4X23A

Crystal structure of cenp-c in complex with the nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
95
structure length
95
Chain Sequence
b'RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (147-MER)
publication title A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 95
sequence length 95
chains with identical sequence E, K, O
ec nomenclature
pdb deposition date 2014-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4x23A00
3UTBB 1P3OA 3WTPC 3KXBA 4YS3A 5AV5C 1P3OB 5B33C 5B40C 3B6GA 5AY8D 3KXBB 4YS3B 1H3OA 3B6GB 4KUDA 5AVCD 1H3OB 2PYOC 4KUDB 3AZND 4WU8A 5B24C 4WU8B 1N1JA 1F66A 1N1JB 4E44A 1F66B 3VH6A 3MGQD 1M18D 3REHD 3AZKD 1BFMA 5B32C 1P34A 1P34B 5CPJD 3X1SC 2F8ND 3AZLC 4J8XC 5G49A 3X1VD 4ZBJC 5AV5A 5G49B 5B33A 4LD9C 5AV5B 5B33B 2L5AA 3LZ0C 2PYOA 3UTAC 2PYOB 5B24A 4R8PA 4H9QA 5B24B 1BH9A 5B2IC 4R8PB 4H9QB 3W99C 1BH9B 4H9SC 3LJAD 2HUEC 3MNND 1M19C 1P3KA 1P3KB 4DRAA 4J8UD 3AZLA 4YM6D 3W97D 4X23A 3AZLB 4X23B 4LD9A 5GT0D 4DRBA 1P3MC 4Z66C 5AV6A 4WV4B 4QLCC 2AROD 5DNNA 5B0ZD 4LD9B 5AV6B 3WKJD 5DNNB 3AZFC 4NE5A 4J8VD 5B31C 3AV1D 3AV2C 2BYMA 5GXQC 1P3AC 1P3BA 3AYWC 4G92B 2BYMB 3AZGA 1P3BB 5B1LD 1KX3C 3O62A 3AZGB 3O62B 5FUGA 3X1TC 1HQ3D 1A7WA 2NZDD 5FUGB 1ZLAA 1KX4D 1TZYD 1P3MA 4Z66A 4CSRA 4QLCA 3AN2D 1ZLAB 1P3MB 4Z66B 4CSRB 4QLCB 3REJC 3AZFA 3WA9C 3AFAC 5AV8D 3AZFB 4WU9A 5JA4A 4JJND 4WU9B 1KX5C 5JA4B 5B0YD 5DNMC 3AZHC 3AZIA 5E5AA 5B32G 1P3PD 3UT9A 3AZIB 5E5AB 2CWEA 5GXQA 3UT9B 1P3AA 1M1AC 5GXQB 1P3AB 4E45A 5CP6D 2NQBC 1EQZA 4KGCC 1P3IC 3X1TA 1EQZB 3W96A 1F1EA 3VH6T 3KUYC 3TU4C 3W96B 3C1CA 3X1UC 3C1CB 3WA9A 5B1MA 3W98A 3UTBC 2CV5C 5B1MB 5GSUC 3W98B 1P3OC 3LZ1A 1P3GA 1U35D 3KXBC 3LZ1B 3AZHA 1P3GB 4KUDC 3AZHB 3LELD 2IO5C 3B0CT 1M1AA 4WU8C 4Z5TD 1S32D 1M1AB 3VH5A 1ID3A 1F66C 5CPKA 1ID3B 4KGCA 4XZQA 3REIA 3AZMC 5CPKB 5F99D 3RELC 4XZQB 3MGSA 3REIB 3KUYA 3TU4A 3MGSB 3KUYB 3TU4B 3V9RA 5B31G 5CPID 4XUJA 1P3FD 3V9RB 3REKD 4XUJB 5JRGD 3UTBA 2CV5A 2BYKA 5GSUA 3A6NA 1AOID 4YS3D 2CV5B 4KHAA 2BYKB 5GSUB 5AVBA 3A6NB 3B6GD 4KHAB 5AVBB 5AVCC 3AZNC 2IO5B 3MVDA 3WAAD 1WWSA 2HIOD 4R8PC 3MVDB 3MGQC 3AZMA 4G91B 3KWQA 3WTPE 3RELA 3AZMB 3KWQB 3RELB 4J8WA 1P3KC 4J8WB 2FJ7A 2FJ7B 3WTPD 3KSYA 5B40D 4X23C 5AV6C 5AVCA 5DNNC 5AVCB 4Z2MH 3AZNA 1P3LD 5B24D 3AZNB 1BH8A 1BH8B 3MGQA 3MGQB 1R4VA 4G92C 3AZKA 1P3BC 5B32D 3AZKB 3AZGC 3X1SD 3O62C 5CPJA 5BS7A 2F8NA 3AZLD 4J8XD 5CPJB 3W97C 2F8NB 3X1VA 4LD9D 1ZLAC 3X1VB 4H9RA 3LZ0D 4H9RB 3WKJC 3UTAD 4WU9C 5B2ID 3W99D 3AZIC 5E5AC 3LJAA 3MNNA 3UT9C 3LJAB 3MNNB 1M19D 4M6BA 1ULYA 3AZJC 3VH5T 1EQZC 3W97A 4YM6A 4J8UB 5BT1C 4YM6B 3W97B 3W96C 5GT0A 1P3MD 4Z66D 4QLCD 5B0ZA 2AROA 5GT0B 3C1CC 5B0ZB 3WKJA 2AROB 3AZFD 5C3IC 3WKJB 5B1MC 4J8VA 3W98C 5AV9C 3MGPD 1HTAA 5B31D 4J8VB 3AZEC 3AV1A 3NQUA 3LZ1C 1P3GC 3AV2D 5B0YC 3NQUB 3AV1B 5GXQD 1P3AD 3AYWD 5CHLB 1KX3D 5B1LA 5B1LB 4AWLB 3AZJA 1ID3C 2YFVA 5CPKC 3X1TD 1HQ3A 4XZQC 3AZJB 2YFVB 3REIC 2NZDA 4H9OA 1HQ3B 1KX4A 1TZYA 3MGSC 2NZDB 4H9OB 3AN2A 1KX4B 1TZYB 5B2JC 3AN2B 3REJD 3WA9D 3AFAD 2RVQC 4XUJC 4H9PA 5AV8A 5C3IB 5AV9A 5AV8B 4H9PB 3AZEA 3A6NC 4JJNA 5AV9B 1KX5D 3B6FC 3AZEB 5AVBC 4JJNB 5DNMD 5B0YA 3NQJA 1P3PA 5B0YB 3NQJB 1P3PB 3VH6W 1M1AD 5GT3C 4ZUXC 2NQBD 5CP6A 3MVDC 3MGRD 5CP6B 4KGCD 3C1BC 4G91C 1P3ID 5BO0A 3KWQC 3KUYD 5BO0B 3X1UD 5B2JA 4J8WC 5CPIC 4NE6A 4NE3A 5B2JB 3REKC 3UTBD 2FJ7C 3B0CW 1AOIC 1P3OD 3B6FA 3KXBD 1U35A 3B6FB 1U35B 5AY8C 4KUDD 3LELA 4CAYA 3LELB 4WU8D 4CAYB 5GT3A 4Z5TA 4ZUXA 1S32A 5GT3B 4Z5TB 4ZUXB 1S32B 1F66D 3C1BA 3RELD 5F99A 3C1BB 4WZSB 5F99B 1M18C 3REHC 3AZKC 4EO5B 1P34D 5CPIA 1P3FA 3REKA 4HGAB 5CPIB 5BS7C 4H9NA 5JRGA 5CPJC 3REKB 1P3FB 1AOIA 5JRGB 4H9NB 1AOIB 5AV5D 3B0DC 5B33D 3X1VC 5AY8A 2F8NH 5AY8B 2PYOD 1P3LC 3WAAA 4R8PD 2HIOA 4WNNA 3WAAB 2HIOB 4WNNB 3LJAC 3MNNC 1M18A 3REHA 1M18B 5BNXA 3REHB 1P3KD 2YFWA 5BNXB 2YFWB 4J8UC 3WTPA 4YM6C 4X23D 5B40A 3WTPB 5B40B 5GT0C 3B0DB 5AV6D 5B0ZC 5DNND 2AROC 1B67A 1P3LA 4J8VC 1P3LB 3AV1C 1P3BD 5B32A 1KU5A 3AZGD 5B32B 5B1LC 1WWIA 3X1SA 3O62D 4AWLC 2LY8A 4UUZA 3X1SB 4J8XA 4J8UA 4UUZB 1HQ3C 4J8XB 2NZDC 1ZLAD 4ZBJB 1KX4C 1TZYC 3LZ0A 3AN2C 3LZ0B 3UTAA 5AV8C 3UTAB 4WU9D 3MGPC 5B2IA 4JJNC 3W99A 4H9SA 5B2IB 3AZID 5E5AD 3VH5W 3W99B 1P3PC 3UT9D 2HUEB 2F8NG 1M19A 1M19B 4Z2MG 5CP6C 3AZJD 1EQZD 5BT1D 3W96D 3C1CD 5B1MD 3W98D 1JFIA 5AV9D 3AZED 3MGPA 5B31A 1JFIB 3LZ1D 3MGPB 5B31B 1P3GD 3AV2A 1U35C 3AZHD 3AV2B 1B6WA 3LELC 3AYWA 3AYWB 1KX3A 4Z5TC 1S32C 1ID3D 3MGRC 1KX3B 5CPKD 4XZQD 3REID 3X1TB 5F99C 3MGSD 3TU4D 4EO5C 3R45A 5B2JD 3REJA 5BNVA 3R45B 3AFAA 2RVQD 4XUJD 4HGAC 1P3FC 2F8NK 3REJB 5BNVB 3WA9B 3AFAB 2CV5D 5JRGC 5GSUD 3A6ND 1KX5A 3B6FD 4YS3C 5AVBD 3B6GC 1KX5B 5DNMA 5DNMB 1TAFA 1TAFB 2JSSA 5GT3D 4ZUXD 4NFTA 3MVDD 2NQBA 3WAAC 2HIOC 3MGRA 2NQBB 3C1BD 3B0BA 1P3IA 3MGRB 4KGCB 3AZMD 3KWQD 1P3IB 5KDMA 3X1UA 1P34C 4J8WD 5KDMB 3X1UB 2FJ7D 1Q9CA
chains in the Genus database with same CATH superfamily
3UTBB 1P3OA 3WTPC 3KXBA 4YS3A 5AV5C 1P3OB 5B33C 5B40C 3B6GA 5AY8D 3KXBB 4YS3B 1H3OA 3B6GB 4KUDA 2VQRA 5AVCD 1H3OB 2PYOC 4KUDB 3AZND 4WU8A 3EPJA 5B24C 4WU8B 1N1JA 1F66A 1N1JB 4E44A 1F66B 3VH6A 3MGQD 1M18D 3REHD 3AZKD 2Y2LA 1BFMA 5B32C 1P34A 1P34B 5CPJD 3X1SC 2F8ND 3AZLC 4J8XC 5G49A 3X1VD 4ZBJC 5AV5A 5G49B 5B33A 4LD9C 5AV5B 5B33B 2L5AA 3LZ0C 2PYOA 3UTAC 2PYOB 5B24A 4R8PA 4H9QA 5B24B 1BH9A 5B2IC 4R8PB 4H9QB 3W99C 1BH9B 4H9SC 3LJAD 2HUEC 3MNND 2ZY4A 1M19C 1P3KA 1P3KB 4DRAA 4J8UD 3AZLA 4YM6D 3W97D 4X23A 3AZLB 4X23B 4LD9A 5GT0D 4DRBA 1P3MC 4Z66C 5AV6A 4WV4B 4QLCC 2AROD 5DNNA 5B0ZD 4LD9B 5AV6B 3WKJD 5DNNB 3AZFC 4NE5A 4J8VD 2DF4C 5B31C 3AV1D 3AV2C 2ZY3A 2BYMA 5GXQC 1P3AC 1P3BA 3AYWC 4G92B 2BYMB 3AZGA 1P3BB 5B1LD 1KX3C 3O62A 3AZGB 3O62B 5FUGA 3X1TC 1HQ3D 1A7WA 2NZDD 5FUGB 1ZLAA 1KX4D 1TZYD 1P3MA 4Z66A 4CSRA 4QLCA 3AN2D 1ZLAB 1P3MB 4Z66B 4CSRB 4QLCB 3REJC 3AZFA 3WA9C 3AFAC 5AV8D 3AZFB 4WU9A 5JA4A 4JJND 4WU9B 1KX5C 5JA4B 3FDDA 2Y2PA 5B0YD 5DNMC 3AZHC 3AZIA 5E5AA 5B32G 1P3PD 3UT9A 3AZIB 5E5AB 2CWEA 5GXQA 3UT9B 1P3AA 1M1AC 5GXQB 1P3AB 4E45A 5CP6D 2NQBC 3EPHA 1EQZA 2G5HC 4KGCC 1P3IC 3X1TA 1EQZB 3W96A 1F1EA 3VH6T 3KUYC 3TU4C 3W96B 3C1CA 3X1UC 3C1CB 3WA9A 5B1MA 3W98A 3UTBC 2CV5C 5B1MB 5GSUC 3W98B 1P3OC 3LZ1A 1P3GA 1U35D 3KXBC 3LZ1B 3AZHA 1P3GB 4KUDC 3AZHB 3LELD 2IO5C 3B0CT 1M1AA 4WU8C 4Z5TD 1S32D 1M1AB 3VH5A 1ID3A 1F66C 5CPKA 1ID3B 4KGCA 4XZQA 3REIA 3AZMC 5CPKB 5F99D 3RELC 4XZQB 3MGSA 3REIB 3KUYA 3TU4A 3MGSB 3KUYB 3TU4B 3V9RA 5B31G 5CPID 4XUJA 1P3FD 3V9RB 3REKD 4XUJB 5JRGD 3UTBA 2CV5A 2BYKA 5GSUA 3A6NA 1AOID 4YS3D 2CV5B 4KHAA 5AVBA 2BYKB 5GSUB 3A6NB 3B6GD 4KHAB 5AVBB 5AVCC 3AZNC 2IO5B 3MVDA 3WAAD 1WWSA 2HIOD 4R8PC 3MVDB 3MGQC 3AZMA 4G91B 3KWQA 3WTPE 3RELA 3AZMB 3KWQB 3RELB 4J8WA 1P3KC 4J8WB 2FJ7A 2FJ7B 3WTPD 4WJ3C 3KSYA 3KFUG 5B40D 4X23C 5AV6C 5AVCA 5DNNC 5AVCB 4Z2MH 3AZNA 1P3LD 5B24D 3AZNB 1BH8A 1BH8B 3MGQA 3MGQB 1R4VA 4G92C 3AZKA 1P3BC 5B32D 3AZKB 3AZGC 3X1SD 3O62C 2J8PA 5BS7A 5CPJA 2F8NA 3AZLD 4J8XD 5CPJB 3W97C 2F8NB 2XD5A 3X1VA 4LD9D 1ZLAC 3X1VB 4H9RA 3LZ0D 1PZRA 4UPKA 4H9RB 3WKJC 3UTAD 4WU9C 5B2ID 3W99D 3AZIC 5E5AC 3LJAA 3MNNA 3UT9C 3LJAB 3MNNB 1M19D 4M6BA 2RIQA 1ULYA 3AZJC 3VH5T 1EQZC 3W97A 4YM6A 4J8UB 5BT1C 2Y2QA 4YM6B 3W97B 3W96C 5GT0A 1P3MD 4Z66D 4QLCD 5B0ZA 2AROA 5GT0B 3C1CC 5B0ZB 3WKJA 2AROB 3AZFD 5C3IC 3WKJB 5B1MC 4J8VA 3W98C 5AV9C 2XD1A 3MGPD 1HTAA 5B31D 4J8VB 3AZEC 3AV1A 3NQUA 3LZ1C 1P3GC 3AV2D 5B0YC 3NQUB 3AV1B 5GXQD 1P3AD 3AYWD 5CHLB 2ZY2A 5B1LA 1KX3D 5B1LB 4AWLB 3AZJA 1ID3C 2YFVA 5CPKC 3X1TD 1HQ3A 4XZQC 3AZJB 2YFVB 3REIC 2NZDA 4H9OA 1HQ3B 1KX4A 1TZYA 3MGSC 2NZDB 4H9OB 3AN2A 1KX4B 1TZYB 5B2JC 3AN2B 3REJD 3WA9D 3AFAD 2RVQC 4XUJC 4H9PA 5AV8A 5C3IB 5AV8B 5AV9A 4H9PB 3AZEA 3A6NC 4JJNA 5AV9B 1KX5D 3B6FC 3AZEB 5AVBC 4JJNB 5DNMD 5B0YA 3NQJA 1P3PA 5B0YB 3NQJB 1P3PB 3VH6W 1M1AD 5GT3C 4ZUXC 1T3UA 2NQBD 5CP6A 3MVDC 3MGRD 5CP6B 4KGCD 3C1BC 4G91C 1P3ID 3EG5B 5BO0A 3KWQC 3KUYD 5BO0B 3X1UD 5B2JA 4J8WC 5CPIC 4NE6A 4NE3A 5B2JB 3REKC 3UTBD 2FJ7C 3B0CW 1AOIC 1P3OD 3B6FA 3KXBD 4DQYB 1U35A 3B6FB 1U35B 5AY8C 4KUDD 3LELA 4CAYA 3LELB 4WU8D 4CAYB 5GT3A 4Z5TA 2F2AC 4ZUXA 1S32A 1W2EA 5GT3B 4Z5TB 4ZUXB 1S32B 1F66D 2ZY5A 3C1BA 3RELD 5F99A 3C1BB 4WZSB 5F99B 1M18C 3REHC 3AZKC 4EO5B 1P34D 5CPIA 1P3FA 3REKA 4HGAB 5CPIB 5BS7C 4H9NA 5JRGA 5CPJC 3REKB 1P3FB 1AOIA 5JRGB 4H9NB 1AOIB 5AV5D 3B0DC 5B33D 3X1VC 5AY8A 2W8SA 2F8NH 5AY8B 2PYOD 1P3LC 3WAAA 4R8PD 2HIOA 4WNNA 3WAAB 2HIOB 2BG1A 4WNNB 3LJAC 3MNNC 1M18A 3REHA 1M18B 5BNXA 3REHB 1P3KD 2YFWA 3F6TA 5BNXB 2YFWB 4J8UC 3WTPA 4YM6C 4X23D 5B40A 3WTPB 5B40B 5GT0C 3B0DB 5AV6D 5B0ZC 5DNND 2AROC 1B67A 1P3LA 4J8VC 1P3LB 2Y2GA 3AV1C 3A1KA 3P5JB 2Y2NA 1P3BD 5B32A 1KU5A 3AZGD 5B32B 5B1LC 1WWIA 3X1SA 3O62D 4AWLC 2LY8A 4UUZA 3X1SB 4J8XA 4J8UA 4UUZB 1HQ3C 4J8XB 2NZDC 1ZLAD 4ZBJB 1KX4C 3H0MC 1TZYC 3LZ0A 3AN2C 3LZ0B 3UTAA 5AV8C 3UTAB 1Z2CB 4WU9D 3MGPC 5B2IA 4JJNC 3AL0C 3W99A 4H9SA 5B2IB 2Y2OA 3AZID 5E5AD 3VH5W 3W99B 1P3PC 3UT9D 2HUEB 2F8NG 3H0LC 1M19A 2FFFB 1M19B 4Z2MG 5CP6C 3AZJD 1EQZD 2Y2JA 5BT1D 2JE5A 3W96D 2JCHA 3H0RC 3C1CD 5B1MD 3W98D 1JFIA 5AV9D 3AZED 3MGPA 5B31A 1JFIB 3LZ1D 3MGPB 5B31B 1P3GD 3AV2A 1U35C 3AZHD 3AV2B 1B6WA 3LELC 3AYWA 3AYWB 3A1IA 1KX3A 4Z5TC 1S32C 1ID3D 3MGRC 1KX3B 5CPKD 4XZQD 3REID 3X1TB 5F99C 3MGSD 3TU4D 4EO5C 3R45A 5B2JD 2Y2IA 3REJA 5BNVA 3R45B 3AFAA 2RVQD 4XUJD 2G5IC 4HGAC 2ZM5A 3REJB 5BNVB 1P3FC 3AFAB 2F8NK 3WA9B 2CV5D 5JRGC 5GSUD 3A6ND 1KX5A 3B6FD 4YS3C 3EPLA 5AVBD 3B6GC 1KX5B 5DNMA 3IP4C 5DNMB 1TAFA 2Y2MA 1TAFB 2DQNC 2JSSA 2Y2KA 4ZUXD 5GT3D 4NFTA 3MVDD 2NQBA 3WAAC 3EPKA 2HIOC 2UWXA 3MGRA 2NQBB 3C1BD 3B0BA 1P3IA 3MGRB 2Y2HA 4KGCB 3AZMD 3KWQD 1P3IB 5KDMA 3X1UA 1P34C 4J8WD 5KDMB 3X1UB 2FJ7D 1Q9CA
chains in the Genus database with same CATH topology
3UTBB 1P3OA 3WTPC 3KXBA 4YS3A 5AV5C 1P3OB 5B33C 5B40C 3B6GA 5AY8D 3KXBB 4YS3B 1H3OA 3B6GB 4KUDA 2VQRA 5AVCD 1H3OB 2PYOC 4KUDB 3AZND 4WU8A 3EPJA 5B24C 4WU8B 1N1JA 1F66A 1N1JB 4E44A 1F66B 3VH6A 3MGQD 1M18D 3REHD 3AZKD 2Y2LA 1BFMA 5B32C 1P34A 1P34B 5CPJD 3X1SC 2F8ND 3AZLC 4J8XC 5G49A 3X1VD 4ZBJC 5AV5A 5G49B 5B33A 4LD9C 5AV5B 5B33B 2L5AA 3LZ0C 2PYOA 3UTAC 2PYOB 5B24A 4R8PA 4H9QA 5B24B 1BH9A 5B2IC 4R8PB 4H9QB 3W99C 1BH9B 4H9SC 3LJAD 2HUEC 3MNND 2ZY4A 1M19C 1P3KA 1P3KB 4DRAA 4J8UD 3AZLA 4YM6D 3W97D 4X23A 3AZLB 4X23B 4LD9A 5GT0D 4DRBA 1P3MC 4Z66C 5AV6A 4WV4B 4QLCC 2AROD 5DNNA 5B0ZD 4LD9B 5AV6B 3WKJD 5DNNB 3AZFC 4NE5A 4J8VD 2DF4C 5B31C 3AV1D 3AV2C 2ZY3A 2BYMA 5GXQC 1P3AC 1P3BA 3AYWC 4G92B 2BYMB 3AZGA 1P3BB 5B1LD 1KX3C 3O62A 3AZGB 3O62B 5FUGA 3X1TC 1HQ3D 1A7WA 2NZDD 5FUGB 1ZLAA 1KX4D 1TZYD 1P3MA 4Z66A 4CSRA 4QLCA 3AN2D 1ZLAB 1P3MB 4Z66B 4CSRB 4QLCB 3REJC 3AZFA 3WA9C 3AFAC 5AV8D 3AZFB 4WU9A 5JA4A 4JJND 4WU9B 1KX5C 5JA4B 3FDDA 2Y2PA 5B0YD 5DNMC 3AZHC 3AZIA 5E5AA 5B32G 1P3PD 3UT9A 3AZIB 5E5AB 2CWEA 5GXQA 3UT9B 1P3AA 1M1AC 5GXQB 1P3AB 4E45A 5CP6D 2NQBC 3EPHA 1EQZA 2G5HC 4KGCC 1P3IC 3X1TA 1EQZB 3W96A 1F1EA 3VH6T 3KUYC 3TU4C 3W96B 3C1CA 3X1UC 3C1CB 3WA9A 5B1MA 3W98A 3UTBC 2CV5C 5B1MB 5GSUC 3W98B 1P3OC 3LZ1A 1P3GA 1U35D 3KXBC 3LZ1B 3AZHA 1P3GB 4KUDC 3AZHB 3LELD 2IO5C 3B0CT 1M1AA 4WU8C 4Z5TD 1S32D 1M1AB 3VH5A 1ID3A 1F66C 5CPKA 1ID3B 4KGCA 4XZQA 3REIA 3AZMC 5CPKB 5F99D 3RELC 4XZQB 3MGSA 3REIB 3KUYA 3TU4A 3MGSB 3KUYB 3TU4B 3V9RA 5B31G 5CPID 4XUJA 1P3FD 3V9RB 3REKD 4XUJB 5JRGD 3UTBA 2CV5A 2BYKA 5GSUA 3A6NA 1AOID 4YS3D 2CV5B 4KHAA 5AVBA 2BYKB 5GSUB 3A6NB 3B6GD 4KHAB 5AVBB 5AVCC 3AZNC 2IO5B 3MVDA 3WAAD 1WWSA 2HIOD 4R8PC 3MVDB 3MGQC 3AZMA 4G91B 3KWQA 3WTPE 3RELA 3AZMB 3KWQB 3RELB 4J8WA 1P3KC 4J8WB 2FJ7A 2FJ7B 3WTPD 4WJ3C 3KSYA 3KFUG 5B40D 4X23C 5AV6C 5AVCA 5DNNC 5AVCB 4Z2MH 3AZNA 1P3LD 5B24D 3AZNB 1BH8A 1BH8B 3MGQA 3MGQB 1R4VA 4G92C 3AZKA 1P3BC 5B32D 3AZKB 3AZGC 3X1SD 3O62C 2J8PA 5BS7A 5CPJA 2F8NA 3AZLD 4J8XD 5CPJB 3W97C 2F8NB 2XD5A 3X1VA 4LD9D 1ZLAC 3X1VB 4H9RA 3LZ0D 1PZRA 4UPKA 4H9RB 3WKJC 3UTAD 4WU9C 5B2ID 3W99D 3AZIC 5E5AC 3LJAA 3MNNA 3UT9C 3LJAB 3MNNB 1M19D 4M6BA 2RIQA 1ULYA 3AZJC 3VH5T 1EQZC 3W97A 4YM6A 4J8UB 5BT1C 2Y2QA 4YM6B 3W97B 3W96C 5GT0A 1P3MD 4Z66D 4QLCD 5B0ZA 2AROA 5GT0B 3C1CC 5B0ZB 3WKJA 2AROB 3AZFD 5C3IC 3WKJB 5B1MC 4J8VA 3W98C 5AV9C 2XD1A 3MGPD 1HTAA 5B31D 4J8VB 3AZEC 3AV1A 3NQUA 3LZ1C 1P3GC 3AV2D 5B0YC 3NQUB 3AV1B 5GXQD 1P3AD 3AYWD 5CHLB 2ZY2A 5B1LA 1KX3D 5B1LB 4AWLB 3AZJA 1ID3C 2YFVA 5CPKC 3X1TD 1HQ3A 4XZQC 3AZJB 2YFVB 3REIC 2NZDA 4H9OA 1HQ3B 1KX4A 1TZYA 3MGSC 2NZDB 4H9OB 3AN2A 1KX4B 1TZYB 5B2JC 3AN2B 3REJD 3WA9D 3AFAD 2RVQC 4XUJC 4H9PA 5AV8A 5C3IB 5AV8B 5AV9A 4H9PB 3AZEA 3A6NC 4JJNA 5AV9B 1KX5D 3B6FC 3AZEB 5AVBC 4JJNB 5DNMD 5B0YA 3NQJA 1P3PA 5B0YB 3NQJB 1P3PB 3VH6W 1M1AD 5GT3C 4ZUXC 1T3UA 2NQBD 5CP6A 3MVDC 3MGRD 5CP6B 4KGCD 3C1BC 4G91C 1P3ID 3EG5B 5BO0A 3KWQC 3KUYD 5BO0B 3X1UD 5B2JA 4J8WC 5CPIC 4NE6A 4NE3A 5B2JB 3REKC 3UTBD 2FJ7C 3B0CW 1AOIC 1P3OD 3B6FA 3KXBD 4DQYB 1U35A 3B6FB 1U35B 5AY8C 4KUDD 3LELA 4CAYA 3LELB 4WU8D 4CAYB 5GT3A 4Z5TA 2F2AC 4ZUXA 1S32A 1W2EA 5GT3B 4Z5TB 4ZUXB 1S32B 1F66D 2ZY5A 3C1BA 3RELD 5F99A 3C1BB 4WZSB 5F99B 1M18C 3REHC 3AZKC 4EO5B 1P34D 5CPIA 1P3FA 3REKA 4HGAB 5CPIB 5BS7C 4H9NA 5JRGA 5CPJC 3REKB 1P3FB 1AOIA 5JRGB 4H9NB 1AOIB 5AV5D 3B0DC 5B33D 3X1VC 5AY8A 2W8SA 2F8NH 5AY8B 2PYOD 1P3LC 3WAAA 4R8PD 2HIOA 4WNNA 3WAAB 2HIOB 2BG1A 4WNNB 3LJAC 3MNNC 1M18A 3REHA 1M18B 5BNXA 3REHB 1P3KD 2YFWA 3F6TA 5BNXB 2YFWB 4J8UC 3WTPA 4YM6C 4X23D 5B40A 3WTPB 5B40B 5GT0C 3B0DB 5AV6D 5B0ZC 5DNND 2AROC 1B67A 1P3LA 4J8VC 1P3LB 2Y2GA 3AV1C 3A1KA 3P5JB 2Y2NA 1P3BD 5B32A 1KU5A 3AZGD 5B32B 5B1LC 1WWIA 3X1SA 3O62D 4AWLC 2LY8A 4UUZA 3X1SB 4J8XA 4J8UA 4UUZB 1HQ3C 4J8XB 2NZDC 1ZLAD 4ZBJB 1KX4C 3H0MC 1TZYC 3LZ0A 3AN2C 3LZ0B 3UTAA 5AV8C 3UTAB 1Z2CB 4WU9D 3MGPC 5B2IA 4JJNC 3AL0C 3W99A 4H9SA 5B2IB 2Y2OA 3AZID 5E5AD 3VH5W 3W99B 1P3PC 3UT9D 2HUEB 2F8NG 3H0LC 1M19A 2FFFB 1M19B 4Z2MG 5CP6C 3AZJD 1EQZD 2Y2JA 5BT1D 2JE5A 3W96D 2JCHA 3H0RC 3C1CD 5B1MD 3W98D 1JFIA 5AV9D 3AZED 3MGPA 5B31A 1JFIB 3LZ1D 3MGPB 5B31B 1P3GD 3AV2A 1U35C 3AZHD 3AV2B 1B6WA 3LELC 3AYWA 3AYWB 3A1IA 1KX3A 4Z5TC 1S32C 1ID3D 3MGRC 1KX3B 5CPKD 4XZQD 3REID 3X1TB 5F99C 3MGSD 3TU4D 4EO5C 3R45A 5B2JD 2Y2IA 3REJA 5BNVA 3R45B 3AFAA 2RVQD 4XUJD 2G5IC 4HGAC 2ZM5A 3REJB 5BNVB 1P3FC 3AFAB 2F8NK 3WA9B 2CV5D 5JRGC 5GSUD 3A6ND 1KX5A 3B6FD 4YS3C 3EPLA 5AVBD 3B6GC 1KX5B 5DNMA 3IP4C 5DNMB 1TAFA 2Y2MA 1TAFB 2DQNC 2JSSA 2Y2KA 4ZUXD 5GT3D 4NFTA 3MVDD 2NQBA 3WAAC 3EPKA 2HIOC 2UWXA 3MGRA 2NQBB 3C1BD 3B0BA 1P3IA 3MGRB 2Y2HA 4KGCB 3AZMD 3KWQD 1P3IB 5KDMA 3X1UA 1P34C 4J8WD 5KDMB 3X1UB 2FJ7D 1Q9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB B;  1P3O A;  3WTP C;  3KXB A;  4YS3 A;  5AV5 C;  1P3O B;  5B33 C;  5B40 C;  3B6G A;  5AY8 D;  3KXB B;  4YS3 B;  1H3O A;  3B6G B;  4KUD A;  5AVC D;  1H3O B;  2PYO C;  4KUD B;  3AZN D;  4WU8 A;  5B24 C;  4WU8 B;  1N1J A;  1F66 A;  1N1J B;  4E44 A;  1F66 B;  3VH6 A;  3MGQ D;  1M18 D;  3REH D;  3AZK D;  1BFM A;  5B32 C;  1P34 A;  1P34 B;  5CPJ D;  3X1S C;  2F8N D;  3AZL C;  4J8X C;  5G49 A;  3X1V D;  4ZBJ C;  5AV5 A;  5G49 B;  5B33 A;  4LD9 C;  5AV5 B;  5B33 B;  2L5A A;  3LZ0 C;  2PYO A;  3UTA C;  2PYO B;  5B24 A;  4R8P A;  4H9Q A;  5B24 B;  1BH9 A;  5B2I C;  4R8P B;  4H9Q B;  3W99 C;  1BH9 B;  4H9S C;  3LJA D;  2HUE C;  3MNN D;  1M19 C;  1P3K A;  1P3K B;  4DRA A;  4J8U D;  3AZL A;  4YM6 D;  3W97 D;  4X23 A;  3AZL B;  4X23 B;  4LD9 A;  5GT0 D;  4DRB A;  1P3M C;  4Z66 C;  5AV6 A;  4WV4 B;  4QLC C;  2ARO D;  5DNN A;  5B0Z D;  4LD9 B;  5AV6 B;  3WKJ D;  5DNN B;  3AZF C;  4NE5 A;  4J8V D;  5B31 C;  3AV1 D;  3AV2 C;  2BYM A;  5GXQ C;  1P3A C;  1P3B A;  3AYW C;  4G92 B;  2BYM B;  3AZG A;  1P3B B;  5B1L D;  1KX3 C;  3O62 A;  3AZG B;  3O62 B;  5FUG A;  3X1T C;  1HQ3 D;  1A7W A;  2NZD D;  5FUG B;  1ZLA A;  1KX4 D;  1TZY D;  1P3M A;  4Z66 A;  4CSR A;  4QLC A;  3AN2 D;  1ZLA B;  1P3M B;  4Z66 B;  4CSR B;  4QLC B;  3REJ C;  3AZF A;  3WA9 C;  3AFA C;  5AV8 D;  3AZF B;  4WU9 A;  5JA4 A;  4JJN D;  4WU9 B;  1KX5 C;  5JA4 B;  5B0Y D;  5DNM C;  3AZH C;  3AZI A;  5E5A A;  5B32 G;  1P3P D;  3UT9 A;  3AZI B;  5E5A B;  2CWE A;  5GXQ A;  3UT9 B;  1P3A A;  1M1A C;  5GXQ B;  1P3A B;  4E45 A;  5CP6 D;  2NQB C;  1EQZ A;  4KGC C;  1P3I C;  3X1T A;  1EQZ B;  3W96 A;  1F1E A;  3VH6 T;  3KUY C;  3TU4 C;  3W96 B;  3C1C A;  3X1U C;  3C1C B;  3WA9 A;  5B1M A;  3W98 A;  3UTB C;  2CV5 C;  5B1M B;  5GSU C;  3W98 B;  1P3O C;  3LZ1 A;  1P3G A;  1U35 D;  3KXB C;  3LZ1 B;  3AZH A;  1P3G B;  4KUD C;  3AZH B;  3LEL D;  2IO5 C;  3B0C T;  1M1A A;  4WU8 C;  4Z5T D;  1S32 D;  1M1A B;  3VH5 A;  1ID3 A;  1F66 C;  5CPK A;  1ID3 B;  4KGC A;  4XZQ A;  3REI A;  3AZM C;  5CPK B;  5F99 D;  3REL C;  4XZQ B;  3MGS A;  3REI B;  3KUY A;  3TU4 A;  3MGS B;  3KUY B;  3TU4 B;  3V9R A;  5B31 G;  5CPI D;  4XUJ A;  1P3F D;  3V9R B;  3REK D;  4XUJ B;  5JRG D;  3UTB A;  2CV5 A;  2BYK A;  5GSU A;  3A6N A;  1AOI D;  4YS3 D;  2CV5 B;  4KHA A;  2BYK B;  5GSU B;  5AVB A;  3A6N B;  3B6G D;  4KHA B;  5AVB B;  5AVC C;  3AZN C;  2IO5 B;  3MVD A;  3WAA D;  1WWS A;  2HIO D;  4R8P C;  3MVD B;  3MGQ C;  3AZM A;  4G91 B;  3KWQ A;  3WTP E;  3REL A;  3AZM B;  3KWQ B;  3REL B;  4J8W A;  1P3K C;  4J8W B;  2FJ7 A;  2FJ7 B;  3WTP D;  3KSY A;  5B40 D;  4X23 C;  5AV6 C;  5AVC A;  5DNN C;  5AVC B;  4Z2M H;  3AZN A;  1P3L D;  5B24 D;  3AZN B;  1BH8 A;  1BH8 B;  3MGQ A;  3MGQ B;  1R4V A;  4G92 C;  3AZK A;  1P3B C;  5B32 D;  3AZK B;  3AZG C;  3X1S D;  3O62 C;  5CPJ A;  5BS7 A;  2F8N A;  3AZL D;  4J8X D;  5CPJ B;  3W97 C;  2F8N B;  3X1V A;  4LD9 D;  1ZLA C;  3X1V B;  4H9R A;  3LZ0 D;  4H9R B;  3WKJ C;  3UTA D;  4WU9 C;  5B2I D;  3W99 D;  3AZI C;  5E5A C;  3LJA A;  3MNN A;  3UT9 C;  3LJA B;  3MNN B;  1M19 D;  4M6B A;  1ULY A;  3AZJ C;  3VH5 T;  1EQZ C;  3W97 A;  4YM6 A;  4J8U B;  5BT1 C;  4YM6 B;  3W97 B;  3W96 C;  5GT0 A;  1P3M D;  4Z66 D;  4QLC D;  5B0Z A;  2ARO A;  5GT0 B;  3C1C C;  5B0Z B;  3WKJ A;  2ARO B;  3AZF D;  5C3I C;  3WKJ B;  5B1M C;  4J8V A;  3W98 C;  5AV9 C;  3MGP D;  1HTA A;  5B31 D;  4J8V B;  3AZE C;  3AV1 A;  3NQU A;  3LZ1 C;  1P3G C;  3AV2 D;  5B0Y C;  3NQU B;  3AV1 B;  5GXQ D;  1P3A D;  3AYW D;  5CHL B;  1KX3 D;  5B1L A;  5B1L B;  4AWL B;  3AZJ A;  1ID3 C;  2YFV A;  5CPK C;  3X1T D;  1HQ3 A;  4XZQ C;  3AZJ B;  2YFV B;  3REI C;  2NZD A;  4H9O A;  1HQ3 B;  1KX4 A;  1TZY A;  3MGS C;  2NZD B;  4H9O B;  3AN2 A;  1KX4 B;  1TZY B;  5B2J C;  3AN2 B;  3REJ D;  3WA9 D;  3AFA D;  2RVQ C;  4XUJ C;  4H9P A;  5AV8 A;  5C3I B;  5AV9 A;  5AV8 B;  4H9P B;  3AZE A;  3A6N C;  4JJN A;  5AV9 B;  1KX5 D;  3B6F C;  3AZE B;  5AVB C;  4JJN B;  5DNM D;  5B0Y A;  3NQJ A;  1P3P A;  5B0Y B;  3NQJ B;  1P3P B;  3VH6 W;  1M1A D;  5GT3 C;  4ZUX C;  2NQB D;  5CP6 A;  3MVD C;  3MGR D;  5CP6 B;  4KGC D;  3C1B C;  4G91 C;  1P3I D;  5BO0 A;  3KWQ C;  3KUY D;  5BO0 B;  3X1U D;  5B2J A;  4J8W C;  5CPI C;  4NE6 A;  4NE3 A;  5B2J B;  3REK C;  3UTB D;  2FJ7 C;  3B0C W;  1AOI C;  1P3O D;  3B6F A;  3KXB D;  1U35 A;  3B6F B;  1U35 B;  5AY8 C;  4KUD D;  3LEL A;  4CAY A;  3LEL B;  4WU8 D;  4CAY B;  5GT3 A;  4Z5T A;  4ZUX A;  1S32 A;  5GT3 B;  4Z5T B;  4ZUX B;  1S32 B;  1F66 D;  3C1B A;  3REL D;  5F99 A;  3C1B B;  4WZS B;  5F99 B;  1M18 C;  3REH C;  3AZK C;  4EO5 B;  1P34 D;  5CPI A;  1P3F A;  3REK A;  4HGA B;  5CPI B;  5BS7 C;  4H9N A;  5JRG A;  5CPJ C;  3REK B;  1P3F B;  1AOI A;  5JRG B;  4H9N B;  1AOI B;  5AV5 D;  3B0D C;  5B33 D;  3X1V C;  5AY8 A;  2F8N H;  5AY8 B;  2PYO D;  1P3L C;  3WAA A;  4R8P D;  2HIO A;  4WNN A;  3WAA B;  2HIO B;  4WNN B;  3LJA C;  3MNN C;  1M18 A;  3REH A;  1M18 B;  5BNX A;  3REH B;  1P3K D;  2YFW A;  5BNX B;  2YFW B;  4J8U C;  3WTP A;  4YM6 C;  4X23 D;  5B40 A;  3WTP B;  5B40 B;  5GT0 C;  3B0D B;  5AV6 D;  5B0Z C;  5DNN D;  2ARO C;  1B67 A;  1P3L A;  4J8V C;  1P3L B;  3AV1 C;  1P3B D;  5B32 A;  1KU5 A;  3AZG D;  5B32 B;  5B1L C;  1WWI A;  3X1S A;  3O62 D;  4AWL C;  2LY8 A;  4UUZ A;  3X1S B;  4J8X A;  4J8U A;  4UUZ B;  1HQ3 C;  4J8X B;  2NZD C;  1ZLA D;  4ZBJ B;  1KX4 C;  1TZY C;  3LZ0 A;  3AN2 C;  3LZ0 B;  3UTA A;  5AV8 C;  3UTA B;  4WU9 D;  3MGP C;  5B2I A;  4JJN C;  3W99 A;  4H9S A;  5B2I B;  3AZI D;  5E5A D;  3VH5 W;  3W99 B;  1P3P C;  3UT9 D;  2HUE B;  2F8N G;  1M19 A;  1M19 B;  4Z2M G;  5CP6 C;  3AZJ D;  1EQZ D;  5BT1 D;  3W96 D;  3C1C D;  5B1M D;  3W98 D;  1JFI A;  5AV9 D;  3AZE D;  3MGP A;  5B31 A;  1JFI B;  3LZ1 D;  3MGP B;  5B31 B;  1P3G D;  3AV2 A;  1U35 C;  3AZH D;  3AV2 B;  1B6W A;  3LEL C;  3AYW A;  3AYW B;  1KX3 A;  4Z5T C;  1S32 C;  1ID3 D;  3MGR C;  1KX3 B;  5CPK D;  4XZQ D;  3REI D;  3X1T B;  5F99 C;  3MGS D;  3TU4 D;  4EO5 C;  3R45 A;  5B2J D;  3REJ A;  5BNV A;  3R45 B;  3AFA A;  2RVQ D;  4XUJ D;  4HGA C;  1P3F C;  2F8N K;  3REJ B;  5BNV B;  3WA9 B;  3AFA B;  2CV5 D;  5JRG C;  5GSU D;  3A6N D;  1KX5 A;  3B6F D;  4YS3 C;  5AVB D;  3B6G C;  1KX5 B;  5DNM A;  5DNM B;  1TAF A;  1TAF B;  2JSS A;  5GT3 D;  4ZUX D;  4NFT A;  3MVD D;  2NQB A;  3WAA C;  2HIO C;  3MGR A;  2NQB B;  3C1B D;  3B0B A;  1P3I A;  3MGR B;  4KGC B;  3AZM D;  3KWQ D;  1P3I B;  5KDM A;  3X1U A;  1P34 C;  4J8W D;  5KDM B;  3X1U B;  2FJ7 D;  1Q9C A; 
#chains in the Genus database with same CATH topology
 3UTB B;  1P3O A;  3WTP C;  3KXB A;  4YS3 A;  5AV5 C;  1P3O B;  5B33 C;  5B40 C;  3B6G A;  5AY8 D;  3KXB B;  4YS3 B;  1H3O A;  3B6G B;  4KUD A;  2VQR A;  5AVC D;  1H3O B;  2PYO C;  4KUD B;  3AZN D;  4WU8 A;  3EPJ A;  5B24 C;  4WU8 B;  1N1J A;  1F66 A;  1N1J B;  4E44 A;  1F66 B;  3VH6 A;  3MGQ D;  1M18 D;  3REH D;  3AZK D;  2Y2L A;  1BFM A;  5B32 C;  1P34 A;  1P34 B;  5CPJ D;  3X1S C;  2F8N D;  3AZL C;  4J8X C;  5G49 A;  3X1V D;  4ZBJ C;  5AV5 A;  5G49 B;  5B33 A;  4LD9 C;  5AV5 B;  5B33 B;  2L5A A;  3LZ0 C;  2PYO A;  3UTA C;  2PYO B;  5B24 A;  4R8P A;  4H9Q A;  5B24 B;  1BH9 A;  5B2I C;  4R8P B;  4H9Q B;  3W99 C;  1BH9 B;  4H9S C;  3LJA D;  2HUE C;  3MNN D;  2ZY4 A;  1M19 C;  1P3K A;  1P3K B;  4DRA A;  4J8U D;  3AZL A;  4YM6 D;  3W97 D;  4X23 A;  3AZL B;  4X23 B;  4LD9 A;  5GT0 D;  4DRB A;  1P3M C;  4Z66 C;  5AV6 A;  4WV4 B;  4QLC C;  2ARO D;  5DNN A;  5B0Z D;  4LD9 B;  5AV6 B;  3WKJ D;  5DNN B;  3AZF C;  4NE5 A;  4J8V D;  2DF4 C;  5B31 C;  3AV1 D;  3AV2 C;  2ZY3 A;  2BYM A;  5GXQ C;  1P3A C;  1P3B A;  3AYW C;  4G92 B;  2BYM B;  3AZG A;  1P3B B;  5B1L D;  1KX3 C;  3O62 A;  3AZG B;  3O62 B;  5FUG A;  3X1T C;  1HQ3 D;  1A7W A;  2NZD D;  5FUG B;  1ZLA A;  1KX4 D;  1TZY D;  1P3M A;  4Z66 A;  4CSR A;  4QLC A;  3AN2 D;  1ZLA B;  1P3M B;  4Z66 B;  4CSR B;  4QLC B;  3REJ C;  3AZF A;  3WA9 C;  3AFA C;  5AV8 D;  3AZF B;  4WU9 A;  5JA4 A;  4JJN D;  4WU9 B;  1KX5 C;  5JA4 B;  3FDD A;  2Y2P A;  5B0Y D;  5DNM C;  3AZH C;  3AZI A;  5E5A A;  5B32 G;  1P3P D;  3UT9 A;  3AZI B;  5E5A B;  2CWE A;  5GXQ A;  3UT9 B;  1P3A A;  1M1A C;  5GXQ B;  1P3A B;  4E45 A;  5CP6 D;  2NQB C;  3EPH A;  1EQZ A;  2G5H C;  4KGC C;  1P3I C;  3X1T A;  1EQZ B;  3W96 A;  1F1E A;  3VH6 T;  3KUY C;  3TU4 C;  3W96 B;  3C1C A;  3X1U C;  3C1C B;  3WA9 A;  5B1M A;  3W98 A;  3UTB C;  2CV5 C;  5B1M B;  5GSU C;  3W98 B;  1P3O C;  3LZ1 A;  1P3G A;  1U35 D;  3KXB C;  3LZ1 B;  3AZH A;  1P3G B;  4KUD C;  3AZH B;  3LEL D;  2IO5 C;  3B0C T;  1M1A A;  4WU8 C;  4Z5T D;  1S32 D;  1M1A B;  3VH5 A;  1ID3 A;  1F66 C;  5CPK A;  1ID3 B;  4KGC A;  4XZQ A;  3REI A;  3AZM C;  5CPK B;  5F99 D;  3REL C;  4XZQ B;  3MGS A;  3REI B;  3KUY A;  3TU4 A;  3MGS B;  3KUY B;  3TU4 B;  3V9R A;  5B31 G;  5CPI D;  4XUJ A;  1P3F D;  3V9R B;  3REK D;  4XUJ B;  5JRG D;  3UTB A;  2CV5 A;  2BYK A;  5GSU A;  3A6N A;  1AOI D;  4YS3 D;  2CV5 B;  4KHA A;  5AVB A;  2BYK B;  5GSU B;  3A6N B;  3B6G D;  4KHA B;  5AVB B;  5AVC C;  3AZN C;  2IO5 B;  3MVD A;  3WAA D;  1WWS A;  2HIO D;  4R8P C;  3MVD B;  3MGQ C;  3AZM A;  4G91 B;  3KWQ A;  3WTP E;  3REL A;  3AZM B;  3KWQ B;  3REL B;  4J8W A;  1P3K C;  4J8W B;  2FJ7 A;  2FJ7 B;  3WTP D;  4WJ3 C;  3KSY A;  3KFU G;  5B40 D;  4X23 C;  5AV6 C;  5AVC A;  5DNN C;  5AVC B;  4Z2M H;  3AZN A;  1P3L D;  5B24 D;  3AZN B;  1BH8 A;  1BH8 B;  3MGQ A;  3MGQ B;  1R4V A;  4G92 C;  3AZK A;  1P3B C;  5B32 D;  3AZK B;  3AZG C;  3X1S D;  3O62 C;  2J8P A;  5BS7 A;  5CPJ A;  2F8N A;  3AZL D;  4J8X D;  5CPJ B;  3W97 C;  2F8N B;  2XD5 A;  3X1V A;  4LD9 D;  1ZLA C;  3X1V B;  4H9R A;  3LZ0 D;  1PZR A;  4UPK A;  4H9R B;  3WKJ C;  3UTA D;  4WU9 C;  5B2I D;  3W99 D;  3AZI C;  5E5A C;  3LJA A;  3MNN A;  3UT9 C;  3LJA B;  3MNN B;  1M19 D;  4M6B A;  2RIQ A;  1ULY A;  3AZJ C;  3VH5 T;  1EQZ C;  3W97 A;  4YM6 A;  4J8U B;  5BT1 C;  2Y2Q A;  4YM6 B;  3W97 B;  3W96 C;  5GT0 A;  1P3M D;  4Z66 D;  4QLC D;  5B0Z A;  2ARO A;  5GT0 B;  3C1C C;  5B0Z B;  3WKJ A;  2ARO B;  3AZF D;  5C3I C;  3WKJ B;  5B1M C;  4J8V A;  3W98 C;  5AV9 C;  2XD1 A;  3MGP D;  1HTA A;  5B31 D;  4J8V B;  3AZE C;  3AV1 A;  3NQU A;  3LZ1 C;  1P3G C;  3AV2 D;  5B0Y C;  3NQU B;  3AV1 B;  5GXQ D;  1P3A D;  3AYW D;  5CHL B;  2ZY2 A;  5B1L A;  1KX3 D;  5B1L B;  4AWL B;  3AZJ A;  1ID3 C;  2YFV A;  5CPK C;  3X1T D;  1HQ3 A;  4XZQ C;  3AZJ B;  2YFV B;  3REI C;  2NZD A;  4H9O A;  1HQ3 B;  1KX4 A;  1TZY A;  3MGS C;  2NZD B;  4H9O B;  3AN2 A;  1KX4 B;  1TZY B;  5B2J C;  3AN2 B;  3REJ D;  3WA9 D;  3AFA D;  2RVQ C;  4XUJ C;  4H9P A;  5AV8 A;  5C3I B;  5AV8 B;  5AV9 A;  4H9P B;  3AZE A;  3A6N C;  4JJN A;  5AV9 B;  1KX5 D;  3B6F C;  3AZE B;  5AVB C;  4JJN B;  5DNM D;  5B0Y A;  3NQJ A;  1P3P A;  5B0Y B;  3NQJ B;  1P3P B;  3VH6 W;  1M1A D;  5GT3 C;  4ZUX C;  1T3U A;  2NQB D;  5CP6 A;  3MVD C;  3MGR D;  5CP6 B;  4KGC D;  3C1B C;  4G91 C;  1P3I D;  3EG5 B;  5BO0 A;  3KWQ C;  3KUY D;  5BO0 B;  3X1U D;  5B2J A;  4J8W C;  5CPI C;  4NE6 A;  4NE3 A;  5B2J B;  3REK C;  3UTB D;  2FJ7 C;  3B0C W;  1AOI C;  1P3O D;  3B6F A;  3KXB D;  4DQY B;  1U35 A;  3B6F B;  1U35 B;  5AY8 C;  4KUD D;  3LEL A;  4CAY A;  3LEL B;  4WU8 D;  4CAY B;  5GT3 A;  4Z5T A;  2F2A C;  4ZUX A;  1S32 A;  1W2E A;  5GT3 B;  4Z5T B;  4ZUX B;  1S32 B;  1F66 D;  2ZY5 A;  3C1B A;  3REL D;  5F99 A;  3C1B B;  4WZS B;  5F99 B;  1M18 C;  3REH C;  3AZK C;  4EO5 B;  1P34 D;  5CPI A;  1P3F A;  3REK A;  4HGA B;  5CPI B;  5BS7 C;  4H9N A;  5JRG A;  5CPJ C;  3REK B;  1P3F B;  1AOI A;  5JRG B;  4H9N B;  1AOI B;  5AV5 D;  3B0D C;  5B33 D;  3X1V C;  5AY8 A;  2W8S A;  2F8N H;  5AY8 B;  2PYO D;  1P3L C;  3WAA A;  4R8P D;  2HIO A;  4WNN A;  3WAA B;  2HIO B;  2BG1 A;  4WNN B;  3LJA C;  3MNN C;  1M18 A;  3REH A;  1M18 B;  5BNX A;  3REH B;  1P3K D;  2YFW A;  3F6T A;  5BNX B;  2YFW B;  4J8U C;  3WTP A;  4YM6 C;  4X23 D;  5B40 A;  3WTP B;  5B40 B;  5GT0 C;  3B0D B;  5AV6 D;  5B0Z C;  5DNN D;  2ARO C;  1B67 A;  1P3L A;  4J8V C;  1P3L B;  2Y2G A;  3AV1 C;  3A1K A;  3P5J B;  2Y2N A;  1P3B D;  5B32 A;  1KU5 A;  3AZG D;  5B32 B;  5B1L C;  1WWI A;  3X1S A;  3O62 D;  4AWL C;  2LY8 A;  4UUZ A;  3X1S B;  4J8X A;  4J8U A;  4UUZ B;  1HQ3 C;  4J8X B;  2NZD C;  1ZLA D;  4ZBJ B;  1KX4 C;  3H0M C;  1TZY C;  3LZ0 A;  3AN2 C;  3LZ0 B;  3UTA A;  5AV8 C;  3UTA B;  1Z2C B;  4WU9 D;  3MGP C;  5B2I A;  4JJN C;  3AL0 C;  3W99 A;  4H9S A;  5B2I B;  2Y2O A;  3AZI D;  5E5A D;  3VH5 W;  3W99 B;  1P3P C;  3UT9 D;  2HUE B;  2F8N G;  3H0L C;  1M19 A;  2FFF B;  1M19 B;  4Z2M G;  5CP6 C;  3AZJ D;  1EQZ D;  2Y2J A;  5BT1 D;  2JE5 A;  3W96 D;  2JCH A;  3H0R C;  3C1C D;  5B1M D;  3W98 D;  1JFI A;  5AV9 D;  3AZE D;  3MGP A;  5B31 A;  1JFI B;  3LZ1 D;  3MGP B;  5B31 B;  1P3G D;  3AV2 A;  1U35 C;  3AZH D;  3AV2 B;  1B6W A;  3LEL C;  3AYW A;  3AYW B;  3A1I A;  1KX3 A;  4Z5T C;  1S32 C;  1ID3 D;  3MGR C;  1KX3 B;  5CPK D;  4XZQ D;  3REI D;  3X1T B;  5F99 C;  3MGS D;  3TU4 D;  4EO5 C;  3R45 A;  5B2J D;  2Y2I A;  3REJ A;  5BNV A;  3R45 B;  3AFA A;  2RVQ D;  4XUJ D;  2G5I C;  4HGA C;  2ZM5 A;  3REJ B;  5BNV B;  1P3F C;  3AFA B;  2F8N K;  3WA9 B;  2CV5 D;  5JRG C;  5GSU D;  3A6N D;  1KX5 A;  3B6F D;  4YS3 C;  3EPL A;  5AVB D;  3B6G C;  1KX5 B;  5DNM A;  3IP4 C;  5DNM B;  1TAF A;  2Y2M A;  1TAF B;  2DQN C;  2JSS A;  2Y2K A;  4ZUX D;  5GT3 D;  4NFT A;  3MVD D;  2NQB A;  3WAA C;  3EPK A;  2HIO C;  2UWX A;  3MGR A;  2NQB B;  3C1B D;  3B0B A;  1P3I A;  3MGR B;  2Y2H A;  4KGC B;  3AZM D;  3KWQ D;  1P3I B;  5KDM A;  3X1U A;  1P34 C;  4J8W D;  5KDM B;  3X1U B;  2FJ7 D;  1Q9C A; 
#chains in the Genus database with same CATH homology
 3UTB B;  1P3O A;  3WTP C;  3KXB A;  4YS3 A;  5AV5 C;  1P3O B;  5B33 C;  5B40 C;  3B6G A;  5AY8 D;  3KXB B;  4YS3 B;  1H3O A;  3B6G B;  4KUD A;  2VQR A;  5AVC D;  1H3O B;  2PYO C;  4KUD B;  3AZN D;  4WU8 A;  3EPJ A;  5B24 C;  4WU8 B;  1N1J A;  1F66 A;  1N1J B;  4E44 A;  1F66 B;  3VH6 A;  3MGQ D;  1M18 D;  3REH D;  3AZK D;  2Y2L A;  1BFM A;  5B32 C;  1P34 A;  1P34 B;  5CPJ D;  3X1S C;  2F8N D;  3AZL C;  4J8X C;  5G49 A;  3X1V D;  4ZBJ C;  5AV5 A;  5G49 B;  5B33 A;  4LD9 C;  5AV5 B;  5B33 B;  2L5A A;  3LZ0 C;  2PYO A;  3UTA C;  2PYO B;  5B24 A;  4R8P A;  4H9Q A;  5B24 B;  1BH9 A;  5B2I C;  4R8P B;  4H9Q B;  3W99 C;  1BH9 B;  4H9S C;  3LJA D;  2HUE C;  3MNN D;  2ZY4 A;  1M19 C;  1P3K A;  1P3K B;  4DRA A;  4J8U D;  3AZL A;  4YM6 D;  3W97 D;  4X23 A;  3AZL B;  4X23 B;  4LD9 A;  5GT0 D;  4DRB A;  1P3M C;  4Z66 C;  5AV6 A;  4WV4 B;  4QLC C;  2ARO D;  5DNN A;  5B0Z D;  4LD9 B;  5AV6 B;  3WKJ D;  5DNN B;  3AZF C;  4NE5 A;  4J8V D;  2DF4 C;  5B31 C;  3AV1 D;  3AV2 C;  2ZY3 A;  2BYM A;  5GXQ C;  1P3A C;  1P3B A;  3AYW C;  4G92 B;  2BYM B;  3AZG A;  1P3B B;  5B1L D;  1KX3 C;  3O62 A;  3AZG B;  3O62 B;  5FUG A;  3X1T C;  1HQ3 D;  1A7W A;  2NZD D;  5FUG B;  1ZLA A;  1KX4 D;  1TZY D;  1P3M A;  4Z66 A;  4CSR A;  4QLC A;  3AN2 D;  1ZLA B;  1P3M B;  4Z66 B;  4CSR B;  4QLC B;  3REJ C;  3AZF A;  3WA9 C;  3AFA C;  5AV8 D;  3AZF B;  4WU9 A;  5JA4 A;  4JJN D;  4WU9 B;  1KX5 C;  5JA4 B;  3FDD A;  2Y2P A;  5B0Y D;  5DNM C;  3AZH C;  3AZI A;  5E5A A;  5B32 G;  1P3P D;  3UT9 A;  3AZI B;  5E5A B;  2CWE A;  5GXQ A;  3UT9 B;  1P3A A;  1M1A C;  5GXQ B;  1P3A B;  4E45 A;  5CP6 D;  2NQB C;  3EPH A;  1EQZ A;  2G5H C;  4KGC C;  1P3I C;  3X1T A;  1EQZ B;  3W96 A;  1F1E A;  3VH6 T;  3KUY C;  3TU4 C;  3W96 B;  3C1C A;  3X1U C;  3C1C B;  3WA9 A;  5B1M A;  3W98 A;  3UTB C;  2CV5 C;  5B1M B;  5GSU C;  3W98 B;  1P3O C;  3LZ1 A;  1P3G A;  1U35 D;  3KXB C;  3LZ1 B;  3AZH A;  1P3G B;  4KUD C;  3AZH B;  3LEL D;  2IO5 C;  3B0C T;  1M1A A;  4WU8 C;  4Z5T D;  1S32 D;  1M1A B;  3VH5 A;  1ID3 A;  1F66 C;  5CPK A;  1ID3 B;  4KGC A;  4XZQ A;  3REI A;  3AZM C;  5CPK B;  5F99 D;  3REL C;  4XZQ B;  3MGS A;  3REI B;  3KUY A;  3TU4 A;  3MGS B;  3KUY B;  3TU4 B;  3V9R A;  5B31 G;  5CPI D;  4XUJ A;  1P3F D;  3V9R B;  3REK D;  4XUJ B;  5JRG D;  3UTB A;  2CV5 A;  2BYK A;  5GSU A;  3A6N A;  1AOI D;  4YS3 D;  2CV5 B;  4KHA A;  5AVB A;  2BYK B;  5GSU B;  3A6N B;  3B6G D;  4KHA B;  5AVB B;  5AVC C;  3AZN C;  2IO5 B;  3MVD A;  3WAA D;  1WWS A;  2HIO D;  4R8P C;  3MVD B;  3MGQ C;  3AZM A;  4G91 B;  3KWQ A;  3WTP E;  3REL A;  3AZM B;  3KWQ B;  3REL B;  4J8W A;  1P3K C;  4J8W B;  2FJ7 A;  2FJ7 B;  3WTP D;  4WJ3 C;  3KSY A;  3KFU G;  5B40 D;  4X23 C;  5AV6 C;  5AVC A;  5DNN C;  5AVC B;  4Z2M H;  3AZN A;  1P3L D;  5B24 D;  3AZN B;  1BH8 A;  1BH8 B;  3MGQ A;  3MGQ B;  1R4V A;  4G92 C;  3AZK A;  1P3B C;  5B32 D;  3AZK B;  3AZG C;  3X1S D;  3O62 C;  2J8P A;  5BS7 A;  5CPJ A;  2F8N A;  3AZL D;  4J8X D;  5CPJ B;  3W97 C;  2F8N B;  2XD5 A;  3X1V A;  4LD9 D;  1ZLA C;  3X1V B;  4H9R A;  3LZ0 D;  1PZR A;  4UPK A;  4H9R B;  3WKJ C;  3UTA D;  4WU9 C;  5B2I D;  3W99 D;  3AZI C;  5E5A C;  3LJA A;  3MNN A;  3UT9 C;  3LJA B;  3MNN B;  1M19 D;  4M6B A;  2RIQ A;  1ULY A;  3AZJ C;  3VH5 T;  1EQZ C;  3W97 A;  4YM6 A;  4J8U B;  5BT1 C;  2Y2Q A;  4YM6 B;  3W97 B;  3W96 C;  5GT0 A;  1P3M D;  4Z66 D;  4QLC D;  5B0Z A;  2ARO A;  5GT0 B;  3C1C C;  5B0Z B;  3WKJ A;  2ARO B;  3AZF D;  5C3I C;  3WKJ B;  5B1M C;  4J8V A;  3W98 C;  5AV9 C;  2XD1 A;  3MGP D;  1HTA A;  5B31 D;  4J8V B;  3AZE C;  3AV1 A;  3NQU A;  3LZ1 C;  1P3G C;  3AV2 D;  5B0Y C;  3NQU B;  3AV1 B;  5GXQ D;  1P3A D;  3AYW D;  5CHL B;  2ZY2 A;  5B1L A;  1KX3 D;  5B1L B;  4AWL B;  3AZJ A;  1ID3 C;  2YFV A;  5CPK C;  3X1T D;  1HQ3 A;  4XZQ C;  3AZJ B;  2YFV B;  3REI C;  2NZD A;  4H9O A;  1HQ3 B;  1KX4 A;  1TZY A;  3MGS C;  2NZD B;  4H9O B;  3AN2 A;  1KX4 B;  1TZY B;  5B2J C;  3AN2 B;  3REJ D;  3WA9 D;  3AFA D;  2RVQ C;  4XUJ C;  4H9P A;  5AV8 A;  5C3I B;  5AV8 B;  5AV9 A;  4H9P B;  3AZE A;  3A6N C;  4JJN A;  5AV9 B;  1KX5 D;  3B6F C;  3AZE B;  5AVB C;  4JJN B;  5DNM D;  5B0Y A;  3NQJ A;  1P3P A;  5B0Y B;  3NQJ B;  1P3P B;  3VH6 W;  1M1A D;  5GT3 C;  4ZUX C;  1T3U A;  2NQB D;  5CP6 A;  3MVD C;  3MGR D;  5CP6 B;  4KGC D;  3C1B C;  4G91 C;  1P3I D;  3EG5 B;  5BO0 A;  3KWQ C;  3KUY D;  5BO0 B;  3X1U D;  5B2J A;  4J8W C;  5CPI C;  4NE6 A;  4NE3 A;  5B2J B;  3REK C;  3UTB D;  2FJ7 C;  3B0C W;  1AOI C;  1P3O D;  3B6F A;  3KXB D;  4DQY B;  1U35 A;  3B6F B;  1U35 B;  5AY8 C;  4KUD D;  3LEL A;  4CAY A;  3LEL B;  4WU8 D;  4CAY B;  5GT3 A;  4Z5T A;  2F2A C;  4ZUX A;  1S32 A;  1W2E A;  5GT3 B;  4Z5T B;  4ZUX B;  1S32 B;  1F66 D;  2ZY5 A;  3C1B A;  3REL D;  5F99 A;  3C1B B;  4WZS B;  5F99 B;  1M18 C;  3REH C;  3AZK C;  4EO5 B;  1P34 D;  5CPI A;  1P3F A;  3REK A;  4HGA B;  5CPI B;  5BS7 C;  4H9N A;  5JRG A;  5CPJ C;  3REK B;  1P3F B;  1AOI A;  5JRG B;  4H9N B;  1AOI B;  5AV5 D;  3B0D C;  5B33 D;  3X1V C;  5AY8 A;  2W8S A;  2F8N H;  5AY8 B;  2PYO D;  1P3L C;  3WAA A;  4R8P D;  2HIO A;  4WNN A;  3WAA B;  2HIO B;  2BG1 A;  4WNN B;  3LJA C;  3MNN C;  1M18 A;  3REH A;  1M18 B;  5BNX A;  3REH B;  1P3K D;  2YFW A;  3F6T A;  5BNX B;  2YFW B;  4J8U C;  3WTP A;  4YM6 C;  4X23 D;  5B40 A;  3WTP B;  5B40 B;  5GT0 C;  3B0D B;  5AV6 D;  5B0Z C;  5DNN D;  2ARO C;  1B67 A;  1P3L A;  4J8V C;  1P3L B;  2Y2G A;  3AV1 C;  3A1K A;  3P5J B;  2Y2N A;  1P3B D;  5B32 A;  1KU5 A;  3AZG D;  5B32 B;  5B1L C;  1WWI A;  3X1S A;  3O62 D;  4AWL C;  2LY8 A;  4UUZ A;  3X1S B;  4J8X A;  4J8U A;  4UUZ B;  1HQ3 C;  4J8X B;  2NZD C;  1ZLA D;  4ZBJ B;  1KX4 C;  3H0M C;  1TZY C;  3LZ0 A;  3AN2 C;  3LZ0 B;  3UTA A;  5AV8 C;  3UTA B;  1Z2C B;  4WU9 D;  3MGP C;  5B2I A;  4JJN C;  3AL0 C;  3W99 A;  4H9S A;  5B2I B;  2Y2O A;  3AZI D;  5E5A D;  3VH5 W;  3W99 B;  1P3P C;  3UT9 D;  2HUE B;  2F8N G;  3H0L C;  1M19 A;  2FFF B;  1M19 B;  4Z2M G;  5CP6 C;  3AZJ D;  1EQZ D;  2Y2J A;  5BT1 D;  2JE5 A;  3W96 D;  2JCH A;  3H0R C;  3C1C D;  5B1M D;  3W98 D;  1JFI A;  5AV9 D;  3AZE D;  3MGP A;  5B31 A;  1JFI B;  3LZ1 D;  3MGP B;  5B31 B;  1P3G D;  3AV2 A;  1U35 C;  3AZH D;  3AV2 B;  1B6W A;  3LEL C;  3AYW A;  3AYW B;  3A1I A;  1KX3 A;  4Z5T C;  1S32 C;  1ID3 D;  3MGR C;  1KX3 B;  5CPK D;  4XZQ D;  3REI D;  3X1T B;  5F99 C;  3MGS D;  3TU4 D;  4EO5 C;  3R45 A;  5B2J D;  2Y2I A;  3REJ A;  5BNV A;  3R45 B;  3AFA A;  2RVQ D;  4XUJ D;  2G5I C;  4HGA C;  2ZM5 A;  3REJ B;  5BNV B;  1P3F C;  3AFA B;  2F8N K;  3WA9 B;  2CV5 D;  5JRG C;  5GSU D;  3A6N D;  1KX5 A;  3B6F D;  4YS3 C;  3EPL A;  5AVB D;  3B6G C;  1KX5 B;  5DNM A;  3IP4 C;  5DNM B;  1TAF A;  2Y2M A;  1TAF B;  2DQN C;  2JSS A;  2Y2K A;  4ZUX D;  5GT3 D;  4NFT A;  3MVD D;  2NQB A;  3WAA C;  3EPK A;  2HIO C;  2UWX A;  3MGR A;  2NQB B;  3C1B D;  3B0B A;  1P3I A;  3MGR B;  2Y2H A;  4KGC B;  3AZM D;  3KWQ D;  1P3I B;  5KDM A;  3X1U A;  1P34 C;  4J8W D;  5KDM B;  3X1U B;  2FJ7 D;  1Q9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...