1WWSA

Crystal structure of ttk003001566 from thermus thermophilus hb8
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
148
structure length
148
Chain Sequence
MLMKVAEFERLFRQAAGLDVDKNDLKRVSDFLRNKLYDLLAVAERNAKYNGRDLIFEPDLPIAKGLQETLQEFRRMDTALELKPVLDALAALPPLDLEVAEDVRNLLPELAGALVVAYARVLKELDPALKNPQTEHHERAERVFNLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA1479
publication title Crystal structure of ttk003001566 from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 54
structure length 148
sequence length 148
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09123 DUF1931 Domain of unknown function (DUF1931)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1wwsA00
5CP6C 3UTBB 2FJ7A 5AVBC 3RELD 4J8VC 4H9PB 2F8NG 1AOIC 1M19C 1F66C 1EQZA 5CPIA 3TU4A 3C1BA 3AZFA 1N1JB 5JRGA 3UTBD 4Z5TB 3NQUA 1P3IA 2RVQC 5BNXB 5B1LC 3AZGB 2PYOD 2AROB 5GXQD 5CPKB 3B0CT 2CWEA 3VH6A 3VH5A 1BFMA 1H3OB 3W97A 4Z2MH 5B2IA 5KDMB 4ZUXB 1TZYB 3B6GA 3X1VB 2HUEC 5AV5B 4J8XD 3REKB 5B40C 1S32C 3KUYC 2NZDB 1P3FA 1JFIA 1HQ3D 4ZUXD 5CP6B 5AVBB 1BH9B 4J8VB 2YFVB 3AN2C 5B32C 1AOIB 1M19B 1F66B 5G49B 5BS7C 5GT0B 4H9PA 1HTAA 5CP6D 3B6FA 5AVBD 3AZID 3AZJA 2YFWB 4KUDD 4XZQA 5B1LB 4KGCC 3AV2D 3R45A 3AZLC 4Z5TA 3UT9C 3X1UA 4H9SA 3AZKA 5GT0D 3WKJC 5CPJA 4YM6C 1M1AD 4WZSB 5CPKA 5DNMC 1KX5A 5B1LD 2HUEB 5B24D 3X1TC 5B1MC 1H3OA 5AVCA 3AFAD 4ZBJC 5B40B 1S32B 1TZYA 4J8WD 3X1SC 3KUYB 1U35D 3REJA 3MGRD 5AV5A 3UTAA 3AN2B 4H9NB 5B32B 4JJND 2HIOC 4YS3C 3REKA 5AY8D 5B0YA 2NZDA 4LD9D 3REHC 2NQBC 1S32D 4UUZB 4J8VA 1AOIA 1M18C 3WA9C 4Z2MG 1F66A 3AN2D 2F8NH 4KGCB 3A6NC 5B33C 5BT1D 5B0ZD 3MGSD 3AZLB 2BYMA 3UT9B 3WKJB 4YM6B 3MGPD 3RELC 1KX3A 5DNMB 4Z66A 3KWQD 2F8NB 2L5AA 3LZ0D 5AV6D 1P3MA 5B1MB 3VH5W 3AZMD 5GSUC 4ZBJB 3AZHD 3WKJD 1P3AA 3X1SB 4WU9D 1P34A 4NE6A 3WTPA 1ZLAC 5DNMD 2PYOC 2HIOB 4YS3B 5GXQC 5B1MD 5GT3D 3REHB 2NQBB 1Q9CA 3X1SD 3KXBD 3MNND 1M18B 3WA9B 4CSRB 1B67A 4R8PC 1F1EA 4YS3D 3LELC 4QLCA 5B33B 4J8XC 3W98D 1HQ3C 2F8NK 4KGCA 3RELB 5C3IC 3AZLA 1WWIA 5B31D 5FUGA 5GSUB 5DNND 2F8NA 4KHAB 3X1TA 3AZIC 1ZLAB 4KUDC 3AZFD 2PYOB 3AV2C 5GXQB 1P3ID 5GSUD 4NFTA 5GT0C 1BH8B 3AV1B 2HIOA 1P3BC 1M1AC 4R8PB 3REIA 1ZLAD 3REHA 1KX4D 5B24C 3LELB 3B6GD 3WA9A 3AFAC 4J8XB 4J8WC 5BO0A 1U35C 2CV5D 3AV1D 3MGRC 1HQ3B 5B33A 4R8PD 3W99C 5AV8A 3A6NA 1P3KA 5C3IB 4JJNC 5E5AC 4X23D 3LELD 5AY8C 1P3OD 5B31G 4WNNB 4LD9C 5BNVB 1P3GC 3W96C 3RELA 4XUJA 3B0CW 3AZIB 3AYWC 4KUDB 5AV9C 3LZ1D 3AV2B 5BT1C 5B0ZC 3MGSC 4KHAA 3UTBA 4J8UD 1P3BB 5GXQA 2JSSA 3X1UD 3MGPC 1M1AB 2BYKB 3KWQC 3LZ0C 5AV6C 5B24B 1N1JA 1KX5D 3AZMC 3AFAB 3AZHC 4J8WB 4WU9C 1U35B 5BNXA 5AVCD 3AZGA 3MGRB 2AROA 1P3BD 3W99B 3REJD 4WV4B 4JJNB 5E5AB 4WU8D 5AY8B 4LD9B 5GT3C 1HQ3A 1P3GB 5KDMA 4ZUXA 1P3LC 5B0YD 3W96B 3KXBC 3MNNC 3X1VA 3W99D 3AYWB 1B6WA 5BNVA 5E5AD 5AV9B 4G91C 3C1CD 3MVDD 5B0ZB 3MGSB 3O62D 1P3GD 3W98C 5CP6A 3W96D 5AVBA 1BH9A 2YFVA 1TAFB 4KUDA 1M19A 3AV2A 3MGPB 5G49A 3AYWD 5AV9D 3KWQB 3LZ0B 5AV6B 5GT0A 5B31C 3AZMB 1P3MD 5DNNC 3AZHB 2BYKA 2YFWA 4WU9B 1EQZC 5B1LA 5B24A 1P3AD 3AZED 3C1BC 3AZFC 3AFAA 5JRGC 3WTPD 4J8WA 4EO5C 2IO5C 5F99D 1P3IC 3LJAD 5GT3B 3MGRA 3WAAD 1P3LB 1ID3D 3KXBB 3MNNB 4JJNA 5AY8A 5B2JB 4LD9A 3AZND 3MGQD 5B40A 1S32A 1KX4C 4G91B 3KUYA 4HGAC 4E45A 3B6GC 4CAYB 3W98B 1P3LD 4QLCD 3AN2A 4NE3A 5JA4B 2CV5C 4H9NA 5B32A 3AV1C 1KU5A 5B2JD 3V9RB 5B0ZA 4G92C 1P3PD 5BS7A 4X23C 3WTPE 4UUZA 1P3OC 5B31B 2LY8A 5DNNB 4H9QB 1WWSA 1EQZB 3KWQA 5AV6A 3C1BB 4E44A 3AZFB 3AZMA 3UT9A 5JRGB 3LZ1C 3AZHA 2FJ7D 4WU9A 3B6FC 3NQUB 2IO5B 4EO5B 1P3IB 4XZQC 4YM6A 5DNMA 1EQZD 5CPID 4J8UC 3TU4D 3AZKC 5B1MA 4H9SC 3X1UC 3C1BD 5CPJC 1KX4B 5JRGD 3X1SA 3KXBA 4HGAB 1KX5C 3B6GB 2CV5B 5AVCC 4YS3A 4AWLC 4G92B 3REJC 1JFIB 4WU8C 2NQBA 3W97D 5B2ID 3W98A 4X23B 5AV8D 1P3KD 1P3OB 3UTAC 1M18A 4CSRA 1ULYA 3V9RA 5B0YC 3KSYA 5B31A 1P3FD 4XUJD 5DNNA 3LZ1B 4H9QA 3MVDC 3C1CC 3B6FB 3AZJB 3O62C 4XZQB 4M6BA 4H9OB 3B0BA 3R45B 4J8UB 3AZKB 3X1UB 5CPJB 5GSUA 4DRBA 3B6FD 1KX3C 3AZJD 4Z66C 4XZQD 1KX5B 1P3MC 1ZLAA 5AVCB 1KX4A 2PYOA 4Z5TD 3AZKD 4AWLB 1P3AC 1P34C 3AZEC 3REJB 3AZGD 5CPJD 4WU8B 2AROD 3WTPC 5CPKD 1BH8A 5F99C 3UTAB 3LJAC 3AV1A 2CV5A 3WAAC 4R8PA 5B0YB 1ID3C 4X23A 3LELA 1TZYD 1P3OA 4J8XA 3AZNC 3MGQC 3X1VD 3C1CB 3MVDB 5AV5D 3UTAD 3O62B 3REKD 4QLCC 2NZDD 3LZ1A 5B2JC 2BYMB 4WNNA 4J8VD 1P3PC 1AOID 4H9OA 1M19D 1F66D 1KX3B 4Z66B 4J8UA 1P3MB 3AZIA 5CHLB 4DRAA 1P3AB 1P34B 2RVQD 3AZEB 2FJ7C 3WTPB 1KX3D 5F99B 4Z66D 3LJAB 4NE5A 1P3BA 1M1AA 3WAAB 1ID3B 5CPIC 4WU8A 3TU4C 4H9RB 3WKJA 1P34D 3AZNB 3MGQB 3REIC 1U35A 1A7WA 5B40D 3W99A 4QLCB 3KUYD 3VH6T 5E5AA 3VH5T 3C1CA 3MVDA 1P3PB 5B32D 3O62A 1P3GA 3W97C 5B2IC 3W96A 5AV8C 1P3KC 3AYWA 5AV9A 5FUGB 3NQJB 3MGSA 1P3FC 4XUJC 4KGCD 3X1TB 3B0DC 3VH6W 2FJ7B 1TAFA 3AZLD 3UT9D 3MGPA 3AZEA 5CPIB 4YM6D 3LZ0A 3UTBC 3TU4B 5F99A 1R4VA 3LJAA 2F8ND 3WAAA 3X1TD 1ID3A 3REIB 3AZJC 4H9RA 3AZNA 3MGQA 4Z5TC 5BO0B 5B32G 5GT3A 3AZGC 2HIOD 2AROC 1P3LA 5B2IB 3W97B 3A6NB 5CPKC 5AV8B 3REID 3MNNA 1P3KB 3REHD 2NQBD 5B2JA 1P3PA 1M18D 3WA9D 4ZUXC 1TZYC 1P3FB 4CAYA 4XUJB 3X1VC 5B33D 3A6ND 3B0DB 5JA4A 5AV5C 3REKC 3NQJA 2NZDC
chains in the Genus database with same CATH superfamily
5CP6C 3UTBB 2FJ7A 5AVBC 3EPKA 4J8VC 3RELD 4H9PB 2F8NG 1AOIC 1M19C 1F66C 1EQZA 5CPIA 3TU4A 3C1BA 3AZFA 1N1JB 5JRGA 3UTBD 4Z5TB 3NQUA 1P3IA 2RVQC 5BNXB 5B1LC 3AZGB 2PYOD 2AROB 5GXQD 5CPKB 3B0CT 2CWEA 3VH6A 3VH5A 1BFMA 1H3OB 2Y2MA 3W97A 4Z2MH 5B2IA 5KDMB 4ZUXB 1TZYB 3B6GA 3X1VB 2HUEC 5AV5B 4J8XD 3REKB 5B40C 1S32C 3KUYC 2NZDB 1P3FA 1JFIA 1HQ3D 4ZUXD 5CP6B 5AVBB 1BH9B 4J8VB 2YFVB 3AN2C 5B32C 1AOIB 1M19B 1F66B 5G49B 5BS7C 5GT0B 4H9PA 1HTAA 5CP6D 3B6FA 5AVBD 3AZID 3KFUG 3AZJA 2YFWB 4KUDD 4XZQA 5B1LB 4KGCC 3AV2D 3R45A 3AZLC 4Z5TA 3UT9C 3X1UA 4H9SA 3AZKA 5GT0D 3WKJC 2JCHA 2W8SA 5CPJA 4YM6C 1M1AD 4WZSB 5CPKA 5DNMC 1KX5A 5B1LD 2HUEB 5B24D 3X1TC 5B1MC 1H3OA 5AVCA 3AFAD 4ZBJC 5B40B 1S32B 1TZYA 3FDDA 4J8WD 3X1SC 3KUYB 1U35D 3REJA 3MGRD 2J8PA 5AV5A 3UTAA 3AN2B 4H9NB 5B32B 4JJND 2HIOC 4YS3C 3REKA 5AY8D 5B0YA 2NZDA 4LD9D 3REHC 2NQBC 1S32D 2Y2HA 4UUZB 4J8VA 1AOIA 1M18C 3WA9C 4Z2MG 1F66A 3AN2D 2F8NH 4KGCB 3A6NC 5B33C 2G5IC 5BT1D 5B0ZD 3MGSD 3AZLB 2BYMA 3UT9B 3WKJB 4YM6B 3MGPD 3RELC 1KX3A 5DNMB 4Z66A 3KWQD 2F8NB 2L5AA 3LZ0D 5AV6D 1P3MA 5B1MB 3VH5W 3AZMD 5GSUC 4ZBJB 3AZHD 3WKJD 1P3AA 3X1SB 4WU9D 1P34A 4NE6A 3WTPA 1ZLAC 5DNMD 2PYOC 2HIOB 4YS3B 5GXQC 5B1MD 5GT3D 2Y2IA 3REHB 2NQBB 1Q9CA 3X1SD 3KXBD 3MNND 2FFFB 1M18B 3WA9B 4CSRB 1B67A 4R8PC 1F1EA 4YS3D 3LELC 4QLCA 5B33B 4J8XC 3W98D 1HQ3C 2F8NK 4KGCA 2Y2LA 3RELB 5C3IC 3AZLA 1WWIA 5B31D 2ZM5A 5FUGA 5GSUB 5DNND 2F8NA 4KHAB 3X1TA 3AZIC 1ZLAB 4KUDC 3AZFD 2PYOB 3AV2C 5GXQB 2G5HC 2ZY4A 1P3ID 3A1IA 2UWXA 5GSUD 4NFTA 5GT0C 1BH8B 2Y2JA 3AV1B 2HIOA 1P3BC 1M1AC 4R8PB 3REIA 1ZLAD 3REHA 1KX4D 5B24C 3LELB 3EPLA 3B6GD 3WA9A 3AFAC 4J8XB 4J8WC 5BO0A 1U35C 3H0LC 2CV5D 4DQYB 3AV1D 3MGRC 1HQ3B 5B33A 4R8PD 3W99C 5AV8A 3A6NA 1P3KA 5C3IB 4JJNC 5E5AC 4X23D 3LELD 5AY8C 1P3OD 5B31G 4WNNB 4LD9C 5BNVB 1P3GC 3W96C 3IP4C 3RELA 3EPHA 4XUJA 3B0CW 3AZIB 3AYWC 4KUDB 5AV9C 3LZ1D 3AV2B 1PZRA 5BT1C 5B0ZC 3MGSC 4KHAA 3UTBA 4J8UD 1P3BB 5GXQA 2JSSA 3X1UD 3MGPC 1M1AB 2BYKB 3KWQC 3LZ0C 5AV6C 5B24B 2VQRA 1N1JA 2ZY2A 3AZMC 1KX5D 3AFAB 3AZHC 2XD1A 4J8WB 4WU9C 2Y2OA 1U35B 5BNXA 5AVCD 3AZGA 3MGRB 2AROA 1P3BD 3W99B 3REJD 4WV4B 4JJNB 5E5AB 4WU8D 5AY8B 4LD9B 5GT3C 1HQ3A 1P3GB 5KDMA 4ZUXA 1P3LC 5B0YD 3W96B 3KXBC 3MNNC 3X1VA 3W99D 3AYWB 1B6WA 5BNVA 5E5AD 5AV9B 4G91C 3C1CD 3MVDD 1W2EA 5B0ZB 3MGSB 3O62D 1P3GD 3W98C 5CP6A 3W96D 5AVBA 1BH9A 1TAFB 2YFVA 4KUDA 1M19A 3AV2A 3MGPB 3F6TA 5G49A 4UPKA 3AYWD 5AV9D 3KWQB 3LZ0B 5AV6B 5GT0A 5B31C 3AZMB 1P3MD 5DNNC 3AZHB 2BYKA 2YFWA 4WU9B 1EQZC 5B1LA 5B24A 1T3UA 1P3AD 3AZED 3C1BC 3AZFC 3AFAA 5JRGC 3WTPD 4J8WA 4EO5C 2IO5C 5F99D 1P3IC 3LJAD 5GT3B 3H0MC 3MGRA 3WAAD 1P3LB 1ID3D 3KXBB 3MNNB 4JJNA 3A1KA 5AY8A 5B2JB 4LD9A 3AZND 3MGQD 5B40A 1S32A 1KX4C 4G91B 3KUYA 4HGAC 4E45A 3B6GC 4CAYB 2F2AC 3AL0C 3W98B 1P3LD 4QLCD 3AN2A 4NE3A 5JA4B 2CV5C 4H9NA 5B32A 3AV1C 1KU5A 5B2JD 3V9RB 5B0ZA 4G92C 1P3PD 5BS7A 4X23C 3WTPE 4UUZA 1P3OC 5B31B 2LY8A 5DNNB 4H9QB 1WWSA 1EQZB 3KWQA 5AV6A 3C1BB 4E44A 3AZFB 3AZMA 3UT9A 5JRGB 3LZ1C 3AZHA 2FJ7D 4WU9A 3B6FC 3NQUB 2IO5B 4EO5B 1P3IB 2Y2GA 4XZQC 4YM6A 5DNMA 1EQZD 5CPID 4J8UC 3TU4D 3AZKC 5B1MA 4H9SC 3X1UC 3C1BD 5CPJC 4WJ3C 1KX4B 5JRGD 3X1SA 3KXBA 4HGAB 2XD5A 1KX5C 3EPJA 3B6GB 2CV5B 5AVCC 4YS3A 4AWLC 4G92B 3REJC 1JFIB 4WU8C 2NQBA 3W97D 5B2ID 3W98A 4X23B 5AV8D 1P3KD 1P3OB 3P5JB 2ZY3A 3UTAC 1M18A 4CSRA 1ULYA 3V9RA 5B0YC 3KSYA 5B31A 1P3FD 4XUJD 5DNNA 3LZ1B 4H9QA 3MVDC 3C1CC 3B6FB 3AZJB 3O62C 4XZQB 4M6BA 4H9OB 2Y2KA 3B0BA 3R45B 4J8UB 3AZKB 3X1UB 5CPJB 5GSUA 4DRBA 3B6FD 1KX3C 3AZJD 4Z66C 4XZQD 1KX5B 1P3MC 2Y2QA 1ZLAA 5AVCB 1KX4A 2PYOA 4Z5TD 3AZKD 4AWLB 1P3AC 1P34C 3AZEC 3REJB 2Y2PA 3AZGD 5CPJD 4WU8B 2AROD 3WTPC 5CPKD 1BH8A 5F99C 3UTAB 3LJAC 3AV1A 2CV5A 3WAAC 3EG5B 4R8PA 5B0YB 1ID3C 4X23A 3LELA 1TZYD 1P3OA 2RIQA 2Y2NA 4J8XA 3MGQC 3AZNC 3X1VD 3C1CB 3MVDB 5AV5D 3UTAD 3O62B 3REKD 4QLCC 2NZDD 3LZ1A 5B2JC 2BYMB 4WNNA 4J8VD 1P3PC 1AOID 4H9OA 1M19D 1F66D 1KX3B 4Z66B 4J8UA 1P3MB 3AZIA 5CHLB 4DRAA 1P3AB 1P34B 2RVQD 3AZEB 2JE5A 2FJ7C 3WTPB 1KX3D 5F99B 4Z66D 3LJAB 4NE5A 1P3BA 1M1AA 3WAAB 1ID3B 5CPIC 4WU8A 3TU4C 4H9RB 3WKJA 1P34D 2DF4C 3AZNB 3MGQB 3REIC 1U35A 1A7WA 5B40D 3W99A 4QLCB 3KUYD 3VH6T 5E5AA 3VH5T 3C1CA 3MVDA 3H0RC 1P3PB 5B32D 3O62A 1P3GA 3W97C 5B2IC 3W96A 5AV8C 1P3KC 3AYWA 5AV9A 5FUGB 3NQJB 2DQNC 3MGSA 1P3FC 4XUJC 4KGCD 3X1TB 3B0DC 3VH6W 2FJ7B 1TAFA 3AZLD 3UT9D 3MGPA 3AZEA 5CPIB 4YM6D 3LZ0A 3UTBC 3TU4B 5F99A 1R4VA 3LJAA 2F8ND 3WAAA 3X1TD 1ID3A 3REIB 3AZJC 4H9RA 2ZY5A 3MGQA 3AZNA 4Z5TC 5BO0B 5B32G 5GT3A 3AZGC 2HIOD 2AROC 1P3LA 5B2IB 1Z2CB 3A6NB 3W97B 5CPKC 5AV8B 3REID 3MNNA 1P3KB 3REHD 2NQBD 5B2JA 1P3PA 1M18D 3WA9D 4ZUXC 2BG1A 1TZYC 1P3FB 4CAYA 4XUJB 3X1VC 5B33D 3A6ND 3B0DB 5JA4A 5AV5C 3REKC 3NQJA 2NZDC
chains in the Genus database with same CATH topology
5CP6C 3UTBB 2FJ7A 5AVBC 3EPKA 4J8VC 3RELD 4H9PB 2F8NG 1AOIC 1M19C 1F66C 1EQZA 5CPIA 3TU4A 3C1BA 3AZFA 1N1JB 5JRGA 3UTBD 4Z5TB 3NQUA 1P3IA 2RVQC 5BNXB 5B1LC 3AZGB 2PYOD 2AROB 5GXQD 5CPKB 3B0CT 2CWEA 3VH6A 3VH5A 1BFMA 1H3OB 2Y2MA 3W97A 4Z2MH 5B2IA 5KDMB 4ZUXB 1TZYB 3B6GA 3X1VB 2HUEC 5AV5B 4J8XD 3REKB 5B40C 1S32C 3KUYC 2NZDB 1P3FA 1JFIA 1HQ3D 4ZUXD 5CP6B 5AVBB 1BH9B 4J8VB 2YFVB 3AN2C 5B32C 1AOIB 1M19B 1F66B 5G49B 5BS7C 5GT0B 4H9PA 1HTAA 5CP6D 3B6FA 5AVBD 3AZID 3KFUG 3AZJA 2YFWB 4KUDD 4XZQA 5B1LB 4KGCC 3AV2D 3R45A 3AZLC 4Z5TA 3UT9C 3X1UA 4H9SA 3AZKA 5GT0D 3WKJC 2JCHA 2W8SA 5CPJA 4YM6C 1M1AD 4WZSB 5CPKA 5DNMC 1KX5A 5B1LD 2HUEB 5B24D 3X1TC 5B1MC 1H3OA 5AVCA 3AFAD 4ZBJC 5B40B 1S32B 1TZYA 3FDDA 4J8WD 3X1SC 3KUYB 1U35D 3REJA 3MGRD 2J8PA 5AV5A 3UTAA 3AN2B 4H9NB 5B32B 4JJND 2HIOC 4YS3C 3REKA 5AY8D 5B0YA 2NZDA 4LD9D 3REHC 2NQBC 1S32D 2Y2HA 4UUZB 4J8VA 1AOIA 1M18C 3WA9C 4Z2MG 1F66A 3AN2D 2F8NH 4KGCB 3A6NC 5B33C 2G5IC 5BT1D 5B0ZD 3MGSD 3AZLB 2BYMA 3UT9B 3WKJB 4YM6B 3MGPD 3RELC 1KX3A 5DNMB 4Z66A 3KWQD 2F8NB 2L5AA 3LZ0D 5AV6D 1P3MA 5B1MB 3VH5W 3AZMD 5GSUC 4ZBJB 3AZHD 3WKJD 1P3AA 3X1SB 4WU9D 1P34A 4NE6A 3WTPA 1ZLAC 5DNMD 2PYOC 2HIOB 4YS3B 5GXQC 5B1MD 5GT3D 2Y2IA 3REHB 2NQBB 1Q9CA 3X1SD 3KXBD 3MNND 2FFFB 1M18B 3WA9B 4CSRB 1B67A 4R8PC 1F1EA 4YS3D 3LELC 4QLCA 5B33B 4J8XC 3W98D 1HQ3C 2F8NK 4KGCA 2Y2LA 3RELB 5C3IC 3AZLA 1WWIA 5B31D 2ZM5A 5FUGA 5GSUB 5DNND 2F8NA 4KHAB 3X1TA 3AZIC 1ZLAB 4KUDC 3AZFD 2PYOB 3AV2C 5GXQB 2G5HC 2ZY4A 1P3ID 3A1IA 2UWXA 5GSUD 4NFTA 5GT0C 1BH8B 2Y2JA 3AV1B 2HIOA 1P3BC 1M1AC 4R8PB 3REIA 1ZLAD 3REHA 1KX4D 5B24C 3LELB 3EPLA 3B6GD 3WA9A 3AFAC 4J8XB 4J8WC 5BO0A 1U35C 3H0LC 2CV5D 4DQYB 3AV1D 3MGRC 1HQ3B 5B33A 4R8PD 3W99C 5AV8A 3A6NA 1P3KA 5C3IB 4JJNC 5E5AC 4X23D 3LELD 5AY8C 1P3OD 5B31G 4WNNB 4LD9C 5BNVB 1P3GC 3W96C 3IP4C 3RELA 3EPHA 4XUJA 3B0CW 3AZIB 3AYWC 4KUDB 5AV9C 3LZ1D 3AV2B 1PZRA 5BT1C 5B0ZC 3MGSC 4KHAA 3UTBA 4J8UD 1P3BB 5GXQA 2JSSA 3X1UD 3MGPC 1M1AB 2BYKB 3KWQC 3LZ0C 5AV6C 5B24B 2VQRA 1N1JA 2ZY2A 3AZMC 1KX5D 3AFAB 3AZHC 2XD1A 4J8WB 4WU9C 2Y2OA 1U35B 5BNXA 5AVCD 3AZGA 3MGRB 2AROA 1P3BD 3W99B 3REJD 4WV4B 4JJNB 5E5AB 4WU8D 5AY8B 4LD9B 5GT3C 1HQ3A 1P3GB 5KDMA 4ZUXA 1P3LC 5B0YD 3W96B 3KXBC 3MNNC 3X1VA 3W99D 3AYWB 1B6WA 5BNVA 5E5AD 5AV9B 4G91C 3C1CD 3MVDD 1W2EA 5B0ZB 3MGSB 3O62D 1P3GD 3W98C 5CP6A 3W96D 5AVBA 1BH9A 1TAFB 2YFVA 4KUDA 1M19A 3AV2A 3MGPB 3F6TA 5G49A 4UPKA 3AYWD 5AV9D 3KWQB 3LZ0B 5AV6B 5GT0A 5B31C 3AZMB 1P3MD 5DNNC 3AZHB 2BYKA 2YFWA 4WU9B 1EQZC 5B1LA 5B24A 1T3UA 1P3AD 3AZED 3C1BC 3AZFC 3AFAA 5JRGC 3WTPD 4J8WA 4EO5C 2IO5C 5F99D 1P3IC 3LJAD 5GT3B 3H0MC 3MGRA 3WAAD 1P3LB 1ID3D 3KXBB 3MNNB 4JJNA 3A1KA 5AY8A 5B2JB 4LD9A 3AZND 3MGQD 5B40A 1S32A 1KX4C 4G91B 3KUYA 4HGAC 4E45A 3B6GC 4CAYB 2F2AC 3AL0C 3W98B 1P3LD 4QLCD 3AN2A 4NE3A 5JA4B 2CV5C 4H9NA 5B32A 3AV1C 1KU5A 5B2JD 3V9RB 5B0ZA 4G92C 1P3PD 5BS7A 4X23C 3WTPE 4UUZA 1P3OC 5B31B 2LY8A 5DNNB 4H9QB 1WWSA 1EQZB 3KWQA 5AV6A 3C1BB 4E44A 3AZFB 3AZMA 3UT9A 5JRGB 3LZ1C 3AZHA 2FJ7D 4WU9A 3B6FC 3NQUB 2IO5B 4EO5B 1P3IB 2Y2GA 4XZQC 4YM6A 5DNMA 1EQZD 5CPID 4J8UC 3TU4D 3AZKC 5B1MA 4H9SC 3X1UC 3C1BD 5CPJC 4WJ3C 1KX4B 5JRGD 3X1SA 3KXBA 4HGAB 2XD5A 1KX5C 3EPJA 3B6GB 2CV5B 5AVCC 4YS3A 4AWLC 4G92B 3REJC 1JFIB 4WU8C 2NQBA 3W97D 5B2ID 3W98A 4X23B 5AV8D 1P3KD 1P3OB 3P5JB 2ZY3A 3UTAC 1M18A 4CSRA 1ULYA 3V9RA 5B0YC 3KSYA 5B31A 1P3FD 4XUJD 5DNNA 3LZ1B 4H9QA 3MVDC 3C1CC 3B6FB 3AZJB 3O62C 4XZQB 4M6BA 4H9OB 2Y2KA 3B0BA 3R45B 4J8UB 3AZKB 3X1UB 5CPJB 5GSUA 4DRBA 3B6FD 1KX3C 3AZJD 4Z66C 4XZQD 1KX5B 1P3MC 2Y2QA 1ZLAA 5AVCB 1KX4A 2PYOA 4Z5TD 3AZKD 4AWLB 1P3AC 1P34C 3AZEC 3REJB 2Y2PA 3AZGD 5CPJD 4WU8B 2AROD 3WTPC 5CPKD 1BH8A 5F99C 3UTAB 3LJAC 3AV1A 2CV5A 3WAAC 3EG5B 4R8PA 5B0YB 1ID3C 4X23A 3LELA 1TZYD 1P3OA 2RIQA 2Y2NA 4J8XA 3MGQC 3AZNC 3X1VD 3C1CB 3MVDB 5AV5D 3UTAD 3O62B 3REKD 4QLCC 2NZDD 3LZ1A 5B2JC 2BYMB 4WNNA 4J8VD 1P3PC 1AOID 4H9OA 1M19D 1F66D 1KX3B 4Z66B 4J8UA 1P3MB 3AZIA 5CHLB 4DRAA 1P3AB 1P34B 2RVQD 3AZEB 2JE5A 2FJ7C 3WTPB 1KX3D 5F99B 4Z66D 3LJAB 4NE5A 1P3BA 1M1AA 3WAAB 1ID3B 5CPIC 4WU8A 3TU4C 4H9RB 3WKJA 1P34D 2DF4C 3AZNB 3MGQB 3REIC 1U35A 1A7WA 5B40D 3W99A 4QLCB 3KUYD 3VH6T 5E5AA 3VH5T 3C1CA 3MVDA 3H0RC 1P3PB 5B32D 3O62A 1P3GA 3W97C 5B2IC 3W96A 5AV8C 1P3KC 3AYWA 5AV9A 5FUGB 3NQJB 2DQNC 3MGSA 1P3FC 4XUJC 4KGCD 3X1TB 3B0DC 3VH6W 2FJ7B 1TAFA 3AZLD 3UT9D 3MGPA 3AZEA 5CPIB 4YM6D 3LZ0A 3UTBC 3TU4B 5F99A 1R4VA 3LJAA 2F8ND 3WAAA 3X1TD 1ID3A 3REIB 3AZJC 4H9RA 2ZY5A 3MGQA 3AZNA 4Z5TC 5BO0B 5B32G 5GT3A 3AZGC 2HIOD 2AROC 1P3LA 5B2IB 1Z2CB 3A6NB 3W97B 5CPKC 5AV8B 3REID 3MNNA 1P3KB 3REHD 2NQBD 5B2JA 1P3PA 1M18D 3WA9D 4ZUXC 2BG1A 1TZYC 1P3FB 4CAYA 4XUJB 3X1VC 5B33D 3A6ND 3B0DB 5JA4A 5AV5C 3REKC 3NQJA 2NZDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 C;  3UTB B;  2FJ7 A;  5AVB C;  3REL D;  4J8V C;  4H9P B;  2F8N G;  1AOI C;  1M19 C;  1F66 C;  1EQZ A;  5CPI A;  3TU4 A;  3C1B A;  3AZF A;  1N1J B;  5JRG A;  3UTB D;  4Z5T B;  3NQU A;  1P3I A;  2RVQ C;  5BNX B;  5B1L C;  3AZG B;  2PYO D;  2ARO B;  5GXQ D;  5CPK B;  3B0C T;  2CWE A;  3VH6 A;  3VH5 A;  1BFM A;  1H3O B;  3W97 A;  4Z2M H;  5B2I A;  5KDM B;  4ZUX B;  1TZY B;  3B6G A;  3X1V B;  2HUE C;  5AV5 B;  4J8X D;  3REK B;  5B40 C;  1S32 C;  3KUY C;  2NZD B;  1P3F A;  1JFI A;  1HQ3 D;  4ZUX D;  5CP6 B;  5AVB B;  1BH9 B;  4J8V B;  2YFV B;  3AN2 C;  5B32 C;  1AOI B;  1M19 B;  1F66 B;  5G49 B;  5BS7 C;  5GT0 B;  4H9P A;  1HTA A;  5CP6 D;  3B6F A;  5AVB D;  3AZI D;  3AZJ A;  2YFW B;  4KUD D;  4XZQ A;  5B1L B;  4KGC C;  3AV2 D;  3R45 A;  3AZL C;  4Z5T A;  3UT9 C;  3X1U A;  4H9S A;  3AZK A;  5GT0 D;  3WKJ C;  5CPJ A;  4YM6 C;  1M1A D;  4WZS B;  5CPK A;  5DNM C;  1KX5 A;  5B1L D;  2HUE B;  5B24 D;  3X1T C;  5B1M C;  1H3O A;  5AVC A;  3AFA D;  4ZBJ C;  5B40 B;  1S32 B;  1TZY A;  4J8W D;  3X1S C;  3KUY B;  1U35 D;  3REJ A;  3MGR D;  5AV5 A;  3UTA A;  3AN2 B;  4H9N B;  5B32 B;  4JJN D;  2HIO C;  4YS3 C;  3REK A;  5AY8 D;  5B0Y A;  2NZD A;  4LD9 D;  3REH C;  2NQB C;  1S32 D;  4UUZ B;  4J8V A;  1AOI A;  1M18 C;  3WA9 C;  4Z2M G;  1F66 A;  3AN2 D;  2F8N H;  4KGC B;  3A6N C;  5B33 C;  5BT1 D;  5B0Z D;  3MGS D;  3AZL B;  2BYM A;  3UT9 B;  3WKJ B;  4YM6 B;  3MGP D;  3REL C;  1KX3 A;  5DNM B;  4Z66 A;  3KWQ D;  2F8N B;  2L5A A;  3LZ0 D;  5AV6 D;  1P3M A;  5B1M B;  3VH5 W;  3AZM D;  5GSU C;  4ZBJ B;  3AZH D;  3WKJ D;  1P3A A;  3X1S B;  4WU9 D;  1P34 A;  4NE6 A;  3WTP A;  1ZLA C;  5DNM D;  2PYO C;  2HIO B;  4YS3 B;  5GXQ C;  5B1M D;  5GT3 D;  3REH B;  2NQB B;  1Q9C A;  3X1S D;  3KXB D;  3MNN D;  1M18 B;  3WA9 B;  4CSR B;  1B67 A;  4R8P C;  1F1E A;  4YS3 D;  3LEL C;  4QLC A;  5B33 B;  4J8X C;  3W98 D;  1HQ3 C;  2F8N K;  4KGC A;  3REL B;  5C3I C;  3AZL A;  1WWI A;  5B31 D;  5FUG A;  5GSU B;  5DNN D;  2F8N A;  4KHA B;  3X1T A;  3AZI C;  1ZLA B;  4KUD C;  3AZF D;  2PYO B;  3AV2 C;  5GXQ B;  1P3I D;  5GSU D;  4NFT A;  5GT0 C;  1BH8 B;  3AV1 B;  2HIO A;  1P3B C;  1M1A C;  4R8P B;  3REI A;  1ZLA D;  3REH A;  1KX4 D;  5B24 C;  3LEL B;  3B6G D;  3WA9 A;  3AFA C;  4J8X B;  4J8W C;  5BO0 A;  1U35 C;  2CV5 D;  3AV1 D;  3MGR C;  1HQ3 B;  5B33 A;  4R8P D;  3W99 C;  5AV8 A;  3A6N A;  1P3K A;  5C3I B;  4JJN C;  5E5A C;  4X23 D;  3LEL D;  5AY8 C;  1P3O D;  5B31 G;  4WNN B;  4LD9 C;  5BNV B;  1P3G C;  3W96 C;  3REL A;  4XUJ A;  3B0C W;  3AZI B;  3AYW C;  4KUD B;  5AV9 C;  3LZ1 D;  3AV2 B;  5BT1 C;  5B0Z C;  3MGS C;  4KHA A;  3UTB A;  4J8U D;  1P3B B;  5GXQ A;  2JSS A;  3X1U D;  3MGP C;  1M1A B;  2BYK B;  3KWQ C;  3LZ0 C;  5AV6 C;  5B24 B;  1N1J A;  1KX5 D;  3AZM C;  3AFA B;  3AZH C;  4J8W B;  4WU9 C;  1U35 B;  5BNX A;  5AVC D;  3AZG A;  3MGR B;  2ARO A;  1P3B D;  3W99 B;  3REJ D;  4WV4 B;  4JJN B;  5E5A B;  4WU8 D;  5AY8 B;  4LD9 B;  5GT3 C;  1HQ3 A;  1P3G B;  5KDM A;  4ZUX A;  1P3L C;  5B0Y D;  3W96 B;  3KXB C;  3MNN C;  3X1V A;  3W99 D;  3AYW B;  1B6W A;  5BNV A;  5E5A D;  5AV9 B;  4G91 C;  3C1C D;  3MVD D;  5B0Z B;  3MGS B;  3O62 D;  1P3G D;  3W98 C;  5CP6 A;  3W96 D;  5AVB A;  1BH9 A;  2YFV A;  1TAF B;  4KUD A;  1M19 A;  3AV2 A;  3MGP B;  5G49 A;  3AYW D;  5AV9 D;  3KWQ B;  3LZ0 B;  5AV6 B;  5GT0 A;  5B31 C;  3AZM B;  1P3M D;  5DNN C;  3AZH B;  2BYK A;  2YFW A;  4WU9 B;  1EQZ C;  5B1L A;  5B24 A;  1P3A D;  3AZE D;  3C1B C;  3AZF C;  3AFA A;  5JRG C;  3WTP D;  4J8W A;  4EO5 C;  2IO5 C;  5F99 D;  1P3I C;  3LJA D;  5GT3 B;  3MGR A;  3WAA D;  1P3L B;  1ID3 D;  3KXB B;  3MNN B;  4JJN A;  5AY8 A;  5B2J B;  4LD9 A;  3AZN D;  3MGQ D;  5B40 A;  1S32 A;  1KX4 C;  4G91 B;  3KUY A;  4HGA C;  4E45 A;  3B6G C;  4CAY B;  3W98 B;  1P3L D;  4QLC D;  3AN2 A;  4NE3 A;  5JA4 B;  2CV5 C;  4H9N A;  5B32 A;  3AV1 C;  1KU5 A;  5B2J D;  3V9R B;  5B0Z A;  4G92 C;  1P3P D;  5BS7 A;  4X23 C;  3WTP E;  4UUZ A;  1P3O C;  5B31 B;  2LY8 A;  5DNN B;  4H9Q B;  1WWS A;  1EQZ B;  3KWQ A;  5AV6 A;  3C1B B;  4E44 A;  3AZF B;  3AZM A;  3UT9 A;  5JRG B;  3LZ1 C;  3AZH A;  2FJ7 D;  4WU9 A;  3B6F C;  3NQU B;  2IO5 B;  4EO5 B;  1P3I B;  4XZQ C;  4YM6 A;  5DNM A;  1EQZ D;  5CPI D;  4J8U C;  3TU4 D;  3AZK C;  5B1M A;  4H9S C;  3X1U C;  3C1B D;  5CPJ C;  1KX4 B;  5JRG D;  3X1S A;  3KXB A;  4HGA B;  1KX5 C;  3B6G B;  2CV5 B;  5AVC C;  4YS3 A;  4AWL C;  4G92 B;  3REJ C;  1JFI B;  4WU8 C;  2NQB A;  3W97 D;  5B2I D;  3W98 A;  4X23 B;  5AV8 D;  1P3K D;  1P3O B;  3UTA C;  1M18 A;  4CSR A;  1ULY A;  3V9R A;  5B0Y C;  3KSY A;  5B31 A;  1P3F D;  4XUJ D;  5DNN A;  3LZ1 B;  4H9Q A;  3MVD C;  3C1C C;  3B6F B;  3AZJ B;  3O62 C;  4XZQ B;  4M6B A;  4H9O B;  3B0B A;  3R45 B;  4J8U B;  3AZK B;  3X1U B;  5CPJ B;  5GSU A;  4DRB A;  3B6F D;  1KX3 C;  3AZJ D;  4Z66 C;  4XZQ D;  1KX5 B;  1P3M C;  1ZLA A;  5AVC B;  1KX4 A;  2PYO A;  4Z5T D;  3AZK D;  4AWL B;  1P3A C;  1P34 C;  3AZE C;  3REJ B;  3AZG D;  5CPJ D;  4WU8 B;  2ARO D;  3WTP C;  5CPK D;  1BH8 A;  5F99 C;  3UTA B;  3LJA C;  3AV1 A;  2CV5 A;  3WAA C;  4R8P A;  5B0Y B;  1ID3 C;  4X23 A;  3LEL A;  1TZY D;  1P3O A;  4J8X A;  3AZN C;  3MGQ C;  3X1V D;  3C1C B;  3MVD B;  5AV5 D;  3UTA D;  3O62 B;  3REK D;  4QLC C;  2NZD D;  3LZ1 A;  5B2J C;  2BYM B;  4WNN A;  4J8V D;  1P3P C;  1AOI D;  4H9O A;  1M19 D;  1F66 D;  1KX3 B;  4Z66 B;  4J8U A;  1P3M B;  3AZI A;  5CHL B;  4DRA A;  1P3A B;  1P34 B;  2RVQ D;  3AZE B;  2FJ7 C;  3WTP B;  1KX3 D;  5F99 B;  4Z66 D;  3LJA B;  4NE5 A;  1P3B A;  1M1A A;  3WAA B;  1ID3 B;  5CPI C;  4WU8 A;  3TU4 C;  4H9R B;  3WKJ A;  1P34 D;  3AZN B;  3MGQ B;  3REI C;  1U35 A;  1A7W A;  5B40 D;  3W99 A;  4QLC B;  3KUY D;  3VH6 T;  5E5A A;  3VH5 T;  3C1C A;  3MVD A;  1P3P B;  5B32 D;  3O62 A;  1P3G A;  3W97 C;  5B2I C;  3W96 A;  5AV8 C;  1P3K C;  3AYW A;  5AV9 A;  5FUG B;  3NQJ B;  3MGS A;  1P3F C;  4XUJ C;  4KGC D;  3X1T B;  3B0D C;  3VH6 W;  2FJ7 B;  1TAF A;  3AZL D;  3UT9 D;  3MGP A;  3AZE A;  5CPI B;  4YM6 D;  3LZ0 A;  3UTB C;  3TU4 B;  5F99 A;  1R4V A;  3LJA A;  2F8N D;  3WAA A;  3X1T D;  1ID3 A;  3REI B;  3AZJ C;  4H9R A;  3AZN A;  3MGQ A;  4Z5T C;  5BO0 B;  5B32 G;  5GT3 A;  3AZG C;  2HIO D;  2ARO C;  1P3L A;  5B2I B;  3W97 B;  3A6N B;  5CPK C;  5AV8 B;  3REI D;  3MNN A;  1P3K B;  3REH D;  2NQB D;  5B2J A;  1P3P A;  1M18 D;  3WA9 D;  4ZUX C;  1TZY C;  1P3F B;  4CAY A;  4XUJ B;  3X1V C;  5B33 D;  3A6N D;  3B0D B;  5JA4 A;  5AV5 C;  3REK C;  3NQJ A;  2NZD C; 
#chains in the Genus database with same CATH topology
 5CP6 C;  3UTB B;  2FJ7 A;  5AVB C;  3EPK A;  4J8V C;  3REL D;  4H9P B;  2F8N G;  1AOI C;  1M19 C;  1F66 C;  1EQZ A;  5CPI A;  3TU4 A;  3C1B A;  3AZF A;  1N1J B;  5JRG A;  3UTB D;  4Z5T B;  3NQU A;  1P3I A;  2RVQ C;  5BNX B;  5B1L C;  3AZG B;  2PYO D;  2ARO B;  5GXQ D;  5CPK B;  3B0C T;  2CWE A;  3VH6 A;  3VH5 A;  1BFM A;  1H3O B;  2Y2M A;  3W97 A;  4Z2M H;  5B2I A;  5KDM B;  4ZUX B;  1TZY B;  3B6G A;  3X1V B;  2HUE C;  5AV5 B;  4J8X D;  3REK B;  5B40 C;  1S32 C;  3KUY C;  2NZD B;  1P3F A;  1JFI A;  1HQ3 D;  4ZUX D;  5CP6 B;  5AVB B;  1BH9 B;  4J8V B;  2YFV B;  3AN2 C;  5B32 C;  1AOI B;  1M19 B;  1F66 B;  5G49 B;  5BS7 C;  5GT0 B;  4H9P A;  1HTA A;  5CP6 D;  3B6F A;  5AVB D;  3AZI D;  3KFU G;  3AZJ A;  2YFW B;  4KUD D;  4XZQ A;  5B1L B;  4KGC C;  3AV2 D;  3R45 A;  3AZL C;  4Z5T A;  3UT9 C;  3X1U A;  4H9S A;  3AZK A;  5GT0 D;  3WKJ C;  2JCH A;  2W8S A;  5CPJ A;  4YM6 C;  1M1A D;  4WZS B;  5CPK A;  5DNM C;  1KX5 A;  5B1L D;  2HUE B;  5B24 D;  3X1T C;  5B1M C;  1H3O A;  5AVC A;  3AFA D;  4ZBJ C;  5B40 B;  1S32 B;  1TZY A;  3FDD A;  4J8W D;  3X1S C;  3KUY B;  1U35 D;  3REJ A;  3MGR D;  2J8P A;  5AV5 A;  3UTA A;  3AN2 B;  4H9N B;  5B32 B;  4JJN D;  2HIO C;  4YS3 C;  3REK A;  5AY8 D;  5B0Y A;  2NZD A;  4LD9 D;  3REH C;  2NQB C;  1S32 D;  2Y2H A;  4UUZ B;  4J8V A;  1AOI A;  1M18 C;  3WA9 C;  4Z2M G;  1F66 A;  3AN2 D;  2F8N H;  4KGC B;  3A6N C;  5B33 C;  2G5I C;  5BT1 D;  5B0Z D;  3MGS D;  3AZL B;  2BYM A;  3UT9 B;  3WKJ B;  4YM6 B;  3MGP D;  3REL C;  1KX3 A;  5DNM B;  4Z66 A;  3KWQ D;  2F8N B;  2L5A A;  3LZ0 D;  5AV6 D;  1P3M A;  5B1M B;  3VH5 W;  3AZM D;  5GSU C;  4ZBJ B;  3AZH D;  3WKJ D;  1P3A A;  3X1S B;  4WU9 D;  1P34 A;  4NE6 A;  3WTP A;  1ZLA C;  5DNM D;  2PYO C;  2HIO B;  4YS3 B;  5GXQ C;  5B1M D;  5GT3 D;  2Y2I A;  3REH B;  2NQB B;  1Q9C A;  3X1S D;  3KXB D;  3MNN D;  2FFF B;  1M18 B;  3WA9 B;  4CSR B;  1B67 A;  4R8P C;  1F1E A;  4YS3 D;  3LEL C;  4QLC A;  5B33 B;  4J8X C;  3W98 D;  1HQ3 C;  2F8N K;  4KGC A;  2Y2L A;  3REL B;  5C3I C;  3AZL A;  1WWI A;  5B31 D;  2ZM5 A;  5FUG A;  5GSU B;  5DNN D;  2F8N A;  4KHA B;  3X1T A;  3AZI C;  1ZLA B;  4KUD C;  3AZF D;  2PYO B;  3AV2 C;  5GXQ B;  2G5H C;  2ZY4 A;  1P3I D;  3A1I A;  2UWX A;  5GSU D;  4NFT A;  5GT0 C;  1BH8 B;  2Y2J A;  3AV1 B;  2HIO A;  1P3B C;  1M1A C;  4R8P B;  3REI A;  1ZLA D;  3REH A;  1KX4 D;  5B24 C;  3LEL B;  3EPL A;  3B6G D;  3WA9 A;  3AFA C;  4J8X B;  4J8W C;  5BO0 A;  1U35 C;  3H0L C;  2CV5 D;  4DQY B;  3AV1 D;  3MGR C;  1HQ3 B;  5B33 A;  4R8P D;  3W99 C;  5AV8 A;  3A6N A;  1P3K A;  5C3I B;  4JJN C;  5E5A C;  4X23 D;  3LEL D;  5AY8 C;  1P3O D;  5B31 G;  4WNN B;  4LD9 C;  5BNV B;  1P3G C;  3W96 C;  3IP4 C;  3REL A;  3EPH A;  4XUJ A;  3B0C W;  3AZI B;  3AYW C;  4KUD B;  5AV9 C;  3LZ1 D;  3AV2 B;  1PZR A;  5BT1 C;  5B0Z C;  3MGS C;  4KHA A;  3UTB A;  4J8U D;  1P3B B;  5GXQ A;  2JSS A;  3X1U D;  3MGP C;  1M1A B;  2BYK B;  3KWQ C;  3LZ0 C;  5AV6 C;  5B24 B;  2VQR A;  1N1J A;  2ZY2 A;  3AZM C;  1KX5 D;  3AFA B;  3AZH C;  2XD1 A;  4J8W B;  4WU9 C;  2Y2O A;  1U35 B;  5BNX A;  5AVC D;  3AZG A;  3MGR B;  2ARO A;  1P3B D;  3W99 B;  3REJ D;  4WV4 B;  4JJN B;  5E5A B;  4WU8 D;  5AY8 B;  4LD9 B;  5GT3 C;  1HQ3 A;  1P3G B;  5KDM A;  4ZUX A;  1P3L C;  5B0Y D;  3W96 B;  3KXB C;  3MNN C;  3X1V A;  3W99 D;  3AYW B;  1B6W A;  5BNV A;  5E5A D;  5AV9 B;  4G91 C;  3C1C D;  3MVD D;  1W2E A;  5B0Z B;  3MGS B;  3O62 D;  1P3G D;  3W98 C;  5CP6 A;  3W96 D;  5AVB A;  1BH9 A;  1TAF B;  2YFV A;  4KUD A;  1M19 A;  3AV2 A;  3MGP B;  3F6T A;  5G49 A;  4UPK A;  3AYW D;  5AV9 D;  3KWQ B;  3LZ0 B;  5AV6 B;  5GT0 A;  5B31 C;  3AZM B;  1P3M D;  5DNN C;  3AZH B;  2BYK A;  2YFW A;  4WU9 B;  1EQZ C;  5B1L A;  5B24 A;  1T3U A;  1P3A D;  3AZE D;  3C1B C;  3AZF C;  3AFA A;  5JRG C;  3WTP D;  4J8W A;  4EO5 C;  2IO5 C;  5F99 D;  1P3I C;  3LJA D;  5GT3 B;  3H0M C;  3MGR A;  3WAA D;  1P3L B;  1ID3 D;  3KXB B;  3MNN B;  4JJN A;  3A1K A;  5AY8 A;  5B2J B;  4LD9 A;  3AZN D;  3MGQ D;  5B40 A;  1S32 A;  1KX4 C;  4G91 B;  3KUY A;  4HGA C;  4E45 A;  3B6G C;  4CAY B;  2F2A C;  3AL0 C;  3W98 B;  1P3L D;  4QLC D;  3AN2 A;  4NE3 A;  5JA4 B;  2CV5 C;  4H9N A;  5B32 A;  3AV1 C;  1KU5 A;  5B2J D;  3V9R B;  5B0Z A;  4G92 C;  1P3P D;  5BS7 A;  4X23 C;  3WTP E;  4UUZ A;  1P3O C;  5B31 B;  2LY8 A;  5DNN B;  4H9Q B;  1WWS A;  1EQZ B;  3KWQ A;  5AV6 A;  3C1B B;  4E44 A;  3AZF B;  3AZM A;  3UT9 A;  5JRG B;  3LZ1 C;  3AZH A;  2FJ7 D;  4WU9 A;  3B6F C;  3NQU B;  2IO5 B;  4EO5 B;  1P3I B;  2Y2G A;  4XZQ C;  4YM6 A;  5DNM A;  1EQZ D;  5CPI D;  4J8U C;  3TU4 D;  3AZK C;  5B1M A;  4H9S C;  3X1U C;  3C1B D;  5CPJ C;  4WJ3 C;  1KX4 B;  5JRG D;  3X1S A;  3KXB A;  4HGA B;  2XD5 A;  1KX5 C;  3EPJ A;  3B6G B;  2CV5 B;  5AVC C;  4YS3 A;  4AWL C;  4G92 B;  3REJ C;  1JFI B;  4WU8 C;  2NQB A;  3W97 D;  5B2I D;  3W98 A;  4X23 B;  5AV8 D;  1P3K D;  1P3O B;  3P5J B;  2ZY3 A;  3UTA C;  1M18 A;  4CSR A;  1ULY A;  3V9R A;  5B0Y C;  3KSY A;  5B31 A;  1P3F D;  4XUJ D;  5DNN A;  3LZ1 B;  4H9Q A;  3MVD C;  3C1C C;  3B6F B;  3AZJ B;  3O62 C;  4XZQ B;  4M6B A;  4H9O B;  2Y2K A;  3B0B A;  3R45 B;  4J8U B;  3AZK B;  3X1U B;  5CPJ B;  5GSU A;  4DRB A;  3B6F D;  1KX3 C;  3AZJ D;  4Z66 C;  4XZQ D;  1KX5 B;  1P3M C;  2Y2Q A;  1ZLA A;  5AVC B;  1KX4 A;  2PYO A;  4Z5T D;  3AZK D;  4AWL B;  1P3A C;  1P34 C;  3AZE C;  3REJ B;  2Y2P A;  3AZG D;  5CPJ D;  4WU8 B;  2ARO D;  3WTP C;  5CPK D;  1BH8 A;  5F99 C;  3UTA B;  3LJA C;  3AV1 A;  2CV5 A;  3WAA C;  3EG5 B;  4R8P A;  5B0Y B;  1ID3 C;  4X23 A;  3LEL A;  1TZY D;  1P3O A;  2RIQ A;  2Y2N A;  4J8X A;  3MGQ C;  3AZN C;  3X1V D;  3C1C B;  3MVD B;  5AV5 D;  3UTA D;  3O62 B;  3REK D;  4QLC C;  2NZD D;  3LZ1 A;  5B2J C;  2BYM B;  4WNN A;  4J8V D;  1P3P C;  1AOI D;  4H9O A;  1M19 D;  1F66 D;  1KX3 B;  4Z66 B;  4J8U A;  1P3M B;  3AZI A;  5CHL B;  4DRA A;  1P3A B;  1P34 B;  2RVQ D;  3AZE B;  2JE5 A;  2FJ7 C;  3WTP B;  1KX3 D;  5F99 B;  4Z66 D;  3LJA B;  4NE5 A;  1P3B A;  1M1A A;  3WAA B;  1ID3 B;  5CPI C;  4WU8 A;  3TU4 C;  4H9R B;  3WKJ A;  1P34 D;  2DF4 C;  3AZN B;  3MGQ B;  3REI C;  1U35 A;  1A7W A;  5B40 D;  3W99 A;  4QLC B;  3KUY D;  3VH6 T;  5E5A A;  3VH5 T;  3C1C A;  3MVD A;  3H0R C;  1P3P B;  5B32 D;  3O62 A;  1P3G A;  3W97 C;  5B2I C;  3W96 A;  5AV8 C;  1P3K C;  3AYW A;  5AV9 A;  5FUG B;  3NQJ B;  2DQN C;  3MGS A;  1P3F C;  4XUJ C;  4KGC D;  3X1T B;  3B0D C;  3VH6 W;  2FJ7 B;  1TAF A;  3AZL D;  3UT9 D;  3MGP A;  3AZE A;  5CPI B;  4YM6 D;  3LZ0 A;  3UTB C;  3TU4 B;  5F99 A;  1R4V A;  3LJA A;  2F8N D;  3WAA A;  3X1T D;  1ID3 A;  3REI B;  3AZJ C;  4H9R A;  2ZY5 A;  3MGQ A;  3AZN A;  4Z5T C;  5BO0 B;  5B32 G;  5GT3 A;  3AZG C;  2HIO D;  2ARO C;  1P3L A;  5B2I B;  1Z2C B;  3A6N B;  3W97 B;  5CPK C;  5AV8 B;  3REI D;  3MNN A;  1P3K B;  3REH D;  2NQB D;  5B2J A;  1P3P A;  1M18 D;  3WA9 D;  4ZUX C;  2BG1 A;  1TZY C;  1P3F B;  4CAY A;  4XUJ B;  3X1V C;  5B33 D;  3A6N D;  3B0D B;  5JA4 A;  5AV5 C;  3REK C;  3NQJ A;  2NZD C; 
#chains in the Genus database with same CATH homology
 5CP6 C;  3UTB B;  2FJ7 A;  5AVB C;  3EPK A;  4J8V C;  3REL D;  4H9P B;  2F8N G;  1AOI C;  1M19 C;  1F66 C;  1EQZ A;  5CPI A;  3TU4 A;  3C1B A;  3AZF A;  1N1J B;  5JRG A;  3UTB D;  4Z5T B;  3NQU A;  1P3I A;  2RVQ C;  5BNX B;  5B1L C;  3AZG B;  2PYO D;  2ARO B;  5GXQ D;  5CPK B;  3B0C T;  2CWE A;  3VH6 A;  3VH5 A;  1BFM A;  1H3O B;  2Y2M A;  3W97 A;  4Z2M H;  5B2I A;  5KDM B;  4ZUX B;  1TZY B;  3B6G A;  3X1V B;  2HUE C;  5AV5 B;  4J8X D;  3REK B;  5B40 C;  1S32 C;  3KUY C;  2NZD B;  1P3F A;  1JFI A;  1HQ3 D;  4ZUX D;  5CP6 B;  5AVB B;  1BH9 B;  4J8V B;  2YFV B;  3AN2 C;  5B32 C;  1AOI B;  1M19 B;  1F66 B;  5G49 B;  5BS7 C;  5GT0 B;  4H9P A;  1HTA A;  5CP6 D;  3B6F A;  5AVB D;  3AZI D;  3KFU G;  3AZJ A;  2YFW B;  4KUD D;  4XZQ A;  5B1L B;  4KGC C;  3AV2 D;  3R45 A;  3AZL C;  4Z5T A;  3UT9 C;  3X1U A;  4H9S A;  3AZK A;  5GT0 D;  3WKJ C;  2JCH A;  2W8S A;  5CPJ A;  4YM6 C;  1M1A D;  4WZS B;  5CPK A;  5DNM C;  1KX5 A;  5B1L D;  2HUE B;  5B24 D;  3X1T C;  5B1M C;  1H3O A;  5AVC A;  3AFA D;  4ZBJ C;  5B40 B;  1S32 B;  1TZY A;  3FDD A;  4J8W D;  3X1S C;  3KUY B;  1U35 D;  3REJ A;  3MGR D;  2J8P A;  5AV5 A;  3UTA A;  3AN2 B;  4H9N B;  5B32 B;  4JJN D;  2HIO C;  4YS3 C;  3REK A;  5AY8 D;  5B0Y A;  2NZD A;  4LD9 D;  3REH C;  2NQB C;  1S32 D;  2Y2H A;  4UUZ B;  4J8V A;  1AOI A;  1M18 C;  3WA9 C;  4Z2M G;  1F66 A;  3AN2 D;  2F8N H;  4KGC B;  3A6N C;  5B33 C;  2G5I C;  5BT1 D;  5B0Z D;  3MGS D;  3AZL B;  2BYM A;  3UT9 B;  3WKJ B;  4YM6 B;  3MGP D;  3REL C;  1KX3 A;  5DNM B;  4Z66 A;  3KWQ D;  2F8N B;  2L5A A;  3LZ0 D;  5AV6 D;  1P3M A;  5B1M B;  3VH5 W;  3AZM D;  5GSU C;  4ZBJ B;  3AZH D;  3WKJ D;  1P3A A;  3X1S B;  4WU9 D;  1P34 A;  4NE6 A;  3WTP A;  1ZLA C;  5DNM D;  2PYO C;  2HIO B;  4YS3 B;  5GXQ C;  5B1M D;  5GT3 D;  2Y2I A;  3REH B;  2NQB B;  1Q9C A;  3X1S D;  3KXB D;  3MNN D;  2FFF B;  1M18 B;  3WA9 B;  4CSR B;  1B67 A;  4R8P C;  1F1E A;  4YS3 D;  3LEL C;  4QLC A;  5B33 B;  4J8X C;  3W98 D;  1HQ3 C;  2F8N K;  4KGC A;  2Y2L A;  3REL B;  5C3I C;  3AZL A;  1WWI A;  5B31 D;  2ZM5 A;  5FUG A;  5GSU B;  5DNN D;  2F8N A;  4KHA B;  3X1T A;  3AZI C;  1ZLA B;  4KUD C;  3AZF D;  2PYO B;  3AV2 C;  5GXQ B;  2G5H C;  2ZY4 A;  1P3I D;  3A1I A;  2UWX A;  5GSU D;  4NFT A;  5GT0 C;  1BH8 B;  2Y2J A;  3AV1 B;  2HIO A;  1P3B C;  1M1A C;  4R8P B;  3REI A;  1ZLA D;  3REH A;  1KX4 D;  5B24 C;  3LEL B;  3EPL A;  3B6G D;  3WA9 A;  3AFA C;  4J8X B;  4J8W C;  5BO0 A;  1U35 C;  3H0L C;  2CV5 D;  4DQY B;  3AV1 D;  3MGR C;  1HQ3 B;  5B33 A;  4R8P D;  3W99 C;  5AV8 A;  3A6N A;  1P3K A;  5C3I B;  4JJN C;  5E5A C;  4X23 D;  3LEL D;  5AY8 C;  1P3O D;  5B31 G;  4WNN B;  4LD9 C;  5BNV B;  1P3G C;  3W96 C;  3IP4 C;  3REL A;  3EPH A;  4XUJ A;  3B0C W;  3AZI B;  3AYW C;  4KUD B;  5AV9 C;  3LZ1 D;  3AV2 B;  1PZR A;  5BT1 C;  5B0Z C;  3MGS C;  4KHA A;  3UTB A;  4J8U D;  1P3B B;  5GXQ A;  2JSS A;  3X1U D;  3MGP C;  1M1A B;  2BYK B;  3KWQ C;  3LZ0 C;  5AV6 C;  5B24 B;  2VQR A;  1N1J A;  2ZY2 A;  3AZM C;  1KX5 D;  3AFA B;  3AZH C;  2XD1 A;  4J8W B;  4WU9 C;  2Y2O A;  1U35 B;  5BNX A;  5AVC D;  3AZG A;  3MGR B;  2ARO A;  1P3B D;  3W99 B;  3REJ D;  4WV4 B;  4JJN B;  5E5A B;  4WU8 D;  5AY8 B;  4LD9 B;  5GT3 C;  1HQ3 A;  1P3G B;  5KDM A;  4ZUX A;  1P3L C;  5B0Y D;  3W96 B;  3KXB C;  3MNN C;  3X1V A;  3W99 D;  3AYW B;  1B6W A;  5BNV A;  5E5A D;  5AV9 B;  4G91 C;  3C1C D;  3MVD D;  1W2E A;  5B0Z B;  3MGS B;  3O62 D;  1P3G D;  3W98 C;  5CP6 A;  3W96 D;  5AVB A;  1BH9 A;  1TAF B;  2YFV A;  4KUD A;  1M19 A;  3AV2 A;  3MGP B;  3F6T A;  5G49 A;  4UPK A;  3AYW D;  5AV9 D;  3KWQ B;  3LZ0 B;  5AV6 B;  5GT0 A;  5B31 C;  3AZM B;  1P3M D;  5DNN C;  3AZH B;  2BYK A;  2YFW A;  4WU9 B;  1EQZ C;  5B1L A;  5B24 A;  1T3U A;  1P3A D;  3AZE D;  3C1B C;  3AZF C;  3AFA A;  5JRG C;  3WTP D;  4J8W A;  4EO5 C;  2IO5 C;  5F99 D;  1P3I C;  3LJA D;  5GT3 B;  3H0M C;  3MGR A;  3WAA D;  1P3L B;  1ID3 D;  3KXB B;  3MNN B;  4JJN A;  3A1K A;  5AY8 A;  5B2J B;  4LD9 A;  3AZN D;  3MGQ D;  5B40 A;  1S32 A;  1KX4 C;  4G91 B;  3KUY A;  4HGA C;  4E45 A;  3B6G C;  4CAY B;  2F2A C;  3AL0 C;  3W98 B;  1P3L D;  4QLC D;  3AN2 A;  4NE3 A;  5JA4 B;  2CV5 C;  4H9N A;  5B32 A;  3AV1 C;  1KU5 A;  5B2J D;  3V9R B;  5B0Z A;  4G92 C;  1P3P D;  5BS7 A;  4X23 C;  3WTP E;  4UUZ A;  1P3O C;  5B31 B;  2LY8 A;  5DNN B;  4H9Q B;  1WWS A;  1EQZ B;  3KWQ A;  5AV6 A;  3C1B B;  4E44 A;  3AZF B;  3AZM A;  3UT9 A;  5JRG B;  3LZ1 C;  3AZH A;  2FJ7 D;  4WU9 A;  3B6F C;  3NQU B;  2IO5 B;  4EO5 B;  1P3I B;  2Y2G A;  4XZQ C;  4YM6 A;  5DNM A;  1EQZ D;  5CPI D;  4J8U C;  3TU4 D;  3AZK C;  5B1M A;  4H9S C;  3X1U C;  3C1B D;  5CPJ C;  4WJ3 C;  1KX4 B;  5JRG D;  3X1S A;  3KXB A;  4HGA B;  2XD5 A;  1KX5 C;  3EPJ A;  3B6G B;  2CV5 B;  5AVC C;  4YS3 A;  4AWL C;  4G92 B;  3REJ C;  1JFI B;  4WU8 C;  2NQB A;  3W97 D;  5B2I D;  3W98 A;  4X23 B;  5AV8 D;  1P3K D;  1P3O B;  3P5J B;  2ZY3 A;  3UTA C;  1M18 A;  4CSR A;  1ULY A;  3V9R A;  5B0Y C;  3KSY A;  5B31 A;  1P3F D;  4XUJ D;  5DNN A;  3LZ1 B;  4H9Q A;  3MVD C;  3C1C C;  3B6F B;  3AZJ B;  3O62 C;  4XZQ B;  4M6B A;  4H9O B;  2Y2K A;  3B0B A;  3R45 B;  4J8U B;  3AZK B;  3X1U B;  5CPJ B;  5GSU A;  4DRB A;  3B6F D;  1KX3 C;  3AZJ D;  4Z66 C;  4XZQ D;  1KX5 B;  1P3M C;  2Y2Q A;  1ZLA A;  5AVC B;  1KX4 A;  2PYO A;  4Z5T D;  3AZK D;  4AWL B;  1P3A C;  1P34 C;  3AZE C;  3REJ B;  2Y2P A;  3AZG D;  5CPJ D;  4WU8 B;  2ARO D;  3WTP C;  5CPK D;  1BH8 A;  5F99 C;  3UTA B;  3LJA C;  3AV1 A;  2CV5 A;  3WAA C;  3EG5 B;  4R8P A;  5B0Y B;  1ID3 C;  4X23 A;  3LEL A;  1TZY D;  1P3O A;  2RIQ A;  2Y2N A;  4J8X A;  3MGQ C;  3AZN C;  3X1V D;  3C1C B;  3MVD B;  5AV5 D;  3UTA D;  3O62 B;  3REK D;  4QLC C;  2NZD D;  3LZ1 A;  5B2J C;  2BYM B;  4WNN A;  4J8V D;  1P3P C;  1AOI D;  4H9O A;  1M19 D;  1F66 D;  1KX3 B;  4Z66 B;  4J8U A;  1P3M B;  3AZI A;  5CHL B;  4DRA A;  1P3A B;  1P34 B;  2RVQ D;  3AZE B;  2JE5 A;  2FJ7 C;  3WTP B;  1KX3 D;  5F99 B;  4Z66 D;  3LJA B;  4NE5 A;  1P3B A;  1M1A A;  3WAA B;  1ID3 B;  5CPI C;  4WU8 A;  3TU4 C;  4H9R B;  3WKJ A;  1P34 D;  2DF4 C;  3AZN B;  3MGQ B;  3REI C;  1U35 A;  1A7W A;  5B40 D;  3W99 A;  4QLC B;  3KUY D;  3VH6 T;  5E5A A;  3VH5 T;  3C1C A;  3MVD A;  3H0R C;  1P3P B;  5B32 D;  3O62 A;  1P3G A;  3W97 C;  5B2I C;  3W96 A;  5AV8 C;  1P3K C;  3AYW A;  5AV9 A;  5FUG B;  3NQJ B;  2DQN C;  3MGS A;  1P3F C;  4XUJ C;  4KGC D;  3X1T B;  3B0D C;  3VH6 W;  2FJ7 B;  1TAF A;  3AZL D;  3UT9 D;  3MGP A;  3AZE A;  5CPI B;  4YM6 D;  3LZ0 A;  3UTB C;  3TU4 B;  5F99 A;  1R4V A;  3LJA A;  2F8N D;  3WAA A;  3X1T D;  1ID3 A;  3REI B;  3AZJ C;  4H9R A;  2ZY5 A;  3MGQ A;  3AZN A;  4Z5T C;  5BO0 B;  5B32 G;  5GT3 A;  3AZG C;  2HIO D;  2ARO C;  1P3L A;  5B2I B;  1Z2C B;  3A6N B;  3W97 B;  5CPK C;  5AV8 B;  3REI D;  3MNN A;  1P3K B;  3REH D;  2NQB D;  5B2J A;  1P3P A;  1M18 D;  3WA9 D;  4ZUX C;  2BG1 A;  1TZY C;  1P3F B;  4CAY A;  4XUJ B;  3X1V C;  5B33 D;  3A6N D;  3B0D B;  5JA4 A;  5AV5 C;  3REK C;  3NQJ A;  2NZD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...