4X23A

Crystal structure of cenp-c in complex with the nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
95
structure length
95
Chain Sequence
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (147-MER)
publication title A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 95
sequence length 95
chains with identical sequence E, K, O
ec nomenclature
pdb deposition date 2014-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4x23A00
1S32D 2HUEC 5AY8B 4AWLC 3W97C 3WA9C 1P3BC 1U35C 5GT0D 5AV5A 1EQZD 5DNMB 4E45A 3TU4A 5B24C 1ID3B 1S32B 5G49A 4XUJC 4J8XC 3REHA 1H3OA 4H9QA 4WNNA 5GT0B 3AZHD 1F66A 3KSYA 3MVDC 3X1VD 4J8WC 5DNND 1ID3D 3MGQD 1P3IA 4NFTA 5AV9D 3B0CW 5B40A 3WAAD 2BYMA 5B31C 2PYOD 3AZHB 2AROB 1P3KA 3W98A 5AVCA 3C1BA 3X1VB 3WA9D 3AV1A 3MGQB 1U35D 4JJNC 4LD9A 5AV9B 3KUYC 4J8UC 3WAAB 5AV8C 5B24D 2PYOB 2HUEB 4J8XD 1P3FA 3LELA 5AV6A 1M19A 3WA9B 3MGPA 3VH6W 5AV5B 1U35B 1P3PA 3W96C 1P3AC 3MVDD 3AZFC 4ZBJB 3MGRA 5G49B 3W99C 4KUDC 4J8XB 5FUGA 4H9QB 3MVDB 5F99C 3A6NC 5B0ZA 4X23A 3WKJC 4JJND 1N1JA 3X1UC 3KUYD 3REKC 5JA4B 5B40B 3C1CA 2BYMB 4UUZA 4WZSB 3LZ0A 1JFIA 5BS7C 5GT3C 5AVCB 3LELD 3B6FC 3AZKC 4QLCC 5AVBA 5E5AC 4R8PA 1P3PD 4JJNB 3B6GB 3W96D 1P3AD 3KUYB 3AZFD 1A7WA 3O62C 4J8VA 5BNVA 3VH5W 3W99D 4KUDD 5GXQA 5AV6B 3LELB 4WU8A 1M19B 2LY8A 3AN2A 1P3PB 3W96B 1P3AB 3AZFB 5F99D 3A6ND 4X23D 1P3OC 3B6GA 3WKJD 3X1UD 3W99B 4KUDB 3REKD 1P3MD 5B31G 4YS3C 3AZEA 1R4VA 3LJAC 5GT3D 5F99B 3A6NB 4X23B 3WAAA 1TZYC 3WKJB 1S32A 3UTAC 3REKB 1P3MB 3C1CB 4Z5TA 1TAFA 3O62D 4J8VD 5GT0A 3LZ0B 1JFIB 3REJC 1EQZA 5GT3B 4WU8D 4R8PB 2NZDA 5B1LC 5B2IC 5B32C 1M18C 2YFVA 3AZLC 4J8VB 3X1SC 5BNVB 3VH6A 4H9PA 3X1VA 4WU8B 3AZED 4G91C 4WU9C 2CV5C 5DNNA 3MGQA 3REIC 5AV9A 3AZNC 2PYOA 1TZYD 4ZUXA 1WWIA 3W97A 3AZEB 3AZGC 1KX4C 4Z5TD 3WA9A 1P3BA 1U35A 1P3LC 1KU5A 3R45B 3V9RB 5B24A 5B33C 2NZDD 4Z66C 1P3GD 5B0YC 5B1LD 4XUJA 4J8XA 1M18D 4Z5TB 1TAFB 1BFMA 1EQZB 1Q9CA 3MVDA 1AOIC 2IO5B 1HQ3C 4WU9D 4J8WA 2CV5D 3NQUB 1F1EA 3AZIC 2NZDB 1P3GB 5CHLB 5B1LB 3VH5A 2YFVB 1M18B 5JA4A 4YM6C 3AZMC 5B31A 4ZUXD 4H9PB 3W97D 3AZGD 5DNNB 4WU9B 1KX4D 4Z2MG 1P3BD 2BYKB 4JJNA 1P34C 1P3LD 3KUYA 2CWEA 4J8UA 3AYWC 4ZUXB 5AV8A 5B33D 4WV4B 3KWQC 3X1TC 4Z66D 4AWLB 3W97B 4XUJD 3AZGB 1KX4B 4NE6A 1P3BB 3W96A 1P3AA 1AOID 1P3LB 3AZFA 4H9SC 4J8WD 1HQ3D 5B24B 5B33B 3AZID 5B32G 4Z66B 3W99A 4XUJB 4KUDA 3AV1C 5GSUC 3AZMD 3RELC 2JSSA 5B31D 5CPJC 5F99A 3A6NA 4J8WB 1HQ3B 5KDMB 4XZQC 3WKJA 3X1UA 2HIOC 3REKA 3MGPC 1P3MA 4J8UD 5B31B 5AV8D 2FJ7C 3X1TD 1KX3C 5BS7A 5GT3A 3B6FA 5B2JC 3AZKA 1ZLAC 4QLCA 2F8NG 5E5AA 1WWSA 4EO5C 4J8UB 5AV8B 3O62A 3UTBC 3UT9C 3KXBC 3RELD 5CPKC 5CPJD 1P3OA 3MNNC 4KGCC 4Z2MH 1BH8A 2HIOD 4YS3A 4NE5A 2FJ7D 3LJAA 1KX3D 5CPJB 3B6FD 3R45A 3AZKD 4H9OA 1ZLAD 4QLCD 5B1MC 3V9RA 5E5AD 1TZYA 1M1AC 4H9RA 3X1UB 2HIOB 5CPIC 3UTAA 1B6WA 4E44A 3UTBD 3AZJC 2F8NK 3KXBD 3REJA 1KX3B 2NQBC 1BH9A 5CP6C 3LZ1C 3B6FB 3AZKB 4QLCB 5AY8C 5E5AB 3NQUA 3VH6T 4EO5B 1P3GA 5B1LA 5B2IA 5B32A 1M18A 1P3OD 2RVQC 3AFAC 3O62B 4KGCD 3UTBB 3X1SA 5DNMC 5C3IC 1ID3C 4YS3D 4WU9A 2CV5A 2BYKA 5BO0A 1B67A 3LJAD 2YFWA 1P3OB 1HTAA 3AZNA 4G92C 4KGCB 2F8NH 1BH8B 3UTAD 5CPID 3AZGA 4YS3B 1KX4A 4DRBA 3LJAB 4KHAA 3REJD 3AZJD 2F8NA 1P3LA 3WTPC 5CP6D 3LZ1D 4H9OB 3AZHC 2AROC 1TZYB 5B33A 5JRGC 4H9RB 4Z66A 5B2ID 5B32D 5B0YA 3UTAB 3AV2C 5CPIB 1KX5C 3AZLD 2RVQD 3AFAD 3MGSC 3X1SD 3WTPE 3REJB 3AZJB 5BNXA 1BH9B 1AOIA 3WAAC 3VH5T 5CP6B 1HQ3A 5KDMA 3REID 3AZIA 5B2IB 5B32B 3AZLB 4YM6A 5AV5C 4H9NA 3AFAB 3AZMA 3AZND 3X1SB 4ZBJC 5C3IB 3TU4C 3B0DC 4G91B 2CV5B 4HGAC 5BO0B 3REIB 2F8ND 1P34A 3REHC 2YFWB 3WTPD 1ULYA 3AZNB 1F66C 2AROD 4G92B 3AYWA 5JRGD 3KWQA 3X1TA 5B0YD 1KX5D 3AV2D 1P3IC 3MGSD 4KHAB 2F8NB 5B40C 3WTPB 4H9SA 5BT1C 3NQJA 1P3KC 3W98C 5AVCC 5JRGB 3C1BC 5B0YB 1KX5B 3AV2B 5GSUA 4YM6D 4NE3A 5AV5D 3RELA 4LD9C 3MGSB 5BNXB 1AOIB 3TU4D 5CPJA 3AZIB 1P3FC 4XZQA 3LELC 5AV6C 1P34D 1M19C 3REHD 2HIOA 4YM6B 3AZMB 4H9NB 1P3PC 1F66D 3AYWD 2FJ7A 3KWQD 1KX3A 3TU4B 1P3ID 3B0DB 5B2JA 3MGRC 1ZLAA 4HGAB 4DRAA 1P34B 5B40D 3REHB 1H3OB 4WNNB 1F66B 5BT1D 3AYWB 1P3KD 3W98D 3KWQB 3UTBA 5AVCD 3C1BD 3X1TB 3UT9A 5B0ZC 4X23C 3KXBA 3AV1D 5GSUD 1P3IB 4LD9D 1P3MC 3C1CC 5CPKA 3NQJB 3LZ0C 3MNNA 1P3KB 3W98B 4KGCA 4XZQD 3C1BB 1P3FD 5AV6D 1M19D 5AVBC 3AV1B 5GSUB 3MGPD 4R8PC 3RELB 4LD9B 3B0CT 2L5AA 4CAYA 4J8VC 5B2JD 3MGRD 5B1MA 4XZQB 5GXQC 1P3FB 4WU8C 1M1AA 3AN2C 5CPIA 3MGPB 4CSRA 2FJ7B 3UT9D 3AZJA 5B0ZD 2NQBA 3B6GC 5CP6A 3LZ1A 5B2JB 1ZLAB 3MGRB 5AY8A 5FUGB 3AZEC 5CPKD 3C1CD 3AZLA 3AFAA 3MNND 3LZ0D 5DNMA 3UT9B 3KXBB 5B0ZB 5AVBD 1ID3A 4R8PD 1S32C 1N1JB 3REIA 5CPKB 4UUZB 4Z5TC 4M6BA 5GT0C 3MNNB 5B1MD 1EQZC 5GXQD 2IO5C 1M1AD 5AVBB 3AN2D 2NZDC 1P3GC 4CAYB 2NQBD 3B6GD 3WTPA 5B1MB 3AZHA 2AROA 5AY8D 5GXQB 3X1VC 5JRGA 1M1AB 5DNNC 1KX5A 3AN2B 3AV2A 3MGQC 4CSRB 5AV9C 3B0BA 3MGSA 5DNMD 2NQBB 3LZ1B 2PYOC 4ZUXC
chains in the Genus database with same CATH superfamily
1S32D 3A1KA 2HUEC 5AY8B 4AWLC 3W97C 3WA9C 1P3BC 2DF4C 1U35C 3KFUG 5GT0D 5AV5A 1EQZD 5DNMB 4E45A 3TU4A 5B24C 1ID3B 1S32B 5G49A 4XUJC 4J8XC 3REHA 1H3OA 4H9QA 4WNNA 5GT0B 3AZHD 1F66A 3KSYA 3MVDC 3X1VD 4J8WC 5DNND 1ID3D 3MGQD 1P3IA 3FDDA 4NFTA 5AV9D 3B0CW 5B40A 3WAAD 2BYMA 5B31C 2PYOD 3AZHB 2AROB 1P3KA 3W98A 5AVCA 3C1BA 3X1VB 3WA9D 3AV1A 3MGQB 1U35D 4JJNC 4LD9A 5AV9B 3KUYC 4J8UC 3WAAB 5AV8C 5B24D 2PYOB 2HUEB 4J8XD 1P3FA 3LELA 5AV6A 1M19A 3WA9B 3MGPA 3VH6W 5AV5B 1U35B 1P3PA 3W96C 1P3AC 3MVDD 3AZFC 4ZBJB 3MGRA 5G49B 3W99C 4KUDC 4J8XB 5FUGA 4H9QB 2ZY3A 3MVDB 2J8PA 3EG5B 5F99C 4DQYB 3A6NC 5B0ZA 2Y2JA 4X23A 3WKJC 4JJND 1N1JA 3X1UC 3KUYD 3REKC 5JA4B 5B40B 3C1CA 2BYMB 4UUZA 4WZSB 3LZ0A 1JFIA 5BS7C 5GT3C 5AVCB 3LELD 3B6FC 3AZKC 4QLCC 5AVBA 5E5AC 4R8PA 1P3PD 4JJNB 3B6GB 3W96D 1P3AD 3EPLA 3KUYB 3AZFD 1A7WA 3O62C 3A1IA 4J8VA 5BNVA 3VH5W 3W99D 4KUDD 5GXQA 5AV6B 3LELB 4WU8A 1M19B 2LY8A 3AN2A 1P3PB 3W96B 1P3AB 3AZFB 5F99D 3A6ND 4X23D 1P3OC 2Y2NA 3B6GA 1W2EA 3WKJD 2DQNC 3X1UD 3W99B 4KUDB 3REKD 1P3MD 5B31G 4YS3C 3AZEA 1R4VA 3LJAC 5GT3D 2UWXA 5F99B 3A6NB 4X23B 3WAAA 1TZYC 3WKJB 1S32A 3UTAC 3REKB 1P3MB 3C1CB 4Z5TA 1TAFA 3O62D 4J8VD 5GT0A 3LZ0B 1JFIB 3REJC 1EQZA 5GT3B 4WU8D 4R8PB 2NZDA 5B1LC 5B2IC 5B32C 2ZM5A 1M18C 2YFVA 2W8SA 3AZLC 4J8VB 3X1SC 5BNVB 1T3UA 3VH6A 4H9PA 3X1VA 4WU8B 3AZED 4G91C 4WU9C 2CV5C 5DNNA 3MGQA 3REIC 5AV9A 3AZNC 2PYOA 1TZYD 4ZUXA 1WWIA 3F6TA 3W97A 3AZEB 3AZGC 1KX4C 4Z5TD 3WA9A 1Z2CB 1P3BA 1U35A 1P3LC 1KU5A 3R45B 3V9RB 5B24A 5B33C 2NZDD 4Z66C 1P3GD 5B0YC 5B1LD 4XUJA 4J8XA 1M18D 4Z5TB 1TAFB 2ZY4A 1BFMA 1EQZB 1Q9CA 3MVDA 1AOIC 2IO5B 1HQ3C 4WU9D 4J8WA 2CV5D 1F1EA 3NQUB 3AZIC 2NZDB 3P5JB 1P3GB 5CHLB 5B1LB 3VH5A 2YFVB 1M18B 5JA4A 4YM6C 3AZMC 5B31A 4ZUXD 2Y2KA 4H9PB 3W97D 3AZGD 5DNNB 4WU9B 1KX4D 4Z2MG 1P3BD 2BYKB 4JJNA 1P34C 1P3LD 3KUYA 3IP4C 2CWEA 4J8UA 3AYWC 4ZUXB 5AV8A 5B33D 4WV4B 3KWQC 3X1TC 4Z66D 4AWLB 3W97B 4XUJD 3AZGB 1KX4B 4NE6A 1P3BB 3W96A 1P3AA 1AOID 1P3LB 3AZFA 4H9SC 4J8WD 1HQ3D 5B24B 5B33B 3AZID 5B32G 4Z66B 3W99A 4XUJB 4KUDA 3AV1C 5GSUC 3AZMD 3RELC 2FFFB 2JSSA 5B31D 5CPJC 2Y2QA 5F99A 3A6NA 4J8WB 1HQ3B 5KDMB 4XZQC 3WKJA 3X1UA 2HIOC 3REKA 3MGPC 1P3MA 2ZY2A 4J8UD 5B31B 5AV8D 2VQRA 2FJ7C 3X1TD 1KX3C 5BS7A 5GT3A 3B6FA 5B2JC 3AZKA 1ZLAC 4UPKA 4QLCA 2F8NG 5E5AA 3H0RC 1WWSA 4EO5C 4J8UB 5AV8B 3O62A 3UTBC 3UT9C 3KXBC 3RELD 2Y2HA 5CPKC 5CPJD 1P3OA 3MNNC 4KGCC 4Z2MH 1BH8A 2HIOD 4YS3A 4NE5A 2FJ7D 3LJAA 1KX3D 5CPJB 3B6FD 3R45A 3AZKD 4H9OA 1ZLAD 4QLCD 5B1MC 3V9RA 5E5AD 1TZYA 1M1AC 4H9RA 3X1UB 2HIOB 5CPIC 3UTAA 1B6WA 4E44A 3UTBD 3AZJC 2F8NK 3KXBD 3REJA 1KX3B 2NQBC 1BH9A 5CP6C 3LZ1C 3B6FB 3AZKB 4QLCB 5AY8C 5E5AB 3NQUA 2ZY5A 3VH6T 4EO5B 1P3GA 5B1LA 5B2IA 5B32A 1M18A 3H0LC 1P3OD 2RVQC 3AFAC 3O62B 4KGCD 3UTBB 3X1SA 5DNMC 2Y2OA 5C3IC 1ID3C 4YS3D 4WU9A 2CV5A 2BYKA 5BO0A 1B67A 3LJAD 2YFWA 1P3OB 1HTAA 3AZNA 4G92C 4KGCB 2F8NH 1BH8B 3UTAD 5CPID 3AZGA 4YS3B 1KX4A 4DRBA 3LJAB 4KHAA 3REJD 3AZJD 2F8NA 1P3LA 3WTPC 5CP6D 3LZ1D 2G5HC 4H9OB 3AZHC 2AROC 1TZYB 5B33A 5JRGC 4H9RB 4Z66A 5B2ID 5B32D 5B0YA 2Y2IA 3UTAB 3AV2C 5CPIB 1KX5C 3AZLD 3AL0C 2RVQD 3AFAD 3MGSC 3X1SD 3WTPE 3REJB 3AZJB 5BNXA 1BH9B 1AOIA 3WAAC 3VH5T 5CP6B 1HQ3A 5KDMA 3REID 3AZIA 3EPHA 5B2IB 5B32B 3AZLB 4YM6A 5AV5C 4H9NA 3AFAB 3AZMA 3AZND 3X1SB 3EPJA 3EPKA 2Y2MA 4ZBJC 5C3IB 3TU4C 2JCHA 3B0DC 4G91B 2CV5B 4HGAC 5BO0B 3REIB 2F8ND 1P34A 3REHC 2YFWB 3WTPD 1ULYA 3AZNB 1F66C 2AROD 4G92B 3AYWA 1PZRA 5JRGD 3KWQA 3X1TA 5B0YD 1KX5D 3AV2D 1P3IC 3MGSD 4KHAB 2F8NB 5B40C 3WTPB 4H9SA 5BT1C 3NQJA 1P3KC 3W98C 5AVCC 5JRGB 3C1BC 5B0YB 2Y2GA 4WJ3C 1KX5B 3AV2B 5GSUA 4YM6D 4NE3A 5AV5D 3RELA 4LD9C 3MGSB 5BNXB 1AOIB 3TU4D 5CPJA 3AZIB 1P3FC 4XZQA 3LELC 5AV6C 1P34D 1M19C 3REHD 2HIOA 4YM6B 3AZMB 4H9NB 1P3PC 1F66D 3AYWD 2FJ7A 3KWQD 1KX3A 3TU4B 2RIQA 1P3ID 3B0DB 5B2JA 3MGRC 1ZLAA 4HGAB 4DRAA 1P34B 5B40D 3REHB 1H3OB 4WNNB 1F66B 5BT1D 3AYWB 1P3KD 3W98D 3KWQB 3UTBA 5AVCD 3C1BD 3X1TB 3UT9A 5B0ZC 4X23C 3KXBA 3AV1D 5GSUD 1P3IB 2F2AC 4LD9D 1P3MC 3C1CC 5CPKA 2BG1A 3NQJB 3LZ0C 3MNNA 1P3KB 3W98B 4KGCA 4XZQD 3C1BB 1P3FD 5AV6D 1M19D 5AVBC 3AV1B 5GSUB 3MGPD 4R8PC 3RELB 4LD9B 3B0CT 2L5AA 4CAYA 4J8VC 5B2JD 3MGRD 5B1MA 3H0MC 2JE5A 4XZQB 5GXQC 1P3FB 4WU8C 1M1AA 3AN2C 5CPIA 3MGPB 4CSRA 2FJ7B 3UT9D 3AZJA 5B0ZD 2NQBA 3B6GC 5CP6A 3LZ1A 5B2JB 1ZLAB 3MGRB 5AY8A 5FUGB 3AZEC 5CPKD 3C1CD 3AZLA 3AFAA 3MNND 3LZ0D 5DNMA 3UT9B 3KXBB 5B0ZB 2Y2LA 5AVBD 1ID3A 4R8PD 1S32C 1N1JB 3REIA 5CPKB 4UUZB 4Z5TC 4M6BA 5GT0C 3MNNB 5B1MD 1EQZC 5GXQD 2IO5C 1M1AD 5AVBB 3AN2D 2NZDC 1P3GC 2XD1A 4CAYB 2NQBD 3B6GD 3WTPA 2G5IC 5B1MB 3AZHA 2AROA 5AY8D 5GXQB 3X1VC 5JRGA 1M1AB 5DNNC 1KX5A 3AN2B 3AV2A 3MGQC 4CSRB 5AV9C 3B0BA 3MGSA 2Y2PA 5DNMD 2NQBB 2XD5A 3LZ1B 2PYOC 4ZUXC
chains in the Genus database with same CATH topology
1S32D 3A1KA 2HUEC 5AY8B 4AWLC 3W97C 3WA9C 1P3BC 2DF4C 1U35C 3KFUG 5GT0D 5AV5A 1EQZD 5DNMB 4E45A 3TU4A 5B24C 1ID3B 1S32B 5G49A 4XUJC 4J8XC 3REHA 1H3OA 4H9QA 4WNNA 5GT0B 3AZHD 1F66A 3KSYA 3MVDC 3X1VD 4J8WC 5DNND 1ID3D 3MGQD 1P3IA 3FDDA 4NFTA 5AV9D 3B0CW 5B40A 3WAAD 2BYMA 5B31C 2PYOD 3AZHB 2AROB 1P3KA 3W98A 5AVCA 3C1BA 3X1VB 3WA9D 3AV1A 3MGQB 1U35D 4JJNC 4LD9A 5AV9B 3KUYC 4J8UC 3WAAB 5AV8C 5B24D 2PYOB 2HUEB 4J8XD 1P3FA 3LELA 5AV6A 1M19A 3WA9B 3MGPA 3VH6W 5AV5B 1U35B 1P3PA 3W96C 1P3AC 3MVDD 3AZFC 4ZBJB 3MGRA 5G49B 3W99C 4KUDC 4J8XB 5FUGA 4H9QB 2ZY3A 3MVDB 2J8PA 3EG5B 5F99C 4DQYB 3A6NC 5B0ZA 2Y2JA 4X23A 3WKJC 4JJND 1N1JA 3X1UC 3KUYD 3REKC 5JA4B 5B40B 3C1CA 2BYMB 4UUZA 4WZSB 3LZ0A 1JFIA 5BS7C 5GT3C 5AVCB 3LELD 3B6FC 3AZKC 4QLCC 5AVBA 5E5AC 4R8PA 1P3PD 4JJNB 3B6GB 3W96D 1P3AD 3EPLA 3KUYB 3AZFD 1A7WA 3O62C 3A1IA 4J8VA 5BNVA 3VH5W 3W99D 4KUDD 5GXQA 5AV6B 3LELB 4WU8A 1M19B 2LY8A 3AN2A 1P3PB 3W96B 1P3AB 3AZFB 5F99D 3A6ND 4X23D 1P3OC 2Y2NA 3B6GA 1W2EA 3WKJD 2DQNC 3X1UD 3W99B 4KUDB 3REKD 1P3MD 5B31G 4YS3C 3AZEA 1R4VA 3LJAC 5GT3D 2UWXA 5F99B 3A6NB 4X23B 3WAAA 1TZYC 3WKJB 1S32A 3UTAC 3REKB 1P3MB 3C1CB 4Z5TA 1TAFA 3O62D 4J8VD 5GT0A 3LZ0B 1JFIB 3REJC 1EQZA 5GT3B 4WU8D 4R8PB 2NZDA 5B1LC 5B2IC 5B32C 2ZM5A 1M18C 2YFVA 2W8SA 3AZLC 4J8VB 3X1SC 5BNVB 1T3UA 3VH6A 4H9PA 3X1VA 4WU8B 3AZED 4G91C 4WU9C 2CV5C 5DNNA 3MGQA 3REIC 5AV9A 3AZNC 2PYOA 1TZYD 4ZUXA 1WWIA 3F6TA 3W97A 3AZEB 3AZGC 1KX4C 4Z5TD 3WA9A 1Z2CB 1P3BA 1U35A 1P3LC 1KU5A 3R45B 3V9RB 5B24A 5B33C 2NZDD 4Z66C 1P3GD 5B0YC 5B1LD 4XUJA 4J8XA 1M18D 4Z5TB 1TAFB 2ZY4A 1BFMA 1EQZB 1Q9CA 3MVDA 1AOIC 2IO5B 1HQ3C 4WU9D 4J8WA 2CV5D 1F1EA 3NQUB 3AZIC 2NZDB 3P5JB 1P3GB 5CHLB 5B1LB 3VH5A 2YFVB 1M18B 5JA4A 4YM6C 3AZMC 5B31A 4ZUXD 2Y2KA 4H9PB 3W97D 3AZGD 5DNNB 4WU9B 1KX4D 4Z2MG 1P3BD 2BYKB 4JJNA 1P34C 1P3LD 3KUYA 3IP4C 2CWEA 4J8UA 3AYWC 4ZUXB 5AV8A 5B33D 4WV4B 3KWQC 3X1TC 4Z66D 4AWLB 3W97B 4XUJD 3AZGB 1KX4B 4NE6A 1P3BB 3W96A 1P3AA 1AOID 1P3LB 3AZFA 4H9SC 4J8WD 1HQ3D 5B24B 5B33B 3AZID 5B32G 4Z66B 3W99A 4XUJB 4KUDA 3AV1C 5GSUC 3AZMD 3RELC 2FFFB 2JSSA 5B31D 5CPJC 2Y2QA 5F99A 3A6NA 4J8WB 1HQ3B 5KDMB 4XZQC 3WKJA 3X1UA 2HIOC 3REKA 3MGPC 1P3MA 2ZY2A 4J8UD 5B31B 5AV8D 2VQRA 2FJ7C 3X1TD 1KX3C 5BS7A 5GT3A 3B6FA 5B2JC 3AZKA 1ZLAC 4UPKA 4QLCA 2F8NG 5E5AA 3H0RC 1WWSA 4EO5C 4J8UB 5AV8B 3O62A 3UTBC 3UT9C 3KXBC 3RELD 2Y2HA 5CPKC 5CPJD 1P3OA 3MNNC 4KGCC 4Z2MH 1BH8A 2HIOD 4YS3A 4NE5A 2FJ7D 3LJAA 1KX3D 5CPJB 3B6FD 3R45A 3AZKD 4H9OA 1ZLAD 4QLCD 5B1MC 3V9RA 5E5AD 1TZYA 1M1AC 4H9RA 3X1UB 2HIOB 5CPIC 3UTAA 1B6WA 4E44A 3UTBD 3AZJC 2F8NK 3KXBD 3REJA 1KX3B 2NQBC 1BH9A 5CP6C 3LZ1C 3B6FB 3AZKB 4QLCB 5AY8C 5E5AB 3NQUA 2ZY5A 3VH6T 4EO5B 1P3GA 5B1LA 5B2IA 5B32A 1M18A 3H0LC 1P3OD 2RVQC 3AFAC 3O62B 4KGCD 3UTBB 3X1SA 5DNMC 2Y2OA 5C3IC 1ID3C 4YS3D 4WU9A 2CV5A 2BYKA 5BO0A 1B67A 3LJAD 2YFWA 1P3OB 1HTAA 3AZNA 4G92C 4KGCB 2F8NH 1BH8B 3UTAD 5CPID 3AZGA 4YS3B 1KX4A 4DRBA 3LJAB 4KHAA 3REJD 3AZJD 2F8NA 1P3LA 3WTPC 5CP6D 3LZ1D 2G5HC 4H9OB 3AZHC 2AROC 1TZYB 5B33A 5JRGC 4H9RB 4Z66A 5B2ID 5B32D 5B0YA 2Y2IA 3UTAB 3AV2C 5CPIB 1KX5C 3AZLD 3AL0C 2RVQD 3AFAD 3MGSC 3X1SD 3WTPE 3REJB 3AZJB 5BNXA 1BH9B 1AOIA 3WAAC 3VH5T 5CP6B 1HQ3A 5KDMA 3REID 3AZIA 3EPHA 5B2IB 5B32B 3AZLB 4YM6A 5AV5C 4H9NA 3AFAB 3AZMA 3AZND 3X1SB 3EPJA 3EPKA 2Y2MA 4ZBJC 5C3IB 3TU4C 2JCHA 3B0DC 4G91B 2CV5B 4HGAC 5BO0B 3REIB 2F8ND 1P34A 3REHC 2YFWB 3WTPD 1ULYA 3AZNB 1F66C 2AROD 4G92B 3AYWA 1PZRA 5JRGD 3KWQA 3X1TA 5B0YD 1KX5D 3AV2D 1P3IC 3MGSD 4KHAB 2F8NB 5B40C 3WTPB 4H9SA 5BT1C 3NQJA 1P3KC 3W98C 5AVCC 5JRGB 3C1BC 5B0YB 2Y2GA 4WJ3C 1KX5B 3AV2B 5GSUA 4YM6D 4NE3A 5AV5D 3RELA 4LD9C 3MGSB 5BNXB 1AOIB 3TU4D 5CPJA 3AZIB 1P3FC 4XZQA 3LELC 5AV6C 1P34D 1M19C 3REHD 2HIOA 4YM6B 3AZMB 4H9NB 1P3PC 1F66D 3AYWD 2FJ7A 3KWQD 1KX3A 3TU4B 2RIQA 1P3ID 3B0DB 5B2JA 3MGRC 1ZLAA 4HGAB 4DRAA 1P34B 5B40D 3REHB 1H3OB 4WNNB 1F66B 5BT1D 3AYWB 1P3KD 3W98D 3KWQB 3UTBA 5AVCD 3C1BD 3X1TB 3UT9A 5B0ZC 4X23C 3KXBA 3AV1D 5GSUD 1P3IB 2F2AC 4LD9D 1P3MC 3C1CC 5CPKA 2BG1A 3NQJB 3LZ0C 3MNNA 1P3KB 3W98B 4KGCA 4XZQD 3C1BB 1P3FD 5AV6D 1M19D 5AVBC 3AV1B 5GSUB 3MGPD 4R8PC 3RELB 4LD9B 3B0CT 2L5AA 4CAYA 4J8VC 5B2JD 3MGRD 5B1MA 3H0MC 2JE5A 4XZQB 5GXQC 1P3FB 4WU8C 1M1AA 3AN2C 5CPIA 3MGPB 4CSRA 2FJ7B 3UT9D 3AZJA 5B0ZD 2NQBA 3B6GC 5CP6A 3LZ1A 5B2JB 1ZLAB 3MGRB 5AY8A 5FUGB 3AZEC 5CPKD 3C1CD 3AZLA 3AFAA 3MNND 3LZ0D 5DNMA 3UT9B 3KXBB 5B0ZB 2Y2LA 5AVBD 1ID3A 4R8PD 1S32C 1N1JB 3REIA 5CPKB 4UUZB 4Z5TC 4M6BA 5GT0C 3MNNB 5B1MD 1EQZC 5GXQD 2IO5C 1M1AD 5AVBB 3AN2D 2NZDC 1P3GC 2XD1A 4CAYB 2NQBD 3B6GD 3WTPA 2G5IC 5B1MB 3AZHA 2AROA 5AY8D 5GXQB 3X1VC 5JRGA 1M1AB 5DNNC 1KX5A 3AN2B 3AV2A 3MGQC 4CSRB 5AV9C 3B0BA 3MGSA 2Y2PA 5DNMD 2NQBB 2XD5A 3LZ1B 2PYOC 4ZUXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S32 D;  2HUE C;  5AY8 B;  4AWL C;  3W97 C;  3WA9 C;  1P3B C;  1U35 C;  5GT0 D;  5AV5 A;  1EQZ D;  5DNM B;  4E45 A;  3TU4 A;  5B24 C;  1ID3 B;  1S32 B;  5G49 A;  4XUJ C;  4J8X C;  3REH A;  1H3O A;  4H9Q A;  4WNN A;  5GT0 B;  3AZH D;  1F66 A;  3KSY A;  3MVD C;  3X1V D;  4J8W C;  5DNN D;  1ID3 D;  3MGQ D;  1P3I A;  4NFT A;  5AV9 D;  3B0C W;  5B40 A;  3WAA D;  2BYM A;  5B31 C;  2PYO D;  3AZH B;  2ARO B;  1P3K A;  3W98 A;  5AVC A;  3C1B A;  3X1V B;  3WA9 D;  3AV1 A;  3MGQ B;  1U35 D;  4JJN C;  4LD9 A;  5AV9 B;  3KUY C;  4J8U C;  3WAA B;  5AV8 C;  5B24 D;  2PYO B;  2HUE B;  4J8X D;  1P3F A;  3LEL A;  5AV6 A;  1M19 A;  3WA9 B;  3MGP A;  3VH6 W;  5AV5 B;  1U35 B;  1P3P A;  3W96 C;  1P3A C;  3MVD D;  3AZF C;  4ZBJ B;  3MGR A;  5G49 B;  3W99 C;  4KUD C;  4J8X B;  5FUG A;  4H9Q B;  3MVD B;  5F99 C;  3A6N C;  5B0Z A;  4X23 A;  3WKJ C;  4JJN D;  1N1J A;  3X1U C;  3KUY D;  3REK C;  5JA4 B;  5B40 B;  3C1C A;  2BYM B;  4UUZ A;  4WZS B;  3LZ0 A;  1JFI A;  5BS7 C;  5GT3 C;  5AVC B;  3LEL D;  3B6F C;  3AZK C;  4QLC C;  5AVB A;  5E5A C;  4R8P A;  1P3P D;  4JJN B;  3B6G B;  3W96 D;  1P3A D;  3KUY B;  3AZF D;  1A7W A;  3O62 C;  4J8V A;  5BNV A;  3VH5 W;  3W99 D;  4KUD D;  5GXQ A;  5AV6 B;  3LEL B;  4WU8 A;  1M19 B;  2LY8 A;  3AN2 A;  1P3P B;  3W96 B;  1P3A B;  3AZF B;  5F99 D;  3A6N D;  4X23 D;  1P3O C;  3B6G A;  3WKJ D;  3X1U D;  3W99 B;  4KUD B;  3REK D;  1P3M D;  5B31 G;  4YS3 C;  3AZE A;  1R4V A;  3LJA C;  5GT3 D;  5F99 B;  3A6N B;  4X23 B;  3WAA A;  1TZY C;  3WKJ B;  1S32 A;  3UTA C;  3REK B;  1P3M B;  3C1C B;  4Z5T A;  1TAF A;  3O62 D;  4J8V D;  5GT0 A;  3LZ0 B;  1JFI B;  3REJ C;  1EQZ A;  5GT3 B;  4WU8 D;  4R8P B;  2NZD A;  5B1L C;  5B2I C;  5B32 C;  1M18 C;  2YFV A;  3AZL C;  4J8V B;  3X1S C;  5BNV B;  3VH6 A;  4H9P A;  3X1V A;  4WU8 B;  3AZE D;  4G91 C;  4WU9 C;  2CV5 C;  5DNN A;  3MGQ A;  3REI C;  5AV9 A;  3AZN C;  2PYO A;  1TZY D;  4ZUX A;  1WWI A;  3W97 A;  3AZE B;  3AZG C;  1KX4 C;  4Z5T D;  3WA9 A;  1P3B A;  1U35 A;  1P3L C;  1KU5 A;  3R45 B;  3V9R B;  5B24 A;  5B33 C;  2NZD D;  4Z66 C;  1P3G D;  5B0Y C;  5B1L D;  4XUJ A;  4J8X A;  1M18 D;  4Z5T B;  1TAF B;  1BFM A;  1EQZ B;  1Q9C A;  3MVD A;  1AOI C;  2IO5 B;  1HQ3 C;  4WU9 D;  4J8W A;  2CV5 D;  3NQU B;  1F1E A;  3AZI C;  2NZD B;  1P3G B;  5CHL B;  5B1L B;  3VH5 A;  2YFV B;  1M18 B;  5JA4 A;  4YM6 C;  3AZM C;  5B31 A;  4ZUX D;  4H9P B;  3W97 D;  3AZG D;  5DNN B;  4WU9 B;  1KX4 D;  4Z2M G;  1P3B D;  2BYK B;  4JJN A;  1P34 C;  1P3L D;  3KUY A;  2CWE A;  4J8U A;  3AYW C;  4ZUX B;  5AV8 A;  5B33 D;  4WV4 B;  3KWQ C;  3X1T C;  4Z66 D;  4AWL B;  3W97 B;  4XUJ D;  3AZG B;  1KX4 B;  4NE6 A;  1P3B B;  3W96 A;  1P3A A;  1AOI D;  1P3L B;  3AZF A;  4H9S C;  4J8W D;  1HQ3 D;  5B24 B;  5B33 B;  3AZI D;  5B32 G;  4Z66 B;  3W99 A;  4XUJ B;  4KUD A;  3AV1 C;  5GSU C;  3AZM D;  3REL C;  2JSS A;  5B31 D;  5CPJ C;  5F99 A;  3A6N A;  4J8W B;  1HQ3 B;  5KDM B;  4XZQ C;  3WKJ A;  3X1U A;  2HIO C;  3REK A;  3MGP C;  1P3M A;  4J8U D;  5B31 B;  5AV8 D;  2FJ7 C;  3X1T D;  1KX3 C;  5BS7 A;  5GT3 A;  3B6F A;  5B2J C;  3AZK A;  1ZLA C;  4QLC A;  2F8N G;  5E5A A;  1WWS A;  4EO5 C;  4J8U B;  5AV8 B;  3O62 A;  3UTB C;  3UT9 C;  3KXB C;  3REL D;  5CPK C;  5CPJ D;  1P3O A;  3MNN C;  4KGC C;  4Z2M H;  1BH8 A;  2HIO D;  4YS3 A;  4NE5 A;  2FJ7 D;  3LJA A;  1KX3 D;  5CPJ B;  3B6F D;  3R45 A;  3AZK D;  4H9O A;  1ZLA D;  4QLC D;  5B1M C;  3V9R A;  5E5A D;  1TZY A;  1M1A C;  4H9R A;  3X1U B;  2HIO B;  5CPI C;  3UTA A;  1B6W A;  4E44 A;  3UTB D;  3AZJ C;  2F8N K;  3KXB D;  3REJ A;  1KX3 B;  2NQB C;  1BH9 A;  5CP6 C;  3LZ1 C;  3B6F B;  3AZK B;  4QLC B;  5AY8 C;  5E5A B;  3NQU A;  3VH6 T;  4EO5 B;  1P3G A;  5B1L A;  5B2I A;  5B32 A;  1M18 A;  1P3O D;  2RVQ C;  3AFA C;  3O62 B;  4KGC D;  3UTB B;  3X1S A;  5DNM C;  5C3I C;  1ID3 C;  4YS3 D;  4WU9 A;  2CV5 A;  2BYK A;  5BO0 A;  1B67 A;  3LJA D;  2YFW A;  1P3O B;  1HTA A;  3AZN A;  4G92 C;  4KGC B;  2F8N H;  1BH8 B;  3UTA D;  5CPI D;  3AZG A;  4YS3 B;  1KX4 A;  4DRB A;  3LJA B;  4KHA A;  3REJ D;  3AZJ D;  2F8N A;  1P3L A;  3WTP C;  5CP6 D;  3LZ1 D;  4H9O B;  3AZH C;  2ARO C;  1TZY B;  5B33 A;  5JRG C;  4H9R B;  4Z66 A;  5B2I D;  5B32 D;  5B0Y A;  3UTA B;  3AV2 C;  5CPI B;  1KX5 C;  3AZL D;  2RVQ D;  3AFA D;  3MGS C;  3X1S D;  3WTP E;  3REJ B;  3AZJ B;  5BNX A;  1BH9 B;  1AOI A;  3WAA C;  3VH5 T;  5CP6 B;  1HQ3 A;  5KDM A;  3REI D;  3AZI A;  5B2I B;  5B32 B;  3AZL B;  4YM6 A;  5AV5 C;  4H9N A;  3AFA B;  3AZM A;  3AZN D;  3X1S B;  4ZBJ C;  5C3I B;  3TU4 C;  3B0D C;  4G91 B;  2CV5 B;  4HGA C;  5BO0 B;  3REI B;  2F8N D;  1P34 A;  3REH C;  2YFW B;  3WTP D;  1ULY A;  3AZN B;  1F66 C;  2ARO D;  4G92 B;  3AYW A;  5JRG D;  3KWQ A;  3X1T A;  5B0Y D;  1KX5 D;  3AV2 D;  1P3I C;  3MGS D;  4KHA B;  2F8N B;  5B40 C;  3WTP B;  4H9S A;  5BT1 C;  3NQJ A;  1P3K C;  3W98 C;  5AVC C;  5JRG B;  3C1B C;  5B0Y B;  1KX5 B;  3AV2 B;  5GSU A;  4YM6 D;  4NE3 A;  5AV5 D;  3REL A;  4LD9 C;  3MGS B;  5BNX B;  1AOI B;  3TU4 D;  5CPJ A;  3AZI B;  1P3F C;  4XZQ A;  3LEL C;  5AV6 C;  1P34 D;  1M19 C;  3REH D;  2HIO A;  4YM6 B;  3AZM B;  4H9N B;  1P3P C;  1F66 D;  3AYW D;  2FJ7 A;  3KWQ D;  1KX3 A;  3TU4 B;  1P3I D;  3B0D B;  5B2J A;  3MGR C;  1ZLA A;  4HGA B;  4DRA A;  1P34 B;  5B40 D;  3REH B;  1H3O B;  4WNN B;  1F66 B;  5BT1 D;  3AYW B;  1P3K D;  3W98 D;  3KWQ B;  3UTB A;  5AVC D;  3C1B D;  3X1T B;  3UT9 A;  5B0Z C;  4X23 C;  3KXB A;  3AV1 D;  5GSU D;  1P3I B;  4LD9 D;  1P3M C;  3C1C C;  5CPK A;  3NQJ B;  3LZ0 C;  3MNN A;  1P3K B;  3W98 B;  4KGC A;  4XZQ D;  3C1B B;  1P3F D;  5AV6 D;  1M19 D;  5AVB C;  3AV1 B;  5GSU B;  3MGP D;  4R8P C;  3REL B;  4LD9 B;  3B0C T;  2L5A A;  4CAY A;  4J8V C;  5B2J D;  3MGR D;  5B1M A;  4XZQ B;  5GXQ C;  1P3F B;  4WU8 C;  1M1A A;  3AN2 C;  5CPI A;  3MGP B;  4CSR A;  2FJ7 B;  3UT9 D;  3AZJ A;  5B0Z D;  2NQB A;  3B6G C;  5CP6 A;  3LZ1 A;  5B2J B;  1ZLA B;  3MGR B;  5AY8 A;  5FUG B;  3AZE C;  5CPK D;  3C1C D;  3AZL A;  3AFA A;  3MNN D;  3LZ0 D;  5DNM A;  3UT9 B;  3KXB B;  5B0Z B;  5AVB D;  1ID3 A;  4R8P D;  1S32 C;  1N1J B;  3REI A;  5CPK B;  4UUZ B;  4Z5T C;  4M6B A;  5GT0 C;  3MNN B;  5B1M D;  1EQZ C;  5GXQ D;  2IO5 C;  1M1A D;  5AVB B;  3AN2 D;  2NZD C;  1P3G C;  4CAY B;  2NQB D;  3B6G D;  3WTP A;  5B1M B;  3AZH A;  2ARO A;  5AY8 D;  5GXQ B;  3X1V C;  5JRG A;  1M1A B;  5DNN C;  1KX5 A;  3AN2 B;  3AV2 A;  3MGQ C;  4CSR B;  5AV9 C;  3B0B A;  3MGS A;  5DNM D;  2NQB B;  3LZ1 B;  2PYO C;  4ZUX C; 
#chains in the Genus database with same CATH topology
 1S32 D;  3A1K A;  2HUE C;  5AY8 B;  4AWL C;  3W97 C;  3WA9 C;  1P3B C;  2DF4 C;  1U35 C;  3KFU G;  5GT0 D;  5AV5 A;  1EQZ D;  5DNM B;  4E45 A;  3TU4 A;  5B24 C;  1ID3 B;  1S32 B;  5G49 A;  4XUJ C;  4J8X C;  3REH A;  1H3O A;  4H9Q A;  4WNN A;  5GT0 B;  3AZH D;  1F66 A;  3KSY A;  3MVD C;  3X1V D;  4J8W C;  5DNN D;  1ID3 D;  3MGQ D;  1P3I A;  3FDD A;  4NFT A;  5AV9 D;  3B0C W;  5B40 A;  3WAA D;  2BYM A;  5B31 C;  2PYO D;  3AZH B;  2ARO B;  1P3K A;  3W98 A;  5AVC A;  3C1B A;  3X1V B;  3WA9 D;  3AV1 A;  3MGQ B;  1U35 D;  4JJN C;  4LD9 A;  5AV9 B;  3KUY C;  4J8U C;  3WAA B;  5AV8 C;  5B24 D;  2PYO B;  2HUE B;  4J8X D;  1P3F A;  3LEL A;  5AV6 A;  1M19 A;  3WA9 B;  3MGP A;  3VH6 W;  5AV5 B;  1U35 B;  1P3P A;  3W96 C;  1P3A C;  3MVD D;  3AZF C;  4ZBJ B;  3MGR A;  5G49 B;  3W99 C;  4KUD C;  4J8X B;  5FUG A;  4H9Q B;  2ZY3 A;  3MVD B;  2J8P A;  3EG5 B;  5F99 C;  4DQY B;  3A6N C;  5B0Z A;  2Y2J A;  4X23 A;  3WKJ C;  4JJN D;  1N1J A;  3X1U C;  3KUY D;  3REK C;  5JA4 B;  5B40 B;  3C1C A;  2BYM B;  4UUZ A;  4WZS B;  3LZ0 A;  1JFI A;  5BS7 C;  5GT3 C;  5AVC B;  3LEL D;  3B6F C;  3AZK C;  4QLC C;  5AVB A;  5E5A C;  4R8P A;  1P3P D;  4JJN B;  3B6G B;  3W96 D;  1P3A D;  3EPL A;  3KUY B;  3AZF D;  1A7W A;  3O62 C;  3A1I A;  4J8V A;  5BNV A;  3VH5 W;  3W99 D;  4KUD D;  5GXQ A;  5AV6 B;  3LEL B;  4WU8 A;  1M19 B;  2LY8 A;  3AN2 A;  1P3P B;  3W96 B;  1P3A B;  3AZF B;  5F99 D;  3A6N D;  4X23 D;  1P3O C;  2Y2N A;  3B6G A;  1W2E A;  3WKJ D;  2DQN C;  3X1U D;  3W99 B;  4KUD B;  3REK D;  1P3M D;  5B31 G;  4YS3 C;  3AZE A;  1R4V A;  3LJA C;  5GT3 D;  2UWX A;  5F99 B;  3A6N B;  4X23 B;  3WAA A;  1TZY C;  3WKJ B;  1S32 A;  3UTA C;  3REK B;  1P3M B;  3C1C B;  4Z5T A;  1TAF A;  3O62 D;  4J8V D;  5GT0 A;  3LZ0 B;  1JFI B;  3REJ C;  1EQZ A;  5GT3 B;  4WU8 D;  4R8P B;  2NZD A;  5B1L C;  5B2I C;  5B32 C;  2ZM5 A;  1M18 C;  2YFV A;  2W8S A;  3AZL C;  4J8V B;  3X1S C;  5BNV B;  1T3U A;  3VH6 A;  4H9P A;  3X1V A;  4WU8 B;  3AZE D;  4G91 C;  4WU9 C;  2CV5 C;  5DNN A;  3MGQ A;  3REI C;  5AV9 A;  3AZN C;  2PYO A;  1TZY D;  4ZUX A;  1WWI A;  3F6T A;  3W97 A;  3AZE B;  3AZG C;  1KX4 C;  4Z5T D;  3WA9 A;  1Z2C B;  1P3B A;  1U35 A;  1P3L C;  1KU5 A;  3R45 B;  3V9R B;  5B24 A;  5B33 C;  2NZD D;  4Z66 C;  1P3G D;  5B0Y C;  5B1L D;  4XUJ A;  4J8X A;  1M18 D;  4Z5T B;  1TAF B;  2ZY4 A;  1BFM A;  1EQZ B;  1Q9C A;  3MVD A;  1AOI C;  2IO5 B;  1HQ3 C;  4WU9 D;  4J8W A;  2CV5 D;  1F1E A;  3NQU B;  3AZI C;  2NZD B;  3P5J B;  1P3G B;  5CHL B;  5B1L B;  3VH5 A;  2YFV B;  1M18 B;  5JA4 A;  4YM6 C;  3AZM C;  5B31 A;  4ZUX D;  2Y2K A;  4H9P B;  3W97 D;  3AZG D;  5DNN B;  4WU9 B;  1KX4 D;  4Z2M G;  1P3B D;  2BYK B;  4JJN A;  1P34 C;  1P3L D;  3KUY A;  3IP4 C;  2CWE A;  4J8U A;  3AYW C;  4ZUX B;  5AV8 A;  5B33 D;  4WV4 B;  3KWQ C;  3X1T C;  4Z66 D;  4AWL B;  3W97 B;  4XUJ D;  3AZG B;  1KX4 B;  4NE6 A;  1P3B B;  3W96 A;  1P3A A;  1AOI D;  1P3L B;  3AZF A;  4H9S C;  4J8W D;  1HQ3 D;  5B24 B;  5B33 B;  3AZI D;  5B32 G;  4Z66 B;  3W99 A;  4XUJ B;  4KUD A;  3AV1 C;  5GSU C;  3AZM D;  3REL C;  2FFF B;  2JSS A;  5B31 D;  5CPJ C;  2Y2Q A;  5F99 A;  3A6N A;  4J8W B;  1HQ3 B;  5KDM B;  4XZQ C;  3WKJ A;  3X1U A;  2HIO C;  3REK A;  3MGP C;  1P3M A;  2ZY2 A;  4J8U D;  5B31 B;  5AV8 D;  2VQR A;  2FJ7 C;  3X1T D;  1KX3 C;  5BS7 A;  5GT3 A;  3B6F A;  5B2J C;  3AZK A;  1ZLA C;  4UPK A;  4QLC A;  2F8N G;  5E5A A;  3H0R C;  1WWS A;  4EO5 C;  4J8U B;  5AV8 B;  3O62 A;  3UTB C;  3UT9 C;  3KXB C;  3REL D;  2Y2H A;  5CPK C;  5CPJ D;  1P3O A;  3MNN C;  4KGC C;  4Z2M H;  1BH8 A;  2HIO D;  4YS3 A;  4NE5 A;  2FJ7 D;  3LJA A;  1KX3 D;  5CPJ B;  3B6F D;  3R45 A;  3AZK D;  4H9O A;  1ZLA D;  4QLC D;  5B1M C;  3V9R A;  5E5A D;  1TZY A;  1M1A C;  4H9R A;  3X1U B;  2HIO B;  5CPI C;  3UTA A;  1B6W A;  4E44 A;  3UTB D;  3AZJ C;  2F8N K;  3KXB D;  3REJ A;  1KX3 B;  2NQB C;  1BH9 A;  5CP6 C;  3LZ1 C;  3B6F B;  3AZK B;  4QLC B;  5AY8 C;  5E5A B;  3NQU A;  2ZY5 A;  3VH6 T;  4EO5 B;  1P3G A;  5B1L A;  5B2I A;  5B32 A;  1M18 A;  3H0L C;  1P3O D;  2RVQ C;  3AFA C;  3O62 B;  4KGC D;  3UTB B;  3X1S A;  5DNM C;  2Y2O A;  5C3I C;  1ID3 C;  4YS3 D;  4WU9 A;  2CV5 A;  2BYK A;  5BO0 A;  1B67 A;  3LJA D;  2YFW A;  1P3O B;  1HTA A;  3AZN A;  4G92 C;  4KGC B;  2F8N H;  1BH8 B;  3UTA D;  5CPI D;  3AZG A;  4YS3 B;  1KX4 A;  4DRB A;  3LJA B;  4KHA A;  3REJ D;  3AZJ D;  2F8N A;  1P3L A;  3WTP C;  5CP6 D;  3LZ1 D;  2G5H C;  4H9O B;  3AZH C;  2ARO C;  1TZY B;  5B33 A;  5JRG C;  4H9R B;  4Z66 A;  5B2I D;  5B32 D;  5B0Y A;  2Y2I A;  3UTA B;  3AV2 C;  5CPI B;  1KX5 C;  3AZL D;  3AL0 C;  2RVQ D;  3AFA D;  3MGS C;  3X1S D;  3WTP E;  3REJ B;  3AZJ B;  5BNX A;  1BH9 B;  1AOI A;  3WAA C;  3VH5 T;  5CP6 B;  1HQ3 A;  5KDM A;  3REI D;  3AZI A;  3EPH A;  5B2I B;  5B32 B;  3AZL B;  4YM6 A;  5AV5 C;  4H9N A;  3AFA B;  3AZM A;  3AZN D;  3X1S B;  3EPJ A;  3EPK A;  2Y2M A;  4ZBJ C;  5C3I B;  3TU4 C;  2JCH A;  3B0D C;  4G91 B;  2CV5 B;  4HGA C;  5BO0 B;  3REI B;  2F8N D;  1P34 A;  3REH C;  2YFW B;  3WTP D;  1ULY A;  3AZN B;  1F66 C;  2ARO D;  4G92 B;  3AYW A;  1PZR A;  5JRG D;  3KWQ A;  3X1T A;  5B0Y D;  1KX5 D;  3AV2 D;  1P3I C;  3MGS D;  4KHA B;  2F8N B;  5B40 C;  3WTP B;  4H9S A;  5BT1 C;  3NQJ A;  1P3K C;  3W98 C;  5AVC C;  5JRG B;  3C1B C;  5B0Y B;  2Y2G A;  4WJ3 C;  1KX5 B;  3AV2 B;  5GSU A;  4YM6 D;  4NE3 A;  5AV5 D;  3REL A;  4LD9 C;  3MGS B;  5BNX B;  1AOI B;  3TU4 D;  5CPJ A;  3AZI B;  1P3F C;  4XZQ A;  3LEL C;  5AV6 C;  1P34 D;  1M19 C;  3REH D;  2HIO A;  4YM6 B;  3AZM B;  4H9N B;  1P3P C;  1F66 D;  3AYW D;  2FJ7 A;  3KWQ D;  1KX3 A;  3TU4 B;  2RIQ A;  1P3I D;  3B0D B;  5B2J A;  3MGR C;  1ZLA A;  4HGA B;  4DRA A;  1P34 B;  5B40 D;  3REH B;  1H3O B;  4WNN B;  1F66 B;  5BT1 D;  3AYW B;  1P3K D;  3W98 D;  3KWQ B;  3UTB A;  5AVC D;  3C1B D;  3X1T B;  3UT9 A;  5B0Z C;  4X23 C;  3KXB A;  3AV1 D;  5GSU D;  1P3I B;  2F2A C;  4LD9 D;  1P3M C;  3C1C C;  5CPK A;  2BG1 A;  3NQJ B;  3LZ0 C;  3MNN A;  1P3K B;  3W98 B;  4KGC A;  4XZQ D;  3C1B B;  1P3F D;  5AV6 D;  1M19 D;  5AVB C;  3AV1 B;  5GSU B;  3MGP D;  4R8P C;  3REL B;  4LD9 B;  3B0C T;  2L5A A;  4CAY A;  4J8V C;  5B2J D;  3MGR D;  5B1M A;  3H0M C;  2JE5 A;  4XZQ B;  5GXQ C;  1P3F B;  4WU8 C;  1M1A A;  3AN2 C;  5CPI A;  3MGP B;  4CSR A;  2FJ7 B;  3UT9 D;  3AZJ A;  5B0Z D;  2NQB A;  3B6G C;  5CP6 A;  3LZ1 A;  5B2J B;  1ZLA B;  3MGR B;  5AY8 A;  5FUG B;  3AZE C;  5CPK D;  3C1C D;  3AZL A;  3AFA A;  3MNN D;  3LZ0 D;  5DNM A;  3UT9 B;  3KXB B;  5B0Z B;  2Y2L A;  5AVB D;  1ID3 A;  4R8P D;  1S32 C;  1N1J B;  3REI A;  5CPK B;  4UUZ B;  4Z5T C;  4M6B A;  5GT0 C;  3MNN B;  5B1M D;  1EQZ C;  5GXQ D;  2IO5 C;  1M1A D;  5AVB B;  3AN2 D;  2NZD C;  1P3G C;  2XD1 A;  4CAY B;  2NQB D;  3B6G D;  3WTP A;  2G5I C;  5B1M B;  3AZH A;  2ARO A;  5AY8 D;  5GXQ B;  3X1V C;  5JRG A;  1M1A B;  5DNN C;  1KX5 A;  3AN2 B;  3AV2 A;  3MGQ C;  4CSR B;  5AV9 C;  3B0B A;  3MGS A;  2Y2P A;  5DNM D;  2NQB B;  2XD5 A;  3LZ1 B;  2PYO C;  4ZUX C; 
#chains in the Genus database with same CATH homology
 1S32 D;  3A1K A;  2HUE C;  5AY8 B;  4AWL C;  3W97 C;  3WA9 C;  1P3B C;  2DF4 C;  1U35 C;  3KFU G;  5GT0 D;  5AV5 A;  1EQZ D;  5DNM B;  4E45 A;  3TU4 A;  5B24 C;  1ID3 B;  1S32 B;  5G49 A;  4XUJ C;  4J8X C;  3REH A;  1H3O A;  4H9Q A;  4WNN A;  5GT0 B;  3AZH D;  1F66 A;  3KSY A;  3MVD C;  3X1V D;  4J8W C;  5DNN D;  1ID3 D;  3MGQ D;  1P3I A;  3FDD A;  4NFT A;  5AV9 D;  3B0C W;  5B40 A;  3WAA D;  2BYM A;  5B31 C;  2PYO D;  3AZH B;  2ARO B;  1P3K A;  3W98 A;  5AVC A;  3C1B A;  3X1V B;  3WA9 D;  3AV1 A;  3MGQ B;  1U35 D;  4JJN C;  4LD9 A;  5AV9 B;  3KUY C;  4J8U C;  3WAA B;  5AV8 C;  5B24 D;  2PYO B;  2HUE B;  4J8X D;  1P3F A;  3LEL A;  5AV6 A;  1M19 A;  3WA9 B;  3MGP A;  3VH6 W;  5AV5 B;  1U35 B;  1P3P A;  3W96 C;  1P3A C;  3MVD D;  3AZF C;  4ZBJ B;  3MGR A;  5G49 B;  3W99 C;  4KUD C;  4J8X B;  5FUG A;  4H9Q B;  2ZY3 A;  3MVD B;  2J8P A;  3EG5 B;  5F99 C;  4DQY B;  3A6N C;  5B0Z A;  2Y2J A;  4X23 A;  3WKJ C;  4JJN D;  1N1J A;  3X1U C;  3KUY D;  3REK C;  5JA4 B;  5B40 B;  3C1C A;  2BYM B;  4UUZ A;  4WZS B;  3LZ0 A;  1JFI A;  5BS7 C;  5GT3 C;  5AVC B;  3LEL D;  3B6F C;  3AZK C;  4QLC C;  5AVB A;  5E5A C;  4R8P A;  1P3P D;  4JJN B;  3B6G B;  3W96 D;  1P3A D;  3EPL A;  3KUY B;  3AZF D;  1A7W A;  3O62 C;  3A1I A;  4J8V A;  5BNV A;  3VH5 W;  3W99 D;  4KUD D;  5GXQ A;  5AV6 B;  3LEL B;  4WU8 A;  1M19 B;  2LY8 A;  3AN2 A;  1P3P B;  3W96 B;  1P3A B;  3AZF B;  5F99 D;  3A6N D;  4X23 D;  1P3O C;  2Y2N A;  3B6G A;  1W2E A;  3WKJ D;  2DQN C;  3X1U D;  3W99 B;  4KUD B;  3REK D;  1P3M D;  5B31 G;  4YS3 C;  3AZE A;  1R4V A;  3LJA C;  5GT3 D;  2UWX A;  5F99 B;  3A6N B;  4X23 B;  3WAA A;  1TZY C;  3WKJ B;  1S32 A;  3UTA C;  3REK B;  1P3M B;  3C1C B;  4Z5T A;  1TAF A;  3O62 D;  4J8V D;  5GT0 A;  3LZ0 B;  1JFI B;  3REJ C;  1EQZ A;  5GT3 B;  4WU8 D;  4R8P B;  2NZD A;  5B1L C;  5B2I C;  5B32 C;  2ZM5 A;  1M18 C;  2YFV A;  2W8S A;  3AZL C;  4J8V B;  3X1S C;  5BNV B;  1T3U A;  3VH6 A;  4H9P A;  3X1V A;  4WU8 B;  3AZE D;  4G91 C;  4WU9 C;  2CV5 C;  5DNN A;  3MGQ A;  3REI C;  5AV9 A;  3AZN C;  2PYO A;  1TZY D;  4ZUX A;  1WWI A;  3F6T A;  3W97 A;  3AZE B;  3AZG C;  1KX4 C;  4Z5T D;  3WA9 A;  1Z2C B;  1P3B A;  1U35 A;  1P3L C;  1KU5 A;  3R45 B;  3V9R B;  5B24 A;  5B33 C;  2NZD D;  4Z66 C;  1P3G D;  5B0Y C;  5B1L D;  4XUJ A;  4J8X A;  1M18 D;  4Z5T B;  1TAF B;  2ZY4 A;  1BFM A;  1EQZ B;  1Q9C A;  3MVD A;  1AOI C;  2IO5 B;  1HQ3 C;  4WU9 D;  4J8W A;  2CV5 D;  1F1E A;  3NQU B;  3AZI C;  2NZD B;  3P5J B;  1P3G B;  5CHL B;  5B1L B;  3VH5 A;  2YFV B;  1M18 B;  5JA4 A;  4YM6 C;  3AZM C;  5B31 A;  4ZUX D;  2Y2K A;  4H9P B;  3W97 D;  3AZG D;  5DNN B;  4WU9 B;  1KX4 D;  4Z2M G;  1P3B D;  2BYK B;  4JJN A;  1P34 C;  1P3L D;  3KUY A;  3IP4 C;  2CWE A;  4J8U A;  3AYW C;  4ZUX B;  5AV8 A;  5B33 D;  4WV4 B;  3KWQ C;  3X1T C;  4Z66 D;  4AWL B;  3W97 B;  4XUJ D;  3AZG B;  1KX4 B;  4NE6 A;  1P3B B;  3W96 A;  1P3A A;  1AOI D;  1P3L B;  3AZF A;  4H9S C;  4J8W D;  1HQ3 D;  5B24 B;  5B33 B;  3AZI D;  5B32 G;  4Z66 B;  3W99 A;  4XUJ B;  4KUD A;  3AV1 C;  5GSU C;  3AZM D;  3REL C;  2FFF B;  2JSS A;  5B31 D;  5CPJ C;  2Y2Q A;  5F99 A;  3A6N A;  4J8W B;  1HQ3 B;  5KDM B;  4XZQ C;  3WKJ A;  3X1U A;  2HIO C;  3REK A;  3MGP C;  1P3M A;  2ZY2 A;  4J8U D;  5B31 B;  5AV8 D;  2VQR A;  2FJ7 C;  3X1T D;  1KX3 C;  5BS7 A;  5GT3 A;  3B6F A;  5B2J C;  3AZK A;  1ZLA C;  4UPK A;  4QLC A;  2F8N G;  5E5A A;  3H0R C;  1WWS A;  4EO5 C;  4J8U B;  5AV8 B;  3O62 A;  3UTB C;  3UT9 C;  3KXB C;  3REL D;  2Y2H A;  5CPK C;  5CPJ D;  1P3O A;  3MNN C;  4KGC C;  4Z2M H;  1BH8 A;  2HIO D;  4YS3 A;  4NE5 A;  2FJ7 D;  3LJA A;  1KX3 D;  5CPJ B;  3B6F D;  3R45 A;  3AZK D;  4H9O A;  1ZLA D;  4QLC D;  5B1M C;  3V9R A;  5E5A D;  1TZY A;  1M1A C;  4H9R A;  3X1U B;  2HIO B;  5CPI C;  3UTA A;  1B6W A;  4E44 A;  3UTB D;  3AZJ C;  2F8N K;  3KXB D;  3REJ A;  1KX3 B;  2NQB C;  1BH9 A;  5CP6 C;  3LZ1 C;  3B6F B;  3AZK B;  4QLC B;  5AY8 C;  5E5A B;  3NQU A;  2ZY5 A;  3VH6 T;  4EO5 B;  1P3G A;  5B1L A;  5B2I A;  5B32 A;  1M18 A;  3H0L C;  1P3O D;  2RVQ C;  3AFA C;  3O62 B;  4KGC D;  3UTB B;  3X1S A;  5DNM C;  2Y2O A;  5C3I C;  1ID3 C;  4YS3 D;  4WU9 A;  2CV5 A;  2BYK A;  5BO0 A;  1B67 A;  3LJA D;  2YFW A;  1P3O B;  1HTA A;  3AZN A;  4G92 C;  4KGC B;  2F8N H;  1BH8 B;  3UTA D;  5CPI D;  3AZG A;  4YS3 B;  1KX4 A;  4DRB A;  3LJA B;  4KHA A;  3REJ D;  3AZJ D;  2F8N A;  1P3L A;  3WTP C;  5CP6 D;  3LZ1 D;  2G5H C;  4H9O B;  3AZH C;  2ARO C;  1TZY B;  5B33 A;  5JRG C;  4H9R B;  4Z66 A;  5B2I D;  5B32 D;  5B0Y A;  2Y2I A;  3UTA B;  3AV2 C;  5CPI B;  1KX5 C;  3AZL D;  3AL0 C;  2RVQ D;  3AFA D;  3MGS C;  3X1S D;  3WTP E;  3REJ B;  3AZJ B;  5BNX A;  1BH9 B;  1AOI A;  3WAA C;  3VH5 T;  5CP6 B;  1HQ3 A;  5KDM A;  3REI D;  3AZI A;  3EPH A;  5B2I B;  5B32 B;  3AZL B;  4YM6 A;  5AV5 C;  4H9N A;  3AFA B;  3AZM A;  3AZN D;  3X1S B;  3EPJ A;  3EPK A;  2Y2M A;  4ZBJ C;  5C3I B;  3TU4 C;  2JCH A;  3B0D C;  4G91 B;  2CV5 B;  4HGA C;  5BO0 B;  3REI B;  2F8N D;  1P34 A;  3REH C;  2YFW B;  3WTP D;  1ULY A;  3AZN B;  1F66 C;  2ARO D;  4G92 B;  3AYW A;  1PZR A;  5JRG D;  3KWQ A;  3X1T A;  5B0Y D;  1KX5 D;  3AV2 D;  1P3I C;  3MGS D;  4KHA B;  2F8N B;  5B40 C;  3WTP B;  4H9S A;  5BT1 C;  3NQJ A;  1P3K C;  3W98 C;  5AVC C;  5JRG B;  3C1B C;  5B0Y B;  2Y2G A;  4WJ3 C;  1KX5 B;  3AV2 B;  5GSU A;  4YM6 D;  4NE3 A;  5AV5 D;  3REL A;  4LD9 C;  3MGS B;  5BNX B;  1AOI B;  3TU4 D;  5CPJ A;  3AZI B;  1P3F C;  4XZQ A;  3LEL C;  5AV6 C;  1P34 D;  1M19 C;  3REH D;  2HIO A;  4YM6 B;  3AZM B;  4H9N B;  1P3P C;  1F66 D;  3AYW D;  2FJ7 A;  3KWQ D;  1KX3 A;  3TU4 B;  2RIQ A;  1P3I D;  3B0D B;  5B2J A;  3MGR C;  1ZLA A;  4HGA B;  4DRA A;  1P34 B;  5B40 D;  3REH B;  1H3O B;  4WNN B;  1F66 B;  5BT1 D;  3AYW B;  1P3K D;  3W98 D;  3KWQ B;  3UTB A;  5AVC D;  3C1B D;  3X1T B;  3UT9 A;  5B0Z C;  4X23 C;  3KXB A;  3AV1 D;  5GSU D;  1P3I B;  2F2A C;  4LD9 D;  1P3M C;  3C1C C;  5CPK A;  2BG1 A;  3NQJ B;  3LZ0 C;  3MNN A;  1P3K B;  3W98 B;  4KGC A;  4XZQ D;  3C1B B;  1P3F D;  5AV6 D;  1M19 D;  5AVB C;  3AV1 B;  5GSU B;  3MGP D;  4R8P C;  3REL B;  4LD9 B;  3B0C T;  2L5A A;  4CAY A;  4J8V C;  5B2J D;  3MGR D;  5B1M A;  3H0M C;  2JE5 A;  4XZQ B;  5GXQ C;  1P3F B;  4WU8 C;  1M1A A;  3AN2 C;  5CPI A;  3MGP B;  4CSR A;  2FJ7 B;  3UT9 D;  3AZJ A;  5B0Z D;  2NQB A;  3B6G C;  5CP6 A;  3LZ1 A;  5B2J B;  1ZLA B;  3MGR B;  5AY8 A;  5FUG B;  3AZE C;  5CPK D;  3C1C D;  3AZL A;  3AFA A;  3MNN D;  3LZ0 D;  5DNM A;  3UT9 B;  3KXB B;  5B0Z B;  2Y2L A;  5AVB D;  1ID3 A;  4R8P D;  1S32 C;  1N1J B;  3REI A;  5CPK B;  4UUZ B;  4Z5T C;  4M6B A;  5GT0 C;  3MNN B;  5B1M D;  1EQZ C;  5GXQ D;  2IO5 C;  1M1A D;  5AVB B;  3AN2 D;  2NZD C;  1P3G C;  2XD1 A;  4CAY B;  2NQB D;  3B6G D;  3WTP A;  2G5I C;  5B1M B;  3AZH A;  2ARO A;  5AY8 D;  5GXQ B;  3X1V C;  5JRG A;  1M1A B;  5DNN C;  1KX5 A;  3AN2 B;  3AV2 A;  3MGQ C;  4CSR B;  5AV9 C;  3B0B A;  3MGS A;  2Y2P A;  5DNM D;  2NQB B;  2XD5 A;  3LZ1 B;  2PYO C;  4ZUX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...