1AD 3LZ1A 3MGQA 3X1VA 2F8NK 5CPIA 3AYWB 3MNND 1BFMA 4UUZB 3C1CD 3RELD 2FJ7A 4J8UB 3UT9D 3V9RB 1S32C 4XZQC 1WWSA 5B1MD 4XUJB 3AZED 1P3AA 3LELA 1P3BA 1AOIC 3W97A 3AZNB 3AN2D 4YS3D 3AZMA 1P3FB 5B0ZD 4KGCD 5DNMC 5B2JA 1B67A 1F66D 5B32A 1U35D 3B6GB 4WV4B 5B32G 4DRBA 3AFAD 4AWLB 1P3GB 2HUEB 1P3PA 3AZHD 1P3OC 3AZKB 1BH8A 4ZBJC 3LZ1B 3X1VB 5CPIB 5AY8A 5B2IA 5B0YC 4WU8C 2FJ7B 3WAAA 5AV5C 3REKC 5B31A 4Z2MG 5B24C 1JFIA 2NQBC 3LZ0C 5C3IB 1P3AB 3LELB 5JA4A 1P3BB 3C1CA 4ZUXA 3UT9A 1KX5B 3AZMB 4Z5TD 5B2JB 4J8WC 5JRGD 4KUDA 5B32B 1TZYC 3WA9D 3AZEA 2F8ND 2L5AA 1P3PB 1M1AC 1BH8B 4E44A 1M18D 4YS3A 1P3ID 1BH9A 1ID3D 4KGCA 5GT3C 5AY8B 3MGPA 5CPKD 3MGSD 4R8PD 3KUYB 3WAAB 4H9RB 3REJC 3MGRA 1JFIB 1H3OA 1N1JA 5GSUC 3B0DB 3W96C 5JA4B 3AYWD 3X1SC 3W98C 4ZUXB 4M6BA 4G92B 3C1BA 5CPJC 4J8VB 4KUDB 4Z66A 5F99C 3AZEB 3AZJB 4XUJD 3AZGC 5CP6D 3AZFA 4LD9A 1F1EA 3AZND 3TU4C 1BH9B 4Z5TA 4KGCB 1P3FD 5AV8C 3MGPB 1Q9CA 4X23C 1P3LC 4G91B 3B6GD 3WA9A 4QLCC 1P3GD 3KXBC 2IO5B 3MGRB 3WTPB 1H3OB 1N1JB 3AZKD 2LY8A 2AROA 3LZ1D 3AV2C 1M18A 3X1VD 3B0BA 3AZIA 5CPID 3MGSA 4R8PA 2FJ7D 3W99C 4YM6A 3C1BB 5E5AC 3UTAC 4Z66B 3AV1C 1P3AD 3LELD 3AYWA 1P3BD 5GXQA 1P3IC 4UUZA 3AZFB 4LD9B 3KWQB 1KX5D 4Z5TB 3V9RA 3AZMD 2CV5A 5B2JD 5B40B 3AZLC 5BS7A 4JJNC 5GT0A 5AV9C 1P3MB 1P3PD 2HIOC 1KX4A 4H9PA 5CP6A 2AROB 3X1TA 5B33A 5AV6C 3AZIB 5AY8D 4EO5C 3UTBC 3B6GA 4J8UC 4WU9C 5BT1D 3KUYD 4YM6B 3REHD 4H9SA 5DNNB 1M19A 5GXQB 1P3FC 4ZUXD 3O62A 4HGAB 3X1UC 2CV5B 3B6FB 4KUDD 4J8VD 2PYOD 3AZJD 5GT0B 1ZLAA 1KX4B 3MGQC 4H9PB 5CP6B 4DRAA 3X1TB 3WKJA 5CPIC 1KX5A 2JSSA 1HQ3B 5B33B 3MGPD 2RVQC 1AOIA 1P3KC 2F8NH 5KDMA 5AVCC 3MGRD 5DNMA 3WTPD 3REIB 1P3BC 1M19B 1KX3C 3W97C 3KUYA 3O62B 3C1BD 4H9RA 5B32C 3REHA 3NQUB 4Z66D 3LJAA 1EQZC 4WU8A 5AV5A 1ZLAB 3REKA 4XZQB 3AZFD 4LD9D 3WKJB 3KWQD 5B2IC 2YFVA 4J8VA 4H9NB 2YFWB 3WAAC 2PYOA 5B40D 1AOIB 3AZJA 5B31C 1A7WA 1P3MD 5KDMB 3A6NA 5DNMB 2AROD 3MVDD 3MNNC 3AZID 3C1CC 4WNNA 3RELC 1P3OB 3UT9C 4J8XA 4ZBJB 4YM6D 5B1MC 3REHB 5GT3A 3WTPA 3AZEC 5B0YB 3LJAB 5DNND 4WU8B 5AV5B 3REJA 3REKB 3AN2C 5GXQD 5AVBA 4YS3C 5B0ZC 4KGCC 3VH6T 3LZ0B 2YFVB 2CV5D 1U35C 1F66C 3B6FD 3AFAC 3X1SA 2PYOB 3W98A 3AZHC 2IO5C 3MGRC 5GT0D 1KX4D 3A6NB 1TZYB 3X1TD 3KWQA 5B33D 1HQ3D 4WNNB 5B40A 3AZGA 4J8XB 1B6WA 3C1BC 3TU4A 1P3MA 5AV8A 5GT3B 5B1LD 1P3LA 3MVDA 3REID 4QLCA 1M19D 3KXBA 3REJB 5BO0B 5AVBB 4Z5TC 1P34A 3O62D 5GSUB 5JRGC 4Z2MH 3WA9C 3X1SB 3W98B 5DNNA 3W99A 1ZLAD 1S32D 5E5AA 1M18C 4XZQD 5CPJB 1ID3C 3WKJD 3AV1A 3B6FA 5CPKC 3MGSC 5G49A 4R8PC 3AZGB 1AOID 3TU4B 5AV8B 5DNMD 1P3LB 3MVDB 3AZLA 4QLCB 3AYWC 1HQ3A 3KXBB 4JJNA 5GXQC 5AV9A 1P3OD 4HGAC 1P34B 3AV2B 5AV6A 2NZDA 4H9QA 5BS7C 1TAFB 5B1LA 4XUJC 3UTBA 3REIA 5B0YD 3LJAD 3R45B
chains in the Genus database with same CATH superfamily
4WU8D 5AV5D 3W99B 5CP6C 3REKD 3AZNC 5E5AB 2NQBD 3UTAB 3LZ0D 4WZSB 3AV1B 3B6GC 5G49B 1P3GC 3NQUA 4AWLC 2HUEC 3AZKC 1S32A 3LZ1C 4XZQA 3X1VC 3A6ND 3VH5T 3AZLB 1TZYD 4E45A 4H9OA 4JJNB 5AV9B 2Y2GA 2YFWA 4H9NA 2FJ7C 3O62C 4J8XD 3WTPE 5AV6B 2NZDB 4H9QB 5GT3D 5B1LB 4EO5B 5C3IC 3LELC 3UTBB 1P3AC 3B0CT 4WU9B 1ZLAC 1P3KA 3REJD 1P3OA 5AVCA 3WKJC 5AVBD 3AZMC 1KX5C 5B2JC 5GSUD 2Y2QA 1KX3A 3W96D 3X1SD 2VQRA 5B0YA 1P3PC 2JE5A 3W98D 4CSRA 3X1UB 1S32B 5B24A 2NQBA 1HTAA 5CPJD 3LZ0A 5AY8C 5F99D 1EQZA 4KHAA 4H9OB 5BT1C 3KUYC 3MGQB 3AZGD 3REHC 3TU4D 1KU5A 5AV8D 3LJAC 4J8WA 4NFTA 3B0DC 4X23D 1P3LD 1TZYA 4QLCD 3AL0C 1P3KB 3KXBD 5B31G 1M1AA 4ZUXC 5AVCB 4G92C 2BYMA 5FUGA 1P34D 3AV2D 4KUDC 3MNNA 4UPKA 4J8VC 2PYOC 1KX3B 3VH5W 3AZJC 2ZY3A 3RELA 3W97B 3A6NC 3W99D 4CSRB 5B1MA 5BO0A 2FFFB 5E5AD 5B24B 2NQBB 3UTAD 3MGPC 5GSUA 1EQZB 2XD5A 2ZY5A 4KHAB 3AV1D 4G91C 4J8XC 3W96A 3AN2A 3B0CW 3NQJA 5B0ZA 3WTPC 5B2IB 1F66A 1U35A 4NE5A 4J8WB 3AFAA 5CPJA 5BNXA 3AZLD 2BG1A 5F99A 5B31B 3AZHA 2G5HC 5BNVA 4NE6A 4JJND 5AVBC 5AV9D 4WJ3C 1M1AB 2HIOD 2BYMB 2G5IC 2BYKA 5FUGB 3VH5A 3MNNB 5AV6D 2Y2KA 4Z66C 2NZDD 1R4VA 3C1CB 3RELB 4X23A 3UTBD 3UT9B 4J8UD 4WU9D 5CHLB 5B1MB 3AZFC 4LD9C 4DQYB 3KWQC 3A1KA 4CAYA 3AV2A 5B40C 3W96B 1TAFA 3AN2B 3R45A 4YS3B 1P3MC 3NQJB 5B0ZB 5JRGA 3X1UD 1F66B 1U35B 2AROC 3MVDC 3AFAB 3UTAA 2F8NA 5BNXB 2F8NG 3AZIC 3F6TA 5F99B 3AZHB 5BNVB 1P34C 3KSYA 3MGQD 4YM6C 1P3IA 2BYKB 1ID3A 5CPKA 5DNNC 3VH6W 4X23B 2RVQD 3H0MC 1P3KD 2HIOA 5AVCD 2JCHA 2CV5C 3B6FC 4CAYB 2CWEA 4NE3A 1KX3D 3W97D 5GT0C 4J8UA 4WU9A 1KX4C 5JRGB 5B32D 5B24D 1ULYA 3X1TC 2F8NB 3WA9B 4XUJA 5B33C 1HQ3C 1EQZD 3AZNA 1M18B 1P3IB 1ID3B 1WWIA 1P3FA 2NZDC 4H9SC 3X1UA 5B1LC 3VH6A 5B2ID 3REIC 5CPKB 3MGSB 4J8WD 4R8PB 1P3GA 1M19C 3WAAD 5B31D 2HIOB 3AZKA 1M1AD 3LZ1A 3MGQA 3X1VA 2F8NK 1PZRA 5CPIA 3AYWB 3MNND 1BFMA 4UUZB 3C1CD 3RELD 2FJ7A 4J8UB 3UT9D 3V9RB 1S32C 4XZQC 1WWSA 5B1MD 2UWXA 4XUJB 3AZED 1P3AA 3LELA 1P3BA 1AOIC 3W97A 3AZNB 3AN2D 4YS3D 3AZMA 1P3FB 5B0ZD 4KGCD 5DNMC 5B2JA 1B67A 1F66D 5B32A 1U35D 3FDDA 3B6GB 4WV4B 5B32G 4DRBA 3AFAD 4AWLB 1P3GB 2HUEB 1P3PA 3AZHD 1P3OC 3AZKB 1BH8A 2Y2HA 4ZBJC 3LZ1B 3X1VB 1W2EA 5CPIB 5AY8A 5B2IA 5B0YC 3KFUG 4WU8C 2FJ7B 3WAAA 5AV5C 3REKC 5B31A 4Z2MG 5B24C 1JFIA 2NQBC 3LZ0C 5C3IB 1P3AB 3LELB 5JA4A 1P3BB 3C1CA 4ZUXA 3UT9A 1KX5B 3AZMB 4Z5TD 2Y2LA 5B2JB 4J8WC 5JRGD 4KUDA 5B32B 1TZYC 3WA9D 3AZEA 2F8ND 2L5AA 1P3PB 1M1AC 1BH8B 4E44A 1M18D 3A1IA 4YS3A 1P3ID 1BH9A 1ID3D 4KGCA 3EPHA 5GT3C 5AY8B 3MGPA 2ZY2A 5CPKD 3MGSD 4R8PD 3KUYB 3WAAB 2Y2IA 4H9RB 3REJC 2ZY4A 3MGRA 1JFIB 1H3OA 1N1JA 5GSUC 3B0DB 3W96C 5JA4B 3AYWD 3X1SC 3W98C 4ZUXB 4M6BA 4G92B 3C1BA 5CPJC 4J8VB 4KUDB 2Y2MA 4Z66A 5F99C 3AZEB 3AZJB 4XUJD 3AZGC 5CP6D 3AZFA 4LD9A 1F1EA 3AZND 3TU4C 1BH9B 4Z5TA 4KGCB 1P3FD 2RIQA 5AV8C 3MGPB 1Q9CA 4X23C 1P3LC 4G91B 3B6GD 3WA9A 4QLCC 1P3GD 3KXBC 2IO5B 3MGRB 3WTPB 1H3OB 1N1JB 3AZKD 2LY8A 2AROA 3LZ1D 3AV2C 1M18A 3X1VD 3B0BA 3AZIA 5CPID 3MGSA 4R8PA 2FJ7D 3W99C 4YM6A 3C1BB 5E5AC 3UTAC 4Z66B 3AV1C 1P3AD 3LELD 3AYWA 1P3BD 5GXQA 2W8SA 1P3IC 4UUZA 3AZFB 4LD9B 3KWQB 1KX5D 4Z5TB 3V9RA 3AZMD 2CV5A 5B2JD 3H0RC 5B40B 3AZLC 5BS7A 4JJNC 5GT0A 5AV9C 1P3MB 1P3PD 2HIOC 1KX4A 4H9PA 5CP6A 2DQNC 2AROB 3X1TA 5B33A 5AV6C 3AZIB 5AY8D 4EO5C 3UTBC 3B6GA 4J8UC 4WU9C 5BT1D 3KUYD 4YM6B 3REHD 4H9SA 5DNNB 1M19A 5GXQB 1P3FC 4ZUXD 3O62A 2J8PA 4HGAB 3X1UC 2CV5B 3B6FB 4KUDD 4J8VD 2PYOD 3AZJD 5GT0B 1ZLAA 3EG5B 1KX4B 3MGQC 4H9PB 5CP6B 4DRAA 3X1TB 3WKJA 5CPIC 1KX5A 2JSSA 1HQ3B 5B33B 3MGPD 2RVQC 2Y2NA 1AOIA 1P3KC 2F8NH 5KDMA 5AVCC 3MGRD 5DNMA 3WTPD 3REIB 1P3BC 1M19B 1KX3C 3W97C 3EPJA 2Y2PA 3KUYA 3O62B 3C1BD 3IP4C 4H9RA 5B32C 3REHA 3NQUB 4Z66D 3LJAA 1EQZC 4WU8A 5AV5A 1ZLAB 3REKA 1Z2CB 4XZQB 3AZFD 4LD9D 3WKJB 3KWQD 5B2IC 2YFVA 4J8VA 4H9NB 2YFWB 3WAAC 2PYOA 5B40D 1AOIB 3AZJA 2Y2JA 5B31C 1A7WA 1P3MD 5KDMB 1T3UA 3A6NA 5DNMB 2F2AC 2AROD 3MVDD 3MNNC 3AZID 3C1CC 4WNNA 3RELC 1P3OB 3UT9C 4J8XA 4ZBJB 4YM6D 5B1MC 3REHB 5GT3A 3WTPA 3AZEC 5B0YB 3LJAB 5DNND 4WU8B 5AV5B 3REJA 3REKB 3AN2C 2Y2OA 5GXQD 5AVBA 4YS3C 5B0ZC 2XD1A 4KGCC 3VH6T 3LZ0B 2YFVB 2CV5D 1U35C 1F66C 3B6FD 3AFAC 3X1SA 2PYOB 3P5JB 3W98A 3AZHC 2IO5C 3MGRC 5GT0D 1KX4D 3A6NB 1TZYB 3X1TD 3KWQA 5B33D 1HQ3D 4WNNB 5B40A 3AZGA 4J8XB 1B6WA 3C1BC 3EPKA 3TU4A 1P3MA 5AV8A 5GT3B 5B1LD 1P3LA 3MVDA 3REID 4QLCA 1M19D 3KXBA 3REJB 5BO0B 5AVBB 4Z5TC 1P34A 3O62D 5GSUB 5JRGC 3EPLA 4Z2MH 3WA9C 3X1SB 3W98B 5DNNA 3W99A 1ZLAD 1S32D 5E5AA 1M18C 4XZQD 5CPJB 3H0LC 1ID3C 2ZM5A 3WKJD 3AV1A 3B6FA 5CPKC 3MGSC 5G49A 4R8PC 3AZGB 1AOID 2DF4C 3TU4B 5AV8B 5DNMD 1P3LB 3MVDB 3AZLA 4QLCB 3AYWC 1HQ3A 3KXBB 4JJNA 5GXQC 5AV9A 1P3OD 4HGAC 1P34B 3AV2B 5AV6A 2NZDA 4H9QA 5BS7C 1TAFB 5B1LA 4XUJC 3UTBA 3REIA 5B0YD 3LJAD 3R45B
chains in the Genus database with same CATH topology
4WU8D 5AV5D 3W99B 5CP6C 3REKD 3AZNC 5E5AB 2NQBD 3UTAB 3LZ0D 4WZSB 3AV1B 3B6GC 5G49B 1P3GC 3NQUA 4AWLC 2HUEC 3AZKC 1S32A 3LZ1C 4XZQA 3X1VC 3A6ND 3VH5T 3AZLB 1TZYD 4E45A 4H9OA 4JJNB 5AV9B 2Y2GA 2YFWA 4H9NA 2FJ7C 3O62C 4J8XD 3WTPE 5AV6B 2NZDB 4H9QB 5GT3D 5B1LB 4EO5B 5C3IC 3LELC 3UTBB 1P3AC 3B0CT 4WU9B 1ZLAC 1P3KA 3REJD 1P3OA 5AVCA 3WKJC 5AVBD 3AZMC 1KX5C 5B2JC 5GSUD 2Y2QA 1KX3A 3W96D 3X1SD 2VQRA 5B0YA 1P3PC 2JE5A 3W98D 4CSRA 3X1UB 1S32B 5B24A 2NQBA 1HTAA 5CPJD 3LZ0A 5AY8C 5F99D 1EQZA 4KHAA 4H9OB 5BT1C 3KUYC 3MGQB 3AZGD 3REHC 3TU4D 1KU5A 5AV8D 3LJAC 4J8WA 4NFTA 3B0DC 4X23D 1P3LD 1TZYA 4QLCD 3AL0C 1P3KB 3KXBD 5B31G 1M1AA 4ZUXC 5AVCB 4G92C 2BYMA 5FUGA 1P34D 3AV2D 4KUDC 3MNNA 4UPKA 4J8VC 2PYOC 1KX3B 3VH5W 3AZJC 2ZY3A 3RELA 3W97B 3A6NC 3W99D 4CSRB 5B1MA 5BO0A 2FFFB 5E5AD 5B24B 2NQBB 3UTAD 3MGPC 5GSUA 1EQZB 2XD5A 2ZY5A 4KHAB 3AV1D 4G91C 4J8XC 3W96A 3AN2A 3B0CW 3NQJA 5B0ZA 3WTPC 5B2IB 1F66A 1U35A 4NE5A 4J8WB 3AFAA 5CPJA 5BNXA 3AZLD 2BG1A 5F99A 5B31B 3AZHA 2G5HC 5BNVA 4NE6A 4JJND 5AVBC 5AV9D 4WJ3C 1M1AB 2HIOD 2BYMB 2G5IC 2BYKA 5FUGB 3VH5A 3MNNB 5AV6D 2Y2KA 4Z66C 2NZDD 1R4VA 3C1CB 3RELB 4X23A 3UTBD 3UT9B 4J8UD 4WU9D 5CHLB 5B1MB 3AZFC 4LD9C 4DQYB 3KWQC 3A1KA 4CAYA 3AV2A 5B40C 3W96B 1TAFA 3AN2B 3R45A 4YS3B 1P3MC 3NQJB 5B0ZB 5JRGA 3X1UD 1F66B 1U35B 2AROC 3MVDC 3AFAB 3UTAA 2F8NA 5BNXB 2F8NG 3AZIC 3F6TA 5F99B 3AZHB 5BNVB 1P34C 3KSYA 3MGQD 4YM6C 1P3IA 2BYKB 1ID3A 5CPKA 5DNNC 3VH6W 4X23B 2RVQD 3H0MC 1P3KD 2HIOA 5AVCD 2JCHA 2CV5C 3B6FC 4CAYB 2CWEA 4NE3A 1KX3D 3W97D 5GT0C 4J8UA 4WU9A 1KX4C 5JRGB 5B32D 5B24D 1ULYA 3X1TC 2F8NB 3WA9B 4XUJA 5B33C 1HQ3C 1EQZD 3AZNA 1M18B 1P3IB 1ID3B 1WWIA 1P3FA 2NZDC 4H9SC 3X1UA 5B1LC 3VH6A 5B2ID 3REIC 5CPKB 3MGSB 4J8WD 4R8PB 1P3GA 1M19C 3WAAD 5B31D 2HIOB 3AZKA 1M1AD 3LZ1A 3MGQA 3X1VA 2F8NK 1PZRA 5CPIA 3AYWB 3MNND 1BFMA 4UUZB 3C1CD 3RELD 2FJ7A 4J8UB 3UT9D 3V9RB 1S32C 4XZQC 1WWSA 5B1MD 2UWXA 4XUJB 3AZED 1P3AA 3LELA 1P3BA 1AOIC 3W97A 3AZNB 3AN2D 4YS3D 3AZMA 1P3FB 5B0ZD 4KGCD 5DNMC 5B2JA 1B67A 1F66D 5B32A 1U35D 3FDDA 3B6GB 4WV4B 5B32G 4DRBA 3AFAD 4AWLB 1P3GB 2HUEB 1P3PA 3AZHD 1P3OC 3AZKB 1BH8A 2Y2HA 4ZBJC 3LZ1B 3X1VB 1W2EA 5CPIB 5AY8A 5B2IA 5B0YC 3KFUG 4WU8C 2FJ7B 3WAAA 5AV5C 3REKC 5B31A 4Z2MG 5B24C 1JFIA 2NQBC 3LZ0C 5C3IB 1P3AB 3LELB 5JA4A 1P3BB 3C1CA 4ZUXA 3UT9A 1KX5B 3AZMB 4Z5TD 2Y2LA 5B2JB 4J8WC 5JRGD 4KUDA 5B32B 1TZYC 3WA9D 3AZEA 2F8ND 2L5AA 1P3PB 1M1AC 1BH8B 4E44A 1M18D 3A1IA 4YS3A 1P3ID 1BH9A 1ID3D 4KGCA 3EPHA 5GT3C 5AY8B 3MGPA 2ZY2A 5CPKD 3MGSD 4R8PD 3KUYB 3WAAB 2Y2IA 4H9RB 3REJC 2ZY4A 3MGRA 1JFIB 1H3OA 1N1JA 5GSUC 3B0DB 3W96C 5JA4B 3AYWD 3X1SC 3W98C 4ZUXB 4M6BA 4G92B 3C1BA 5CPJC 4J8VB 4KUDB 2Y2MA 4Z66A 5F99C 3AZEB 3AZJB 4XUJD 3AZGC 5CP6D 3AZFA 4LD9A 1F1EA 3AZND 3TU4C 1BH9B 4Z5TA 4KGCB 1P3FD 2RIQA 5AV8C 3MGPB 1Q9CA 4X23C 1P3LC 4G91B 3B6GD 3WA9A 4QLCC 1P3GD 3KXBC 2IO5B 3MGRB 3WTPB 1H3OB 1N1JB 3AZKD 2LY8A 2AROA 3LZ1D 3AV2C 1M18A 3X1VD 3B0BA 3AZIA 5CPID 3MGSA 4R8PA 2FJ7D 3W99C 4YM6A 3C1BB 5E5AC 3UTAC 4Z66B 3AV1C 1P3AD 3LELD 3AYWA 1P3BD 5GXQA 2W8SA 1P3IC 4UUZA 3AZFB 4LD9B 3KWQB 1KX5D 4Z5TB 3V9RA 3AZMD 2CV5A 5B2JD 3H0RC 5B40B 3AZLC 5BS7A 4JJNC 5GT0A 5AV9C 1P3MB 1P3PD 2HIOC 1KX4A 4H9PA 5CP6A 2DQNC 2AROB 3X1TA 5B33A 5AV6C 3AZIB 5AY8D 4EO5C 3UTBC 3B6GA 4J8UC 4WU9C 5BT1D 3KUYD 4YM6B 3REHD 4H9SA 5DNNB 1M19A 5GXQB 1P3FC 4ZUXD 3O62A 2J8PA 4HGAB 3X1UC 2CV5B 3B6FB 4KUDD 4J8VD 2PYOD 3AZJD 5GT0B 1ZLAA 3EG5B 1KX4B 3MGQC 4H9PB 5CP6B 4DRAA 3X1TB 3WKJA 5CPIC 1KX5A 2JSSA 1HQ3B 5B33B 3MGPD 2RVQC 2Y2NA 1AOIA 1P3KC 2F8NH 5KDMA 5AVCC 3MGRD 5DNMA 3WTPD 3REIB 1P3BC 1M19B 1KX3C 3W97C 3EPJA 2Y2PA 3KUYA 3O62B 3C1BD 3IP4C 4H9RA 5B32C 3REHA 3NQUB 4Z66D 3LJAA 1EQZC 4WU8A 5AV5A 1ZLAB 3REKA 1Z2CB 4XZQB 3AZFD 4LD9D 3WKJB 3KWQD 5B2IC 2YFVA 4J8VA 4H9NB 2YFWB 3WAAC 2PYOA 5B40D 1AOIB 3AZJA 2Y2JA 5B31C 1A7WA 1P3MD 5KDMB 1T3UA 3A6NA 5DNMB 2F2AC 2AROD 3MVDD 3MNNC 3AZID 3C1CC 4WNNA 3RELC 1P3OB 3UT9C 4J8XA 4ZBJB 4YM6D 5B1MC 3REHB 5GT3A 3WTPA 3AZEC 5B0YB 3LJAB 5DNND 4WU8B 5AV5B 3REJA 3REKB 3AN2C 2Y2OA 5GXQD 5AVBA 4YS3C 5B0ZC 2XD1A 4KGCC 3VH6T 3LZ0B 2YFVB 2CV5D 1U35C 1F66C 3B6FD 3AFAC 3X1SA 2PYOB 3P5JB 3W98A 3AZHC 2IO5C 3MGRC 5GT0D 1KX4D 3A6NB 1TZYB 3X1TD 3KWQA 5B33D 1HQ3D 4WNNB 5B40A 3AZGA 4J8XB 1B6WA 3C1BC 3EPKA 3TU4A 1P3MA 5AV8A 5GT3B 5B1LD 1P3LA 3MVDA 3REID 4QLCA 1M19D 3KXBA 3REJB 5BO0B 5AVBB 4Z5TC 1P34A 3O62D 5GSUB 5JRGC 3EPLA 4Z2MH 3WA9C 3X1SB 3W98B 5DNNA 3W99A 1ZLAD 1S32D 5E5AA 1M18C 4XZQD 5CPJB 3H0LC 1ID3C 2ZM5A 3WKJD 3AV1A 3B6FA 5CPKC 3MGSC 5G49A 4R8PC 3AZGB 1AOID 2DF4C 3TU4B 5AV8B 5DNMD 1P3LB 3MVDB 3AZLA 4QLCB 3AYWC 1HQ3A 3KXBB 4JJNA 5GXQC 5AV9A 1P3OD 4HGAC 1P34B 3AV2B 5AV6A 2NZDA 4H9QA 5BS7C 1TAFB 5B1LA 4XUJC 3UTBA 3REIA 5B0YD 3LJAD 3R45B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU8 D;  5AV5 D;  3W99 B;  5CP6 C;  3REK D;  3AZN C;  5E5A B;  2NQB D;  3UTA B;  3LZ0 D;  4WZS B;  3AV1 B;  3B6G C;  5G49 B;  1P3G C;  3NQU A;  4AWL C;  2HUE C;  3AZK C;  1S32 A;  3LZ1 C;  4XZQ A;  3X1V C;  3A6N D;  3VH5 T;  3AZL B;  1TZY D;  4E45 A;  4H9O A;  4JJN B;  5AV9 B;  4H9N A;  2YFW A;  2FJ7 C;  3O62 C;  4J8X D;  3WTP E;  5AV6 B;  2NZD B;  4H9Q B;  5GT3 D;  5B1L B;  4EO5 B;  5C3I C;  3LEL C;  3UTB B;  1P3A C;  3B0C T;  4WU9 B;  1ZLA C;  1P3K A;  3REJ D;  1P3O A;  5AVC A;  3WKJ C;  5AVB D;  3AZM C;  1KX5 C;  5B2J C;  5GSU D;  1KX3 A;  3W96 D;  3X1S D;  5B0Y A;  1P3P C;  3W98 D;  4CSR A;  3X1U B;  1S32 B;  5B24 A;  2NQB A;  1HTA A;  5CPJ D;  3LZ0 A;  5AY8 C;  5F99 D;  1EQZ A;  4KHA A;  4H9O B;  5BT1 C;  3KUY C;  3MGQ B;  3AZG D;  3REH C;  3TU4 D;  1KU5 A;  5AV8 D;  3LJA C;  4J8W A;  4NFT A;  3B0D C;  4X23 D;  1P3L D;  1TZY A;  4QLC D;  1P3K B;  3KXB D;  5B31 G;  1M1A A;  4ZUX C;  5AVC B;  4G92 C;  2BYM A;  5FUG A;  1P34 D;  3AV2 D;  4KUD C;  3MNN A;  4J8V C;  2PYO C;  1KX3 B;  3VH5 W;  3AZJ C;  3W97 B;  3REL A;  3A6N C;  3W99 D;  4CSR B;  5B1M A;  5BO0 A;  5E5A D;  5B24 B;  2NQB B;  3UTA D;  3MGP C;  5GSU A;  1EQZ B;  3AV1 D;  4KHA B;  4G91 C;  4J8X C;  3W96 A;  3AN2 A;  3B0C W;  3NQJ A;  5B0Z A;  3WTP C;  5B2I B;  1F66 A;  1U35 A;  4NE5 A;  4J8W B;  3AFA A;  5CPJ A;  5BNX A;  3AZL D;  5F99 A;  5B31 B;  3AZH A;  5BNV A;  4NE6 A;  4JJN D;  5AVB C;  5AV9 D;  1M1A B;  2HIO D;  2BYM B;  5FUG B;  2BYK A;  3VH5 A;  3MNN B;  5AV6 D;  4Z66 C;  2NZD D;  1R4V A;  3C1C B;  3REL B;  4X23 A;  3UTB D;  3UT9 B;  4J8U D;  4WU9 D;  5CHL B;  5B1M B;  3AZF C;  4LD9 C;  3KWQ C;  3AV2 A;  4CAY A;  5B40 C;  3W96 B;  1TAF A;  3AN2 B;  3R45 A;  4YS3 B;  1P3M C;  3NQJ B;  5B0Z B;  5JRG A;  3X1U D;  1F66 B;  1U35 B;  2ARO C;  3MVD C;  3AFA B;  3UTA A;  2F8N A;  5BNX B;  2F8N G;  3AZI C;  5F99 B;  3AZH B;  5BNV B;  1P34 C;  3KSY A;  3MGQ D;  4YM6 C;  1P3I A;  2BYK B;  1ID3 A;  5CPK A;  5DNN C;  3VH6 W;  4X23 B;  2RVQ D;  1P3K D;  2HIO A;  5AVC D;  2CV5 C;  3B6F C;  4CAY B;  2CWE A;  4NE3 A;  1KX3 D;  3W97 D;  5GT0 C;  4J8U A;  4WU9 A;  1KX4 C;  5JRG B;  5B32 D;  5B24 D;  1ULY A;  3X1T C;  2F8N B;  3WA9 B;  4XUJ A;  5B33 C;  1HQ3 C;  1EQZ D;  3AZN A;  1M18 B;  1P3I B;  1ID3 B;  1WWI A;  1P3F A;  2NZD C;  4H9S C;  3X1U A;  5B1L C;  3VH6 A;  5B2I D;  3REI C;  5CPK B;  3MGS B;  4J8W D;  4R8P B;  1P3G A;  1M19 C;  3WAA D;  5B31 D;  2HIO B;  3AZK A;  1M1A D;  3LZ1 A;  3MGQ A;  3X1V A;  2F8N K;  5CPI A;  3AYW B;  3MNN D;  1BFM A;  4UUZ B;  3C1C D;  3REL D;  2FJ7 A;  4J8U B;  3UT9 D;  3V9R B;  1S32 C;  4XZQ C;  1WWS A;  5B1M D;  4XUJ B;  3AZE D;  1P3A A;  3LEL A;  1P3B A;  1AOI C;  3W97 A;  3AZN B;  3AN2 D;  4YS3 D;  3AZM A;  1P3F B;  5B0Z D;  4KGC D;  5DNM C;  5B2J A;  1B67 A;  1F66 D;  5B32 A;  1U35 D;  3B6G B;  4WV4 B;  5B32 G;  4DRB A;  3AFA D;  4AWL B;  1P3G B;  2HUE B;  1P3P A;  3AZH D;  1P3O C;  3AZK B;  1BH8 A;  4ZBJ C;  3LZ1 B;  3X1V B;  5CPI B;  5AY8 A;  5B2I A;  5B0Y C;  4WU8 C;  2FJ7 B;  3WAA A;  5AV5 C;  3REK C;  5B31 A;  4Z2M G;  5B24 C;  1JFI A;  2NQB C;  3LZ0 C;  5C3I B;  1P3A B;  3LEL B;  5JA4 A;  1P3B B;  3C1C A;  4ZUX A;  3UT9 A;  1KX5 B;  3AZM B;  4Z5T D;  5B2J B;  4J8W C;  5JRG D;  4KUD A;  5B32 B;  1TZY C;  3WA9 D;  3AZE A;  2F8N D;  2L5A A;  1P3P B;  1M1A C;  1BH8 B;  4E44 A;  1M18 D;  4YS3 A;  1P3I D;  1BH9 A;  1ID3 D;  4KGC A;  5GT3 C;  5AY8 B;  3MGP A;  5CPK D;  3MGS D;  4R8P D;  3KUY B;  3WAA B;  4H9R B;  3REJ C;  3MGR A;  1JFI B;  1H3O A;  1N1J A;  5GSU C;  3B0D B;  3W96 C;  5JA4 B;  3AYW D;  3X1S C;  3W98 C;  4ZUX B;  4M6B A;  4G92 B;  3C1B A;  5CPJ C;  4J8V B;  4KUD B;  4Z66 A;  5F99 C;  3AZE B;  3AZJ B;  4XUJ D;  3AZG C;  5CP6 D;  3AZF A;  4LD9 A;  1F1E A;  3AZN D;  3TU4 C;  1BH9 B;  4Z5T A;  4KGC B;  1P3F D;  5AV8 C;  3MGP B;  1Q9C A;  4X23 C;  1P3L C;  4G91 B;  3B6G D;  3WA9 A;  4QLC C;  1P3G D;  3KXB C;  2IO5 B;  3MGR B;  3WTP B;  1H3O B;  1N1J B;  3AZK D;  2LY8 A;  2ARO A;  3LZ1 D;  3AV2 C;  1M18 A;  3X1V D;  3B0B A;  3AZI A;  5CPI D;  3MGS A;  4R8P A;  2FJ7 D;  3W99 C;  4YM6 A;  3C1B B;  5E5A C;  3UTA C;  4Z66 B;  3AV1 C;  1P3A D;  3LEL D;  3AYW A;  1P3B D;  5GXQ A;  1P3I C;  4UUZ A;  3AZF B;  4LD9 B;  3KWQ B;  1KX5 D;  4Z5T B;  3V9R A;  3AZM D;  2CV5 A;  5B2J D;  5B40 B;  3AZL C;  5BS7 A;  4JJN C;  5GT0 A;  5AV9 C;  1P3M B;  1P3P D;  2HIO C;  1KX4 A;  4H9P A;  5CP6 A;  2ARO B;  3X1T A;  5B33 A;  5AV6 C;  3AZI B;  5AY8 D;  4EO5 C;  3UTB C;  3B6G A;  4J8U C;  4WU9 C;  5BT1 D;  3KUY D;  4YM6 B;  3REH D;  4H9S A;  5DNN B;  1M19 A;  5GXQ B;  1P3F C;  4ZUX D;  3O62 A;  4HGA B;  3X1U C;  2CV5 B;  3B6F B;  4KUD D;  4J8V D;  2PYO D;  3AZJ D;  5GT0 B;  1ZLA A;  1KX4 B;  3MGQ C;  4H9P B;  5CP6 B;  4DRA A;  3X1T B;  3WKJ A;  5CPI C;  1KX5 A;  2JSS A;  1HQ3 B;  5B33 B;  3MGP D;  2RVQ C;  1AOI A;  1P3K C;  2F8N H;  5KDM A;  5AVC C;  3MGR D;  5DNM A;  3WTP D;  3REI B;  1P3B C;  1M19 B;  1KX3 C;  3W97 C;  3KUY A;  3O62 B;  3C1B D;  4H9R A;  5B32 C;  3REH A;  3NQU B;  4Z66 D;  3LJA A;  1EQZ C;  4WU8 A;  5AV5 A;  1ZLA B;  3REK A;  4XZQ B;  3AZF D;  4LD9 D;  3WKJ B;  3KWQ D;  5B2I C;  2YFV A;  4J8V A;  4H9N B;  2YFW B;  3WAA C;  2PYO A;  5B40 D;  1AOI B;  3AZJ A;  5B31 C;  1A7W A;  1P3M D;  5KDM B;  3A6N A;  5DNM B;  2ARO D;  3MVD D;  3MNN C;  3AZI D;  3C1C C;  4WNN A;  3REL C;  1P3O B;  3UT9 C;  4J8X A;  4ZBJ B;  4YM6 D;  5B1M C;  3REH B;  5GT3 A;  3WTP A;  3AZE C;  5B0Y B;  3LJA B;  5DNN D;  4WU8 B;  5AV5 B;  3REJ A;  3REK B;  3AN2 C;  5GXQ D;  5AVB A;  4YS3 C;  5B0Z C;  4KGC C;  3VH6 T;  3LZ0 B;  2YFV B;  2CV5 D;  1U35 C;  1F66 C;  3B6F D;  3AFA C;  3X1S A;  2PYO B;  3W98 A;  3AZH C;  2IO5 C;  3MGR C;  5GT0 D;  1KX4 D;  3A6N B;  1TZY B;  3X1T D;  3KWQ A;  5B33 D;  1HQ3 D;  4WNN B;  5B40 A;  3AZG A;  4J8X B;  1B6W A;  3C1B C;  3TU4 A;  1P3M A;  5AV8 A;  5GT3 B;  5B1L D;  1P3L A;  3MVD A;  3REI D;  4QLC A;  1M19 D;  3KXB A;  3REJ B;  5BO0 B;  5AVB B;  4Z5T C;  1P34 A;  3O62 D;  5GSU B;  5JRG C;  4Z2M H;  3WA9 C;  3X1S B;  3W98 B;  5DNN A;  3W99 A;  1ZLA D;  1S32 D;  5E5A A;  1M18 C;  4XZQ D;  5CPJ B;  1ID3 C;  3WKJ D;  3AV1 A;  3B6F A;  5CPK C;  3MGS C;  5G49 A;  4R8P C;  3AZG B;  1AOI D;  3TU4 B;  5AV8 B;  5DNM D;  1P3L B;  3MVD B;  3AZL A;  4QLC B;  3AYW C;  1HQ3 A;  3KXB B;  4JJN A;  5GXQ C;  5AV9 A;  1P3O D;  4HGA C;  1P34 B;  3AV2 B;  5AV6 A;  2NZD A;  4H9Q A;  5BS7 C;  1TAF B;  5B1L A;  4XUJ C;  3UTB A;  3REI A;  5B0Y D;  3LJA D;  3R45 B; 
#chains in the Genus database with same CATH topology
 4WU8 D;  5AV5 D;  3W99 B;  5CP6 C;  3REK D;  3AZN C;  5E5A B;  2NQB D;  3UTA B;  3LZ0 D;  4WZS B;  3AV1 B;  3B6G C;  5G49 B;  1P3G C;  3NQU A;  4AWL C;  2HUE C;  3AZK C;  1S32 A;  3LZ1 C;  4XZQ A;  3X1V C;  3A6N D;  3VH5 T;  3AZL B;  1TZY D;  4E45 A;  4H9O A;  4JJN B;  5AV9 B;  2Y2G A;  2YFW A;  4H9N A;  2FJ7 C;  3O62 C;  4J8X D;  3WTP E;  5AV6 B;  2NZD B;  4H9Q B;  5GT3 D;  5B1L B;  4EO5 B;  5C3I C;  3LEL C;  3UTB B;  1P3A C;  3B0C T;  4WU9 B;  1ZLA C;  1P3K A;  3REJ D;  1P3O A;  5AVC A;  3WKJ C;  5AVB D;  3AZM C;  1KX5 C;  5B2J C;  5GSU D;  2Y2Q A;  1KX3 A;  3W96 D;  3X1S D;  2VQR A;  5B0Y A;  1P3P C;  2JE5 A;  3W98 D;  4CSR A;  3X1U B;  1S32 B;  5B24 A;  2NQB A;  1HTA A;  5CPJ D;  3LZ0 A;  5AY8 C;  5F99 D;  1EQZ A;  4KHA A;  4H9O B;  5BT1 C;  3KUY C;  3MGQ B;  3AZG D;  3REH C;  3TU4 D;  1KU5 A;  5AV8 D;  3LJA C;  4J8W A;  4NFT A;  3B0D C;  4X23 D;  1P3L D;  1TZY A;  4QLC D;  3AL0 C;  1P3K B;  3KXB D;  5B31 G;  1M1A A;  4ZUX C;  5AVC B;  4G92 C;  2BYM A;  5FUG A;  1P34 D;  3AV2 D;  4KUD C;  3MNN A;  4UPK A;  4J8V C;  2PYO C;  1KX3 B;  3VH5 W;  3AZJ C;  2ZY3 A;  3REL A;  3W97 B;  3A6N C;  3W99 D;  4CSR B;  5B1M A;  5BO0 A;  2FFF B;  5E5A D;  5B24 B;  2NQB B;  3UTA D;  3MGP C;  5GSU A;  1EQZ B;  2XD5 A;  2ZY5 A;  4KHA B;  3AV1 D;  4G91 C;  4J8X C;  3W96 A;  3AN2 A;  3B0C W;  3NQJ A;  5B0Z A;  3WTP C;  5B2I B;  1F66 A;  1U35 A;  4NE5 A;  4J8W B;  3AFA A;  5CPJ A;  5BNX A;  3AZL D;  2BG1 A;  5F99 A;  5B31 B;  3AZH A;  2G5H C;  5BNV A;  4NE6 A;  4JJN D;  5AVB C;  5AV9 D;  4WJ3 C;  1M1A B;  2HIO D;  2BYM B;  2G5I C;  2BYK A;  5FUG B;  3VH5 A;  3MNN B;  5AV6 D;  2Y2K A;  4Z66 C;  2NZD D;  1R4V A;  3C1C B;  3REL B;  4X23 A;  3UTB D;  3UT9 B;  4J8U D;  4WU9 D;  5CHL B;  5B1M B;  3AZF C;  4LD9 C;  4DQY B;  3KWQ C;  3A1K A;  4CAY A;  3AV2 A;  5B40 C;  3W96 B;  1TAF A;  3AN2 B;  3R45 A;  4YS3 B;  1P3M C;  3NQJ B;  5B0Z B;  5JRG A;  3X1U D;  1F66 B;  1U35 B;  2ARO C;  3MVD C;  3AFA B;  3UTA A;  2F8N A;  5BNX B;  2F8N G;  3AZI C;  3F6T A;  5F99 B;  3AZH B;  5BNV B;  1P34 C;  3KSY A;  3MGQ D;  4YM6 C;  1P3I A;  2BYK B;  1ID3 A;  5CPK A;  5DNN C;  3VH6 W;  4X23 B;  2RVQ D;  3H0M C;  1P3K D;  2HIO A;  5AVC D;  2JCH A;  2CV5 C;  3B6F C;  4CAY B;  2CWE A;  4NE3 A;  1KX3 D;  3W97 D;  5GT0 C;  4J8U A;  4WU9 A;  1KX4 C;  5JRG B;  5B32 D;  5B24 D;  1ULY A;  3X1T C;  2F8N B;  3WA9 B;  4XUJ A;  5B33 C;  1HQ3 C;  1EQZ D;  3AZN A;  1M18 B;  1P3I B;  1ID3 B;  1WWI A;  1P3F A;  2NZD C;  4H9S C;  3X1U A;  5B1L C;  3VH6 A;  5B2I D;  3REI C;  5CPK B;  3MGS B;  4J8W D;  4R8P B;  1P3G A;  1M19 C;  3WAA D;  5B31 D;  2HIO B;  3AZK A;  1M1A D;  3LZ1 A;  3MGQ A;  3X1V A;  2F8N K;  1PZR A;  5CPI A;  3AYW B;  3MNN D;  1BFM A;  4UUZ B;  3C1C D;  3REL D;  2FJ7 A;  4J8U B;  3UT9 D;  3V9R B;  1S32 C;  4XZQ C;  1WWS A;  5B1M D;  2UWX A;  4XUJ B;  3AZE D;  1P3A A;  3LEL A;  1P3B A;  1AOI C;  3W97 A;  3AZN B;  3AN2 D;  4YS3 D;  3AZM A;  1P3F B;  5B0Z D;  4KGC D;  5DNM C;  5B2J A;  1B67 A;  1F66 D;  5B32 A;  1U35 D;  3FDD A;  3B6G B;  4WV4 B;  5B32 G;  4DRB A;  3AFA D;  4AWL B;  1P3G B;  2HUE B;  1P3P A;  3AZH D;  1P3O C;  3AZK B;  1BH8 A;  2Y2H A;  4ZBJ C;  3LZ1 B;  3X1V B;  1W2E A;  5CPI B;  5AY8 A;  5B2I A;  5B0Y C;  3KFU G;  4WU8 C;  2FJ7 B;  3WAA A;  5AV5 C;  3REK C;  5B31 A;  4Z2M G;  5B24 C;  1JFI A;  2NQB C;  3LZ0 C;  5C3I B;  1P3A B;  3LEL B;  5JA4 A;  1P3B B;  3C1C A;  4ZUX A;  3UT9 A;  1KX5 B;  3AZM B;  4Z5T D;  2Y2L A;  5B2J B;  4J8W C;  5JRG D;  4KUD A;  5B32 B;  1TZY C;  3WA9 D;  3AZE A;  2F8N D;  2L5A A;  1P3P B;  1M1A C;  1BH8 B;  4E44 A;  1M18 D;  3A1I A;  4YS3 A;  1P3I D;  1BH9 A;  1ID3 D;  4KGC A;  3EPH A;  5GT3 C;  5AY8 B;  3MGP A;  2ZY2 A;  5CPK D;  3MGS D;  4R8P D;  3KUY B;  3WAA B;  2Y2I A;  4H9R B;  3REJ C;  2ZY4 A;  3MGR A;  1JFI B;  1H3O A;  1N1J A;  5GSU C;  3B0D B;  3W96 C;  5JA4 B;  3AYW D;  3X1S C;  3W98 C;  4ZUX B;  4M6B A;  4G92 B;  3C1B A;  5CPJ C;  4J8V B;  4KUD B;  2Y2M A;  4Z66 A;  5F99 C;  3AZE B;  3AZJ B;  4XUJ D;  3AZG C;  5CP6 D;  3AZF A;  4LD9 A;  1F1E A;  3AZN D;  3TU4 C;  1BH9 B;  4Z5T A;  4KGC B;  1P3F D;  2RIQ A;  5AV8 C;  3MGP B;  1Q9C A;  4X23 C;  1P3L C;  4G91 B;  3B6G D;  3WA9 A;  4QLC C;  1P3G D;  3KXB C;  2IO5 B;  3MGR B;  3WTP B;  1H3O B;  1N1J B;  3AZK D;  2LY8 A;  2ARO A;  3LZ1 D;  3AV2 C;  1M18 A;  3X1V D;  3B0B A;  3AZI A;  5CPI D;  3MGS A;  4R8P A;  2FJ7 D;  3W99 C;  4YM6 A;  3C1B B;  5E5A C;  3UTA C;  4Z66 B;  3AV1 C;  1P3A D;  3LEL D;  3AYW A;  1P3B D;  5GXQ A;  2W8S A;  1P3I C;  4UUZ A;  3AZF B;  4LD9 B;  3KWQ B;  1KX5 D;  4Z5T B;  3V9R A;  3AZM D;  2CV5 A;  5B2J D;  3H0R C;  5B40 B;  3AZL C;  5BS7 A;  4JJN C;  5GT0 A;  5AV9 C;  1P3M B;  1P3P D;  2HIO C;  1KX4 A;  4H9P A;  5CP6 A;  2DQN C;  2ARO B;  3X1T A;  5B33 A;  5AV6 C;  3AZI B;  5AY8 D;  4EO5 C;  3UTB C;  3B6G A;  4J8U C;  4WU9 C;  5BT1 D;  3KUY D;  4YM6 B;  3REH D;  4H9S A;  5DNN B;  1M19 A;  5GXQ B;  1P3F C;  4ZUX D;  3O62 A;  2J8P A;  4HGA B;  3X1U C;  2CV5 B;  3B6F B;  4KUD D;  4J8V D;  2PYO D;  3AZJ D;  5GT0 B;  1ZLA A;  3EG5 B;  1KX4 B;  3MGQ C;  4H9P B;  5CP6 B;  4DRA A;  3X1T B;  3WKJ A;  5CPI C;  1KX5 A;  2JSS A;  1HQ3 B;  5B33 B;  3MGP D;  2RVQ C;  2Y2N A;  1AOI A;  1P3K C;  2F8N H;  5KDM A;  5AVC C;  3MGR D;  5DNM A;  3WTP D;  3REI B;  1P3B C;  1M19 B;  1KX3 C;  3W97 C;  3EPJ A;  2Y2P A;  3KUY A;  3O62 B;  3C1B D;  3IP4 C;  4H9R A;  5B32 C;  3REH A;  3NQU B;  4Z66 D;  3LJA A;  1EQZ C;  4WU8 A;  5AV5 A;  1ZLA B;  3REK A;  1Z2C B;  4XZQ B;  3AZF D;  4LD9 D;  3WKJ B;  3KWQ D;  5B2I C;  2YFV A;  4J8V A;  4H9N B;  2YFW B;  3WAA C;  2PYO A;  5B40 D;  1AOI B;  3AZJ A;  2Y2J A;  5B31 C;  1A7W A;  1P3M D;  5KDM B;  1T3U A;  3A6N A;  5DNM B;  2F2A C;  2ARO D;  3MVD D;  3MNN C;  3AZI D;  3C1C C;  4WNN A;  3REL C;  1P3O B;  3UT9 C;  4J8X A;  4ZBJ B;  4YM6 D;  5B1M C;  3REH B;  5GT3 A;  3WTP A;  3AZE C;  5B0Y B;  3LJA B;  5DNN D;  4WU8 B;  5AV5 B;  3REJ A;  3REK B;  3AN2 C;  2Y2O A;  5GXQ D;  5AVB A;  4YS3 C;  5B0Z C;  2XD1 A;  4KGC C;  3VH6 T;  3LZ0 B;  2YFV B;  2CV5 D;  1U35 C;  1F66 C;  3B6F D;  3AFA C;  3X1S A;  2PYO B;  3P5J B;  3W98 A;  3AZH C;  2IO5 C;  3MGR C;  5GT0 D;  1KX4 D;  3A6N B;  1TZY B;  3X1T D;  3KWQ A;  5B33 D;  1HQ3 D;  4WNN B;  5B40 A;  3AZG A;  4J8X B;  1B6W A;  3C1B C;  3EPK A;  3TU4 A;  1P3M A;  5AV8 A;  5GT3 B;  5B1L D;  1P3L A;  3MVD A;  3REI D;  4QLC A;  1M19 D;  3KXB A;  3REJ B;  5BO0 B;  5AVB B;  4Z5T C;  1P34 A;  3O62 D;  5GSU B;  5JRG C;  3EPL A;  4Z2M H;  3WA9 C;  3X1S B;  3W98 B;  5DNN A;  3W99 A;  1ZLA D;  1S32 D;  5E5A A;  1M18 C;  4XZQ D;  5CPJ B;  3H0L C;  1ID3 C;  2ZM5 A;  3WKJ D;  3AV1 A;  3B6F A;  5CPK C;  3MGS C;  5G49 A;  4R8P C;  3AZG B;  1AOI D;  2DF4 C;  3TU4 B;  5AV8 B;  5DNM D;  1P3L B;  3MVD B;  3AZL A;  4QLC B;  3AYW C;  1HQ3 A;  3KXB B;  4JJN A;  5GXQ C;  5AV9 A;  1P3O D;  4HGA C;  1P34 B;  3AV2 B;  5AV6 A;  2NZD A;  4H9Q A;  5BS7 C;  1TAF B;  5B1L A;  4XUJ C;  3UTB A;  3REI A;  5B0Y D;  3LJA D;  3R45 B; 
#chains in the Genus database with same CATH homology
 4WU8 D;  5AV5 D;  3W99 B;  5CP6 C;  3REK D;  3AZN C;  5E5A B;  2NQB D;  3UTA B;  3LZ0 D;  4WZS B;  3AV1 B;  3B6G C;  5G49 B;  1P3G C;  3NQU A;  4AWL C;  2HUE C;  3AZK C;  1S32 A;  3LZ1 C;  4XZQ A;  3X1V C;  3A6N D;  3VH5 T;  3AZL B;  1TZY D;  4E45 A;  4H9O A;  4JJN B;  5AV9 B;  2Y2G A;  2YFW A;  4H9N A;  2FJ7 C;  3O62 C;  4J8X D;  3WTP E;  5AV6 B;  2NZD B;  4H9Q B;  5GT3 D;  5B1L B;  4EO5 B;  5C3I C;  3LEL C;  3UTB B;  1P3A C;  3B0C T;  4WU9 B;  1ZLA C;  1P3K A;  3REJ D;  1P3O A;  5AVC A;  3WKJ C;  5AVB D;  3AZM C;  1KX5 C;  5B2J C;  5GSU D;  2Y2Q A;  1KX3 A;  3W96 D;  3X1S D;  2VQR A;  5B0Y A;  1P3P C;  2JE5 A;  3W98 D;  4CSR A;  3X1U B;  1S32 B;  5B24 A;  2NQB A;  1HTA A;  5CPJ D;  3LZ0 A;  5AY8 C;  5F99 D;  1EQZ A;  4KHA A;  4H9O B;  5BT1 C;  3KUY C;  3MGQ B;  3AZG D;  3REH C;  3TU4 D;  1KU5 A;  5AV8 D;  3LJA C;  4J8W A;  4NFT A;  3B0D C;  4X23 D;  1P3L D;  1TZY A;  4QLC D;  3AL0 C;  1P3K B;  3KXB D;  5B31 G;  1M1A A;  4ZUX C;  5AVC B;  4G92 C;  2BYM A;  5FUG A;  1P34 D;  3AV2 D;  4KUD C;  3MNN A;  4UPK A;  4J8V C;  2PYO C;  1KX3 B;  3VH5 W;  3AZJ C;  2ZY3 A;  3REL A;  3W97 B;  3A6N C;  3W99 D;  4CSR B;  5B1M A;  5BO0 A;  2FFF B;  5E5A D;  5B24 B;  2NQB B;  3UTA D;  3MGP C;  5GSU A;  1EQZ B;  2XD5 A;  2ZY5 A;  4KHA B;  3AV1 D;  4G91 C;  4J8X C;  3W96 A;  3AN2 A;  3B0C W;  3NQJ A;  5B0Z A;  3WTP C;  5B2I B;  1F66 A;  1U35 A;  4NE5 A;  4J8W B;  3AFA A;  5CPJ A;  5BNX A;  3AZL D;  2BG1 A;  5F99 A;  5B31 B;  3AZH A;  2G5H C;  5BNV A;  4NE6 A;  4JJN D;  5AVB C;  5AV9 D;  4WJ3 C;  1M1A B;  2HIO D;  2BYM B;  2G5I C;  2BYK A;  5FUG B;  3VH5 A;  3MNN B;  5AV6 D;  2Y2K A;  4Z66 C;  2NZD D;  1R4V A;  3C1C B;  3REL B;  4X23 A;  3UTB D;  3UT9 B;  4J8U D;  4WU9 D;  5CHL B;  5B1M B;  3AZF C;  4LD9 C;  4DQY B;  3KWQ C;  3A1K A;  4CAY A;  3AV2 A;  5B40 C;  3W96 B;  1TAF A;  3AN2 B;  3R45 A;  4YS3 B;  1P3M C;  3NQJ B;  5B0Z B;  5JRG A;  3X1U D;  1F66 B;  1U35 B;  2ARO C;  3MVD C;  3AFA B;  3UTA A;  2F8N A;  5BNX B;  2F8N G;  3AZI C;  3F6T A;  5F99 B;  3AZH B;  5BNV B;  1P34 C;  3KSY A;  3MGQ D;  4YM6 C;  1P3I A;  2BYK B;  1ID3 A;  5CPK A;  5DNN C;  3VH6 W;  4X23 B;  2RVQ D;  3H0M C;  1P3K D;  2HIO A;  5AVC D;  2JCH A;  2CV5 C;  3B6F C;  4CAY B;  2CWE A;  4NE3 A;  1KX3 D;  3W97 D;  5GT0 C;  4J8U A;  4WU9 A;  1KX4 C;  5JRG B;  5B32 D;  5B24 D;  1ULY A;  3X1T C;  2F8N B;  3WA9 B;  4XUJ A;  5B33 C;  1HQ3 C;  1EQZ D;  3AZN A;  1M18 B;  1P3I B;  1ID3 B;  1WWI A;  1P3F A;  2NZD C;  4H9S C;  3X1U A;  5B1L C;  3VH6 A;  5B2I D;  3REI C;  5CPK B;  3MGS B;  4J8W D;  4R8P B;  1P3G A;  1M19 C;  3WAA D;  5B31 D;  2HIO B;  3AZK A;  1M1A D;  3LZ1 A;  3MGQ A;  3X1V A;  2F8N K;  1PZR A;  5CPI A;  3AYW B;  3MNN D;  1BFM A;  4UUZ B;  3C1C D;  3REL D;  2FJ7 A;  4J8U B;  3UT9 D;  3V9R B;  1S32 C;  4XZQ C;  1WWS A;  5B1M D;  2UWX A;  4XUJ B;  3AZE D;  1P3A A;  3LEL A;  1P3B A;  1AOI C;  3W97 A;  3AZN B;  3AN2 D;  4YS3 D;  3AZM A;  1P3F B;  5B0Z D;  4KGC D;  5DNM C;  5B2J A;  1B67 A;  1F66 D;  5B32 A;  1U35 D;  3FDD A;  3B6G B;  4WV4 B;  5B32 G;  4DRB A;  3AFA D;  4AWL B;  1P3G B;  2HUE B;  1P3P A;  3AZH D;  1P3O C;  3AZK B;  1BH8 A;  2Y2H A;  4ZBJ C;  3LZ1 B;  3X1V B;  1W2E A;  5CPI B;  5AY8 A;  5B2I A;  5B0Y C;  3KFU G;  4WU8 C;  2FJ7 B;  3WAA A;  5AV5 C;  3REK C;  5B31 A;  4Z2M G;  5B24 C;  1JFI A;  2NQB C;  3LZ0 C;  5C3I B;  1P3A B;  3LEL B;  5JA4 A;  1P3B B;  3C1C A;  4ZUX A;  3UT9 A;  1KX5 B;  3AZM B;  4Z5T D;  2Y2L A;  5B2J B;  4J8W C;  5JRG D;  4KUD A;  5B32 B;  1TZY C;  3WA9 D;  3AZE A;  2F8N D;  2L5A A;  1P3P B;  1M1A C;  1BH8 B;  4E44 A;  1M18 D;  3A1I A;  4YS3 A;  1P3I D;  1BH9 A;  1ID3 D;  4KGC A;  3EPH A;  5GT3 C;  5AY8 B;  3MGP A;  2ZY2 A;  5CPK D;  3MGS D;  4R8P D;  3KUY B;  3WAA B;  2Y2I A;  4H9R B;  3REJ C;  2ZY4 A;  3MGR A;  1JFI B;  1H3O A;  1N1J A;  5GSU C;  3B0D B;  3W96 C;  5JA4 B;  3AYW D;  3X1S C;  3W98 C;  4ZUX B;  4M6B A;  4G92 B;  3C1B A;  5CPJ C;  4J8V B;  4KUD B;  2Y2M A;  4Z66 A;  5F99 C;  3AZE B;  3AZJ B;  4XUJ D;  3AZG C;  5CP6 D;  3AZF A;  4LD9 A;  1F1E A;  3AZN D;  3TU4 C;  1BH9 B;  4Z5T A;  4KGC B;  1P3F D;  2RIQ A;  5AV8 C;  3MGP B;  1Q9C A;  4X23 C;  1P3L C;  4G91 B;  3B6G D;  3WA9 A;  4QLC C;  1P3G D;  3KXB C;  2IO5 B;  3MGR B;  3WTP B;  1H3O B;  1N1J B;  3AZK D;  2LY8 A;  2ARO A;  3LZ1 D;  3AV2 C;  1M18 A;  3X1V D;  3B0B A;  3AZI A;  5CPI D;  3MGS A;  4R8P A;  2FJ7 D;  3W99 C;  4YM6 A;  3C1B B;  5E5A C;  3UTA C;  4Z66 B;  3AV1 C;  1P3A D;  3LEL D;  3AYW A;  1P3B D;  5GXQ A;  2W8S A;  1P3I C;  4UUZ A;  3AZF B;  4LD9 B;  3KWQ B;  1KX5 D;  4Z5T B;  3V9R A;  3AZM D;  2CV5 A;  5B2J D;  3H0R C;  5B40 B;  3AZL C;  5BS7 A;  4JJN C;  5GT0 A;  5AV9 C;  1P3M B;  1P3P D;  2HIO C;  1KX4 A;  4H9P A;  5CP6 A;  2DQN C;  2ARO B;  3X1T A;  5B33 A;  5AV6 C;  3AZI B;  5AY8 D;  4EO5 C;  3UTB C;  3B6G A;  4J8U C;  4WU9 C;  5BT1 D;  3KUY D;  4YM6 B;  3REH D;  4H9S A;  5DNN B;  1M19 A;  5GXQ B;  1P3F C;  4ZUX D;  3O62 A;  2J8P A;  4HGA B;  3X1U C;  2CV5 B;  3B6F B;  4KUD D;  4J8V D;  2PYO D;  3AZJ D;  5GT0 B;  1ZLA A;  3EG5 B;  1KX4 B;  3MGQ C;  4H9P B;  5CP6 B;  4DRA A;  3X1T B;  3WKJ A;  5CPI C;  1KX5 A;  2JSS A;  1HQ3 B;  5B33 B;  3MGP D;  2RVQ C;  2Y2N A;  1AOI A;  1P3K C;  2F8N H;  5KDM A;  5AVC C;  3MGR D;  5DNM A;  3WTP D;  3REI B;  1P3B C;  1M19 B;  1KX3 C;  3W97 C;  3EPJ A;  2Y2P A;  3KUY A;  3O62 B;  3C1B D;  3IP4 C;  4H9R A;  5B32 C;  3REH A;  3NQU B;  4Z66 D;  3LJA A;  1EQZ C;  4WU8 A;  5AV5 A;  1ZLA B;  3REK A;  1Z2C B;  4XZQ B;  3AZF D;  4LD9 D;  3WKJ B;  3KWQ D;  5B2I C;  2YFV A;  4J8V A;  4H9N B;  2YFW B;  3WAA C;  2PYO A;  5B40 D;  1AOI B;  3AZJ A;  2Y2J A;  5B31 C;  1A7W A;  1P3M D;  5KDM B;  1T3U A;  3A6N A;  5DNM B;  2F2A C;  2ARO D;  3MVD D;  3MNN C;  3AZI D;  3C1C C;  4WNN A;  3REL C;  1P3O B;  3UT9 C;  4J8X A;  4ZBJ B;  4YM6 D;  5B1M C;  3REH B;  5GT3 A;  3WTP A;  3AZE C;  5B0Y B;  3LJA B;  5DNN D;  4WU8 B;  5AV5 B;  3REJ A;  3REK B;  3AN2 C;  2Y2O A;  5GXQ D;  5AVB A;  4YS3 C;  5B0Z C;  2XD1 A;  4KGC C;  3VH6 T;  3LZ0 B;  2YFV B;  2CV5 D;  1U35 C;  1F66 C;  3B6F D;  3AFA C;  3X1S A;  2PYO B;  3P5J B;  3W98 A;  3AZH C;  2IO5 C;  3MGR C;  5GT0 D;  1KX4 D;  3A6N B;  1TZY B;  3X1T D;  3KWQ A;  5B33 D;  1HQ3 D;  4WNN B;  5B40 A;  3AZG A;  4J8X B;  1B6W A;  3C1B C;  3EPK A;  3TU4 A;  1P3M A;  5AV8 A;  5GT3 B;  5B1L D;  1P3L A;  3MVD A;  3REI D;  4QLC A;  1M19 D;  3KXB A;  3REJ B;  5BO0 B;  5AVB B;  4Z5T C;  1P34 A;  3O62 D;  5GSU B;  5JRG C;  3EPL A;  4Z2M H;  3WA9 C;  3X1S B;  3W98 B;  5DNN A;  3W99 A;  1ZLA D;  1S32 D;  5E5A A;  1M18 C;  4XZQ D;  5CPJ B;  3H0L C;  1ID3 C;  2ZM5 A;  3WKJ D;  3AV1 A;  3B6F A;  5CPK C;  3MGS C;  5G49 A;  4R8P C;  3AZG B;  1AOI D;  2DF4 C;  3TU4 B;  5AV8 B;  5DNM D;  1P3L B;  3MVD B;  3AZL A;  4QLC B;  3AYW C;  1HQ3 A;  3KXB B;  4JJN A;  5GXQ C;  5AV9 A;  1P3O D;  4HGA C;  1P34 B;  3AV2 B;  5AV6 A;  2NZD A;  4H9Q A;  5BS7 C;  1TAF B;  5B1L A;  4XUJ C;  3UTB A;  3REI A;  5B0Y D;  3LJA D;  3R45 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...