4X23A

Crystal structure of cenp-c in complex with the nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
95
structure length
95
Chain Sequence
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords DNA (147-MER)
total genus 26
structure length 95
sequence length 95
chains with identical sequence E, K, O
ec nomenclature
pdb deposition date 2014-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4x23A00
4KUDC 2F8NK 5CPIC 2RVQC 3W99D 4UUZA 3KWQA 1EQZC 3REIA 1P3GB 1P3GC 3AN2D 4H9PB 3UTBA 1KX3A 3AZEB 3RELA 4X23C 5AY8D 3MNNC 5BNXA 4H9NA 4WU8B 3REHD 1F66A 2FJ7D 3MNNB 5KDMB 5B2IB 5AY8C 3C1BB 3UTAC 3B0BA 4NE5A 4H9SC 4EO5C 3C1BA 3UTAD 4EO5B 5B40B 5DNNC 1N1JB 1M1AA 3VH6T 3B6FB 5AVBC 3MGQC 5CPID 1EQZD 1S32B 3MGQB 5AV5A 5F99A 4H9RA 3W98B 4J8WA 3REJC 5B24C 3AZGC 3REJB 1M1AD 3AYWC 5AVCA 1ID3B 4WNNB 5GXQC 1KU5A 2LY8A 3C1CC 5B33C 5AV9D 5DNND 5B40A 3VH6A 4AWLC 3REHB 1TZYA 1F66C 4Z5TB 5CPKD 1U35D 3AZJA 4YS3A 1P3PB 4KGCB 5B0ZB 2BYMA 4ZUXD 5B24D 5B32B 3AN2C 4J8WB 1P3MC 3MGRA 1JFIB 5AV8B 4KGCA 1P3MB 3MGPA 3LELD 3LJAC 5B2JA 3WTPD 3WKJA 4WU9A 2CV5A 1M18A 3A6NB 4CSRB 3X1TB 3X1UD 4JJND 4Z2MG 3TU4C 3X1TC 2AROB 3NQUA 2NQBD 1P3AA 3TU4B 4J8VC 3AZLC 2F8NH 4YS3D 3AZJD 1HQ3C 3W97B 3B6FD 4Z66A 1P3BC 3NQJA 1WWSA 1P3BB 1KX5B 4XZQA 5B1LC 3WAAC 3O62D 3WA9C 4X23A 5AV9A 4WU8C 5B2IC 5B31D 5B33A 3AFAD 5BS7C 1P3KB 1P3KC 3MNND 3AZMB 5B1MA 3TU4D 1P3GD 4LD9D 2AROA 1HQ3D 2F8NG 1ZLAC 3NQUB 3REJA 2PYOB 4Z66B 3X1UA 4JJNA 3W98A 5B24B 4LD9B 2PYOD 5DNMC 5BNXB 3B0CW 1TAFA 5AV6C 3MGRD 5AVBD 1TAFB 1H3OA 5CPKC 1U35C 3REHA 4H9NB 5GT0A 3AZEA 3W96B 3REKD 5B1LA 3AV1C 3W96C 3KUYB 3REKC 1KX5D 5BNVB 3REKB 4Z5TC 3AZHB 3AV2A 1P34B 1P3BD 1B6WA 3LZ0A 2AROD 5CPJB 5AV8C 4NE6A 3KXBC 2NZDB 3LJAA 3MGQD 3A6NC 4ZUXC 1P3LB 1P3BA 3B6GC 3AV2D 4LD9A 1P3PD 5G49B 5BO0A 4XZQD 4XUJB 3WAAA 3MVDD 5KDMA 5BO0B 5AV9C 4R8PD 4WU8A 4ZBJB 3AZED 5B31A 5B2IA 3MGRB 3MVDB 2JSSA 3MGPB 1P3FD 3X1VC 3X1VB 3O62C 5CPJA 3UTBD 1P3IB 3WTPA 2RVQD 3W99C 4QLCA 5GSUA 5CP6D 3REJD 1BH9B 3NQJB 1KX5A 1P34D 4CAYA 5E5AB 5CPJD 3LELC 5CPIB 1EQZB 2IO5B 3LELB 4ZUXA 5AV6B 1ID3A 2HUEC 2HUEB 5AV5D 3X1VD 5BS7A 5JRGA 4J8UD 4X23B 3V9RA 3AFAA 3MVDA 3AZFC 4E45A 3KUYD 4HGAB 5B33D 3WAAD 5AY8B 3UT9D 3W96A 1P3OA 4G92B 2F8NB 4G92C 3UTAA 3AZJB 4YS3B 4J8XB 1P3PA 4Z5TA 4YM6B 3B6FA 5DNNB 2F8NA 3X1UB 4JJNB 1N1JA 1JFIA 4J8XA 3KXBA 3X1VA 5B0ZA 2FJ7A 2BYKA 3O62A 5CPJC 4KUDD 3KXBB 1S32C 3AZID 2NZDC 1P3OD 2YFVA 3AZNC 3W98C 4KUDB 3B0DC 2PYOA 3B0DB 4WV4B 2F8ND 5AVCB 4Z5TD 5B24A 3AYWB 4YM6D 3REIC 3AZEC 3B6GA 5B2JD 2L5AA 5BNVA 3REKA 1KX3D 4XUJC 3AV1A 5B40D 5B1LD 1KX3C 5B31G 3AV2B 1P34A 3AV2C 5B40C 3AZFA 1P3IA 5B2JB 5B0YC 3W97D 2CWEA 5B0YB 4KHAA 2FJ7B 3LZ0C 2NQBB 5GSUB 4DRBA 4QLCB 5B32C 1AOIA 2NZDD 2YFVB 5DNNA 3WTPC 4KUDA 1M19C 3WTPB 1P3MA 1M19B 3AZIB 4G91C 1F1EA 3VH5W 3KWQC 4G91B 4H9QA 3MNNA 5AV8D 1HQ3B 5B1MD 3TU4A 3C1CB 1AOID 5B0ZD 3UT9C 3AZMD 3MGPD 1P3FB 4XUJD 5JA4A 4H9SA 4WU8D 5JRGD 4R8PB 4J8UA 3AZFB 3AFAC 5B1MB 4HGAC 5C3IB 3V9RB 3AFAB 3C1BC 2NQBA 1P3PC 5AV5B 5AV5C 4YS3C 3AZJC 4J8XC 3W99A 1TZYC 4Z66D 4YM6C 3REID 1TZYB 3B6FC 3MGSD 5F99C 3LZ1C 5F99B 4H9QB 4QLCD 5GSUD 4WU9D 2CV5D 1M18D 2AROC 3AYWA 3W97A 5GXQA 3RELC 3KSYA 5B0YD 1P3FA 3MGSA 1ID3C 5B1LB 3X1TA 4H9PA 3UTBB 5AY8A 5DNMA 1HQ3A 5JRGC 1ULYA 3UTAB 5CPKB 1U35B 2YFWA 3W96D 4XZQC 1KX3B 4AWLB 2YFWB 3AV1B 5B0YA 3KUYC 1HTAA 5GXQD 3VH5T 1F66B 5AVBB 5B2JC 3C1CD 1AOIB 1P3OB 5AVCD 3AZMA 5B32A 1AOIC 4KGCC 5B0ZC 1M19A 4J8WC 3AZHA 3RELD 4WU9C 2CV5C 1M18C 2PYOC 4NFTA 3VH6W 4J8WD 3AZNA 4E44A 1KX4A 1P3AD 5BT1C 3AZIC 1ZLAA 4UUZB 3KWQB 4J8VB 3AZLB 4CAYB 4H9OA 1BFMA 5B33B 3B6GB 5B31B 1P3KD 3LZ0D 4J8UB 3UT9B 4J8UC 1P3FC 4XUJA 3WAAB 3REHC 5GT0D 4NE3A 3R45A 3WA9B 1B67A 5FUGB 5B1MC 5C3IC 5CPKA 4R8PA 1U35A 4ZBJC 1H3OB 5FUGA 3WA9D 5AV6D 3MGRC 2HIOA 3MGPC 5DNMD 5BT1D 3B6GD 3A6ND 4YM6A 3AZKA 5E5AA 1BH8B 1A7WA 3LZ1B 4J8VA 3AZLA 3AZND 1ZLAB 2BYMB 4ZUXB 5AV6A 3W97C 1TZYD 4Z66C 1ZLAD 1P3ID 4WNNA 5B32D 3RELB 5GT3A 3LZ1D 1KX5C 4J8XD 4M6BA 3UTBC 5CPIA 1EQZA 5GT0C 5JRGB 1F66D 5AV9B 5JA4B 3KUYA 3X1SC 4XZQB 3X1SB 2BYKB 3O62B 3AZMC 1BH8A 5GT3D 3LZ1A 1M1AB 1M1AC 1P3OC 1ID3D 5AVBA 5AV8A 4H9RB 4Z2MH 3X1UC 4JJNC 3MGQA 4CSRA 1M19D 1P3LA 3LJAD 1S32D 4WU9B 2CV5B 1M18B 4J8VD 3AZLD 5CP6B 3WTPE 5E5AD 3AZKB 5F99D 3W98D 4LD9C 3AZKC 5B32G 5DNMB 5E5AC 5CP6A 4H9OB 1WWIA 4DRAA 3MGSC 3MGSB 3X1SD 3AZGA 3LELA 4KGCD 3REIB 1P3GA 5B31C 5GT3B 3B0CT 5GT3C 5B2ID 3AV1D 3AYWD 3MVDC 3AZHC 1P34C 3X1SA 3AZGD 1BH9A 1KX4B 4WZSB 1KX4C 3A6NA 4QLCC 5GSUC 3WKJB 3KXBD 1KX4D 1R4VA 3WKJC 1P3LD 1S32A 3AZGB 3AZIA 1P3LC 5AVCC 5GXQB 5CHLB 3C1CA 5G49A 2IO5C 3AZHD 5GT0B 2HIOB 4X23D 2HIOC 3UT9A 3C1BD 4R8PC 2HIOD 3R45B 3WA9A 3VH5A 3AZFD 2FJ7C 1P3IC 3KWQD 3LZ0B 3X1TD 2NQBC 4KHAB 3AN2B 3AZKD 3LJAB 1Q9CA 3W99B 3AN2A 3WKJD 2NZDA 1P3KA 1P3AB 5CP6C 1P3AC 1P3MD 3AZNB
chains in the Genus database with same CATH superfamily
4KUDC 2F8NK 5CPIC 2RVQC 3W99D 4UUZA 3KWQA 1EQZC 3REIA 1P3GB 1P3GC 3AN2D 4H9PB 3UTBA 1KX3A 3AZEB 3RELA 4X23C 5AY8D 3MNNC 5BNXA 4H9NA 4WU8B 3REHD 1F66A 2FJ7D 3MNNB 5KDMB 5B2IB 5AY8C 3C1BB 3UTAC 3B0BA 4NE5A 4H9SC 4EO5C 3C1BA 3UTAD 4EO5B 5B40B 5DNNC 1N1JB 2DF4C 1M1AA 3VH6T 3B6FB 5AVBC 3MGQC 5CPID 1EQZD 1S32B 3MGQB 5AV5A 5F99A 4H9RA 3W98B 4J8WA 3REJC 5B24C 3AZGC 3REJB 1M1AD 3H0LC 3AYWC 5AVCA 1ID3B 4WNNB 5GXQC 1KU5A 2J8PA 2LY8A 3C1CC 5B33C 5AV9D 5DNND 5B40A 3VH6A 4AWLC 3REHB 1TZYA 1F66C 4Z5TB 5CPKD 1U35D 3AZJA 4YS3A 1P3PB 4KGCB 2F2AC 5B0ZB 2BYMA 4ZUXD 5B24D 5B32B 3AN2C 4J8WB 1P3MC 3MGRA 1JFIB 5AV8B 4KGCA 1P3MB 3MGPA 3LELD 3LJAC 5B2JA 3WTPD 3WKJA 4WU9A 2CV5A 1M18A 3A6NB 4CSRB 3X1TB 3X1UD 4JJND 4Z2MG 3TU4C 3X1TC 2AROB 3NQUA 2NQBD 1P3AA 3TU4B 1PZRA 4J8VC 3AZLC 2F8NH 4YS3D 3FDDA 1HQ3C 3AZJD 3W97B 3KFUG 2JE5A 3B6FD 2XD5A 4Z66A 1P3BC 3NQJA 1WWSA 1P3BB 1KX5B 4XZQA 5B1LC 3WAAC 3O62D 3WA9C 4X23A 5AV9A 4WU8C 3H0MC 5B2IC 5B31D 5B33A 3AFAD 2Y2LA 5BS7C 1P3KB 1P3KC 3MNND 3AZMB 5B1MA 3TU4D 1P3GD 4LD9D 2AROA 1HQ3D 2F8NG 1ZLAC 3NQUB 3REJA 2PYOB 4Z66B 3X1UA 4JJNA 3W98A 5B24B 4LD9B 2PYOD 5DNMC 5BNXB 3B0CW 1TAFA 5AV6C 3MGRD 5AVBD 1TAFB 1H3OA 5CPKC 1U35C 3REHA 4H9NB 5GT0A 3AZEA 3W96B 3REKD 5B1LA 3AV1C 3W96C 3KUYB 3REKC 1KX5D 5BNVB 3REKB 4Z5TC 3AZHB 3AV2A 1P34B 1P3BD 1B6WA 3LZ0A 2AROD 5CPJB 5AV8C 4NE6A 3KXBC 2NZDB 3LJAA 3MGQD 3A6NC 4ZUXC 1P3LB 1P3BA 3B6GC 3AV2D 4LD9A 2RIQA 1P3PD 5G49B 5BO0A 4XZQD 4XUJB 3WAAA 3MVDD 5KDMA 5BO0B 5AV9C 4WU8A 4R8PD 1T3UA 4ZBJB 5B31A 4DQYB 5B2IA 3AZED 3MGRB 3MVDB 2JSSA 3MGPB 1P3FD 3X1VC 3X1VB 3O62C 5CPJA 3UTBD 1P3IB 3WTPA 2Y2NA 2RVQD 3W99C 4QLCA 5GSUA 5CP6D 3REJD 1BH9B 3NQJB 1KX5A 1P34D 4CAYA 5E5AB 5CPJD 3LELC 5CPIB 1EQZB 2IO5B 3LELB 4ZUXA 5AV6B 1ID3A 2HUEC 2ZM5A 2HUEB 5AV5D 3X1VD 3IP4C 5BS7A 5JRGA 4J8UD 4X23B 3V9RA 3AFAA 3MVDA 3EPLA 3AZFC 4E45A 3KUYD 4HGAB 5B33D 3WAAD 2XD1A 5AY8B 3UT9D 3W96A 1P3OA 4G92B 2F8NB 4G92C 3UTAA 3AZJB 4YS3B 4J8XB 1P3PA 4Z5TA 4YM6B 3B6FA 5DNNB 2F8NA 3AL0C 3X1UB 4JJNB 1N1JA 1JFIA 4J8XA 3KXBA 3X1VA 5B0ZA 2FJ7A 2BYKA 3O62A 5CPJC 4KUDD 3KXBB 1S32C 3AZID 2NZDC 1P3OD 2YFVA 3AZNC 3W98C 4KUDB 3B0DC 2ZY3A 2PYOA 3B0DB 4WV4B 2F8ND 5AVCB 4Z5TD 5B24A 3AYWB 4YM6D 3REIC 3AZEC 3B6GA 2Y2MA 2Y2QA 5B2JD 2L5AA 5BNVA 3REKA 1KX3D 4XUJC 3EPKA 5B40D 5B1LD 3AV1A 1KX3C 5B31G 3AV2B 1P34A 2ZY2A 3AV2C 5B40C 3AZFA 1P3IA 2ZY4A 5B2JB 5B0YC 3W97D 2CWEA 5B0YB 4KHAA 2FJ7B 3LZ0C 2NQBB 5GSUB 4DRBA 4QLCB 5B32C 1AOIA 2NZDD 2YFVB 5DNNA 3WTPC 4KUDA 1M19C 3WTPB 1P3MA 1M19B 1W2EA 3AZIB 4G91C 1F1EA 3VH5W 3KWQC 4G91B 4H9QA 3MNNA 3A1KA 5AV8D 1HQ3B 5B1MD 3TU4A 3C1CB 1AOID 5B0ZD 3UT9C 3AZMD 3MGPD 1P3FB 4XUJD 5JA4A 4H9SA 3EPHA 4WU8D 5JRGD 4R8PB 4J8UA 3AZFB 3AFAC 5B1MB 4HGAC 5C3IB 3V9RB 3AFAB 3C1BC 2NQBA 1P3PC 5AV5B 5AV5C 4YS3C 3AZJC 4J8XC 3W99A 1TZYC 4Z66D 4YM6C 3REID 1TZYB 3B6FC 3MGSD 5F99C 3LZ1C 5F99B 4H9QB 4QLCD 5GSUD 3F6TA 4WU9D 2CV5D 1M18D 2AROC 3AYWA 3W97A 5GXQA 3RELC 3KSYA 5B0YD 1P3FA 3MGSA 1ID3C 5B1LB 3X1TA 4H9PA 3UTBB 5AY8A 5DNMA 1HQ3A 5JRGC 1ULYA 3UTAB 5CPKB 1U35B 2YFWA 3W96D 4XZQC 1KX3B 4AWLB 2YFWB 3AV1B 5B0YA 2G5HC 3KUYC 1HTAA 5GXQD 3VH5T 1F66B 5AVBB 5B2JC 3C1CD 1AOIB 1P3OB 5AVCD 2UWXA 5B32A 3AZMA 1AOIC 2Y2HA 4KGCC 5B0ZC 1M19A 4UPKA 4J8WC 3AZHA 3RELD 4WU9C 2CV5C 1M18C 2PYOC 4NFTA 3VH6W 4J8WD 3AZNA 4E44A 1KX4A 1P3AD 5BT1C 3AZIC 1ZLAA 4UUZB 3KWQB 4J8VB 3AZLB 3H0RC 4CAYB 4H9OA 1BFMA 5B33B 3B6GB 5B31B 1P3KD 3LZ0D 4J8UB 3UT9B 4J8UC 1P3FC 4XUJA 3WAAB 3REHC 5GT0D 4NE3A 3R45A 3WA9B 1B67A 5FUGB 5B1MC 5C3IC 5CPKA 4R8PA 1U35A 4ZBJC 1H3OB 5FUGA 3WA9D 5AV6D 3MGRC 2HIOA 3MGPC 5DNMD 2FFFB 5BT1D 3B6GD 3A6ND 4YM6A 3AZKA 4WJ3C 5E5AA 1BH8B 1A7WA 3LZ1B 4J8VA 3AZLA 3AZND 1ZLAB 2BYMB 4ZUXB 5AV6A 3W97C 1TZYD 4Z66C 1ZLAD 1P3ID 4WNNA 5B32D 3RELB 5GT3A 3LZ1D 1KX5C 1Z2CB 4J8XD 4M6BA 3UTBC 5CPIA 1EQZA 5GT0C 5JRGB 3P5JB 1F66D 5AV9B 5JA4B 3KUYA 3X1SC 4XZQB 3X1SB 2BYKB 3O62B 3AZMC 1BH8A 5GT3D 3LZ1A 1M1AB 1M1AC 1P3OC 1ID3D 5AVBA 5AV8A 4H9RB 2Y2PA 4Z2MH 3X1UC 4JJNC 3MGQA 4CSRA 1M19D 1P3LA 3LJAD 1S32D 4WU9B 2CV5B 1M18B 2Y2KA 4J8VD 3AZLD 3A1IA 5CP6B 5E5AD 3WTPE 3AZKB 2W8SA 5F99D 3W98D 4LD9C 3AZKC 5B32G 5DNMB 5E5AC 5CP6A 4H9OB 1WWIA 4DRAA 3MGSC 2G5IC 3MGSB 3X1SD 3AZGA 3LELA 4KGCD 3REIB 1P3GA 5B31C 5GT3B 3B0CT 5GT3C 2VQRA 5B2ID 3AV1D 3AYWD 3MVDC 3AZHC 1P34C 3X1SA 3AZGD 1BH9A 3EG5B 1KX4B 4WZSB 1KX4C 3A6NA 2BG1A 4QLCC 5GSUC 3WKJB 3KXBD 1KX4D 1R4VA 3WKJC 1P3LD 1S32A 3AZGB 2Y2OA 3AZIA 2Y2GA 1P3LC 5AVCC 5GXQB 2Y2JA 5CHLB 2Y2IA 3C1CA 5G49A 2IO5C 3AZHD 5GT0B 2HIOB 3EPJA 4X23D 2HIOC 3UT9A 3C1BD 4R8PC 2HIOD 2JCHA 3R45B 3WA9A 3VH5A 3AZFD 2FJ7C 1P3IC 3KWQD 3LZ0B 3X1TD 2NQBC 2ZY5A 4KHAB 2DQNC 3AZKD 3AN2B 3LJAB 1Q9CA 3W99B 3AN2A 3WKJD 2NZDA 1P3KA 1P3AB 5CP6C 1P3AC 1P3MD 3AZNB
chains in the Genus database with same CATH topology
4KUDC 2F8NK 5CPIC 2RVQC 3W99D 4UUZA 3KWQA 1EQZC 3REIA 1P3GB 1P3GC 3AN2D 4H9PB 3UTBA 1KX3A 3AZEB 3RELA 4X23C 5AY8D 3MNNC 5BNXA 4H9NA 4WU8B 3REHD 1F66A 2FJ7D 3MNNB 5KDMB 5B2IB 5AY8C 3C1BB 3UTAC 3B0BA 4NE5A 4H9SC 4EO5C 3C1BA 3UTAD 4EO5B 5B40B 5DNNC 1N1JB 2DF4C 1M1AA 3VH6T 3B6FB 5AVBC 3MGQC 5CPID 1EQZD 1S32B 3MGQB 5AV5A 5F99A 4H9RA 3W98B 4J8WA 3REJC 5B24C 3AZGC 3REJB 1M1AD 3H0LC 3AYWC 5AVCA 1ID3B 4WNNB 5GXQC 1KU5A 2J8PA 2LY8A 3C1CC 5B33C 5AV9D 5DNND 5B40A 3VH6A 4AWLC 3REHB 1TZYA 1F66C 4Z5TB 5CPKD 1U35D 3AZJA 4YS3A 1P3PB 4KGCB 2F2AC 5B0ZB 2BYMA 4ZUXD 5B24D 5B32B 3AN2C 4J8WB 1P3MC 3MGRA 1JFIB 5AV8B 4KGCA 1P3MB 3MGPA 3LELD 3LJAC 5B2JA 3WTPD 3WKJA 4WU9A 2CV5A 1M18A 3A6NB 4CSRB 3X1TB 3X1UD 4JJND 4Z2MG 3TU4C 3X1TC 2AROB 3NQUA 2NQBD 1P3AA 3TU4B 1PZRA 4J8VC 3AZLC 2F8NH 4YS3D 3FDDA 1HQ3C 3AZJD 3W97B 3KFUG 2JE5A 3B6FD 2XD5A 4Z66A 1P3BC 3NQJA 1WWSA 1P3BB 1KX5B 4XZQA 5B1LC 3WAAC 3O62D 3WA9C 4X23A 5AV9A 4WU8C 3H0MC 5B2IC 5B31D 5B33A 3AFAD 2Y2LA 5BS7C 1P3KB 1P3KC 3MNND 3AZMB 5B1MA 3TU4D 1P3GD 4LD9D 2AROA 1HQ3D 2F8NG 1ZLAC 3NQUB 3REJA 2PYOB 4Z66B 3X1UA 4JJNA 3W98A 5B24B 4LD9B 2PYOD 5DNMC 5BNXB 3B0CW 1TAFA 5AV6C 3MGRD 5AVBD 1TAFB 1H3OA 5CPKC 1U35C 3REHA 4H9NB 5GT0A 3AZEA 3W96B 3REKD 5B1LA 3AV1C 3W96C 3KUYB 3REKC 1KX5D 5BNVB 3REKB 4Z5TC 3AZHB 3AV2A 1P34B 1P3BD 1B6WA 3LZ0A 2AROD 5CPJB 5AV8C 4NE6A 3KXBC 2NZDB 3LJAA 3MGQD 3A6NC 4ZUXC 1P3LB 1P3BA 3B6GC 3AV2D 4LD9A 2RIQA 1P3PD 5G49B 5BO0A 4XZQD 4XUJB 3WAAA 3MVDD 5KDMA 5BO0B 5AV9C 4WU8A 4R8PD 1T3UA 4ZBJB 5B31A 4DQYB 5B2IA 3AZED 3MGRB 3MVDB 2JSSA 3MGPB 1P3FD 3X1VC 3X1VB 3O62C 5CPJA 3UTBD 1P3IB 3WTPA 2Y2NA 2RVQD 3W99C 4QLCA 5GSUA 5CP6D 3REJD 1BH9B 3NQJB 1KX5A 1P34D 4CAYA 5E5AB 5CPJD 3LELC 5CPIB 1EQZB 2IO5B 3LELB 4ZUXA 5AV6B 1ID3A 2HUEC 2ZM5A 2HUEB 5AV5D 3X1VD 3IP4C 5BS7A 5JRGA 4J8UD 4X23B 3V9RA 3AFAA 3MVDA 3EPLA 3AZFC 4E45A 3KUYD 4HGAB 5B33D 3WAAD 2XD1A 5AY8B 3UT9D 3W96A 1P3OA 4G92B 2F8NB 4G92C 3UTAA 3AZJB 4YS3B 4J8XB 1P3PA 4Z5TA 4YM6B 3B6FA 5DNNB 2F8NA 3AL0C 3X1UB 4JJNB 1N1JA 1JFIA 4J8XA 3KXBA 3X1VA 5B0ZA 2FJ7A 2BYKA 3O62A 5CPJC 4KUDD 3KXBB 1S32C 3AZID 2NZDC 1P3OD 2YFVA 3AZNC 3W98C 4KUDB 3B0DC 2ZY3A 2PYOA 3B0DB 4WV4B 2F8ND 5AVCB 4Z5TD 5B24A 3AYWB 4YM6D 3REIC 3AZEC 3B6GA 2Y2MA 2Y2QA 5B2JD 2L5AA 5BNVA 3REKA 1KX3D 4XUJC 3EPKA 5B40D 5B1LD 3AV1A 1KX3C 5B31G 3AV2B 1P34A 2ZY2A 3AV2C 5B40C 3AZFA 1P3IA 2ZY4A 5B2JB 5B0YC 3W97D 2CWEA 5B0YB 4KHAA 2FJ7B 3LZ0C 2NQBB 5GSUB 4DRBA 4QLCB 5B32C 1AOIA 2NZDD 2YFVB 5DNNA 3WTPC 4KUDA 1M19C 3WTPB 1P3MA 1M19B 1W2EA 3AZIB 4G91C 1F1EA 3VH5W 3KWQC 4G91B 4H9QA 3MNNA 3A1KA 5AV8D 1HQ3B 5B1MD 3TU4A 3C1CB 1AOID 5B0ZD 3UT9C 3AZMD 3MGPD 1P3FB 4XUJD 5JA4A 4H9SA 3EPHA 4WU8D 5JRGD 4R8PB 4J8UA 3AZFB 3AFAC 5B1MB 4HGAC 5C3IB 3V9RB 3AFAB 3C1BC 2NQBA 1P3PC 5AV5B 5AV5C 4YS3C 3AZJC 4J8XC 3W99A 1TZYC 4Z66D 4YM6C 3REID 1TZYB 3B6FC 3MGSD 5F99C 3LZ1C 5F99B 4H9QB 4QLCD 5GSUD 3F6TA 4WU9D 2CV5D 1M18D 2AROC 3AYWA 3W97A 5GXQA 3RELC 3KSYA 5B0YD 1P3FA 3MGSA 1ID3C 5B1LB 3X1TA 4H9PA 3UTBB 5AY8A 5DNMA 1HQ3A 5JRGC 1ULYA 3UTAB 5CPKB 1U35B 2YFWA 3W96D 4XZQC 1KX3B 4AWLB 2YFWB 3AV1B 5B0YA 2G5HC 3KUYC 1HTAA 5GXQD 3VH5T 1F66B 5AVBB 5B2JC 3C1CD 1AOIB 1P3OB 5AVCD 2UWXA 5B32A 3AZMA 1AOIC 2Y2HA 4KGCC 5B0ZC 1M19A 4UPKA 4J8WC 3AZHA 3RELD 4WU9C 2CV5C 1M18C 2PYOC 4NFTA 3VH6W 4J8WD 3AZNA 4E44A 1KX4A 1P3AD 5BT1C 3AZIC 1ZLAA 4UUZB 3KWQB 4J8VB 3AZLB 3H0RC 4CAYB 4H9OA 1BFMA 5B33B 3B6GB 5B31B 1P3KD 3LZ0D 4J8UB 3UT9B 4J8UC 1P3FC 4XUJA 3WAAB 3REHC 5GT0D 4NE3A 3R45A 3WA9B 1B67A 5FUGB 5B1MC 5C3IC 5CPKA 4R8PA 1U35A 4ZBJC 1H3OB 5FUGA 3WA9D 5AV6D 3MGRC 2HIOA 3MGPC 5DNMD 2FFFB 5BT1D 3B6GD 3A6ND 4YM6A 3AZKA 4WJ3C 5E5AA 1BH8B 1A7WA 3LZ1B 4J8VA 3AZLA 3AZND 1ZLAB 2BYMB 4ZUXB 5AV6A 3W97C 1TZYD 4Z66C 1ZLAD 1P3ID 4WNNA 5B32D 3RELB 5GT3A 3LZ1D 1KX5C 1Z2CB 4J8XD 4M6BA 3UTBC 5CPIA 1EQZA 5GT0C 5JRGB 3P5JB 1F66D 5AV9B 5JA4B 3KUYA 3X1SC 4XZQB 3X1SB 2BYKB 3O62B 3AZMC 1BH8A 5GT3D 3LZ1A 1M1AB 1M1AC 1P3OC 1ID3D 5AVBA 5AV8A 4H9RB 2Y2PA 4Z2MH 3X1UC 4JJNC 3MGQA 4CSRA 1M19D 1P3LA 3LJAD 1S32D 4WU9B 2CV5B 1M18B 2Y2KA 4J8VD 3AZLD 3A1IA 5CP6B 5E5AD 3WTPE 3AZKB 2W8SA 5F99D 3W98D 4LD9C 3AZKC 5B32G 5DNMB 5E5AC 5CP6A 4H9OB 1WWIA 4DRAA 3MGSC 2G5IC 3MGSB 3X1SD 3AZGA 3LELA 4KGCD 3REIB 1P3GA 5B31C 5GT3B 3B0CT 5GT3C 2VQRA 5B2ID 3AV1D 3AYWD 3MVDC 3AZHC 1P34C 3X1SA 3AZGD 1BH9A 3EG5B 1KX4B 4WZSB 1KX4C 3A6NA 2BG1A 4QLCC 5GSUC 3WKJB 3KXBD 1KX4D 1R4VA 3WKJC 1P3LD 1S32A 3AZGB 2Y2OA 3AZIA 2Y2GA 1P3LC 5AVCC 5GXQB 2Y2JA 5CHLB 2Y2IA 3C1CA 5G49A 2IO5C 3AZHD 5GT0B 2HIOB 3EPJA 4X23D 2HIOC 3UT9A 3C1BD 4R8PC 2HIOD 2JCHA 3R45B 3WA9A 3VH5A 3AZFD 2FJ7C 1P3IC 3KWQD 3LZ0B 3X1TD 2NQBC 2ZY5A 4KHAB 2DQNC 3AZKD 3AN2B 3LJAB 1Q9CA 3W99B 3AN2A 3WKJD 2NZDA 1P3KA 1P3AB 5CP6C 1P3AC 1P3MD 3AZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUD C;  2F8N K;  5CPI C;  2RVQ C;  3W99 D;  4UUZ A;  3KWQ A;  1EQZ C;  3REI A;  1P3G B;  1P3G C;  3AN2 D;  4H9P B;  3UTB A;  1KX3 A;  3AZE B;  3REL A;  4X23 C;  5AY8 D;  3MNN C;  5BNX A;  4H9N A;  4WU8 B;  3REH D;  1F66 A;  2FJ7 D;  3MNN B;  5KDM B;  5B2I B;  5AY8 C;  3C1B B;  3UTA C;  3B0B A;  4NE5 A;  4H9S C;  4EO5 C;  3C1B A;  3UTA D;  4EO5 B;  5B40 B;  5DNN C;  1N1J B;  1M1A A;  3VH6 T;  3B6F B;  5AVB C;  3MGQ C;  5CPI D;  1EQZ D;  1S32 B;  3MGQ B;  5AV5 A;  5F99 A;  4H9R A;  3W98 B;  4J8W A;  3REJ C;  5B24 C;  3AZG C;  3REJ B;  1M1A D;  3AYW C;  5AVC A;  1ID3 B;  4WNN B;  5GXQ C;  1KU5 A;  2LY8 A;  3C1C C;  5B33 C;  5AV9 D;  5DNN D;  5B40 A;  3VH6 A;  4AWL C;  3REH B;  1TZY A;  1F66 C;  4Z5T B;  5CPK D;  1U35 D;  3AZJ A;  4YS3 A;  1P3P B;  4KGC B;  5B0Z B;  2BYM A;  4ZUX D;  5B24 D;  5B32 B;  3AN2 C;  4J8W B;  1P3M C;  3MGR A;  1JFI B;  5AV8 B;  4KGC A;  1P3M B;  3MGP A;  3LEL D;  3LJA C;  5B2J A;  3WTP D;  3WKJ A;  4WU9 A;  2CV5 A;  1M18 A;  3A6N B;  4CSR B;  3X1T B;  3X1U D;  4JJN D;  4Z2M G;  3TU4 C;  3X1T C;  2ARO B;  3NQU A;  2NQB D;  1P3A A;  3TU4 B;  4J8V C;  3AZL C;  2F8N H;  4YS3 D;  3AZJ D;  1HQ3 C;  3W97 B;  3B6F D;  4Z66 A;  1P3B C;  3NQJ A;  1WWS A;  1P3B B;  1KX5 B;  4XZQ A;  5B1L C;  3WAA C;  3O62 D;  3WA9 C;  4X23 A;  5AV9 A;  4WU8 C;  5B2I C;  5B31 D;  5B33 A;  3AFA D;  5BS7 C;  1P3K B;  1P3K C;  3MNN D;  3AZM B;  5B1M A;  3TU4 D;  1P3G D;  4LD9 D;  2ARO A;  1HQ3 D;  2F8N G;  1ZLA C;  3NQU B;  3REJ A;  2PYO B;  4Z66 B;  3X1U A;  4JJN A;  3W98 A;  5B24 B;  4LD9 B;  2PYO D;  5DNM C;  5BNX B;  3B0C W;  1TAF A;  5AV6 C;  3MGR D;  5AVB D;  1TAF B;  1H3O A;  5CPK C;  1U35 C;  3REH A;  4H9N B;  5GT0 A;  3AZE A;  3W96 B;  3REK D;  5B1L A;  3AV1 C;  3W96 C;  3KUY B;  3REK C;  1KX5 D;  5BNV B;  3REK B;  4Z5T C;  3AZH B;  3AV2 A;  1P34 B;  1P3B D;  1B6W A;  3LZ0 A;  2ARO D;  5CPJ B;  5AV8 C;  4NE6 A;  3KXB C;  2NZD B;  3LJA A;  3MGQ D;  3A6N C;  4ZUX C;  1P3L B;  1P3B A;  3B6G C;  3AV2 D;  4LD9 A;  1P3P D;  5G49 B;  5BO0 A;  4XZQ D;  4XUJ B;  3WAA A;  3MVD D;  5KDM A;  5BO0 B;  5AV9 C;  4R8P D;  4WU8 A;  4ZBJ B;  3AZE D;  5B31 A;  5B2I A;  3MGR B;  3MVD B;  2JSS A;  3MGP B;  1P3F D;  3X1V C;  3X1V B;  3O62 C;  5CPJ A;  3UTB D;  1P3I B;  3WTP A;  2RVQ D;  3W99 C;  4QLC A;  5GSU A;  5CP6 D;  3REJ D;  1BH9 B;  3NQJ B;  1KX5 A;  1P34 D;  4CAY A;  5E5A B;  5CPJ D;  3LEL C;  5CPI B;  1EQZ B;  2IO5 B;  3LEL B;  4ZUX A;  5AV6 B;  1ID3 A;  2HUE C;  2HUE B;  5AV5 D;  3X1V D;  5BS7 A;  5JRG A;  4J8U D;  4X23 B;  3V9R A;  3AFA A;  3MVD A;  3AZF C;  4E45 A;  3KUY D;  4HGA B;  5B33 D;  3WAA D;  5AY8 B;  3UT9 D;  3W96 A;  1P3O A;  4G92 B;  2F8N B;  4G92 C;  3UTA A;  3AZJ B;  4YS3 B;  4J8X B;  1P3P A;  4Z5T A;  4YM6 B;  3B6F A;  5DNN B;  2F8N A;  3X1U B;  4JJN B;  1N1J A;  1JFI A;  4J8X A;  3KXB A;  3X1V A;  5B0Z A;  2FJ7 A;  2BYK A;  3O62 A;  5CPJ C;  4KUD D;  3KXB B;  1S32 C;  3AZI D;  2NZD C;  1P3O D;  2YFV A;  3AZN C;  3W98 C;  4KUD B;  3B0D C;  2PYO A;  3B0D B;  4WV4 B;  2F8N D;  5AVC B;  4Z5T D;  5B24 A;  3AYW B;  4YM6 D;  3REI C;  3AZE C;  3B6G A;  5B2J D;  2L5A A;  5BNV A;  3REK A;  1KX3 D;  4XUJ C;  3AV1 A;  5B40 D;  5B1L D;  1KX3 C;  5B31 G;  3AV2 B;  1P34 A;  3AV2 C;  5B40 C;  3AZF A;  1P3I A;  5B2J B;  5B0Y C;  3W97 D;  2CWE A;  5B0Y B;  4KHA A;  2FJ7 B;  3LZ0 C;  2NQB B;  5GSU B;  4DRB A;  4QLC B;  5B32 C;  1AOI A;  2NZD D;  2YFV B;  5DNN A;  3WTP C;  4KUD A;  1M19 C;  3WTP B;  1P3M A;  1M19 B;  3AZI B;  4G91 C;  1F1E A;  3VH5 W;  3KWQ C;  4G91 B;  4H9Q A;  3MNN A;  5AV8 D;  1HQ3 B;  5B1M D;  3TU4 A;  3C1C B;  1AOI D;  5B0Z D;  3UT9 C;  3AZM D;  3MGP D;  1P3F B;  4XUJ D;  5JA4 A;  4H9S A;  4WU8 D;  5JRG D;  4R8P B;  4J8U A;  3AZF B;  3AFA C;  5B1M B;  4HGA C;  5C3I B;  3V9R B;  3AFA B;  3C1B C;  2NQB A;  1P3P C;  5AV5 B;  5AV5 C;  4YS3 C;  3AZJ C;  4J8X C;  3W99 A;  1TZY C;  4Z66 D;  4YM6 C;  3REI D;  1TZY B;  3B6F C;  3MGS D;  5F99 C;  3LZ1 C;  5F99 B;  4H9Q B;  4QLC D;  5GSU D;  4WU9 D;  2CV5 D;  1M18 D;  2ARO C;  3AYW A;  3W97 A;  5GXQ A;  3REL C;  3KSY A;  5B0Y D;  1P3F A;  3MGS A;  1ID3 C;  5B1L B;  3X1T A;  4H9P A;  3UTB B;  5AY8 A;  5DNM A;  1HQ3 A;  5JRG C;  1ULY A;  3UTA B;  5CPK B;  1U35 B;  2YFW A;  3W96 D;  4XZQ C;  1KX3 B;  4AWL B;  2YFW B;  3AV1 B;  5B0Y A;  3KUY C;  1HTA A;  5GXQ D;  3VH5 T;  1F66 B;  5AVB B;  5B2J C;  3C1C D;  1AOI B;  1P3O B;  5AVC D;  3AZM A;  5B32 A;  1AOI C;  4KGC C;  5B0Z C;  1M19 A;  4J8W C;  3AZH A;  3REL D;  4WU9 C;  2CV5 C;  1M18 C;  2PYO C;  4NFT A;  3VH6 W;  4J8W D;  3AZN A;  4E44 A;  1KX4 A;  1P3A D;  5BT1 C;  3AZI C;  1ZLA A;  4UUZ B;  3KWQ B;  4J8V B;  3AZL B;  4CAY B;  4H9O A;  1BFM A;  5B33 B;  3B6G B;  5B31 B;  1P3K D;  3LZ0 D;  4J8U B;  3UT9 B;  4J8U C;  1P3F C;  4XUJ A;  3WAA B;  3REH C;  5GT0 D;  4NE3 A;  3R45 A;  3WA9 B;  1B67 A;  5FUG B;  5B1M C;  5C3I C;  5CPK A;  4R8P A;  1U35 A;  4ZBJ C;  1H3O B;  5FUG A;  3WA9 D;  5AV6 D;  3MGR C;  2HIO A;  3MGP C;  5DNM D;  5BT1 D;  3B6G D;  3A6N D;  4YM6 A;  3AZK A;  5E5A A;  1BH8 B;  1A7W A;  3LZ1 B;  4J8V A;  3AZL A;  3AZN D;  1ZLA B;  2BYM B;  4ZUX B;  5AV6 A;  3W97 C;  1TZY D;  4Z66 C;  1ZLA D;  1P3I D;  4WNN A;  5B32 D;  3REL B;  5GT3 A;  3LZ1 D;  1KX5 C;  4J8X D;  4M6B A;  3UTB C;  5CPI A;  1EQZ A;  5GT0 C;  5JRG B;  1F66 D;  5AV9 B;  5JA4 B;  3KUY A;  3X1S C;  4XZQ B;  3X1S B;  2BYK B;  3O62 B;  3AZM C;  1BH8 A;  5GT3 D;  3LZ1 A;  1M1A B;  1M1A C;  1P3O C;  1ID3 D;  5AVB A;  5AV8 A;  4H9R B;  4Z2M H;  3X1U C;  4JJN C;  3MGQ A;  4CSR A;  1M19 D;  1P3L A;  3LJA D;  1S32 D;  4WU9 B;  2CV5 B;  1M18 B;  4J8V D;  3AZL D;  5CP6 B;  3WTP E;  5E5A D;  3AZK B;  5F99 D;  3W98 D;  4LD9 C;  3AZK C;  5B32 G;  5DNM B;  5E5A C;  5CP6 A;  4H9O B;  1WWI A;  4DRA A;  3MGS C;  3MGS B;  3X1S D;  3AZG A;  3LEL A;  4KGC D;  3REI B;  1P3G A;  5B31 C;  5GT3 B;  3B0C T;  5GT3 C;  5B2I D;  3AV1 D;  3AYW D;  3MVD C;  3AZH C;  1P34 C;  3X1S A;  3AZG D;  1BH9 A;  1KX4 B;  4WZS B;  1KX4 C;  3A6N A;  4QLC C;  5GSU C;  3WKJ B;  3KXB D;  1KX4 D;  1R4V A;  3WKJ C;  1P3L D;  1S32 A;  3AZG B;  3AZI A;  1P3L C;  5AVC C;  5GXQ B;  5CHL B;  3C1C A;  5G49 A;  2IO5 C;  3AZH D;  5GT0 B;  2HIO B;  4X23 D;  2HIO C;  3UT9 A;  3C1B D;  4R8P C;  2HIO D;  3R45 B;  3WA9 A;  3VH5 A;  3AZF D;  2FJ7 C;  1P3I C;  3KWQ D;  3LZ0 B;  3X1T D;  2NQB C;  4KHA B;  3AN2 B;  3AZK D;  3LJA B;  1Q9C A;  3W99 B;  3AN2 A;  3WKJ D;  2NZD A;  1P3K A;  1P3A B;  5CP6 C;  1P3A C;  1P3M D;  3AZN B; 
#chains in the Genus database with same CATH topology
 4KUD C;  2F8N K;  5CPI C;  2RVQ C;  3W99 D;  4UUZ A;  3KWQ A;  1EQZ C;  3REI A;  1P3G B;  1P3G C;  3AN2 D;  4H9P B;  3UTB A;  1KX3 A;  3AZE B;  3REL A;  4X23 C;  5AY8 D;  3MNN C;  5BNX A;  4H9N A;  4WU8 B;  3REH D;  1F66 A;  2FJ7 D;  3MNN B;  5KDM B;  5B2I B;  5AY8 C;  3C1B B;  3UTA C;  3B0B A;  4NE5 A;  4H9S C;  4EO5 C;  3C1B A;  3UTA D;  4EO5 B;  5B40 B;  5DNN C;  1N1J B;  2DF4 C;  1M1A A;  3VH6 T;  3B6F B;  5AVB C;  3MGQ C;  5CPI D;  1EQZ D;  1S32 B;  3MGQ B;  5AV5 A;  5F99 A;  4H9R A;  3W98 B;  4J8W A;  3REJ C;  5B24 C;  3AZG C;  3REJ B;  1M1A D;  3H0L C;  3AYW C;  5AVC A;  1ID3 B;  4WNN B;  5GXQ C;  1KU5 A;  2J8P A;  2LY8 A;  3C1C C;  5B33 C;  5AV9 D;  5DNN D;  5B40 A;  3VH6 A;  4AWL C;  3REH B;  1TZY A;  1F66 C;  4Z5T B;  5CPK D;  1U35 D;  3AZJ A;  4YS3 A;  1P3P B;  4KGC B;  2F2A C;  5B0Z B;  2BYM A;  4ZUX D;  5B24 D;  5B32 B;  3AN2 C;  4J8W B;  1P3M C;  3MGR A;  1JFI B;  5AV8 B;  4KGC A;  1P3M B;  3MGP A;  3LEL D;  3LJA C;  5B2J A;  3WTP D;  3WKJ A;  4WU9 A;  2CV5 A;  1M18 A;  3A6N B;  4CSR B;  3X1T B;  3X1U D;  4JJN D;  4Z2M G;  3TU4 C;  3X1T C;  2ARO B;  3NQU A;  2NQB D;  1P3A A;  3TU4 B;  1PZR A;  4J8V C;  3AZL C;  2F8N H;  4YS3 D;  3FDD A;  1HQ3 C;  3AZJ D;  3W97 B;  3KFU G;  2JE5 A;  3B6F D;  2XD5 A;  4Z66 A;  1P3B C;  3NQJ A;  1WWS A;  1P3B B;  1KX5 B;  4XZQ A;  5B1L C;  3WAA C;  3O62 D;  3WA9 C;  4X23 A;  5AV9 A;  4WU8 C;  3H0M C;  5B2I C;  5B31 D;  5B33 A;  3AFA D;  2Y2L A;  5BS7 C;  1P3K B;  1P3K C;  3MNN D;  3AZM B;  5B1M A;  3TU4 D;  1P3G D;  4LD9 D;  2ARO A;  1HQ3 D;  2F8N G;  1ZLA C;  3NQU B;  3REJ A;  2PYO B;  4Z66 B;  3X1U A;  4JJN A;  3W98 A;  5B24 B;  4LD9 B;  2PYO D;  5DNM C;  5BNX B;  3B0C W;  1TAF A;  5AV6 C;  3MGR D;  5AVB D;  1TAF B;  1H3O A;  5CPK C;  1U35 C;  3REH A;  4H9N B;  5GT0 A;  3AZE A;  3W96 B;  3REK D;  5B1L A;  3AV1 C;  3W96 C;  3KUY B;  3REK C;  1KX5 D;  5BNV B;  3REK B;  4Z5T C;  3AZH B;  3AV2 A;  1P34 B;  1P3B D;  1B6W A;  3LZ0 A;  2ARO D;  5CPJ B;  5AV8 C;  4NE6 A;  3KXB C;  2NZD B;  3LJA A;  3MGQ D;  3A6N C;  4ZUX C;  1P3L B;  1P3B A;  3B6G C;  3AV2 D;  4LD9 A;  2RIQ A;  1P3P D;  5G49 B;  5BO0 A;  4XZQ D;  4XUJ B;  3WAA A;  3MVD D;  5KDM A;  5BO0 B;  5AV9 C;  4WU8 A;  4R8P D;  1T3U A;  4ZBJ B;  5B31 A;  4DQY B;  5B2I A;  3AZE D;  3MGR B;  3MVD B;  2JSS A;  3MGP B;  1P3F D;  3X1V C;  3X1V B;  3O62 C;  5CPJ A;  3UTB D;  1P3I B;  3WTP A;  2Y2N A;  2RVQ D;  3W99 C;  4QLC A;  5GSU A;  5CP6 D;  3REJ D;  1BH9 B;  3NQJ B;  1KX5 A;  1P34 D;  4CAY A;  5E5A B;  5CPJ D;  3LEL C;  5CPI B;  1EQZ B;  2IO5 B;  3LEL B;  4ZUX A;  5AV6 B;  1ID3 A;  2HUE C;  2ZM5 A;  2HUE B;  5AV5 D;  3X1V D;  3IP4 C;  5BS7 A;  5JRG A;  4J8U D;  4X23 B;  3V9R A;  3AFA A;  3MVD A;  3EPL A;  3AZF C;  4E45 A;  3KUY D;  4HGA B;  5B33 D;  3WAA D;  2XD1 A;  5AY8 B;  3UT9 D;  3W96 A;  1P3O A;  4G92 B;  2F8N B;  4G92 C;  3UTA A;  3AZJ B;  4YS3 B;  4J8X B;  1P3P A;  4Z5T A;  4YM6 B;  3B6F A;  5DNN B;  2F8N A;  3AL0 C;  3X1U B;  4JJN B;  1N1J A;  1JFI A;  4J8X A;  3KXB A;  3X1V A;  5B0Z A;  2FJ7 A;  2BYK A;  3O62 A;  5CPJ C;  4KUD D;  3KXB B;  1S32 C;  3AZI D;  2NZD C;  1P3O D;  2YFV A;  3AZN C;  3W98 C;  4KUD B;  3B0D C;  2ZY3 A;  2PYO A;  3B0D B;  4WV4 B;  2F8N D;  5AVC B;  4Z5T D;  5B24 A;  3AYW B;  4YM6 D;  3REI C;  3AZE C;  3B6G A;  2Y2M A;  2Y2Q A;  5B2J D;  2L5A A;  5BNV A;  3REK A;  1KX3 D;  4XUJ C;  3EPK A;  5B40 D;  5B1L D;  3AV1 A;  1KX3 C;  5B31 G;  3AV2 B;  1P34 A;  2ZY2 A;  3AV2 C;  5B40 C;  3AZF A;  1P3I A;  2ZY4 A;  5B2J B;  5B0Y C;  3W97 D;  2CWE A;  5B0Y B;  4KHA A;  2FJ7 B;  3LZ0 C;  2NQB B;  5GSU B;  4DRB A;  4QLC B;  5B32 C;  1AOI A;  2NZD D;  2YFV B;  5DNN A;  3WTP C;  4KUD A;  1M19 C;  3WTP B;  1P3M A;  1M19 B;  1W2E A;  3AZI B;  4G91 C;  1F1E A;  3VH5 W;  3KWQ C;  4G91 B;  4H9Q A;  3MNN A;  3A1K A;  5AV8 D;  1HQ3 B;  5B1M D;  3TU4 A;  3C1C B;  1AOI D;  5B0Z D;  3UT9 C;  3AZM D;  3MGP D;  1P3F B;  4XUJ D;  5JA4 A;  4H9S A;  3EPH A;  4WU8 D;  5JRG D;  4R8P B;  4J8U A;  3AZF B;  3AFA C;  5B1M B;  4HGA C;  5C3I B;  3V9R B;  3AFA B;  3C1B C;  2NQB A;  1P3P C;  5AV5 B;  5AV5 C;  4YS3 C;  3AZJ C;  4J8X C;  3W99 A;  1TZY C;  4Z66 D;  4YM6 C;  3REI D;  1TZY B;  3B6F C;  3MGS D;  5F99 C;  3LZ1 C;  5F99 B;  4H9Q B;  4QLC D;  5GSU D;  3F6T A;  4WU9 D;  2CV5 D;  1M18 D;  2ARO C;  3AYW A;  3W97 A;  5GXQ A;  3REL C;  3KSY A;  5B0Y D;  1P3F A;  3MGS A;  1ID3 C;  5B1L B;  3X1T A;  4H9P A;  3UTB B;  5AY8 A;  5DNM A;  1HQ3 A;  5JRG C;  1ULY A;  3UTA B;  5CPK B;  1U35 B;  2YFW A;  3W96 D;  4XZQ C;  1KX3 B;  4AWL B;  2YFW B;  3AV1 B;  5B0Y A;  2G5H C;  3KUY C;  1HTA A;  5GXQ D;  3VH5 T;  1F66 B;  5AVB B;  5B2J C;  3C1C D;  1AOI B;  1P3O B;  5AVC D;  2UWX A;  5B32 A;  3AZM A;  1AOI C;  2Y2H A;  4KGC C;  5B0Z C;  1M19 A;  4UPK A;  4J8W C;  3AZH A;  3REL D;  4WU9 C;  2CV5 C;  1M18 C;  2PYO C;  4NFT A;  3VH6 W;  4J8W D;  3AZN A;  4E44 A;  1KX4 A;  1P3A D;  5BT1 C;  3AZI C;  1ZLA A;  4UUZ B;  3KWQ B;  4J8V B;  3AZL B;  3H0R C;  4CAY B;  4H9O A;  1BFM A;  5B33 B;  3B6G B;  5B31 B;  1P3K D;  3LZ0 D;  4J8U B;  3UT9 B;  4J8U C;  1P3F C;  4XUJ A;  3WAA B;  3REH C;  5GT0 D;  4NE3 A;  3R45 A;  3WA9 B;  1B67 A;  5FUG B;  5B1M C;  5C3I C;  5CPK A;  4R8P A;  1U35 A;  4ZBJ C;  1H3O B;  5FUG A;  3WA9 D;  5AV6 D;  3MGR C;  2HIO A;  3MGP C;  5DNM D;  2FFF B;  5BT1 D;  3B6G D;  3A6N D;  4YM6 A;  3AZK A;  4WJ3 C;  5E5A A;  1BH8 B;  1A7W A;  3LZ1 B;  4J8V A;  3AZL A;  3AZN D;  1ZLA B;  2BYM B;  4ZUX B;  5AV6 A;  3W97 C;  1TZY D;  4Z66 C;  1ZLA D;  1P3I D;  4WNN A;  5B32 D;  3REL B;  5GT3 A;  3LZ1 D;  1KX5 C;  1Z2C B;  4J8X D;  4M6B A;  3UTB C;  5CPI A;  1EQZ A;  5GT0 C;  5JRG B;  3P5J B;  1F66 D;  5AV9 B;  5JA4 B;  3KUY A;  3X1S C;  4XZQ B;  3X1S B;  2BYK B;  3O62 B;  3AZM C;  1BH8 A;  5GT3 D;  3LZ1 A;  1M1A B;  1M1A C;  1P3O C;  1ID3 D;  5AVB A;  5AV8 A;  4H9R B;  2Y2P A;  4Z2M H;  3X1U C;  4JJN C;  3MGQ A;  4CSR A;  1M19 D;  1P3L A;  3LJA D;  1S32 D;  4WU9 B;  2CV5 B;  1M18 B;  2Y2K A;  4J8V D;  3AZL D;  3A1I A;  5CP6 B;  5E5A D;  3WTP E;  3AZK B;  2W8S A;  5F99 D;  3W98 D;  4LD9 C;  3AZK C;  5B32 G;  5DNM B;  5E5A C;  5CP6 A;  4H9O B;  1WWI A;  4DRA A;  3MGS C;  2G5I C;  3MGS B;  3X1S D;  3AZG A;  3LEL A;  4KGC D;  3REI B;  1P3G A;  5B31 C;  5GT3 B;  3B0C T;  5GT3 C;  2VQR A;  5B2I D;  3AV1 D;  3AYW D;  3MVD C;  3AZH C;  1P34 C;  3X1S A;  3AZG D;  1BH9 A;  3EG5 B;  1KX4 B;  4WZS B;  1KX4 C;  3A6N A;  2BG1 A;  4QLC C;  5GSU C;  3WKJ B;  3KXB D;  1KX4 D;  1R4V A;  3WKJ C;  1P3L D;  1S32 A;  3AZG B;  2Y2O A;  3AZI A;  2Y2G A;  1P3L C;  5AVC C;  5GXQ B;  2Y2J A;  5CHL B;  2Y2I A;  3C1C A;  5G49 A;  2IO5 C;  3AZH D;  5GT0 B;  2HIO B;  3EPJ A;  4X23 D;  2HIO C;  3UT9 A;  3C1B D;  4R8P C;  2HIO D;  2JCH A;  3R45 B;  3WA9 A;  3VH5 A;  3AZF D;  2FJ7 C;  1P3I C;  3KWQ D;  3LZ0 B;  3X1T D;  2NQB C;  2ZY5 A;  4KHA B;  2DQN C;  3AZK D;  3AN2 B;  3LJA B;  1Q9C A;  3W99 B;  3AN2 A;  3WKJ D;  2NZD A;  1P3K A;  1P3A B;  5CP6 C;  1P3A C;  1P3M D;  3AZN B; 
#chains in the Genus database with same CATH homology
 4KUD C;  2F8N K;  5CPI C;  2RVQ C;  3W99 D;  4UUZ A;  3KWQ A;  1EQZ C;  3REI A;  1P3G B;  1P3G C;  3AN2 D;  4H9P B;  3UTB A;  1KX3 A;  3AZE B;  3REL A;  4X23 C;  5AY8 D;  3MNN C;  5BNX A;  4H9N A;  4WU8 B;  3REH D;  1F66 A;  2FJ7 D;  3MNN B;  5KDM B;  5B2I B;  5AY8 C;  3C1B B;  3UTA C;  3B0B A;  4NE5 A;  4H9S C;  4EO5 C;  3C1B A;  3UTA D;  4EO5 B;  5B40 B;  5DNN C;  1N1J B;  2DF4 C;  1M1A A;  3VH6 T;  3B6F B;  5AVB C;  3MGQ C;  5CPI D;  1EQZ D;  1S32 B;  3MGQ B;  5AV5 A;  5F99 A;  4H9R A;  3W98 B;  4J8W A;  3REJ C;  5B24 C;  3AZG C;  3REJ B;  1M1A D;  3H0L C;  3AYW C;  5AVC A;  1ID3 B;  4WNN B;  5GXQ C;  1KU5 A;  2J8P A;  2LY8 A;  3C1C C;  5B33 C;  5AV9 D;  5DNN D;  5B40 A;  3VH6 A;  4AWL C;  3REH B;  1TZY A;  1F66 C;  4Z5T B;  5CPK D;  1U35 D;  3AZJ A;  4YS3 A;  1P3P B;  4KGC B;  2F2A C;  5B0Z B;  2BYM A;  4ZUX D;  5B24 D;  5B32 B;  3AN2 C;  4J8W B;  1P3M C;  3MGR A;  1JFI B;  5AV8 B;  4KGC A;  1P3M B;  3MGP A;  3LEL D;  3LJA C;  5B2J A;  3WTP D;  3WKJ A;  4WU9 A;  2CV5 A;  1M18 A;  3A6N B;  4CSR B;  3X1T B;  3X1U D;  4JJN D;  4Z2M G;  3TU4 C;  3X1T C;  2ARO B;  3NQU A;  2NQB D;  1P3A A;  3TU4 B;  1PZR A;  4J8V C;  3AZL C;  2F8N H;  4YS3 D;  3FDD A;  1HQ3 C;  3AZJ D;  3W97 B;  3KFU G;  2JE5 A;  3B6F D;  2XD5 A;  4Z66 A;  1P3B C;  3NQJ A;  1WWS A;  1P3B B;  1KX5 B;  4XZQ A;  5B1L C;  3WAA C;  3O62 D;  3WA9 C;  4X23 A;  5AV9 A;  4WU8 C;  3H0M C;  5B2I C;  5B31 D;  5B33 A;  3AFA D;  2Y2L A;  5BS7 C;  1P3K B;  1P3K C;  3MNN D;  3AZM B;  5B1M A;  3TU4 D;  1P3G D;  4LD9 D;  2ARO A;  1HQ3 D;  2F8N G;  1ZLA C;  3NQU B;  3REJ A;  2PYO B;  4Z66 B;  3X1U A;  4JJN A;  3W98 A;  5B24 B;  4LD9 B;  2PYO D;  5DNM C;  5BNX B;  3B0C W;  1TAF A;  5AV6 C;  3MGR D;  5AVB D;  1TAF B;  1H3O A;  5CPK C;  1U35 C;  3REH A;  4H9N B;  5GT0 A;  3AZE A;  3W96 B;  3REK D;  5B1L A;  3AV1 C;  3W96 C;  3KUY B;  3REK C;  1KX5 D;  5BNV B;  3REK B;  4Z5T C;  3AZH B;  3AV2 A;  1P34 B;  1P3B D;  1B6W A;  3LZ0 A;  2ARO D;  5CPJ B;  5AV8 C;  4NE6 A;  3KXB C;  2NZD B;  3LJA A;  3MGQ D;  3A6N C;  4ZUX C;  1P3L B;  1P3B A;  3B6G C;  3AV2 D;  4LD9 A;  2RIQ A;  1P3P D;  5G49 B;  5BO0 A;  4XZQ D;  4XUJ B;  3WAA A;  3MVD D;  5KDM A;  5BO0 B;  5AV9 C;  4WU8 A;  4R8P D;  1T3U A;  4ZBJ B;  5B31 A;  4DQY B;  5B2I A;  3AZE D;  3MGR B;  3MVD B;  2JSS A;  3MGP B;  1P3F D;  3X1V C;  3X1V B;  3O62 C;  5CPJ A;  3UTB D;  1P3I B;  3WTP A;  2Y2N A;  2RVQ D;  3W99 C;  4QLC A;  5GSU A;  5CP6 D;  3REJ D;  1BH9 B;  3NQJ B;  1KX5 A;  1P34 D;  4CAY A;  5E5A B;  5CPJ D;  3LEL C;  5CPI B;  1EQZ B;  2IO5 B;  3LEL B;  4ZUX A;  5AV6 B;  1ID3 A;  2HUE C;  2ZM5 A;  2HUE B;  5AV5 D;  3X1V D;  3IP4 C;  5BS7 A;  5JRG A;  4J8U D;  4X23 B;  3V9R A;  3AFA A;  3MVD A;  3EPL A;  3AZF C;  4E45 A;  3KUY D;  4HGA B;  5B33 D;  3WAA D;  2XD1 A;  5AY8 B;  3UT9 D;  3W96 A;  1P3O A;  4G92 B;  2F8N B;  4G92 C;  3UTA A;  3AZJ B;  4YS3 B;  4J8X B;  1P3P A;  4Z5T A;  4YM6 B;  3B6F A;  5DNN B;  2F8N A;  3AL0 C;  3X1U B;  4JJN B;  1N1J A;  1JFI A;  4J8X A;  3KXB A;  3X1V A;  5B0Z A;  2FJ7 A;  2BYK A;  3O62 A;  5CPJ C;  4KUD D;  3KXB B;  1S32 C;  3AZI D;  2NZD C;  1P3O D;  2YFV A;  3AZN C;  3W98 C;  4KUD B;  3B0D C;  2ZY3 A;  2PYO A;  3B0D B;  4WV4 B;  2F8N D;  5AVC B;  4Z5T D;  5B24 A;  3AYW B;  4YM6 D;  3REI C;  3AZE C;  3B6G A;  2Y2M A;  2Y2Q A;  5B2J D;  2L5A A;  5BNV A;  3REK A;  1KX3 D;  4XUJ C;  3EPK A;  5B40 D;  5B1L D;  3AV1 A;  1KX3 C;  5B31 G;  3AV2 B;  1P34 A;  2ZY2 A;  3AV2 C;  5B40 C;  3AZF A;  1P3I A;  2ZY4 A;  5B2J B;  5B0Y C;  3W97 D;  2CWE A;  5B0Y B;  4KHA A;  2FJ7 B;  3LZ0 C;  2NQB B;  5GSU B;  4DRB A;  4QLC B;  5B32 C;  1AOI A;  2NZD D;  2YFV B;  5DNN A;  3WTP C;  4KUD A;  1M19 C;  3WTP B;  1P3M A;  1M19 B;  1W2E A;  3AZI B;  4G91 C;  1F1E A;  3VH5 W;  3KWQ C;  4G91 B;  4H9Q A;  3MNN A;  3A1K A;  5AV8 D;  1HQ3 B;  5B1M D;  3TU4 A;  3C1C B;  1AOI D;  5B0Z D;  3UT9 C;  3AZM D;  3MGP D;  1P3F B;  4XUJ D;  5JA4 A;  4H9S A;  3EPH A;  4WU8 D;  5JRG D;  4R8P B;  4J8U A;  3AZF B;  3AFA C;  5B1M B;  4HGA C;  5C3I B;  3V9R B;  3AFA B;  3C1B C;  2NQB A;  1P3P C;  5AV5 B;  5AV5 C;  4YS3 C;  3AZJ C;  4J8X C;  3W99 A;  1TZY C;  4Z66 D;  4YM6 C;  3REI D;  1TZY B;  3B6F C;  3MGS D;  5F99 C;  3LZ1 C;  5F99 B;  4H9Q B;  4QLC D;  5GSU D;  3F6T A;  4WU9 D;  2CV5 D;  1M18 D;  2ARO C;  3AYW A;  3W97 A;  5GXQ A;  3REL C;  3KSY A;  5B0Y D;  1P3F A;  3MGS A;  1ID3 C;  5B1L B;  3X1T A;  4H9P A;  3UTB B;  5AY8 A;  5DNM A;  1HQ3 A;  5JRG C;  1ULY A;  3UTA B;  5CPK B;  1U35 B;  2YFW A;  3W96 D;  4XZQ C;  1KX3 B;  4AWL B;  2YFW B;  3AV1 B;  5B0Y A;  2G5H C;  3KUY C;  1HTA A;  5GXQ D;  3VH5 T;  1F66 B;  5AVB B;  5B2J C;  3C1C D;  1AOI B;  1P3O B;  5AVC D;  2UWX A;  5B32 A;  3AZM A;  1AOI C;  2Y2H A;  4KGC C;  5B0Z C;  1M19 A;  4UPK A;  4J8W C;  3AZH A;  3REL D;  4WU9 C;  2CV5 C;  1M18 C;  2PYO C;  4NFT A;  3VH6 W;  4J8W D;  3AZN A;  4E44 A;  1KX4 A;  1P3A D;  5BT1 C;  3AZI C;  1ZLA A;  4UUZ B;  3KWQ B;  4J8V B;  3AZL B;  3H0R C;  4CAY B;  4H9O A;  1BFM A;  5B33 B;  3B6G B;  5B31 B;  1P3K D;  3LZ0 D;  4J8U B;  3UT9 B;  4J8U C;  1P3F C;  4XUJ A;  3WAA B;  3REH C;  5GT0 D;  4NE3 A;  3R45 A;  3WA9 B;  1B67 A;  5FUG B;  5B1M C;  5C3I C;  5CPK A;  4R8P A;  1U35 A;  4ZBJ C;  1H3O B;  5FUG A;  3WA9 D;  5AV6 D;  3MGR C;  2HIO A;  3MGP C;  5DNM D;  2FFF B;  5BT1 D;  3B6G D;  3A6N D;  4YM6 A;  3AZK A;  4WJ3 C;  5E5A A;  1BH8 B;  1A7W A;  3LZ1 B;  4J8V A;  3AZL A;  3AZN D;  1ZLA B;  2BYM B;  4ZUX B;  5AV6 A;  3W97 C;  1TZY D;  4Z66 C;  1ZLA D;  1P3I D;  4WNN A;  5B32 D;  3REL B;  5GT3 A;  3LZ1 D;  1KX5 C;  1Z2C B;  4J8X D;  4M6B A;  3UTB C;  5CPI A;  1EQZ A;  5GT0 C;  5JRG B;  3P5J B;  1F66 D;  5AV9 B;  5JA4 B;  3KUY A;  3X1S C;  4XZQ B;  3X1S B;  2BYK B;  3O62 B;  3AZM C;  1BH8 A;  5GT3 D;  3LZ1 A;  1M1A B;  1M1A C;  1P3O C;  1ID3 D;  5AVB A;  5AV8 A;  4H9R B;  2Y2P A;  4Z2M H;  3X1U C;  4JJN C;  3MGQ A;  4CSR A;  1M19 D;  1P3L A;  3LJA D;  1S32 D;  4WU9 B;  2CV5 B;  1M18 B;  2Y2K A;  4J8V D;  3AZL D;  3A1I A;  5CP6 B;  5E5A D;  3WTP E;  3AZK B;  2W8S A;  5F99 D;  3W98 D;  4LD9 C;  3AZK C;  5B32 G;  5DNM B;  5E5A C;  5CP6 A;  4H9O B;  1WWI A;  4DRA A;  3MGS C;  2G5I C;  3MGS B;  3X1S D;  3AZG A;  3LEL A;  4KGC D;  3REI B;  1P3G A;  5B31 C;  5GT3 B;  3B0C T;  5GT3 C;  2VQR A;  5B2I D;  3AV1 D;  3AYW D;  3MVD C;  3AZH C;  1P34 C;  3X1S A;  3AZG D;  1BH9 A;  3EG5 B;  1KX4 B;  4WZS B;  1KX4 C;  3A6N A;  2BG1 A;  4QLC C;  5GSU C;  3WKJ B;  3KXB D;  1KX4 D;  1R4V A;  3WKJ C;  1P3L D;  1S32 A;  3AZG B;  2Y2O A;  3AZI A;  2Y2G A;  1P3L C;  5AVC C;  5GXQ B;  2Y2J A;  5CHL B;  2Y2I A;  3C1C A;  5G49 A;  2IO5 C;  3AZH D;  5GT0 B;  2HIO B;  3EPJ A;  4X23 D;  2HIO C;  3UT9 A;  3C1B D;  4R8P C;  2HIO D;  2JCH A;  3R45 B;  3WA9 A;  3VH5 A;  3AZF D;  2FJ7 C;  1P3I C;  3KWQ D;  3LZ0 B;  3X1T D;  2NQB C;  2ZY5 A;  4KHA B;  2DQN C;  3AZK D;  3AN2 B;  3LJA B;  1Q9C A;  3W99 B;  3AN2 A;  3WKJ D;  2NZD A;  1P3K A;  1P3A B;  5CP6 C;  1P3A C;  1P3M D;  3AZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...