1WWSA

Crystal structure of ttk003001566 from thermus thermophilus hb8
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
148
structure length
148
Chain Sequence
MLMKVAEFERLFRQAAGLDVDKNDLKRVSDFLRNKLYDLLAVAERNAKYNGRDLIFEPDLPIAKGLQETLQEFRRMDTALELKPVLDALAALPPLDLEVAEDVRNLLPELAGALVVAYARVLKELDPALKNPQTEHHERAERVFNLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TTHA1479
publication title Crystal structure of ttk003001566 from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 54
structure length 148
sequence length 148
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09123 DUF1931 Domain of unknown function (DUF1931)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1wwsA00
3X1SB 1M19D 1BH8A 3W97A 4LD9A 3AYWD 2F8NG 3MGPB 2HIOC 3LZ0A 3AZHB 4H9QB 1AOIB 5DNND 2YFVA 5CPJB 3LELA 3X1VC 1KX4A 1P3FD 1BH8B 3W97B 4LD9B 3MVDD 2HIOA 3AZMC 3LZ0B 1B67A 5BT1C 3RELA 5JRGD 2YFVB 3X1VA 5AY8D 5GSUD 3LELB 3MGSA 1HTAA 5B2JC 1KX4B 1HQ3C 3AZMA 3MGQD 3AZEC 3RELB 3AZLD 3X1VB 5B2JA 4Z66C 3MGSB 1HQ3A 1M1AD 1F66C 5CP6A 5E5AD 1P3OD 3V9RA 3AZFC 3AZMB 4JJNC 5GXQA 1BFMA 5AVCD 2FJ7C 2JSSA 3AZEA 1P3AC 5B2JB 5AV9D 2F8ND 3B6FD 3VH6T 3AZGC 4QLCC 3W96D 1HQ3B 5CP6B 4KUDA 4XZQD 3V9RB 4UUZA 3UTAA 5GXQB 3X1SD 4X23C 3MGRC 4CSRA 5B1LC 4J8UA 4EO5C 1P3AA 3AZGA 4QLCA 3MGPD 1EQZC 4DRAA 3AYWB 3AZHD 4KUDB 2AROC 3UTAB 3MGRA 5AV8A 2NZDC 5DNNB 1P3BA 5B1LA 4CSRB 2HUEB 3W97D 4WV4B 4LD9D 4J8UB 1P3AB 4WNNA 3AZGB 4QLCB 3LZ0D 3REHA 4NFTA 2LY8A 2AROA 3AV1A 5CPIC 1U35C 3B6GA 4KGCC 4DRBA 3MGRB 5AV8B 3LELD 1KX4D 3WAAC 3REJA 5AY8B 1P3BB 5B1LB 3WA9C 3TU4A 3AZKC 4EO5B 2HIOD 3REHB 5GT0A 3AZNC 5CPIA 5BNVA 2AROB 3AV1B 5B33C 1F1EA 3AZIC 1U35A 3VH5T 3B6GB 4KGCA 4H9SC 4AWLC 3X1VD 3REIC 3MGSD 2L5AA 3REJB 3AZKA 5JA4A 3TU4B 3AZMD 5B2IC 5BT1D 3UTBA 5GT0B 1P3IC 5B33A 5CPIB 5BNVB 3AZJC 4KGCB 4H9SA 2NQBC 4WZSB 3REIA 1S32C 5B2JD 4G91C 5B1MC 1HQ3D 3AZKB 5CP6D 5JA4B 5B2IA 3WTPA 4CAYA 5F99C 5B32C 5B0YC 3UTBB 4E44A 3AZED 3AZJA 5B33B 2NQBA 3AN2A 1KX5C 1S32A 4WU9C 3REIB 5B31C 3X1TC 5B1MA 4WU8C 5AVBC 1KU5A 1F66D 4ZBJC 4KUDD 5F99A 3WTPB 5B2IB 4JJND 4CAYB 3UTAD 5B0YA 3C1CA 4H9NA 4ZUXC 3AFAC 3AZJB 3REKC 2NQBB 3AN2B 4WU9A 1WWSA 1S32B 3R45A 5B31A 4J8UD 1P3AD 4G91B 5AVBA 4QLCD 3AZGD 1P3LC 3W98C 3W99C 1KX3C 5F99B 3UT9C 5B0YB 2PYOC 3C1CB 4H9NB 4ZUXA 4X23D 5AV8D 3AFAA 3MGRD 5CPKC 3REKA 1P3BD 5DNMC 1B6WA 5B1LD 4Z2MH 4WU9B 3R45B 4J8XC 1P3LA 5AVBB 1EQZD 4ZBJB 3W98A 3REHD 2HIOB 3KWQC 4G92C 3B0CT 4Z5TC 2AROD 3AV1D 2PYOA 3B6GD 1ZLAC 4M6BA 5CPKA 3AFAB 1TZYC 4H9PA 3X1UC 3REKB 3REJD 3TU4D 2F8NH 5B0ZC 4J8XA 1P3LB 3MNNC 3KWQA 5B24C 5GT0D 3NQJA 5CPID 1U35D 4KGCD 1ZLAA 1TZYA 3AV2C 5CPKB 4H9PB 4Z66A 3AZKD 5B0ZA 1F66A 4YM6C 3AZFA 4JJNA 5B24A 3UTBD 3KWQB 4G92B 2FJ7A 3NQJB 5B33D 1P3KC 3AZEB 3AV2A 1TZYB 4NE6A 3REID 5B40C 4Z66B 3KXBC 4YM6A 5B0ZB 1F66B 5B2ID 3WTPD 3AZFB 1WWIA 4JJNB 4UUZB 5B24B 2FJ7B 4X23A 1P3KA 3AZJD 2RVQC 2CV5C 2NQBD 3AN2D 1S32D 5B40A 1Q9CA 5B1MD 3KXBA 3WTPE 1EQZA 4YM6B 5JRGC 5F99D 5KDMA 4H9OA 5B0YD 3C1CD 2YFWA 3B0DC 1TAFA 2NZDA 4X23B 1P3KB 2CV5A 4WU9D 5B31D 5B40B 5AVBD 3KXBB 4WNNB 1EQZB 5KDMB 3AZLC 4J8VC 4H9OB 2YFWB 4ZUXD 3AFAD 1TAFB 3O62C 3C1BC 3REKD 2NZDB 2CV5B 1P3GC 3WAAA 3WA9A 1P3LD 3W98D 3W99D 3AZNA 4J8VA 1ID3C 2PYOD 3B0DB 3AZIA 5AV9C 3O62A 5CPKD 1U35B 3W96C 1N1JA 4XUJC 1P3GA 1P3MC 3WAAB 3LZ1C 4J8XD 3WA9B 3WKJC 5C3IC 4NE5A 3KWQD 3AZNB 4J8VB 1ID3A 1P3IA 1ZLAD 3KSYA 3NQUA 2BYKA 1BH9A 3KUYC 1TZYD 3O62B 3AZIB 3MGPC 4AWLB 4XUJA 4Z66D 1P3GB 1P3MA 3LZ1A 4R8PC 5B0ZD 3WKJA 1AOIC 3AZFD 5CPJC 1P3PC 5B24D 5B32A 2FJ7D 1A7WA 3KUYA 1P3IB 4LD9C 3NQUB 3AV2D 1R4VA 1BH9B 2BYKB 1KX5A 1JFIA 3LZ0C 4XUJB 3X1TA 1P3MB 4R8PA 4WU8A 5B1MB 4YM6D 3B6FA 3WKJB 5CPJA 5C3IB 1P3PA 5GT3C 5AV6C 3LELC 1KX4C 5B32B 1P3KD 4YS3C 3KUYB 5BNXA 1KX5B 5B40D 1JFIB 3VH6A 5B31B 3VH6W 3KXBD 3X1TB 4R8PB 4WU8B 3W99A 3RELC 5GT3A 5AV6A 1KX3A 1P3PB 1M18C 3MGSC 3UT9A 5B32G 3LJAC 2NZDD 4ZUXB 2RVQD 2CV5D 4YS3A 1P34C 5DNMA 5BNXB 4E45A 4J8WC 5B31G 4NE3A 3W98B 3W99B 1M18A 5GT3B 5AV6B 4Z5TA 1KX3B 3LJAA 3UT9B 2PYOB 2CWEA 3A6NC 1P34A 5CP6C 3X1UA 4YS3B 3WAAD 2IO5C 5AV5C 5DNMB 4J8WA 3WA9D 5GXQC 4J8XB 1M19C 3MNNA 3AZND 4J8VD 1M18B 4Z5TB 3AZID 3O62D 3LJAB 3C1BD 3A6NA 1ZLAB 3AYWC 1P34B 1P3GD 3X1UB 5AV5A 4KUDC 4J8WB 3UTAC 4HGAC 3B0BA 5DNNC 1M19A 5FUGA 3MNNB 2HUEC 1P3FC 1ID3D 1P3ID 4J8UC 3VH5A 5G49A 3VH5W 3MVDC 3A6NB 3AYWA 4XUJD 3AV2B 2F8NK 1P3MD 2IO5B 5AV5B 3LZ1D 3WKJD 5DNNA 5AV8C 1M19B 5FUGB 5AY8C 5GSUC 5B32D 1P3BC 1P3FA 3KUYD 5G49B 5BS7C 1KX5D 3MVDA 3REHC 3X1TD 3MGQC 4R8PD 4WU8D 3AV1C 4HGAB 1AOID 3B6GC 5CPJD 5JRGA 1P3PD 5AY8A 5GSUA 3REJC 1P3FB 3TU4C 1M1AC 5BS7A 5E5AC 1P3OC 3MVDB 3MGQA 5GT0C 5AVCC 5GT3D 5AV6D 1KX3D 5JRGB 3AZLA 5GSUB 3UT9D 2BYMA 3B6FC 3C1BA 1M1AA 4YS3D 5E5AA 1P3OA 5DNMD 4XZQC 3UTBC 3MGQB 5AVCA 3X1SC 3RELD 1M18D 4Z5TD 3AZLB 3LJAD 5AV9A 2BYMB 4H9RA 5BO0A 2F8NA 4KHAA 3W96A 1P34D 3X1UD 3C1BB 1M1AB 1N1JB 5E5AB 4XZQA 3WTPC 4J8WD 3AZHC 1P3OB 1H3OA 1ULYA 5AVCB 3X1SA 3MNND 3AN2C 3B0CW 3W97C 1ID3B 4Z2MG 3A6ND 5AV9B 5BO0B 4H9RB 3MGPA 2F8NB 4KHAB 3B6FB 3W96B 5AV5D 3AZHA 4XZQB 5GXQD 4H9QA 5CHLB 1H3OB 3LZ1B 3C1CC 1AOIA
chains in the Genus database with same CATH superfamily
3X1SB 1M19D 1BH8A 3W97A 4LD9A 3AYWD 2F8NG 3MGPB 2HIOC 3LZ0A 3AZHB 4H9QB 1AOIB 5DNND 2YFVA 5CPJB 3LELA 3X1VC 1KX4A 1P3FD 1BH8B 3W97B 4LD9B 3MVDD 2HIOA 3AZMC 3LZ0B 1B67A 5BT1C 3RELA 5JRGD 2YFVB 3X1VA 5AY8D 5GSUD 3LELB 3MGSA 1HTAA 5B2JC 1KX4B 1HQ3C 3AZMA 3MGQD 3AZEC 3EG5B 3RELB 3AZLD 3X1VB 5B2JA 4Z66C 3MGSB 1HQ3A 1M1AD 1F66C 5CP6A 5E5AD 1P3OD 3V9RA 3AZFC 3AZMB 4JJNC 5GXQA 1BFMA 5AVCD 2FJ7C 2JSSA 3AZEA 2G5HC 1P3AC 5B2JB 5AV9D 2F8ND 3B6FD 3VH6T 3AZGC 4QLCC 3W96D 1HQ3B 5CP6B 3EPHA 4KUDA 4XZQD 3V9RB 4UUZA 3UTAA 5GXQB 3X1SD 4X23C 3MGRC 2ZM5A 4CSRA 5B1LC 4J8UA 4EO5C 1P3AA 3AZGA 4QLCA 3MGPD 1EQZC 2VQRA 4DRAA 3AYWB 3AZHD 4KUDB 2AROC 3UTAB 3MGRA 5AV8A 2NZDC 5DNNB 1P3BA 5B1LA 4CSRB 2HUEB 3W97D 4WV4B 4LD9D 4J8UB 1P3AB 4WNNA 3AZGB 4QLCB 3LZ0D 3REHA 4NFTA 2LY8A 2AROA 3AV1A 5CPIC 1U35C 3B6GA 4DQYB 4KGCC 4DRBA 3MGRB 5AV8B 3LELD 1KX4D 3WAAC 3REJA 5AY8B 1P3BB 5B1LB 3WA9C 3TU4A 3AZKC 4EO5B 2HIOD 3REHB 5GT0A 3AZNC 3A1KA 5CPIA 3AL0C 5BNVA 2AROB 3AV1B 5B33C 1F1EA 3AZIC 1U35A 3VH5T 3B6GB 4KGCA 4H9SC 4AWLC 3X1VD 3REIC 3IP4C 2L5AA 3MGSD 3REJB 3AZKA 5JA4A 3TU4B 3AZMD 5B2IC 5BT1D 3UTBA 5GT0B 2Y2LA 3A1IA 5B33A 5CPIB 5BNVB 3AZJC 1P3IC 4KGCB 4H9SA 2NQBC 4WZSB 3REIA 1S32C 5B2JD 4G91C 5B1MC 2JE5A 1HQ3D 3AZKB 5CP6D 5JA4B 5B2IA 3WTPA 4CAYA 5F99C 2ZY2A 5B32C 5B0YC 3UTBB 4E44A 3AZED 3AZJA 5B33B 2NQBA 3AN2A 1KX5C 1S32A 3H0RC 4WU9C 3REIB 5B31C 3X1TC 5B1MA 4WU8C 5AVBC 1KU5A 1F66D 4ZBJC 4KUDD 5F99A 3WTPB 5B2IB 4JJND 4CAYB 3UTAD 5B0YA 3C1CA 4H9NA 4ZUXC 3AFAC 2ZY5A 3AZJB 3REKC 2NQBB 3AN2B 4WU9A 1WWSA 1S32B 3R45A 5B31A 4J8UD 1P3AD 4G91B 2Y2GA 5AVBA 4QLCD 3AZGD 1P3LC 3W98C 3W99C 2J8PA 1KX3C 2Y2KA 5F99B 3UT9C 2Y2HA 2Y2JA 5B0YB 4H9NB 3F6TA 4ZUXA 5AV8D 4X23D 3AFAA 3MGRD 3C1CB 5CPKC 3REKA 1P3BD 5DNMC 1B6WA 5B1LD 4Z2MH 4WU9B 3R45B 4J8XC 1P3LA 5AVBB 1EQZD 4ZBJB 3W98A 3REHD 2HIOB 3KWQC 4G92C 3B0CT 4Z5TC 2AROD 3AV1D 2PYOA 3B6GD 1ZLAC 4M6BA 5CPKA 3AFAB 1TZYC 4H9PA 3X1UC 3REKB 3REJD 3TU4D 2F8NH 5B0ZC 4J8XA 2PYOC 1P3LB 3MNNC 3KWQA 5B24C 5GT0D 3NQJA 5CPID 1U35D 4KGCD 1ZLAA 1TZYA 3AV2C 5CPKB 4H9PB 4Z66A 3EPKA 3AZKD 5B0ZA 2JCHA 1F66A 4YM6C 3AZFA 4JJNA 5B24A 3UTBD 3KWQB 4G92B 2FJ7A 3NQJB 5B33D 1P3KC 3AZEB 3AV2A 1TZYB 4NE6A 3REID 5B40C 4Z66B 3KXBC 4YM6A 5B0ZB 1F66B 5B2ID 3WTPD 3AZFB 1WWIA 4JJNB 4UUZB 5B24B 2FJ7B 4X23A 1P3KA 3H0LC 3AZJD 2RVQC 2CV5C 2NQBD 3AN2D 1S32D 5B40A 1Q9CA 5B1MD 3KXBA 3WTPE 1EQZA 4YM6B 5JRGC 5F99D 5KDMA 4H9OA 2Y2QA 5B0YD 3C1CD 2YFWA 3B0DC 1Z2CB 1TAFA 2NZDA 4X23B 3EPLA 1P3KB 2CV5A 4WU9D 5B31D 5B40B 2F2AC 3KFUG 5AVBD 3KXBB 4WNNB 1EQZB 5KDMB 3AZLC 4J8VC 4H9OB 2YFWB 2ZY4A 4ZUXD 3AFAD 1TAFB 3O62C 3C1BC 3REKD 2NZDB 2CV5B 1P3GC 3WAAA 3WA9A 1P3LD 3W98D 3W99D 3AZNA 2W8SA 4J8VA 2DQNC 1ID3C 2PYOD 3B0DB 3AZIA 5AV9C 3O62A 5CPKD 1U35B 3W96C 1N1JA 1W2EA 4XUJC 1P3GA 3EPJA 1P3MC 3WAAB 3LZ1C 4J8XD 3WA9B 3WKJC 5C3IC 4NE5A 3KWQD 3AZNB 4J8VB 1ID3A 1P3IA 1ZLAD 3KSYA 3NQUA 2BYKA 1BH9A 3KUYC 1TZYD 3O62B 3AZIB 3MGPC 4AWLB 4XUJA 4Z66D 1P3GB 1P3MA 3LZ1A 4R8PC 5B0ZD 3WKJA 1AOIC 3AZFD 5CPJC 1P3PC 5B24D 5B32A 2FJ7D 3H0MC 1A7WA 3KUYA 1P3IB 4LD9C 3NQUB 3AV2D 1R4VA 1BH9B 2BYKB 1KX5A 1JFIA 2ZY3A 3LZ0C 4XUJB 3X1TA 1P3MB 4R8PA 4WU8A 5B1MB 4YM6D 3B6FA 3WKJB 5CPJA 5C3IB 1P3PA 5GT3C 5AV6C 3LELC 1KX4C 5B32B 2DF4C 1P3KD 4YS3C 3KUYB 1PZRA 5BNXA 1KX5B 5B40D 1JFIB 3VH6A 5B31B 3VH6W 3KXBD 3X1TB 4R8PB 4WU8B 3W99A 3RELC 5GT3A 5AV6A 1KX3A 1P3PB 1M18C 3MGSC 3UT9A 5B32G 3LJAC 2NZDD 4ZUXB 2RVQD 2CV5D 4YS3A 2G5IC 1P34C 5DNMA 5BNXB 4E45A 4J8WC 5B31G 4NE3A 3W98B 3W99B 1M18A 5GT3B 5AV6B 4Z5TA 1KX3B 3LJAA 3UT9B 2PYOB 2CWEA 3A6NC 1P34A 5CP6C 3X1UA 2BG1A 4YS3B 3WAAD 2IO5C 5AV5C 5DNMB 4J8WA 3WA9D 5GXQC 4J8XB 4UPKA 1M19C 3MNNA 3AZND 4J8VD 1M18B 4Z5TB 2Y2NA 3AZID 3O62D 3LJAB 3C1BD 3A6NA 1ZLAB 3AYWC 1P34B 1P3GD 3X1UB 5AV5A 4KUDC 1T3UA 4J8WB 3UTAC 4HGAC 3B0BA 5DNNC 1M19A 5FUGA 3MNNB 2HUEC 1P3FC 1ID3D 1P3ID 4J8UC 3VH5A 5G49A 3VH5W 3MVDC 3A6NB 3AYWA 4XUJD 3AV2B 2F8NK 1P3MD 2IO5B 5AV5B 3LZ1D 3WKJD 5DNNA 5AV8C 1M19B 5FUGB 5AY8C 5GSUC 5B32D 1P3BC 1P3FA 3KUYD 5G49B 5BS7C 1KX5D 3MVDA 3REHC 3X1TD 3MGQC 4R8PD 4WJ3C 4WU8D 3AV1C 3P5JB 4HGAB 1AOID 3B6GC 2Y2PA 5CPJD 5JRGA 1P3PD 5AY8A 5GSUA 3REJC 1P3FB 3TU4C 1M1AC 2Y2OA 2Y2MA 5BS7A 5E5AC 1P3OC 3MVDB 3MGQA 5GT0C 5AVCC 5GT3D 5AV6D 1KX3D 5JRGB 3AZLA 2Y2IA 5GSUB 3UT9D 2BYMA 3B6FC 3C1BA 1M1AA 4YS3D 5E5AA 1P3OA 5DNMD 4XZQC 3UTBC 3MGQB 5AVCA 3FDDA 3X1SC 3RELD 1M18D 4Z5TD 3AZLB 3LJAD 2BYMB 5BO0A 4H9RA 5AV9A 2F8NA 4KHAA 3W96A 1P34D 3X1UD 3C1BB 1M1AB 1N1JB 5E5AB 4XZQA 3WTPC 4J8WD 3AZHC 1P3OB 1H3OA 1ULYA 2XD5A 5AVCB 3X1SA 3MNND 3AN2C 3B0CW 2XD1A 3W97C 1ID3B 4Z2MG 3A6ND 5AV9B 5BO0B 4H9RB 2UWXA 3MGPA 4KHAB 2F8NB 2FFFB 3B6FB 5AV5D 3W96B 3AZHA 4XZQB 5GXQD 4H9QA 5CHLB 1H3OB 2RIQA 3LZ1B 3C1CC 1AOIA
chains in the Genus database with same CATH topology
3X1SB 1M19D 1BH8A 3W97A 4LD9A 3AYWD 2F8NG 3MGPB 2HIOC 3LZ0A 3AZHB 4H9QB 1AOIB 5DNND 2YFVA 5CPJB 3LELA 3X1VC 1KX4A 1P3FD 1BH8B 3W97B 4LD9B 3MVDD 2HIOA 3AZMC 3LZ0B 1B67A 5BT1C 3RELA 5JRGD 2YFVB 3X1VA 5AY8D 5GSUD 3LELB 3MGSA 1HTAA 5B2JC 1KX4B 1HQ3C 3AZMA 3MGQD 3AZEC 3EG5B 3RELB 3AZLD 3X1VB 5B2JA 4Z66C 3MGSB 1HQ3A 1M1AD 1F66C 5CP6A 5E5AD 1P3OD 3V9RA 3AZFC 3AZMB 4JJNC 5GXQA 1BFMA 5AVCD 2FJ7C 2JSSA 3AZEA 2G5HC 1P3AC 5B2JB 5AV9D 2F8ND 3B6FD 3VH6T 3AZGC 4QLCC 3W96D 1HQ3B 5CP6B 3EPHA 4KUDA 4XZQD 3V9RB 4UUZA 3UTAA 5GXQB 3X1SD 4X23C 3MGRC 2ZM5A 4CSRA 5B1LC 4J8UA 4EO5C 1P3AA 3AZGA 4QLCA 3MGPD 1EQZC 2VQRA 4DRAA 3AYWB 3AZHD 4KUDB 2AROC 3UTAB 3MGRA 5AV8A 2NZDC 5DNNB 1P3BA 5B1LA 4CSRB 2HUEB 3W97D 4WV4B 4LD9D 4J8UB 1P3AB 4WNNA 3AZGB 4QLCB 3LZ0D 3REHA 4NFTA 2LY8A 2AROA 3AV1A 5CPIC 1U35C 3B6GA 4DQYB 4KGCC 4DRBA 3MGRB 5AV8B 3LELD 1KX4D 3WAAC 3REJA 5AY8B 1P3BB 5B1LB 3WA9C 3TU4A 3AZKC 4EO5B 2HIOD 3REHB 5GT0A 3AZNC 3A1KA 5CPIA 3AL0C 5BNVA 2AROB 3AV1B 5B33C 1F1EA 3AZIC 1U35A 3VH5T 3B6GB 4KGCA 4H9SC 4AWLC 3X1VD 3REIC 3IP4C 2L5AA 3MGSD 3REJB 3AZKA 5JA4A 3TU4B 3AZMD 5B2IC 5BT1D 3UTBA 5GT0B 2Y2LA 3A1IA 5B33A 5CPIB 5BNVB 3AZJC 1P3IC 4KGCB 4H9SA 2NQBC 4WZSB 3REIA 1S32C 5B2JD 4G91C 5B1MC 2JE5A 1HQ3D 3AZKB 5CP6D 5JA4B 5B2IA 3WTPA 4CAYA 5F99C 2ZY2A 5B32C 5B0YC 3UTBB 4E44A 3AZED 3AZJA 5B33B 2NQBA 3AN2A 1KX5C 1S32A 3H0RC 4WU9C 3REIB 5B31C 3X1TC 5B1MA 4WU8C 5AVBC 1KU5A 1F66D 4ZBJC 4KUDD 5F99A 3WTPB 5B2IB 4JJND 4CAYB 3UTAD 5B0YA 3C1CA 4H9NA 4ZUXC 3AFAC 2ZY5A 3AZJB 3REKC 2NQBB 3AN2B 4WU9A 1WWSA 1S32B 3R45A 5B31A 4J8UD 1P3AD 4G91B 2Y2GA 5AVBA 4QLCD 3AZGD 1P3LC 3W98C 3W99C 2J8PA 1KX3C 2Y2KA 5F99B 3UT9C 2Y2HA 2Y2JA 5B0YB 4H9NB 3F6TA 4ZUXA 5AV8D 4X23D 3AFAA 3MGRD 3C1CB 5CPKC 3REKA 1P3BD 5DNMC 1B6WA 5B1LD 4Z2MH 4WU9B 3R45B 4J8XC 1P3LA 5AVBB 1EQZD 4ZBJB 3W98A 3REHD 2HIOB 3KWQC 4G92C 3B0CT 4Z5TC 2AROD 3AV1D 2PYOA 3B6GD 1ZLAC 4M6BA 5CPKA 3AFAB 1TZYC 4H9PA 3X1UC 3REKB 3REJD 3TU4D 2F8NH 5B0ZC 4J8XA 2PYOC 1P3LB 3MNNC 3KWQA 5B24C 5GT0D 3NQJA 5CPID 1U35D 4KGCD 1ZLAA 1TZYA 3AV2C 5CPKB 4H9PB 4Z66A 3EPKA 3AZKD 5B0ZA 2JCHA 1F66A 4YM6C 3AZFA 4JJNA 5B24A 3UTBD 3KWQB 4G92B 2FJ7A 3NQJB 5B33D 1P3KC 3AZEB 3AV2A 1TZYB 4NE6A 3REID 5B40C 4Z66B 3KXBC 4YM6A 5B0ZB 1F66B 5B2ID 3WTPD 3AZFB 1WWIA 4JJNB 4UUZB 5B24B 2FJ7B 4X23A 1P3KA 3H0LC 3AZJD 2RVQC 2CV5C 2NQBD 3AN2D 1S32D 5B40A 1Q9CA 5B1MD 3KXBA 3WTPE 1EQZA 4YM6B 5JRGC 5F99D 5KDMA 4H9OA 2Y2QA 5B0YD 3C1CD 2YFWA 3B0DC 1Z2CB 1TAFA 2NZDA 4X23B 3EPLA 1P3KB 2CV5A 4WU9D 5B31D 5B40B 2F2AC 3KFUG 5AVBD 3KXBB 4WNNB 1EQZB 5KDMB 3AZLC 4J8VC 4H9OB 2YFWB 2ZY4A 4ZUXD 3AFAD 1TAFB 3O62C 3C1BC 3REKD 2NZDB 2CV5B 1P3GC 3WAAA 3WA9A 1P3LD 3W98D 3W99D 3AZNA 2W8SA 4J8VA 2DQNC 1ID3C 2PYOD 3B0DB 3AZIA 5AV9C 3O62A 5CPKD 1U35B 3W96C 1N1JA 1W2EA 4XUJC 1P3GA 3EPJA 1P3MC 3WAAB 3LZ1C 4J8XD 3WA9B 3WKJC 5C3IC 4NE5A 3KWQD 3AZNB 4J8VB 1ID3A 1P3IA 1ZLAD 3KSYA 3NQUA 2BYKA 1BH9A 3KUYC 1TZYD 3O62B 3AZIB 3MGPC 4AWLB 4XUJA 4Z66D 1P3GB 1P3MA 3LZ1A 4R8PC 5B0ZD 3WKJA 1AOIC 3AZFD 5CPJC 1P3PC 5B24D 5B32A 2FJ7D 3H0MC 1A7WA 3KUYA 1P3IB 4LD9C 3NQUB 3AV2D 1R4VA 1BH9B 2BYKB 1KX5A 1JFIA 2ZY3A 3LZ0C 4XUJB 3X1TA 1P3MB 4R8PA 4WU8A 5B1MB 4YM6D 3B6FA 3WKJB 5CPJA 5C3IB 1P3PA 5GT3C 5AV6C 3LELC 1KX4C 5B32B 2DF4C 1P3KD 4YS3C 3KUYB 1PZRA 5BNXA 1KX5B 5B40D 1JFIB 3VH6A 5B31B 3VH6W 3KXBD 3X1TB 4R8PB 4WU8B 3W99A 3RELC 5GT3A 5AV6A 1KX3A 1P3PB 1M18C 3MGSC 3UT9A 5B32G 3LJAC 2NZDD 4ZUXB 2RVQD 2CV5D 4YS3A 2G5IC 1P34C 5DNMA 5BNXB 4E45A 4J8WC 5B31G 4NE3A 3W98B 3W99B 1M18A 5GT3B 5AV6B 4Z5TA 1KX3B 3LJAA 3UT9B 2PYOB 2CWEA 3A6NC 1P34A 5CP6C 3X1UA 2BG1A 4YS3B 3WAAD 2IO5C 5AV5C 5DNMB 4J8WA 3WA9D 5GXQC 4J8XB 4UPKA 1M19C 3MNNA 3AZND 4J8VD 1M18B 4Z5TB 2Y2NA 3AZID 3O62D 3LJAB 3C1BD 3A6NA 1ZLAB 3AYWC 1P34B 1P3GD 3X1UB 5AV5A 4KUDC 1T3UA 4J8WB 3UTAC 4HGAC 3B0BA 5DNNC 1M19A 5FUGA 3MNNB 2HUEC 1P3FC 1ID3D 1P3ID 4J8UC 3VH5A 5G49A 3VH5W 3MVDC 3A6NB 3AYWA 4XUJD 3AV2B 2F8NK 1P3MD 2IO5B 5AV5B 3LZ1D 3WKJD 5DNNA 5AV8C 1M19B 5FUGB 5AY8C 5GSUC 5B32D 1P3BC 1P3FA 3KUYD 5G49B 5BS7C 1KX5D 3MVDA 3REHC 3X1TD 3MGQC 4R8PD 4WJ3C 4WU8D 3AV1C 3P5JB 4HGAB 1AOID 3B6GC 2Y2PA 5CPJD 5JRGA 1P3PD 5AY8A 5GSUA 3REJC 1P3FB 3TU4C 1M1AC 2Y2OA 2Y2MA 5BS7A 5E5AC 1P3OC 3MVDB 3MGQA 5GT0C 5AVCC 5GT3D 5AV6D 1KX3D 5JRGB 3AZLA 2Y2IA 5GSUB 3UT9D 2BYMA 3B6FC 3C1BA 1M1AA 4YS3D 5E5AA 1P3OA 5DNMD 4XZQC 3UTBC 3MGQB 5AVCA 3FDDA 3X1SC 3RELD 1M18D 4Z5TD 3AZLB 3LJAD 2BYMB 5BO0A 4H9RA 5AV9A 2F8NA 4KHAA 3W96A 1P34D 3X1UD 3C1BB 1M1AB 1N1JB 5E5AB 4XZQA 3WTPC 4J8WD 3AZHC 1P3OB 1H3OA 1ULYA 2XD5A 5AVCB 3X1SA 3MNND 3AN2C 3B0CW 2XD1A 3W97C 1ID3B 4Z2MG 3A6ND 5AV9B 5BO0B 4H9RB 2UWXA 3MGPA 4KHAB 2F8NB 2FFFB 3B6FB 5AV5D 3W96B 3AZHA 4XZQB 5GXQD 4H9QA 5CHLB 1H3OB 2RIQA 3LZ1B 3C1CC 1AOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S B;  1M19 D;  1BH8 A;  3W97 A;  4LD9 A;  3AYW D;  2F8N G;  3MGP B;  2HIO C;  3LZ0 A;  3AZH B;  4H9Q B;  1AOI B;  5DNN D;  2YFV A;  5CPJ B;  3LEL A;  3X1V C;  1KX4 A;  1P3F D;  1BH8 B;  3W97 B;  4LD9 B;  3MVD D;  2HIO A;  3AZM C;  3LZ0 B;  1B67 A;  5BT1 C;  3REL A;  5JRG D;  2YFV B;  3X1V A;  5AY8 D;  5GSU D;  3LEL B;  3MGS A;  1HTA A;  5B2J C;  1KX4 B;  1HQ3 C;  3AZM A;  3MGQ D;  3AZE C;  3REL B;  3AZL D;  3X1V B;  5B2J A;  4Z66 C;  3MGS B;  1HQ3 A;  1M1A D;  1F66 C;  5CP6 A;  5E5A D;  1P3O D;  3V9R A;  3AZF C;  3AZM B;  4JJN C;  5GXQ A;  1BFM A;  5AVC D;  2FJ7 C;  2JSS A;  3AZE A;  1P3A C;  5B2J B;  5AV9 D;  2F8N D;  3B6F D;  3VH6 T;  3AZG C;  4QLC C;  3W96 D;  1HQ3 B;  5CP6 B;  4KUD A;  4XZQ D;  3V9R B;  4UUZ A;  3UTA A;  5GXQ B;  3X1S D;  4X23 C;  3MGR C;  4CSR A;  5B1L C;  4J8U A;  4EO5 C;  1P3A A;  3AZG A;  4QLC A;  3MGP D;  1EQZ C;  4DRA A;  3AYW B;  3AZH D;  4KUD B;  2ARO C;  3UTA B;  3MGR A;  5AV8 A;  2NZD C;  5DNN B;  1P3B A;  5B1L A;  4CSR B;  2HUE B;  3W97 D;  4WV4 B;  4LD9 D;  4J8U B;  1P3A B;  4WNN A;  3AZG B;  4QLC B;  3LZ0 D;  3REH A;  4NFT A;  2LY8 A;  2ARO A;  3AV1 A;  5CPI C;  1U35 C;  3B6G A;  4KGC C;  4DRB A;  3MGR B;  5AV8 B;  3LEL D;  1KX4 D;  3WAA C;  3REJ A;  5AY8 B;  1P3B B;  5B1L B;  3WA9 C;  3TU4 A;  3AZK C;  4EO5 B;  2HIO D;  3REH B;  5GT0 A;  3AZN C;  5CPI A;  5BNV A;  2ARO B;  3AV1 B;  5B33 C;  1F1E A;  3AZI C;  1U35 A;  3VH5 T;  3B6G B;  4KGC A;  4H9S C;  4AWL C;  3X1V D;  3REI C;  3MGS D;  2L5A A;  3REJ B;  3AZK A;  5JA4 A;  3TU4 B;  3AZM D;  5B2I C;  5BT1 D;  3UTB A;  5GT0 B;  1P3I C;  5B33 A;  5CPI B;  5BNV B;  3AZJ C;  4KGC B;  4H9S A;  2NQB C;  4WZS B;  3REI A;  1S32 C;  5B2J D;  4G91 C;  5B1M C;  1HQ3 D;  3AZK B;  5CP6 D;  5JA4 B;  5B2I A;  3WTP A;  4CAY A;  5F99 C;  5B32 C;  5B0Y C;  3UTB B;  4E44 A;  3AZE D;  3AZJ A;  5B33 B;  2NQB A;  3AN2 A;  1KX5 C;  1S32 A;  4WU9 C;  3REI B;  5B31 C;  3X1T C;  5B1M A;  4WU8 C;  5AVB C;  1KU5 A;  1F66 D;  4ZBJ C;  4KUD D;  5F99 A;  3WTP B;  5B2I B;  4JJN D;  4CAY B;  3UTA D;  5B0Y A;  3C1C A;  4H9N A;  4ZUX C;  3AFA C;  3AZJ B;  3REK C;  2NQB B;  3AN2 B;  4WU9 A;  1WWS A;  1S32 B;  3R45 A;  5B31 A;  4J8U D;  1P3A D;  4G91 B;  5AVB A;  4QLC D;  3AZG D;  1P3L C;  3W98 C;  3W99 C;  1KX3 C;  5F99 B;  3UT9 C;  5B0Y B;  2PYO C;  3C1C B;  4H9N B;  4ZUX A;  4X23 D;  5AV8 D;  3AFA A;  3MGR D;  5CPK C;  3REK A;  1P3B D;  5DNM C;  1B6W A;  5B1L D;  4Z2M H;  4WU9 B;  3R45 B;  4J8X C;  1P3L A;  5AVB B;  1EQZ D;  4ZBJ B;  3W98 A;  3REH D;  2HIO B;  3KWQ C;  4G92 C;  3B0C T;  4Z5T C;  2ARO D;  3AV1 D;  2PYO A;  3B6G D;  1ZLA C;  4M6B A;  5CPK A;  3AFA B;  1TZY C;  4H9P A;  3X1U C;  3REK B;  3REJ D;  3TU4 D;  2F8N H;  5B0Z C;  4J8X A;  1P3L B;  3MNN C;  3KWQ A;  5B24 C;  5GT0 D;  3NQJ A;  5CPI D;  1U35 D;  4KGC D;  1ZLA A;  1TZY A;  3AV2 C;  5CPK B;  4H9P B;  4Z66 A;  3AZK D;  5B0Z A;  1F66 A;  4YM6 C;  3AZF A;  4JJN A;  5B24 A;  3UTB D;  3KWQ B;  4G92 B;  2FJ7 A;  3NQJ B;  5B33 D;  1P3K C;  3AZE B;  3AV2 A;  1TZY B;  4NE6 A;  3REI D;  5B40 C;  4Z66 B;  3KXB C;  4YM6 A;  5B0Z B;  1F66 B;  5B2I D;  3WTP D;  3AZF B;  1WWI A;  4JJN B;  4UUZ B;  5B24 B;  2FJ7 B;  4X23 A;  1P3K A;  3AZJ D;  2RVQ C;  2CV5 C;  2NQB D;  3AN2 D;  1S32 D;  5B40 A;  1Q9C A;  5B1M D;  3KXB A;  3WTP E;  1EQZ A;  4YM6 B;  5JRG C;  5F99 D;  5KDM A;  4H9O A;  5B0Y D;  3C1C D;  2YFW A;  3B0D C;  1TAF A;  2NZD A;  4X23 B;  1P3K B;  2CV5 A;  4WU9 D;  5B31 D;  5B40 B;  5AVB D;  3KXB B;  4WNN B;  1EQZ B;  5KDM B;  3AZL C;  4J8V C;  4H9O B;  2YFW B;  4ZUX D;  3AFA D;  1TAF B;  3O62 C;  3C1B C;  3REK D;  2NZD B;  2CV5 B;  1P3G C;  3WAA A;  3WA9 A;  1P3L D;  3W98 D;  3W99 D;  3AZN A;  4J8V A;  1ID3 C;  2PYO D;  3B0D B;  3AZI A;  5AV9 C;  3O62 A;  5CPK D;  1U35 B;  3W96 C;  1N1J A;  4XUJ C;  1P3G A;  1P3M C;  3WAA B;  3LZ1 C;  4J8X D;  3WA9 B;  3WKJ C;  5C3I C;  4NE5 A;  3KWQ D;  3AZN B;  4J8V B;  1ID3 A;  1P3I A;  1ZLA D;  3KSY A;  3NQU A;  2BYK A;  1BH9 A;  3KUY C;  1TZY D;  3O62 B;  3AZI B;  3MGP C;  4AWL B;  4XUJ A;  4Z66 D;  1P3G B;  1P3M A;  3LZ1 A;  4R8P C;  5B0Z D;  3WKJ A;  1AOI C;  3AZF D;  5CPJ C;  1P3P C;  5B24 D;  5B32 A;  2FJ7 D;  1A7W A;  3KUY A;  1P3I B;  4LD9 C;  3NQU B;  3AV2 D;  1R4V A;  1BH9 B;  2BYK B;  1KX5 A;  1JFI A;  3LZ0 C;  4XUJ B;  3X1T A;  1P3M B;  4R8P A;  4WU8 A;  5B1M B;  4YM6 D;  3B6F A;  3WKJ B;  5CPJ A;  5C3I B;  1P3P A;  5GT3 C;  5AV6 C;  3LEL C;  1KX4 C;  5B32 B;  1P3K D;  4YS3 C;  3KUY B;  5BNX A;  1KX5 B;  5B40 D;  1JFI B;  3VH6 A;  5B31 B;  3VH6 W;  3KXB D;  3X1T B;  4R8P B;  4WU8 B;  3W99 A;  3REL C;  5GT3 A;  5AV6 A;  1KX3 A;  1P3P B;  1M18 C;  3MGS C;  3UT9 A;  5B32 G;  3LJA C;  2NZD D;  4ZUX B;  2RVQ D;  2CV5 D;  4YS3 A;  1P34 C;  5DNM A;  5BNX B;  4E45 A;  4J8W C;  5B31 G;  4NE3 A;  3W98 B;  3W99 B;  1M18 A;  5GT3 B;  5AV6 B;  4Z5T A;  1KX3 B;  3LJA A;  3UT9 B;  2PYO B;  2CWE A;  3A6N C;  1P34 A;  5CP6 C;  3X1U A;  4YS3 B;  3WAA D;  2IO5 C;  5AV5 C;  5DNM B;  4J8W A;  3WA9 D;  5GXQ C;  4J8X B;  1M19 C;  3MNN A;  3AZN D;  4J8V D;  1M18 B;  4Z5T B;  3AZI D;  3O62 D;  3LJA B;  3C1B D;  3A6N A;  1ZLA B;  3AYW C;  1P34 B;  1P3G D;  3X1U B;  5AV5 A;  4KUD C;  4J8W B;  3UTA C;  4HGA C;  3B0B A;  5DNN C;  1M19 A;  5FUG A;  3MNN B;  2HUE C;  1P3F C;  1ID3 D;  1P3I D;  4J8U C;  3VH5 A;  5G49 A;  3VH5 W;  3MVD C;  3A6N B;  3AYW A;  4XUJ D;  3AV2 B;  2F8N K;  1P3M D;  2IO5 B;  5AV5 B;  3LZ1 D;  3WKJ D;  5DNN A;  5AV8 C;  1M19 B;  5FUG B;  5AY8 C;  5GSU C;  5B32 D;  1P3B C;  1P3F A;  3KUY D;  5G49 B;  5BS7 C;  1KX5 D;  3MVD A;  3REH C;  3X1T D;  3MGQ C;  4R8P D;  4WU8 D;  3AV1 C;  4HGA B;  1AOI D;  3B6G C;  5CPJ D;  5JRG A;  1P3P D;  5AY8 A;  5GSU A;  3REJ C;  1P3F B;  3TU4 C;  1M1A C;  5BS7 A;  5E5A C;  1P3O C;  3MVD B;  3MGQ A;  5GT0 C;  5AVC C;  5GT3 D;  5AV6 D;  1KX3 D;  5JRG B;  3AZL A;  5GSU B;  3UT9 D;  2BYM A;  3B6F C;  3C1B A;  1M1A A;  4YS3 D;  5E5A A;  1P3O A;  5DNM D;  4XZQ C;  3UTB C;  3MGQ B;  5AVC A;  3X1S C;  3REL D;  1M18 D;  4Z5T D;  3AZL B;  3LJA D;  5AV9 A;  2BYM B;  4H9R A;  5BO0 A;  2F8N A;  4KHA A;  3W96 A;  1P34 D;  3X1U D;  3C1B B;  1M1A B;  1N1J B;  5E5A B;  4XZQ A;  3WTP C;  4J8W D;  3AZH C;  1P3O B;  1H3O A;  1ULY A;  5AVC B;  3X1S A;  3MNN D;  3AN2 C;  3B0C W;  3W97 C;  1ID3 B;  4Z2M G;  3A6N D;  5AV9 B;  5BO0 B;  4H9R B;  3MGP A;  2F8N B;  4KHA B;  3B6F B;  3W96 B;  5AV5 D;  3AZH A;  4XZQ B;  5GXQ D;  4H9Q A;  5CHL B;  1H3O B;  3LZ1 B;  3C1C C;  1AOI A; 
#chains in the Genus database with same CATH topology
 3X1S B;  1M19 D;  1BH8 A;  3W97 A;  4LD9 A;  3AYW D;  2F8N G;  3MGP B;  2HIO C;  3LZ0 A;  3AZH B;  4H9Q B;  1AOI B;  5DNN D;  2YFV A;  5CPJ B;  3LEL A;  3X1V C;  1KX4 A;  1P3F D;  1BH8 B;  3W97 B;  4LD9 B;  3MVD D;  2HIO A;  3AZM C;  3LZ0 B;  1B67 A;  5BT1 C;  3REL A;  5JRG D;  2YFV B;  3X1V A;  5AY8 D;  5GSU D;  3LEL B;  3MGS A;  1HTA A;  5B2J C;  1KX4 B;  1HQ3 C;  3AZM A;  3MGQ D;  3AZE C;  3EG5 B;  3REL B;  3AZL D;  3X1V B;  5B2J A;  4Z66 C;  3MGS B;  1HQ3 A;  1M1A D;  1F66 C;  5CP6 A;  5E5A D;  1P3O D;  3V9R A;  3AZF C;  3AZM B;  4JJN C;  5GXQ A;  1BFM A;  5AVC D;  2FJ7 C;  2JSS A;  3AZE A;  2G5H C;  1P3A C;  5B2J B;  5AV9 D;  2F8N D;  3B6F D;  3VH6 T;  3AZG C;  4QLC C;  3W96 D;  1HQ3 B;  5CP6 B;  3EPH A;  4KUD A;  4XZQ D;  3V9R B;  4UUZ A;  3UTA A;  5GXQ B;  3X1S D;  4X23 C;  3MGR C;  2ZM5 A;  4CSR A;  5B1L C;  4J8U A;  4EO5 C;  1P3A A;  3AZG A;  4QLC A;  3MGP D;  1EQZ C;  2VQR A;  4DRA A;  3AYW B;  3AZH D;  4KUD B;  2ARO C;  3UTA B;  3MGR A;  5AV8 A;  2NZD C;  5DNN B;  1P3B A;  5B1L A;  4CSR B;  2HUE B;  3W97 D;  4WV4 B;  4LD9 D;  4J8U B;  1P3A B;  4WNN A;  3AZG B;  4QLC B;  3LZ0 D;  3REH A;  4NFT A;  2LY8 A;  2ARO A;  3AV1 A;  5CPI C;  1U35 C;  3B6G A;  4DQY B;  4KGC C;  4DRB A;  3MGR B;  5AV8 B;  3LEL D;  1KX4 D;  3WAA C;  3REJ A;  5AY8 B;  1P3B B;  5B1L B;  3WA9 C;  3TU4 A;  3AZK C;  4EO5 B;  2HIO D;  3REH B;  5GT0 A;  3AZN C;  3A1K A;  5CPI A;  3AL0 C;  5BNV A;  2ARO B;  3AV1 B;  5B33 C;  1F1E A;  3AZI C;  1U35 A;  3VH5 T;  3B6G B;  4KGC A;  4H9S C;  4AWL C;  3X1V D;  3REI C;  3IP4 C;  2L5A A;  3MGS D;  3REJ B;  3AZK A;  5JA4 A;  3TU4 B;  3AZM D;  5B2I C;  5BT1 D;  3UTB A;  5GT0 B;  2Y2L A;  3A1I A;  5B33 A;  5CPI B;  5BNV B;  3AZJ C;  1P3I C;  4KGC B;  4H9S A;  2NQB C;  4WZS B;  3REI A;  1S32 C;  5B2J D;  4G91 C;  5B1M C;  2JE5 A;  1HQ3 D;  3AZK B;  5CP6 D;  5JA4 B;  5B2I A;  3WTP A;  4CAY A;  5F99 C;  2ZY2 A;  5B32 C;  5B0Y C;  3UTB B;  4E44 A;  3AZE D;  3AZJ A;  5B33 B;  2NQB A;  3AN2 A;  1KX5 C;  1S32 A;  3H0R C;  4WU9 C;  3REI B;  5B31 C;  3X1T C;  5B1M A;  4WU8 C;  5AVB C;  1KU5 A;  1F66 D;  4ZBJ C;  4KUD D;  5F99 A;  3WTP B;  5B2I B;  4JJN D;  4CAY B;  3UTA D;  5B0Y A;  3C1C A;  4H9N A;  4ZUX C;  3AFA C;  2ZY5 A;  3AZJ B;  3REK C;  2NQB B;  3AN2 B;  4WU9 A;  1WWS A;  1S32 B;  3R45 A;  5B31 A;  4J8U D;  1P3A D;  4G91 B;  2Y2G A;  5AVB A;  4QLC D;  3AZG D;  1P3L C;  3W98 C;  3W99 C;  2J8P A;  1KX3 C;  2Y2K A;  5F99 B;  3UT9 C;  2Y2H A;  2Y2J A;  5B0Y B;  4H9N B;  3F6T A;  4ZUX A;  5AV8 D;  4X23 D;  3AFA A;  3MGR D;  3C1C B;  5CPK C;  3REK A;  1P3B D;  5DNM C;  1B6W A;  5B1L D;  4Z2M H;  4WU9 B;  3R45 B;  4J8X C;  1P3L A;  5AVB B;  1EQZ D;  4ZBJ B;  3W98 A;  3REH D;  2HIO B;  3KWQ C;  4G92 C;  3B0C T;  4Z5T C;  2ARO D;  3AV1 D;  2PYO A;  3B6G D;  1ZLA C;  4M6B A;  5CPK A;  3AFA B;  1TZY C;  4H9P A;  3X1U C;  3REK B;  3REJ D;  3TU4 D;  2F8N H;  5B0Z C;  4J8X A;  2PYO C;  1P3L B;  3MNN C;  3KWQ A;  5B24 C;  5GT0 D;  3NQJ A;  5CPI D;  1U35 D;  4KGC D;  1ZLA A;  1TZY A;  3AV2 C;  5CPK B;  4H9P B;  4Z66 A;  3EPK A;  3AZK D;  5B0Z A;  2JCH A;  1F66 A;  4YM6 C;  3AZF A;  4JJN A;  5B24 A;  3UTB D;  3KWQ B;  4G92 B;  2FJ7 A;  3NQJ B;  5B33 D;  1P3K C;  3AZE B;  3AV2 A;  1TZY B;  4NE6 A;  3REI D;  5B40 C;  4Z66 B;  3KXB C;  4YM6 A;  5B0Z B;  1F66 B;  5B2I D;  3WTP D;  3AZF B;  1WWI A;  4JJN B;  4UUZ B;  5B24 B;  2FJ7 B;  4X23 A;  1P3K A;  3H0L C;  3AZJ D;  2RVQ C;  2CV5 C;  2NQB D;  3AN2 D;  1S32 D;  5B40 A;  1Q9C A;  5B1M D;  3KXB A;  3WTP E;  1EQZ A;  4YM6 B;  5JRG C;  5F99 D;  5KDM A;  4H9O A;  2Y2Q A;  5B0Y D;  3C1C D;  2YFW A;  3B0D C;  1Z2C B;  1TAF A;  2NZD A;  4X23 B;  3EPL A;  1P3K B;  2CV5 A;  4WU9 D;  5B31 D;  5B40 B;  2F2A C;  3KFU G;  5AVB D;  3KXB B;  4WNN B;  1EQZ B;  5KDM B;  3AZL C;  4J8V C;  4H9O B;  2YFW B;  2ZY4 A;  4ZUX D;  3AFA D;  1TAF B;  3O62 C;  3C1B C;  3REK D;  2NZD B;  2CV5 B;  1P3G C;  3WAA A;  3WA9 A;  1P3L D;  3W98 D;  3W99 D;  3AZN A;  2W8S A;  4J8V A;  2DQN C;  1ID3 C;  2PYO D;  3B0D B;  3AZI A;  5AV9 C;  3O62 A;  5CPK D;  1U35 B;  3W96 C;  1N1J A;  1W2E A;  4XUJ C;  1P3G A;  3EPJ A;  1P3M C;  3WAA B;  3LZ1 C;  4J8X D;  3WA9 B;  3WKJ C;  5C3I C;  4NE5 A;  3KWQ D;  3AZN B;  4J8V B;  1ID3 A;  1P3I A;  1ZLA D;  3KSY A;  3NQU A;  2BYK A;  1BH9 A;  3KUY C;  1TZY D;  3O62 B;  3AZI B;  3MGP C;  4AWL B;  4XUJ A;  4Z66 D;  1P3G B;  1P3M A;  3LZ1 A;  4R8P C;  5B0Z D;  3WKJ A;  1AOI C;  3AZF D;  5CPJ C;  1P3P C;  5B24 D;  5B32 A;  2FJ7 D;  3H0M C;  1A7W A;  3KUY A;  1P3I B;  4LD9 C;  3NQU B;  3AV2 D;  1R4V A;  1BH9 B;  2BYK B;  1KX5 A;  1JFI A;  2ZY3 A;  3LZ0 C;  4XUJ B;  3X1T A;  1P3M B;  4R8P A;  4WU8 A;  5B1M B;  4YM6 D;  3B6F A;  3WKJ B;  5CPJ A;  5C3I B;  1P3P A;  5GT3 C;  5AV6 C;  3LEL C;  1KX4 C;  5B32 B;  2DF4 C;  1P3K D;  4YS3 C;  3KUY B;  1PZR A;  5BNX A;  1KX5 B;  5B40 D;  1JFI B;  3VH6 A;  5B31 B;  3VH6 W;  3KXB D;  3X1T B;  4R8P B;  4WU8 B;  3W99 A;  3REL C;  5GT3 A;  5AV6 A;  1KX3 A;  1P3P B;  1M18 C;  3MGS C;  3UT9 A;  5B32 G;  3LJA C;  2NZD D;  4ZUX B;  2RVQ D;  2CV5 D;  4YS3 A;  2G5I C;  1P34 C;  5DNM A;  5BNX B;  4E45 A;  4J8W C;  5B31 G;  4NE3 A;  3W98 B;  3W99 B;  1M18 A;  5GT3 B;  5AV6 B;  4Z5T A;  1KX3 B;  3LJA A;  3UT9 B;  2PYO B;  2CWE A;  3A6N C;  1P34 A;  5CP6 C;  3X1U A;  2BG1 A;  4YS3 B;  3WAA D;  2IO5 C;  5AV5 C;  5DNM B;  4J8W A;  3WA9 D;  5GXQ C;  4J8X B;  4UPK A;  1M19 C;  3MNN A;  3AZN D;  4J8V D;  1M18 B;  4Z5T B;  2Y2N A;  3AZI D;  3O62 D;  3LJA B;  3C1B D;  3A6N A;  1ZLA B;  3AYW C;  1P34 B;  1P3G D;  3X1U B;  5AV5 A;  4KUD C;  1T3U A;  4J8W B;  3UTA C;  4HGA C;  3B0B A;  5DNN C;  1M19 A;  5FUG A;  3MNN B;  2HUE C;  1P3F C;  1ID3 D;  1P3I D;  4J8U C;  3VH5 A;  5G49 A;  3VH5 W;  3MVD C;  3A6N B;  3AYW A;  4XUJ D;  3AV2 B;  2F8N K;  1P3M D;  2IO5 B;  5AV5 B;  3LZ1 D;  3WKJ D;  5DNN A;  5AV8 C;  1M19 B;  5FUG B;  5AY8 C;  5GSU C;  5B32 D;  1P3B C;  1P3F A;  3KUY D;  5G49 B;  5BS7 C;  1KX5 D;  3MVD A;  3REH C;  3X1T D;  3MGQ C;  4R8P D;  4WJ3 C;  4WU8 D;  3AV1 C;  3P5J B;  4HGA B;  1AOI D;  3B6G C;  2Y2P A;  5CPJ D;  5JRG A;  1P3P D;  5AY8 A;  5GSU A;  3REJ C;  1P3F B;  3TU4 C;  1M1A C;  2Y2O A;  2Y2M A;  5BS7 A;  5E5A C;  1P3O C;  3MVD B;  3MGQ A;  5GT0 C;  5AVC C;  5GT3 D;  5AV6 D;  1KX3 D;  5JRG B;  3AZL A;  2Y2I A;  5GSU B;  3UT9 D;  2BYM A;  3B6F C;  3C1B A;  1M1A A;  4YS3 D;  5E5A A;  1P3O A;  5DNM D;  4XZQ C;  3UTB C;  3MGQ B;  5AVC A;  3FDD A;  3X1S C;  3REL D;  1M18 D;  4Z5T D;  3AZL B;  3LJA D;  2BYM B;  5BO0 A;  4H9R A;  5AV9 A;  2F8N A;  4KHA A;  3W96 A;  1P34 D;  3X1U D;  3C1B B;  1M1A B;  1N1J B;  5E5A B;  4XZQ A;  3WTP C;  4J8W D;  3AZH C;  1P3O B;  1H3O A;  1ULY A;  2XD5 A;  5AVC B;  3X1S A;  3MNN D;  3AN2 C;  3B0C W;  2XD1 A;  3W97 C;  1ID3 B;  4Z2M G;  3A6N D;  5AV9 B;  5BO0 B;  4H9R B;  2UWX A;  3MGP A;  4KHA B;  2F8N B;  2FFF B;  3B6F B;  5AV5 D;  3W96 B;  3AZH A;  4XZQ B;  5GXQ D;  4H9Q A;  5CHL B;  1H3O B;  2RIQ A;  3LZ1 B;  3C1C C;  1AOI A; 
#chains in the Genus database with same CATH homology
 3X1S B;  1M19 D;  1BH8 A;  3W97 A;  4LD9 A;  3AYW D;  2F8N G;  3MGP B;  2HIO C;  3LZ0 A;  3AZH B;  4H9Q B;  1AOI B;  5DNN D;  2YFV A;  5CPJ B;  3LEL A;  3X1V C;  1KX4 A;  1P3F D;  1BH8 B;  3W97 B;  4LD9 B;  3MVD D;  2HIO A;  3AZM C;  3LZ0 B;  1B67 A;  5BT1 C;  3REL A;  5JRG D;  2YFV B;  3X1V A;  5AY8 D;  5GSU D;  3LEL B;  3MGS A;  1HTA A;  5B2J C;  1KX4 B;  1HQ3 C;  3AZM A;  3MGQ D;  3AZE C;  3EG5 B;  3REL B;  3AZL D;  3X1V B;  5B2J A;  4Z66 C;  3MGS B;  1HQ3 A;  1M1A D;  1F66 C;  5CP6 A;  5E5A D;  1P3O D;  3V9R A;  3AZF C;  3AZM B;  4JJN C;  5GXQ A;  1BFM A;  5AVC D;  2FJ7 C;  2JSS A;  3AZE A;  2G5H C;  1P3A C;  5B2J B;  5AV9 D;  2F8N D;  3B6F D;  3VH6 T;  3AZG C;  4QLC C;  3W96 D;  1HQ3 B;  5CP6 B;  3EPH A;  4KUD A;  4XZQ D;  3V9R B;  4UUZ A;  3UTA A;  5GXQ B;  3X1S D;  4X23 C;  3MGR C;  2ZM5 A;  4CSR A;  5B1L C;  4J8U A;  4EO5 C;  1P3A A;  3AZG A;  4QLC A;  3MGP D;  1EQZ C;  2VQR A;  4DRA A;  3AYW B;  3AZH D;  4KUD B;  2ARO C;  3UTA B;  3MGR A;  5AV8 A;  2NZD C;  5DNN B;  1P3B A;  5B1L A;  4CSR B;  2HUE B;  3W97 D;  4WV4 B;  4LD9 D;  4J8U B;  1P3A B;  4WNN A;  3AZG B;  4QLC B;  3LZ0 D;  3REH A;  4NFT A;  2LY8 A;  2ARO A;  3AV1 A;  5CPI C;  1U35 C;  3B6G A;  4DQY B;  4KGC C;  4DRB A;  3MGR B;  5AV8 B;  3LEL D;  1KX4 D;  3WAA C;  3REJ A;  5AY8 B;  1P3B B;  5B1L B;  3WA9 C;  3TU4 A;  3AZK C;  4EO5 B;  2HIO D;  3REH B;  5GT0 A;  3AZN C;  3A1K A;  5CPI A;  3AL0 C;  5BNV A;  2ARO B;  3AV1 B;  5B33 C;  1F1E A;  3AZI C;  1U35 A;  3VH5 T;  3B6G B;  4KGC A;  4H9S C;  4AWL C;  3X1V D;  3REI C;  3IP4 C;  2L5A A;  3MGS D;  3REJ B;  3AZK A;  5JA4 A;  3TU4 B;  3AZM D;  5B2I C;  5BT1 D;  3UTB A;  5GT0 B;  2Y2L A;  3A1I A;  5B33 A;  5CPI B;  5BNV B;  3AZJ C;  1P3I C;  4KGC B;  4H9S A;  2NQB C;  4WZS B;  3REI A;  1S32 C;  5B2J D;  4G91 C;  5B1M C;  2JE5 A;  1HQ3 D;  3AZK B;  5CP6 D;  5JA4 B;  5B2I A;  3WTP A;  4CAY A;  5F99 C;  2ZY2 A;  5B32 C;  5B0Y C;  3UTB B;  4E44 A;  3AZE D;  3AZJ A;  5B33 B;  2NQB A;  3AN2 A;  1KX5 C;  1S32 A;  3H0R C;  4WU9 C;  3REI B;  5B31 C;  3X1T C;  5B1M A;  4WU8 C;  5AVB C;  1KU5 A;  1F66 D;  4ZBJ C;  4KUD D;  5F99 A;  3WTP B;  5B2I B;  4JJN D;  4CAY B;  3UTA D;  5B0Y A;  3C1C A;  4H9N A;  4ZUX C;  3AFA C;  2ZY5 A;  3AZJ B;  3REK C;  2NQB B;  3AN2 B;  4WU9 A;  1WWS A;  1S32 B;  3R45 A;  5B31 A;  4J8U D;  1P3A D;  4G91 B;  2Y2G A;  5AVB A;  4QLC D;  3AZG D;  1P3L C;  3W98 C;  3W99 C;  2J8P A;  1KX3 C;  2Y2K A;  5F99 B;  3UT9 C;  2Y2H A;  2Y2J A;  5B0Y B;  4H9N B;  3F6T A;  4ZUX A;  5AV8 D;  4X23 D;  3AFA A;  3MGR D;  3C1C B;  5CPK C;  3REK A;  1P3B D;  5DNM C;  1B6W A;  5B1L D;  4Z2M H;  4WU9 B;  3R45 B;  4J8X C;  1P3L A;  5AVB B;  1EQZ D;  4ZBJ B;  3W98 A;  3REH D;  2HIO B;  3KWQ C;  4G92 C;  3B0C T;  4Z5T C;  2ARO D;  3AV1 D;  2PYO A;  3B6G D;  1ZLA C;  4M6B A;  5CPK A;  3AFA B;  1TZY C;  4H9P A;  3X1U C;  3REK B;  3REJ D;  3TU4 D;  2F8N H;  5B0Z C;  4J8X A;  2PYO C;  1P3L B;  3MNN C;  3KWQ A;  5B24 C;  5GT0 D;  3NQJ A;  5CPI D;  1U35 D;  4KGC D;  1ZLA A;  1TZY A;  3AV2 C;  5CPK B;  4H9P B;  4Z66 A;  3EPK A;  3AZK D;  5B0Z A;  2JCH A;  1F66 A;  4YM6 C;  3AZF A;  4JJN A;  5B24 A;  3UTB D;  3KWQ B;  4G92 B;  2FJ7 A;  3NQJ B;  5B33 D;  1P3K C;  3AZE B;  3AV2 A;  1TZY B;  4NE6 A;  3REI D;  5B40 C;  4Z66 B;  3KXB C;  4YM6 A;  5B0Z B;  1F66 B;  5B2I D;  3WTP D;  3AZF B;  1WWI A;  4JJN B;  4UUZ B;  5B24 B;  2FJ7 B;  4X23 A;  1P3K A;  3H0L C;  3AZJ D;  2RVQ C;  2CV5 C;  2NQB D;  3AN2 D;  1S32 D;  5B40 A;  1Q9C A;  5B1M D;  3KXB A;  3WTP E;  1EQZ A;  4YM6 B;  5JRG C;  5F99 D;  5KDM A;  4H9O A;  2Y2Q A;  5B0Y D;  3C1C D;  2YFW A;  3B0D C;  1Z2C B;  1TAF A;  2NZD A;  4X23 B;  3EPL A;  1P3K B;  2CV5 A;  4WU9 D;  5B31 D;  5B40 B;  2F2A C;  3KFU G;  5AVB D;  3KXB B;  4WNN B;  1EQZ B;  5KDM B;  3AZL C;  4J8V C;  4H9O B;  2YFW B;  2ZY4 A;  4ZUX D;  3AFA D;  1TAF B;  3O62 C;  3C1B C;  3REK D;  2NZD B;  2CV5 B;  1P3G C;  3WAA A;  3WA9 A;  1P3L D;  3W98 D;  3W99 D;  3AZN A;  2W8S A;  4J8V A;  2DQN C;  1ID3 C;  2PYO D;  3B0D B;  3AZI A;  5AV9 C;  3O62 A;  5CPK D;  1U35 B;  3W96 C;  1N1J A;  1W2E A;  4XUJ C;  1P3G A;  3EPJ A;  1P3M C;  3WAA B;  3LZ1 C;  4J8X D;  3WA9 B;  3WKJ C;  5C3I C;  4NE5 A;  3KWQ D;  3AZN B;  4J8V B;  1ID3 A;  1P3I A;  1ZLA D;  3KSY A;  3NQU A;  2BYK A;  1BH9 A;  3KUY C;  1TZY D;  3O62 B;  3AZI B;  3MGP C;  4AWL B;  4XUJ A;  4Z66 D;  1P3G B;  1P3M A;  3LZ1 A;  4R8P C;  5B0Z D;  3WKJ A;  1AOI C;  3AZF D;  5CPJ C;  1P3P C;  5B24 D;  5B32 A;  2FJ7 D;  3H0M C;  1A7W A;  3KUY A;  1P3I B;  4LD9 C;  3NQU B;  3AV2 D;  1R4V A;  1BH9 B;  2BYK B;  1KX5 A;  1JFI A;  2ZY3 A;  3LZ0 C;  4XUJ B;  3X1T A;  1P3M B;  4R8P A;  4WU8 A;  5B1M B;  4YM6 D;  3B6F A;  3WKJ B;  5CPJ A;  5C3I B;  1P3P A;  5GT3 C;  5AV6 C;  3LEL C;  1KX4 C;  5B32 B;  2DF4 C;  1P3K D;  4YS3 C;  3KUY B;  1PZR A;  5BNX A;  1KX5 B;  5B40 D;  1JFI B;  3VH6 A;  5B31 B;  3VH6 W;  3KXB D;  3X1T B;  4R8P B;  4WU8 B;  3W99 A;  3REL C;  5GT3 A;  5AV6 A;  1KX3 A;  1P3P B;  1M18 C;  3MGS C;  3UT9 A;  5B32 G;  3LJA C;  2NZD D;  4ZUX B;  2RVQ D;  2CV5 D;  4YS3 A;  2G5I C;  1P34 C;  5DNM A;  5BNX B;  4E45 A;  4J8W C;  5B31 G;  4NE3 A;  3W98 B;  3W99 B;  1M18 A;  5GT3 B;  5AV6 B;  4Z5T A;  1KX3 B;  3LJA A;  3UT9 B;  2PYO B;  2CWE A;  3A6N C;  1P34 A;  5CP6 C;  3X1U A;  2BG1 A;  4YS3 B;  3WAA D;  2IO5 C;  5AV5 C;  5DNM B;  4J8W A;  3WA9 D;  5GXQ C;  4J8X B;  4UPK A;  1M19 C;  3MNN A;  3AZN D;  4J8V D;  1M18 B;  4Z5T B;  2Y2N A;  3AZI D;  3O62 D;  3LJA B;  3C1B D;  3A6N A;  1ZLA B;  3AYW C;  1P34 B;  1P3G D;  3X1U B;  5AV5 A;  4KUD C;  1T3U A;  4J8W B;  3UTA C;  4HGA C;  3B0B A;  5DNN C;  1M19 A;  5FUG A;  3MNN B;  2HUE C;  1P3F C;  1ID3 D;  1P3I D;  4J8U C;  3VH5 A;  5G49 A;  3VH5 W;  3MVD C;  3A6N B;  3AYW A;  4XUJ D;  3AV2 B;  2F8N K;  1P3M D;  2IO5 B;  5AV5 B;  3LZ1 D;  3WKJ D;  5DNN A;  5AV8 C;  1M19 B;  5FUG B;  5AY8 C;  5GSU C;  5B32 D;  1P3B C;  1P3F A;  3KUY D;  5G49 B;  5BS7 C;  1KX5 D;  3MVD A;  3REH C;  3X1T D;  3MGQ C;  4R8P D;  4WJ3 C;  4WU8 D;  3AV1 C;  3P5J B;  4HGA B;  1AOI D;  3B6G C;  2Y2P A;  5CPJ D;  5JRG A;  1P3P D;  5AY8 A;  5GSU A;  3REJ C;  1P3F B;  3TU4 C;  1M1A C;  2Y2O A;  2Y2M A;  5BS7 A;  5E5A C;  1P3O C;  3MVD B;  3MGQ A;  5GT0 C;  5AVC C;  5GT3 D;  5AV6 D;  1KX3 D;  5JRG B;  3AZL A;  2Y2I A;  5GSU B;  3UT9 D;  2BYM A;  3B6F C;  3C1B A;  1M1A A;  4YS3 D;  5E5A A;  1P3O A;  5DNM D;  4XZQ C;  3UTB C;  3MGQ B;  5AVC A;  3FDD A;  3X1S C;  3REL D;  1M18 D;  4Z5T D;  3AZL B;  3LJA D;  2BYM B;  5BO0 A;  4H9R A;  5AV9 A;  2F8N A;  4KHA A;  3W96 A;  1P34 D;  3X1U D;  3C1B B;  1M1A B;  1N1J B;  5E5A B;  4XZQ A;  3WTP C;  4J8W D;  3AZH C;  1P3O B;  1H3O A;  1ULY A;  2XD5 A;  5AVC B;  3X1S A;  3MNN D;  3AN2 C;  3B0C W;  2XD1 A;  3W97 C;  1ID3 B;  4Z2M G;  3A6N D;  5AV9 B;  5BO0 B;  4H9R B;  2UWX A;  3MGP A;  4KHA B;  2F8N B;  2FFF B;  3B6F B;  5AV5 D;  3W96 B;  3AZH A;  4XZQ B;  5GXQ D;  4H9Q A;  5CHL B;  1H3O B;  2RIQ A;  3LZ1 B;  3C1C C;  1AOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...