1WWSA

Crystal structure of ttk003001566 from thermus thermophilus hb8
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
148
structure length
148
Chain Sequence
MLMKVAEFERLFRQAAGLDVDKNDLKRVSDFLRNKLYDLLAVAERNAKYNGRDLIFEPDLPIAKGLQETLQEFRRMDTALELKPVLDALAALPPLDLEVAEDVRNLLPELAGALVVAYARVLKELDPALKNPQTEHHERAERVFNLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ttk003001566 from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA1479
total genus 54
structure length 148
sequence length 148
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09123 DUF1931 Domain of unknown function (DUF1931)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1wwsA00
3LZ1C 3MVDB 3REHC 3MGPC 4EO5B 3O62D 3W99B 4H9PB 4J8WC 3X1UD 4LD9D 5B33C 5FUGA 4WU9A 3AV2B 3MGSB 5AVBC 5JRGC 4J8XA 3W98B 5AY8A 5E5AA 1P3IB 2YFVB 1P3BC 1M18C 5GSUA 3AYWD 2RVQC 3B6GB 1KX3A 1EQZA 5BT1D 5DNMC 3NQUB 4AWLC 5B33B 5E5AB 3W97B 3C1BC 3W98A 3MNNC 2NQBA 2HUEB 3X1TB 5BNVA 1B67A 5B1MB 1P3GB 5B1LB 5BS7A 3MGQD 3A6NA 3UT9D 2CV5A 3AZNA 3B6GC 5B33A 5CPIB 3REID 1P3AB 5CP6A 1ID3B 2NZDB 5JRGA 5BNVB 4AWLB 4Z2MH 2F8NG 3B6GD 3AZKA 4LD9B 2FJ7C 5GSUC 4YM6A 3AN2D 3AZEC 2F8NA 4X23B 5GT0A 3WAAA 4G92C 1F66B 3V9RA 3B6FC 5B40C 1M19A 2PYOA 5B32C 3A6ND 3B0BA 3X1VC 3W99A 3REJC 3KUYD 5DNMD 1KX5D 3A6NC 1P3AD 4WU8A 1ID3D 2F8NH 2NZDD 4Z2MG 4DRAA 5B0YB 5GT0D 4H9QB 4X23C 1P3OB 3AN2B 4Z5TD 1M18D 3AZMA 4NE6A 4NFTA 3VH5W 1S32D 3AZJD 3LZ0D 4CAYB 5AV6C 3AV1A 3AZEA 3LZ1B 4H9QA 5DNNA 2AROD 5GXQD 1P3IA 4J8VC 1P3GA 5B2JD 4EO5C 4J8UC 2HIOB 5AV5D 3WA9C 3LJAB 4G91C 1EQZB 5B32G 5B40D 3REIC 2HIOD 3LZ1A 3AV2D 3WKJD 3X1VD 2NQBD 1M18B 3WA9A 5B0ZC 5CPJD 2CWEA 2F8NB 3LZ1D 2HIOA 3AZGC 1P34A 3W97C 5AV5A 5DNNB 2HUEC 5C3IC 3AZLC 5AV8B 5F99A 4JJNC 3AV1D 5AVCB 2CV5B 1KX4B 4NE5A 5DNND 3O62A 1P3KC 1ULYA 5BNXA 4Z66B 3AZKB 1P3BD 4LD9A 3B0DB 5F99C 5B1MA 5CPIC 4YM6D 3AZGB 3AN2A 1TZYA 3B0CT 1P3AC 1ID3C 2NZDC 5KDMA 2L5AA 4CSRB 4J8WA 4Z5TA 4YM6B 4M6BA 1KX4A 4XZQA 3AZMD 5B0ZA 4ZUXC 3RELB 2CV5C 3LZ0B 3UTBA 1P3KB 5GT3D 3LELA 3C1CA 1ZLAA 2LY8A 3REKC 3UT9C 3X1TA 2AROC 4H9NB 5B0ZD 1HQ3C 5B32B 4XUJA 3W99D 5JA4B 3KWQB 3MGQC 2F8NK 3WAAD 3AZGD 4YS3C 3AZKD 3KSYA 1BH9B 3REKD 5AY8C 3KUYB 5KDMB 3UTBD 3MGRC 1BH8B 5CP6B 5B0YC 1P3BA 1P3OC 3WKJB 3AN2C 1WWSA 5GSUD 3AYWA 3WTPB 1AOIC 1F66D 4KGCA 5AVBB 5CPKB 3B6FD 3AFAB 5F99D 5B0YA 1P3OA 5B33D 1P3FC 4KUDD 4R8PC 3TU4B 3KXBC 3NQJB 1M1AA 4KGCC 5AVCA 3KUYC 1P3LC 1ZLAC 1P3PD 3AZMC 1KX5C 4J8UB 5E5AC 1JFIA 5B24D 1AOIB 1P3LA 5CPKC 5B40A 1M19C 5G49A 4Z5TB 1P3FB 5B24A 4R8PB 3TU4C 3REJA 4HGAB 5AV6D 5AV9B 3AZIC 3AZJC 3AZFC 3AV2A 3B0CW 1JFIB 5FUGB 3C1CB 1AOIA 4J8XD 4WU8C 1TAFB 5CPJB 5B2JC 5BNXB 3MGRD 3R45A 2IO5C 5B31B 3AZIA 3B6FA 5C3IB 3AZLB 2FJ7B 3MGPA 5B24B 4WU9D 4JJNB 1AOID 3AZNC 3C1BD 5B2JA 2BYKA 3X1UA 5AV5B 5AV6A 4HGAC 1P3MD 1TZYB 3AZKC 4R8PD 3REHD 1WWIA 1N1JB 3X1VB 4WU8B 5CPJC 2FJ7A 5CHLB 3MGPB 4JJNA 1M18A 4NE3A 5B1LA 5AVBD 3AZHD 3X1SD 3AZLD 4ZUXB 5AVCD 3AZFA 3W96B 4KUDC 4XUJB 1TZYC 4XZQD 5GXQB 3X1SA 3MNNA 3KWQA 3AZHA 1P3IC 3REKB 1P3MB 1P34B 4KHAA 4J8WD 1ZLAD 3LELD 5B32D 3WAAB 3UTAA 5JRGD 4WNNB 4X23A 4QLCA 4WV4B 3REIA 5B2IB 3LELC 5B1MD 3AZHB 3AYWB 5CP6C 3X1SB 4WU9C 5BO0B 3REKA 3X1TC 3UTAC 1A7WA 3C1BB 4XUJC 3MGQA 3WTPC 3LJAC 3VH5A 3AZGA 4G91B 3MGSD 4H9OA 5B1MC 5B1LC 3KWQD 5CPIA 3RELA 1BFMA 1U35D 3WTPA 3WAAC 3AZLA 4KGCB 1S32C 4YS3D 1EQZD 3WTPE 5AV8A 2PYOC 1H3OA 4UUZA 3AZHC 2NQBC 1P3KA 3UTBC 3UTAB 4WZSB 4LD9C 4J8VD 1BH9A 5AV8C 4R8PA 4H9RB 1HQ3A 4G92B 3WA9D 1F66C 5B31A 3MVDD 4Z66C 5AV9C 1R4VA 1S32B 3AZFB 1P3FD 3AZED 4ZUXA 3LJAA 3O62C 5GXQA 3V9RB 3MGRA 3LZ0A 3UTBB 3REJB 3MVDC 2IO5B 4H9RA 4YM6C 1P3ID 1N1JA 5B24C 3REJD 3LZ0C 3MVDA 1B6WA 1P3AA 1ID3A 5JRGB 2NZDA 5B2IA 3TU4D 3X1VA 4QLCB 2BYMB 4H9SC 2AROB 5DNMA 1P3BB 3KUYA 5AV6B 3MNND 4XUJD 5BS7C 1U35A 4J8XC 4WU8D 5AY8B 3AV1B 4J8VB 5CPKA 3MGRB 3AFAA 4E44A 3MNNB 3WKJC 2AROA 2BYMA 3RELD 1U35C 1KX3B 3VH6A 5GXQC 3WA9B 3B6GA 3REIB 1P3MC 5AV9D 3AZJA 2YFWB 1EQZC 3AFAC 5GT3C 5B2ID 4XZQB 5B0ZB 3KXBB 1KU5A 1P3MA 3AFAD 1P3LB 4H9NA 5B2IC 4ZBJC 5JA4A 5B32A 3X1SC 3MGPD 4WU9B 4H9SA 3X1UC 1U35B 1KX3C 5AVCC 3AZEB 4CAYA 1KX4C 1M1AC 5GT3B 3VH5T 1TAFA 5CPJA 5F99B 1KX3D 3B6FB 3R45B 4E45A 1P34D 4JJND 3WKJA 4H9OB 5B31G 1KX4D 2F8ND 5AVBA 2RVQD 3W97A 5GT0C 2NQBB 5BT1C 5B2JB 3X1UB 3REHB 2JSSA 1P3PC 3RELC 3W99C 3LJAD 5E5AD 3WTPD 3MGSC 3UT9B 4J8UA 3C1BA 3W98C 5AY8D 4ZUXD 1HQ3B 3NQUA 5GT0B 5B0YD 1P3OD 3AZID 4J8UD 1P3FA 4YS3B 3VH6W 3W98D 3W97D 1P3PB 1HQ3D 2YFWA 1HTAA 4QLCD 5DNMB 5B31D 1F1EA 2YFVA 5AV8D 2HIOC 4KHAB 1H3OB 4UUZB 3W96C 4KUDB 1P3KD 1BH8A 4QLCC 4J8VA 4Z66D 4WNNA 1P3GC 1P34C 1P3LD 5CPID 4YS3A 4H9PA 1P3PA 3W96D 2BYKB 1P3GD 4J8XB 1M19D 4KUDA 3MGSA 3AV1C 1ZLAB 3LELB 3AYWC 1M1AD 3AZMB 5DNNC 1KX5B 4X23D 4KGCD 1F66A 1S32A 1M19B 5GSUB 5AV9A 4Z5TC 5CP6D 3REHA 3KXBA 1TZYD 4XZQC 3UTAD 3B0DC 5B40B 5G49B 5CPKD 3AZIB 1Q9CA 3C1CC 3AZJB 3W96A 1KX5A 3AZND 2PYOB 4ZBJB 3UT9A 2CV5D 5B31C 4Z66A 3AZFD 3A6NB 5GT3A 3C1CD 3VH6T 3AZNB 2PYOD 3NQJA 3X1TD 3TU4A 4J8WB 5AV5C 4DRBA 1M1AB 4CSRA 3AV2C 2FJ7D 5BO0A 3KXBD 5B1LD 3KWQC 3MGQB 3O62B
chains in the Genus database with same CATH superfamily
2DQNC 3LZ1C 3MVDB 3REHC 1Z2CB 3MGPC 4EO5B 3O62D 3W99B 2Y2LA 4H9PB 4J8WC 3X1UD 4LD9D 5B33C 3A1KA 5FUGA 4WU9A 3AV2B 3MGSB 2XD5A 5AVBC 5JRGC 4J8XA 3W98B 5AY8A 5E5AA 1P3IB 2YFVB 1P3BC 1M18C 5GSUA 3AYWD 2RVQC 3B6GB 1KX3A 1EQZA 5BT1D 5DNMC 3NQUB 2RIQA 5B33B 5E5AB 4AWLC 3W97B 3C1BC 3W98A 3MNNC 2NQBA 2HUEB 3X1TB 5BNVA 1B67A 5B1MB 1P3GB 5B1LB 5BS7A 3MGQD 3A6NA 3UT9D 2CV5A 3AZNA 3B6GC 5B33A 5CPIB 3REID 1P3AB 5CP6A 1ID3B 2NZDB 5JRGA 5BNVB 4AWLB 4Z2MH 2F8NG 3B6GD 3AZKA 4LD9B 2FJ7C 5GSUC 2ZM5A 4YM6A 3AN2D 3AZEC 2F8NA 4X23B 5GT0A 3WAAA 4G92C 1F66B 3V9RA 3B6FC 5B40C 1M19A 2PYOA 5B32C 3A6ND 3B0BA 3X1VC 3W99A 3REJC 3KUYD 5DNMD 1KX5D 3A6NC 1P3AD 4WU8A 1ID3D 2F8NH 2NZDD 4Z2MG 4DRAA 5B0YB 5GT0D 4H9QB 4X23C 1P3OB 3AN2B 4Z5TD 1M18D 2XD1A 3AZMA 4NE6A 4NFTA 3VH5W 1S32D 3AZJD 3LZ0D 4CAYB 5AV6C 3AV1A 3AZEA 3LZ1B 2UWXA 4H9QA 5DNNA 2AROD 5GXQD 1P3IA 4J8VC 1P3GA 5B2JD 4EO5C 4J8UC 2HIOB 2Y2QA 5AV5D 3WA9C 3LJAB 4G91C 1EQZB 5B32G 5B40D 3REIC 2HIOD 2G5IC 3LZ1A 3AV2D 3WKJD 3X1VD 2NQBD 1M18B 3WA9A 5B0ZC 5CPJD 3EG5B 2CWEA 2F8NB 2HIOA 3LZ1D 2DF4C 3AZGC 1P34A 3IP4C 3W97C 5AV5A 5DNNB 2HUEC 5C3IC 3AZLC 5AV8B 5F99A 4JJNC 3AV1D 5AVCB 2CV5B 1KX4B 4NE5A 5DNND 2FFFB 3O62A 1P3KC 1ULYA 5BNXA 4Z66B 3AZKB 1P3BD 4LD9A 3B0DB 5F99C 5B1MA 5CPIC 4YM6D 3AZGB 3AN2A 1TZYA 3B0CT 1P3AC 1ID3C 2Y2NA 2NZDC 5KDMA 2L5AA 4CSRB 4J8WA 4Z5TA 4YM6B 4M6BA 1KX4A 4XZQA 3AZMD 5B0ZA 4ZUXC 3RELB 2CV5C 3LZ0B 3UTBA 3F6TA 1P3KB 5GT3D 3LELA 3C1CA 1ZLAA 2LY8A 3REKC 3UT9C 3X1TA 2AROC 4H9NB 5B0ZD 1HQ3C 5B32B 4XUJA 3W99D 5JA4B 3KWQB 3MGQC 2F8NK 3WAAD 3AZGD 3FDDA 4YS3C 3AZKD 3KSYA 1BH9B 3REKD 2ZY4A 2Y2OA 5AY8C 3KUYB 5KDMB 3UTBD 3MGRC 1BH8B 5CP6B 5B0YC 1P3BA 1P3OC 3WKJB 3AN2C 1WWSA 5GSUD 3AYWA 3WTPB 1AOIC 1F66D 4KGCA 5AVBB 5CPKB 3B6FD 3AFAB 5F99D 5B0YA 1P3OA 5B33D 1P3FC 4KUDD 4R8PC 3TU4B 3KXBC 3NQJB 1M1AA 4KGCC 2J8PA 5AVCA 3KUYC 1P3LC 3H0MC 1ZLAC 1P3PD 3AZMC 1KX5C 4J8UB 5E5AC 1JFIA 2JE5A 5B24D 1AOIB 1P3LA 5CPKC 5B40A 1M19C 5G49A 4Z5TB 1P3FB 5B24A 4R8PB 3TU4C 3REJA 4HGAB 5AV6D 5AV9B 3AZIC 3AZJC 3AZFC 3AV2A 3B0CW 1JFIB 5FUGB 3C1CB 1AOIA 4J8XD 4WU8C 1TAFB 5CPJB 5B2JC 5BNXB 3MGRD 3R45A 2IO5C 5B31B 3AZIA 3B6FA 5C3IB 3AZLB 2FJ7B 3MGPA 5B24B 4WU9D 4JJNB 1AOID 3AZNC 3C1BD 5B2JA 2BYKA 3X1UA 5AV5B 5AV6A 4HGAC 1P3MD 1TZYB 3AZKC 4R8PD 3REHD 1WWIA 1N1JB 3X1VB 4WU8B 5CPJC 2FJ7A 3P5JB 5CHLB 3MGPB 4JJNA 1M18A 4NE3A 5B1LA 5AVBD 3EPKA 3AZHD 3X1SD 3AZLD 4ZUXB 5AVCD 3AZFA 2ZY2A 3W96B 4KUDC 4XUJB 1TZYC 4XZQD 5GXQB 3X1SA 3MNNA 3KWQA 3AZHA 1P3IC 3REKB 1P3MB 1P34B 4KHAA 4J8WD 1ZLAD 3LELD 2Y2MA 5B32D 3WAAB 3UTAA 5JRGD 4WNNB 4X23A 4QLCA 4WV4B 3REIA 5B2IB 3LELC 5B1MD 3AZHB 3AYWB 5CP6C 3X1SB 4WU9C 5BO0B 3REKA 3X1TC 3UTAC 1A7WA 3C1BB 4XUJC 3MGQA 3WTPC 3LJAC 3VH5A 3AZGA 4G91B 3MGSD 4H9OA 4UPKA 5B1MC 5B1LC 3KWQD 5CPIA 3RELA 1BFMA 1U35D 3WTPA 3WAAC 2Y2KA 3AZLA 4KGCB 1S32C 4YS3D 1EQZD 3WTPE 5AV8A 2PYOC 1H3OA 1PZRA 4UUZA 3AZHC 2NQBC 2Y2JA 1P3KA 3UTBC 3UTAB 4WZSB 4LD9C 4J8VD 1BH9A 5AV8C 4R8PA 4H9RB 1HQ3A 4G92B 3WA9D 1F66C 5B31A 3MVDD 4Z66C 5AV9C 1R4VA 1S32B 3AZFB 2Y2IA 1P3FD 3AZED 4ZUXA 3LJAA 3O62C 5GXQA 3V9RB 3MGRA 3LZ0A 3UTBB 3REJB 3MVDC 2IO5B 4H9RA 4YM6C 1P3ID 1N1JA 5B24C 3REJD 3LZ0C 3MVDA 2W8SA 1B6WA 1P3AA 1ID3A 5JRGB 2NZDA 5B2IA 3TU4D 3X1VA 4QLCB 2BYMB 2AROB 4H9SC 5DNMA 2Y2HA 1P3BB 3KUYA 5AV6B 3MNND 4XUJD 5BS7C 3AL0C 1U35A 4J8XC 4WU8D 5AY8B 3AV1B 4J8VB 5CPKA 2ZY5A 3MGRB 3AFAA 4E44A 3MNNB 3WKJC 2AROA 2BYMA 2ZY3A 3RELD 1U35C 1KX3B 3VH6A 5GXQC 3WA9B 3B6GA 3REIB 1P3MC 5AV9D 3AZJA 2Y2PA 2YFWB 1EQZC 3AFAC 2Y2GA 5GT3C 5B2ID 4XZQB 5B0ZB 3KXBB 1KU5A 1P3MA 3AFAD 1P3LB 4H9NA 5B2IC 4ZBJC 5JA4A 5B32A 3X1SC 3MGPD 4WU9B 4H9SA 3X1UC 1U35B 1KX3C 5AVCC 3AZEB 4CAYA 1KX4C 1M1AC 5GT3B 2F2AC 3VH5T 1TAFA 5CPJA 5F99B 1KX3D 3B6FB 3R45B 4E45A 1P34D 4JJND 3WKJA 4H9OB 5B31G 1KX4D 2F8ND 5AVBA 2RVQD 3W97A 5GT0C 2NQBB 5BT1C 5B2JB 3X1UB 3REHB 1W2EA 2JSSA 3EPHA 1P3PC 3RELC 3W99C 3LJAD 5E5AD 3WTPD 3MGSC 3UT9B 4J8UA 3C1BA 3W98C 3H0RC 2JCHA 5AY8D 4ZUXD 1HQ3B 3NQUA 5GT0B 5B0YD 1P3OD 3AZID 4J8UD 1P3FA 4YS3B 3VH6W 3H0LC 3W97D 3W98D 4WJ3C 1P3PB 1HQ3D 2YFWA 1HTAA 4QLCD 5DNMB 5B31D 1F1EA 2YFVA 5AV8D 2HIOC 4KHAB 1H3OB 4UUZB 2VQRA 3W96C 4KUDB 1P3KD 2G5HC 1BH8A 4QLCC 4J8VA 4Z66D 4WNNA 1P3GC 1P34C 1P3LD 5CPID 4YS3A 4H9PA 1P3PA 3W96D 2BYKB 3EPLA 4DQYB 2BG1A 1P3GD 4J8XB 1M19D 4KUDA 3MGSA 3AV1C 1ZLAB 3LELB 3AYWC 1M1AD 3A1IA 3AZMB 5DNNC 1KX5B 4X23D 4KGCD 1F66A 1S32A 1M19B 5GSUB 5AV9A 4Z5TC 5CP6D 3REHA 3KXBA 1TZYD 4XZQC 3UTAD 3B0DC 5B40B 5G49B 5CPKD 3AZIB 1Q9CA 3C1CC 3AZJB 3W96A 1KX5A 3AZND 2PYOB 4ZBJB 3UT9A 2CV5D 5B31C 4Z66A 3AZFD 3A6NB 5GT3A 3C1CD 3VH6T 3AZNB 2PYOD 3NQJA 3X1TD 1T3UA 4J8WB 5AV5C 4DRBA 3TU4A 1M1AB 3EPJA 4CSRA 3AV2C 2FJ7D 5BO0A 3KXBD 5B1LD 3KWQC 3MGQB 3KFUG 3O62B
chains in the Genus database with same CATH topology
2DQNC 3LZ1C 3MVDB 3REHC 1Z2CB 3MGPC 4EO5B 3O62D 3W99B 2Y2LA 4H9PB 4J8WC 3X1UD 4LD9D 5B33C 3A1KA 5FUGA 4WU9A 3AV2B 3MGSB 2XD5A 5AVBC 5JRGC 4J8XA 3W98B 5AY8A 5E5AA 1P3IB 2YFVB 1P3BC 1M18C 5GSUA 3AYWD 2RVQC 3B6GB 1KX3A 1EQZA 5BT1D 5DNMC 3NQUB 2RIQA 5B33B 5E5AB 4AWLC 3W97B 3C1BC 3W98A 3MNNC 2NQBA 2HUEB 3X1TB 5BNVA 1B67A 5B1MB 1P3GB 5B1LB 5BS7A 3MGQD 3A6NA 3UT9D 2CV5A 3AZNA 3B6GC 5B33A 5CPIB 3REID 1P3AB 5CP6A 1ID3B 2NZDB 5JRGA 5BNVB 4AWLB 4Z2MH 2F8NG 3B6GD 3AZKA 4LD9B 2FJ7C 5GSUC 2ZM5A 4YM6A 3AN2D 3AZEC 2F8NA 4X23B 5GT0A 3WAAA 4G92C 1F66B 3V9RA 3B6FC 5B40C 1M19A 2PYOA 5B32C 3A6ND 3B0BA 3X1VC 3W99A 3REJC 3KUYD 5DNMD 1KX5D 3A6NC 1P3AD 4WU8A 1ID3D 2F8NH 2NZDD 4Z2MG 4DRAA 5B0YB 5GT0D 4H9QB 4X23C 1P3OB 3AN2B 4Z5TD 1M18D 2XD1A 3AZMA 4NE6A 4NFTA 3VH5W 1S32D 3AZJD 3LZ0D 4CAYB 5AV6C 3AV1A 3AZEA 3LZ1B 2UWXA 4H9QA 5DNNA 2AROD 5GXQD 1P3IA 4J8VC 1P3GA 5B2JD 4EO5C 4J8UC 2HIOB 2Y2QA 5AV5D 3WA9C 3LJAB 4G91C 1EQZB 5B32G 5B40D 3REIC 2HIOD 2G5IC 3LZ1A 3AV2D 3WKJD 3X1VD 2NQBD 1M18B 3WA9A 5B0ZC 5CPJD 3EG5B 2CWEA 2F8NB 2HIOA 3LZ1D 2DF4C 3AZGC 1P34A 3IP4C 3W97C 5AV5A 5DNNB 2HUEC 5C3IC 3AZLC 5AV8B 5F99A 4JJNC 3AV1D 5AVCB 2CV5B 1KX4B 4NE5A 5DNND 2FFFB 3O62A 1P3KC 1ULYA 5BNXA 4Z66B 3AZKB 1P3BD 4LD9A 3B0DB 5F99C 5B1MA 5CPIC 4YM6D 3AZGB 3AN2A 1TZYA 3B0CT 1P3AC 1ID3C 2Y2NA 2NZDC 5KDMA 2L5AA 4CSRB 4J8WA 4Z5TA 4YM6B 4M6BA 1KX4A 4XZQA 3AZMD 5B0ZA 4ZUXC 3RELB 2CV5C 3LZ0B 3UTBA 3F6TA 1P3KB 5GT3D 3LELA 3C1CA 1ZLAA 2LY8A 3REKC 3UT9C 3X1TA 2AROC 4H9NB 5B0ZD 1HQ3C 5B32B 4XUJA 3W99D 5JA4B 3KWQB 3MGQC 2F8NK 3WAAD 3AZGD 3FDDA 4YS3C 3AZKD 3KSYA 1BH9B 3REKD 2ZY4A 2Y2OA 5AY8C 3KUYB 5KDMB 3UTBD 3MGRC 1BH8B 5CP6B 5B0YC 1P3BA 1P3OC 3WKJB 3AN2C 1WWSA 5GSUD 3AYWA 3WTPB 1AOIC 1F66D 4KGCA 5AVBB 5CPKB 3B6FD 3AFAB 5F99D 5B0YA 1P3OA 5B33D 1P3FC 4KUDD 4R8PC 3TU4B 3KXBC 3NQJB 1M1AA 4KGCC 2J8PA 5AVCA 3KUYC 1P3LC 3H0MC 1ZLAC 1P3PD 3AZMC 1KX5C 4J8UB 5E5AC 1JFIA 2JE5A 5B24D 1AOIB 1P3LA 5CPKC 5B40A 1M19C 5G49A 4Z5TB 1P3FB 5B24A 4R8PB 3TU4C 3REJA 4HGAB 5AV6D 5AV9B 3AZIC 3AZJC 3AZFC 3AV2A 3B0CW 1JFIB 5FUGB 3C1CB 1AOIA 4J8XD 4WU8C 1TAFB 5CPJB 5B2JC 5BNXB 3MGRD 3R45A 2IO5C 5B31B 3AZIA 3B6FA 5C3IB 3AZLB 2FJ7B 3MGPA 5B24B 4WU9D 4JJNB 1AOID 3AZNC 3C1BD 5B2JA 2BYKA 3X1UA 5AV5B 5AV6A 4HGAC 1P3MD 1TZYB 3AZKC 4R8PD 3REHD 1WWIA 1N1JB 3X1VB 4WU8B 5CPJC 2FJ7A 3P5JB 5CHLB 3MGPB 4JJNA 1M18A 4NE3A 5B1LA 5AVBD 3EPKA 3AZHD 3X1SD 3AZLD 4ZUXB 5AVCD 3AZFA 2ZY2A 3W96B 4KUDC 4XUJB 1TZYC 4XZQD 5GXQB 3X1SA 3MNNA 3KWQA 3AZHA 1P3IC 3REKB 1P3MB 1P34B 4KHAA 4J8WD 1ZLAD 3LELD 2Y2MA 5B32D 3WAAB 3UTAA 5JRGD 4WNNB 4X23A 4QLCA 4WV4B 3REIA 5B2IB 3LELC 5B1MD 3AZHB 3AYWB 5CP6C 3X1SB 4WU9C 5BO0B 3REKA 3X1TC 3UTAC 1A7WA 3C1BB 4XUJC 3MGQA 3WTPC 3LJAC 3VH5A 3AZGA 4G91B 3MGSD 4H9OA 4UPKA 5B1MC 5B1LC 3KWQD 5CPIA 3RELA 1BFMA 1U35D 3WTPA 3WAAC 2Y2KA 3AZLA 4KGCB 1S32C 4YS3D 1EQZD 3WTPE 5AV8A 2PYOC 1H3OA 1PZRA 4UUZA 3AZHC 2NQBC 2Y2JA 1P3KA 3UTBC 3UTAB 4WZSB 4LD9C 4J8VD 1BH9A 5AV8C 4R8PA 4H9RB 1HQ3A 4G92B 3WA9D 1F66C 5B31A 3MVDD 4Z66C 5AV9C 1R4VA 1S32B 3AZFB 2Y2IA 1P3FD 3AZED 4ZUXA 3LJAA 3O62C 5GXQA 3V9RB 3MGRA 3LZ0A 3UTBB 3REJB 3MVDC 2IO5B 4H9RA 4YM6C 1P3ID 1N1JA 5B24C 3REJD 3LZ0C 3MVDA 2W8SA 1B6WA 1P3AA 1ID3A 5JRGB 2NZDA 5B2IA 3TU4D 3X1VA 4QLCB 2BYMB 2AROB 4H9SC 5DNMA 2Y2HA 1P3BB 3KUYA 5AV6B 3MNND 4XUJD 5BS7C 3AL0C 1U35A 4J8XC 4WU8D 5AY8B 3AV1B 4J8VB 5CPKA 2ZY5A 3MGRB 3AFAA 4E44A 3MNNB 3WKJC 2AROA 2BYMA 2ZY3A 3RELD 1U35C 1KX3B 3VH6A 5GXQC 3WA9B 3B6GA 3REIB 1P3MC 5AV9D 3AZJA 2Y2PA 2YFWB 1EQZC 3AFAC 2Y2GA 5GT3C 5B2ID 4XZQB 5B0ZB 3KXBB 1KU5A 1P3MA 3AFAD 1P3LB 4H9NA 5B2IC 4ZBJC 5JA4A 5B32A 3X1SC 3MGPD 4WU9B 4H9SA 3X1UC 1U35B 1KX3C 5AVCC 3AZEB 4CAYA 1KX4C 1M1AC 5GT3B 2F2AC 3VH5T 1TAFA 5CPJA 5F99B 1KX3D 3B6FB 3R45B 4E45A 1P34D 4JJND 3WKJA 4H9OB 5B31G 1KX4D 2F8ND 5AVBA 2RVQD 3W97A 5GT0C 2NQBB 5BT1C 5B2JB 3X1UB 3REHB 1W2EA 2JSSA 3EPHA 1P3PC 3RELC 3W99C 3LJAD 5E5AD 3WTPD 3MGSC 3UT9B 4J8UA 3C1BA 3W98C 3H0RC 2JCHA 5AY8D 4ZUXD 1HQ3B 3NQUA 5GT0B 5B0YD 1P3OD 3AZID 4J8UD 1P3FA 4YS3B 3VH6W 3H0LC 3W97D 3W98D 4WJ3C 1P3PB 1HQ3D 2YFWA 1HTAA 4QLCD 5DNMB 5B31D 1F1EA 2YFVA 5AV8D 2HIOC 4KHAB 1H3OB 4UUZB 2VQRA 3W96C 4KUDB 1P3KD 2G5HC 1BH8A 4QLCC 4J8VA 4Z66D 4WNNA 1P3GC 1P34C 1P3LD 5CPID 4YS3A 4H9PA 1P3PA 3W96D 2BYKB 3EPLA 4DQYB 2BG1A 1P3GD 4J8XB 1M19D 4KUDA 3MGSA 3AV1C 1ZLAB 3LELB 3AYWC 1M1AD 3A1IA 3AZMB 5DNNC 1KX5B 4X23D 4KGCD 1F66A 1S32A 1M19B 5GSUB 5AV9A 4Z5TC 5CP6D 3REHA 3KXBA 1TZYD 4XZQC 3UTAD 3B0DC 5B40B 5G49B 5CPKD 3AZIB 1Q9CA 3C1CC 3AZJB 3W96A 1KX5A 3AZND 2PYOB 4ZBJB 3UT9A 2CV5D 5B31C 4Z66A 3AZFD 3A6NB 5GT3A 3C1CD 3VH6T 3AZNB 2PYOD 3NQJA 3X1TD 1T3UA 4J8WB 5AV5C 4DRBA 3TU4A 1M1AB 3EPJA 4CSRA 3AV2C 2FJ7D 5BO0A 3KXBD 5B1LD 3KWQC 3MGQB 3KFUG 3O62B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ1 C;  3MVD B;  3REH C;  3MGP C;  4EO5 B;  3O62 D;  3W99 B;  4H9P B;  4J8W C;  3X1U D;  4LD9 D;  5B33 C;  5FUG A;  4WU9 A;  3AV2 B;  3MGS B;  5AVB C;  5JRG C;  4J8X A;  3W98 B;  5AY8 A;  5E5A A;  1P3I B;  2YFV B;  1P3B C;  1M18 C;  5GSU A;  3AYW D;  2RVQ C;  3B6G B;  1KX3 A;  1EQZ A;  5BT1 D;  5DNM C;  3NQU B;  4AWL C;  5B33 B;  5E5A B;  3W97 B;  3C1B C;  3W98 A;  3MNN C;  2NQB A;  2HUE B;  3X1T B;  5BNV A;  1B67 A;  5B1M B;  1P3G B;  5B1L B;  5BS7 A;  3MGQ D;  3A6N A;  3UT9 D;  2CV5 A;  3AZN A;  3B6G C;  5B33 A;  5CPI B;  3REI D;  1P3A B;  5CP6 A;  1ID3 B;  2NZD B;  5JRG A;  5BNV B;  4AWL B;  4Z2M H;  2F8N G;  3B6G D;  3AZK A;  4LD9 B;  2FJ7 C;  5GSU C;  4YM6 A;  3AN2 D;  3AZE C;  2F8N A;  4X23 B;  5GT0 A;  3WAA A;  4G92 C;  1F66 B;  3V9R A;  3B6F C;  5B40 C;  1M19 A;  2PYO A;  5B32 C;  3A6N D;  3B0B A;  3X1V C;  3W99 A;  3REJ C;  3KUY D;  5DNM D;  1KX5 D;  3A6N C;  1P3A D;  4WU8 A;  1ID3 D;  2F8N H;  2NZD D;  4Z2M G;  4DRA A;  5B0Y B;  5GT0 D;  4H9Q B;  4X23 C;  1P3O B;  3AN2 B;  4Z5T D;  1M18 D;  3AZM A;  4NE6 A;  4NFT A;  3VH5 W;  1S32 D;  3AZJ D;  3LZ0 D;  4CAY B;  5AV6 C;  3AV1 A;  3AZE A;  3LZ1 B;  4H9Q A;  5DNN A;  2ARO D;  5GXQ D;  1P3I A;  4J8V C;  1P3G A;  5B2J D;  4EO5 C;  4J8U C;  2HIO B;  5AV5 D;  3WA9 C;  3LJA B;  4G91 C;  1EQZ B;  5B32 G;  5B40 D;  3REI C;  2HIO D;  3LZ1 A;  3AV2 D;  3WKJ D;  3X1V D;  2NQB D;  1M18 B;  3WA9 A;  5B0Z C;  5CPJ D;  2CWE A;  2F8N B;  3LZ1 D;  2HIO A;  3AZG C;  1P34 A;  3W97 C;  5AV5 A;  5DNN B;  2HUE C;  5C3I C;  3AZL C;  5AV8 B;  5F99 A;  4JJN C;  3AV1 D;  5AVC B;  2CV5 B;  1KX4 B;  4NE5 A;  5DNN D;  3O62 A;  1P3K C;  1ULY A;  5BNX A;  4Z66 B;  3AZK B;  1P3B D;  4LD9 A;  3B0D B;  5F99 C;  5B1M A;  5CPI C;  4YM6 D;  3AZG B;  3AN2 A;  1TZY A;  3B0C T;  1P3A C;  1ID3 C;  2NZD C;  5KDM A;  2L5A A;  4CSR B;  4J8W A;  4Z5T A;  4YM6 B;  4M6B A;  1KX4 A;  4XZQ A;  3AZM D;  5B0Z A;  4ZUX C;  3REL B;  2CV5 C;  3LZ0 B;  3UTB A;  1P3K B;  5GT3 D;  3LEL A;  3C1C A;  1ZLA A;  2LY8 A;  3REK C;  3UT9 C;  3X1T A;  2ARO C;  4H9N B;  5B0Z D;  1HQ3 C;  5B32 B;  4XUJ A;  3W99 D;  5JA4 B;  3KWQ B;  3MGQ C;  2F8N K;  3WAA D;  3AZG D;  4YS3 C;  3AZK D;  3KSY A;  1BH9 B;  3REK D;  5AY8 C;  3KUY B;  5KDM B;  3UTB D;  3MGR C;  1BH8 B;  5CP6 B;  5B0Y C;  1P3B A;  1P3O C;  3WKJ B;  3AN2 C;  1WWS A;  5GSU D;  3AYW A;  3WTP B;  1AOI C;  1F66 D;  4KGC A;  5AVB B;  5CPK B;  3B6F D;  3AFA B;  5F99 D;  5B0Y A;  1P3O A;  5B33 D;  1P3F C;  4KUD D;  4R8P C;  3TU4 B;  3KXB C;  3NQJ B;  1M1A A;  4KGC C;  5AVC A;  3KUY C;  1P3L C;  1ZLA C;  1P3P D;  3AZM C;  1KX5 C;  4J8U B;  5E5A C;  1JFI A;  5B24 D;  1AOI B;  1P3L A;  5CPK C;  5B40 A;  1M19 C;  5G49 A;  4Z5T B;  1P3F B;  5B24 A;  4R8P B;  3TU4 C;  3REJ A;  4HGA B;  5AV6 D;  5AV9 B;  3AZI C;  3AZJ C;  3AZF C;  3AV2 A;  3B0C W;  1JFI B;  5FUG B;  3C1C B;  1AOI A;  4J8X D;  4WU8 C;  1TAF B;  5CPJ B;  5B2J C;  5BNX B;  3MGR D;  3R45 A;  2IO5 C;  5B31 B;  3AZI A;  3B6F A;  5C3I B;  3AZL B;  2FJ7 B;  3MGP A;  5B24 B;  4WU9 D;  4JJN B;  1AOI D;  3AZN C;  3C1B D;  5B2J A;  2BYK A;  3X1U A;  5AV5 B;  5AV6 A;  4HGA C;  1P3M D;  1TZY B;  3AZK C;  4R8P D;  3REH D;  1WWI A;  1N1J B;  3X1V B;  4WU8 B;  5CPJ C;  2FJ7 A;  5CHL B;  3MGP B;  4JJN A;  1M18 A;  4NE3 A;  5B1L A;  5AVB D;  3AZH D;  3X1S D;  3AZL D;  4ZUX B;  5AVC D;  3AZF A;  3W96 B;  4KUD C;  4XUJ B;  1TZY C;  4XZQ D;  5GXQ B;  3X1S A;  3MNN A;  3KWQ A;  3AZH A;  1P3I C;  3REK B;  1P3M B;  1P34 B;  4KHA A;  4J8W D;  1ZLA D;  3LEL D;  5B32 D;  3WAA B;  3UTA A;  5JRG D;  4WNN B;  4X23 A;  4QLC A;  4WV4 B;  3REI A;  5B2I B;  3LEL C;  5B1M D;  3AZH B;  3AYW B;  5CP6 C;  3X1S B;  4WU9 C;  5BO0 B;  3REK A;  3X1T C;  3UTA C;  1A7W A;  3C1B B;  4XUJ C;  3MGQ A;  3WTP C;  3LJA C;  3VH5 A;  3AZG A;  4G91 B;  3MGS D;  4H9O A;  5B1M C;  5B1L C;  3KWQ D;  5CPI A;  3REL A;  1BFM A;  1U35 D;  3WTP A;  3WAA C;  3AZL A;  4KGC B;  1S32 C;  4YS3 D;  1EQZ D;  3WTP E;  5AV8 A;  2PYO C;  1H3O A;  4UUZ A;  3AZH C;  2NQB C;  1P3K A;  3UTB C;  3UTA B;  4WZS B;  4LD9 C;  4J8V D;  1BH9 A;  5AV8 C;  4R8P A;  4H9R B;  1HQ3 A;  4G92 B;  3WA9 D;  1F66 C;  5B31 A;  3MVD D;  4Z66 C;  5AV9 C;  1R4V A;  1S32 B;  3AZF B;  1P3F D;  3AZE D;  4ZUX A;  3LJA A;  3O62 C;  5GXQ A;  3V9R B;  3MGR A;  3LZ0 A;  3UTB B;  3REJ B;  3MVD C;  2IO5 B;  4H9R A;  4YM6 C;  1P3I D;  1N1J A;  5B24 C;  3REJ D;  3LZ0 C;  3MVD A;  1B6W A;  1P3A A;  1ID3 A;  5JRG B;  2NZD A;  5B2I A;  3TU4 D;  3X1V A;  4QLC B;  2BYM B;  4H9S C;  2ARO B;  5DNM A;  1P3B B;  3KUY A;  5AV6 B;  3MNN D;  4XUJ D;  5BS7 C;  1U35 A;  4J8X C;  4WU8 D;  5AY8 B;  3AV1 B;  4J8V B;  5CPK A;  3MGR B;  3AFA A;  4E44 A;  3MNN B;  3WKJ C;  2ARO A;  2BYM A;  3REL D;  1U35 C;  1KX3 B;  3VH6 A;  5GXQ C;  3WA9 B;  3B6G A;  3REI B;  1P3M C;  5AV9 D;  3AZJ A;  2YFW B;  1EQZ C;  3AFA C;  5GT3 C;  5B2I D;  4XZQ B;  5B0Z B;  3KXB B;  1KU5 A;  1P3M A;  3AFA D;  1P3L B;  4H9N A;  5B2I C;  4ZBJ C;  5JA4 A;  5B32 A;  3X1S C;  3MGP D;  4WU9 B;  4H9S A;  3X1U C;  1U35 B;  1KX3 C;  5AVC C;  3AZE B;  4CAY A;  1KX4 C;  1M1A C;  5GT3 B;  3VH5 T;  1TAF A;  5CPJ A;  5F99 B;  1KX3 D;  3B6F B;  3R45 B;  4E45 A;  1P34 D;  4JJN D;  3WKJ A;  4H9O B;  5B31 G;  1KX4 D;  2F8N D;  5AVB A;  2RVQ D;  3W97 A;  5GT0 C;  2NQB B;  5BT1 C;  5B2J B;  3X1U B;  3REH B;  2JSS A;  1P3P C;  3REL C;  3W99 C;  3LJA D;  5E5A D;  3WTP D;  3MGS C;  3UT9 B;  4J8U A;  3C1B A;  3W98 C;  5AY8 D;  4ZUX D;  1HQ3 B;  3NQU A;  5GT0 B;  5B0Y D;  1P3O D;  3AZI D;  4J8U D;  1P3F A;  4YS3 B;  3VH6 W;  3W98 D;  3W97 D;  1P3P B;  1HQ3 D;  2YFW A;  1HTA A;  4QLC D;  5DNM B;  5B31 D;  1F1E A;  2YFV A;  5AV8 D;  2HIO C;  4KHA B;  1H3O B;  4UUZ B;  3W96 C;  4KUD B;  1P3K D;  1BH8 A;  4QLC C;  4J8V A;  4Z66 D;  4WNN A;  1P3G C;  1P34 C;  1P3L D;  5CPI D;  4YS3 A;  4H9P A;  1P3P A;  3W96 D;  2BYK B;  1P3G D;  4J8X B;  1M19 D;  4KUD A;  3MGS A;  3AV1 C;  1ZLA B;  3LEL B;  3AYW C;  1M1A D;  3AZM B;  5DNN C;  1KX5 B;  4X23 D;  4KGC D;  1F66 A;  1S32 A;  1M19 B;  5GSU B;  5AV9 A;  4Z5T C;  5CP6 D;  3REH A;  3KXB A;  1TZY D;  4XZQ C;  3UTA D;  3B0D C;  5B40 B;  5G49 B;  5CPK D;  3AZI B;  1Q9C A;  3C1C C;  3AZJ B;  3W96 A;  1KX5 A;  3AZN D;  2PYO B;  4ZBJ B;  3UT9 A;  2CV5 D;  5B31 C;  4Z66 A;  3AZF D;  3A6N B;  5GT3 A;  3C1C D;  3VH6 T;  3AZN B;  2PYO D;  3NQJ A;  3X1T D;  3TU4 A;  4J8W B;  5AV5 C;  4DRB A;  1M1A B;  4CSR A;  3AV2 C;  2FJ7 D;  5BO0 A;  3KXB D;  5B1L D;  3KWQ C;  3MGQ B;  3O62 B; 
#chains in the Genus database with same CATH topology
 2DQN C;  3LZ1 C;  3MVD B;  3REH C;  1Z2C B;  3MGP C;  4EO5 B;  3O62 D;  3W99 B;  2Y2L A;  4H9P B;  4J8W C;  3X1U D;  4LD9 D;  5B33 C;  3A1K A;  5FUG A;  4WU9 A;  3AV2 B;  3MGS B;  2XD5 A;  5AVB C;  5JRG C;  4J8X A;  3W98 B;  5AY8 A;  5E5A A;  1P3I B;  2YFV B;  1P3B C;  1M18 C;  5GSU A;  3AYW D;  2RVQ C;  3B6G B;  1KX3 A;  1EQZ A;  5BT1 D;  5DNM C;  3NQU B;  2RIQ A;  5B33 B;  5E5A B;  4AWL C;  3W97 B;  3C1B C;  3W98 A;  3MNN C;  2NQB A;  2HUE B;  3X1T B;  5BNV A;  1B67 A;  5B1M B;  1P3G B;  5B1L B;  5BS7 A;  3MGQ D;  3A6N A;  3UT9 D;  2CV5 A;  3AZN A;  3B6G C;  5B33 A;  5CPI B;  3REI D;  1P3A B;  5CP6 A;  1ID3 B;  2NZD B;  5JRG A;  5BNV B;  4AWL B;  4Z2M H;  2F8N G;  3B6G D;  3AZK A;  4LD9 B;  2FJ7 C;  5GSU C;  2ZM5 A;  4YM6 A;  3AN2 D;  3AZE C;  2F8N A;  4X23 B;  5GT0 A;  3WAA A;  4G92 C;  1F66 B;  3V9R A;  3B6F C;  5B40 C;  1M19 A;  2PYO A;  5B32 C;  3A6N D;  3B0B A;  3X1V C;  3W99 A;  3REJ C;  3KUY D;  5DNM D;  1KX5 D;  3A6N C;  1P3A D;  4WU8 A;  1ID3 D;  2F8N H;  2NZD D;  4Z2M G;  4DRA A;  5B0Y B;  5GT0 D;  4H9Q B;  4X23 C;  1P3O B;  3AN2 B;  4Z5T D;  1M18 D;  2XD1 A;  3AZM A;  4NE6 A;  4NFT A;  3VH5 W;  1S32 D;  3AZJ D;  3LZ0 D;  4CAY B;  5AV6 C;  3AV1 A;  3AZE A;  3LZ1 B;  2UWX A;  4H9Q A;  5DNN A;  2ARO D;  5GXQ D;  1P3I A;  4J8V C;  1P3G A;  5B2J D;  4EO5 C;  4J8U C;  2HIO B;  2Y2Q A;  5AV5 D;  3WA9 C;  3LJA B;  4G91 C;  1EQZ B;  5B32 G;  5B40 D;  3REI C;  2HIO D;  2G5I C;  3LZ1 A;  3AV2 D;  3WKJ D;  3X1V D;  2NQB D;  1M18 B;  3WA9 A;  5B0Z C;  5CPJ D;  3EG5 B;  2CWE A;  2F8N B;  2HIO A;  3LZ1 D;  2DF4 C;  3AZG C;  1P34 A;  3IP4 C;  3W97 C;  5AV5 A;  5DNN B;  2HUE C;  5C3I C;  3AZL C;  5AV8 B;  5F99 A;  4JJN C;  3AV1 D;  5AVC B;  2CV5 B;  1KX4 B;  4NE5 A;  5DNN D;  2FFF B;  3O62 A;  1P3K C;  1ULY A;  5BNX A;  4Z66 B;  3AZK B;  1P3B D;  4LD9 A;  3B0D B;  5F99 C;  5B1M A;  5CPI C;  4YM6 D;  3AZG B;  3AN2 A;  1TZY A;  3B0C T;  1P3A C;  1ID3 C;  2Y2N A;  2NZD C;  5KDM A;  2L5A A;  4CSR B;  4J8W A;  4Z5T A;  4YM6 B;  4M6B A;  1KX4 A;  4XZQ A;  3AZM D;  5B0Z A;  4ZUX C;  3REL B;  2CV5 C;  3LZ0 B;  3UTB A;  3F6T A;  1P3K B;  5GT3 D;  3LEL A;  3C1C A;  1ZLA A;  2LY8 A;  3REK C;  3UT9 C;  3X1T A;  2ARO C;  4H9N B;  5B0Z D;  1HQ3 C;  5B32 B;  4XUJ A;  3W99 D;  5JA4 B;  3KWQ B;  3MGQ C;  2F8N K;  3WAA D;  3AZG D;  3FDD A;  4YS3 C;  3AZK D;  3KSY A;  1BH9 B;  3REK D;  2ZY4 A;  2Y2O A;  5AY8 C;  3KUY B;  5KDM B;  3UTB D;  3MGR C;  1BH8 B;  5CP6 B;  5B0Y C;  1P3B A;  1P3O C;  3WKJ B;  3AN2 C;  1WWS A;  5GSU D;  3AYW A;  3WTP B;  1AOI C;  1F66 D;  4KGC A;  5AVB B;  5CPK B;  3B6F D;  3AFA B;  5F99 D;  5B0Y A;  1P3O A;  5B33 D;  1P3F C;  4KUD D;  4R8P C;  3TU4 B;  3KXB C;  3NQJ B;  1M1A A;  4KGC C;  2J8P A;  5AVC A;  3KUY C;  1P3L C;  3H0M C;  1ZLA C;  1P3P D;  3AZM C;  1KX5 C;  4J8U B;  5E5A C;  1JFI A;  2JE5 A;  5B24 D;  1AOI B;  1P3L A;  5CPK C;  5B40 A;  1M19 C;  5G49 A;  4Z5T B;  1P3F B;  5B24 A;  4R8P B;  3TU4 C;  3REJ A;  4HGA B;  5AV6 D;  5AV9 B;  3AZI C;  3AZJ C;  3AZF C;  3AV2 A;  3B0C W;  1JFI B;  5FUG B;  3C1C B;  1AOI A;  4J8X D;  4WU8 C;  1TAF B;  5CPJ B;  5B2J C;  5BNX B;  3MGR D;  3R45 A;  2IO5 C;  5B31 B;  3AZI A;  3B6F A;  5C3I B;  3AZL B;  2FJ7 B;  3MGP A;  5B24 B;  4WU9 D;  4JJN B;  1AOI D;  3AZN C;  3C1B D;  5B2J A;  2BYK A;  3X1U A;  5AV5 B;  5AV6 A;  4HGA C;  1P3M D;  1TZY B;  3AZK C;  4R8P D;  3REH D;  1WWI A;  1N1J B;  3X1V B;  4WU8 B;  5CPJ C;  2FJ7 A;  3P5J B;  5CHL B;  3MGP B;  4JJN A;  1M18 A;  4NE3 A;  5B1L A;  5AVB D;  3EPK A;  3AZH D;  3X1S D;  3AZL D;  4ZUX B;  5AVC D;  3AZF A;  2ZY2 A;  3W96 B;  4KUD C;  4XUJ B;  1TZY C;  4XZQ D;  5GXQ B;  3X1S A;  3MNN A;  3KWQ A;  3AZH A;  1P3I C;  3REK B;  1P3M B;  1P34 B;  4KHA A;  4J8W D;  1ZLA D;  3LEL D;  2Y2M A;  5B32 D;  3WAA B;  3UTA A;  5JRG D;  4WNN B;  4X23 A;  4QLC A;  4WV4 B;  3REI A;  5B2I B;  3LEL C;  5B1M D;  3AZH B;  3AYW B;  5CP6 C;  3X1S B;  4WU9 C;  5BO0 B;  3REK A;  3X1T C;  3UTA C;  1A7W A;  3C1B B;  4XUJ C;  3MGQ A;  3WTP C;  3LJA C;  3VH5 A;  3AZG A;  4G91 B;  3MGS D;  4H9O A;  4UPK A;  5B1M C;  5B1L C;  3KWQ D;  5CPI A;  3REL A;  1BFM A;  1U35 D;  3WTP A;  3WAA C;  2Y2K A;  3AZL A;  4KGC B;  1S32 C;  4YS3 D;  1EQZ D;  3WTP E;  5AV8 A;  2PYO C;  1H3O A;  1PZR A;  4UUZ A;  3AZH C;  2NQB C;  2Y2J A;  1P3K A;  3UTB C;  3UTA B;  4WZS B;  4LD9 C;  4J8V D;  1BH9 A;  5AV8 C;  4R8P A;  4H9R B;  1HQ3 A;  4G92 B;  3WA9 D;  1F66 C;  5B31 A;  3MVD D;  4Z66 C;  5AV9 C;  1R4V A;  1S32 B;  3AZF B;  2Y2I A;  1P3F D;  3AZE D;  4ZUX A;  3LJA A;  3O62 C;  5GXQ A;  3V9R B;  3MGR A;  3LZ0 A;  3UTB B;  3REJ B;  3MVD C;  2IO5 B;  4H9R A;  4YM6 C;  1P3I D;  1N1J A;  5B24 C;  3REJ D;  3LZ0 C;  3MVD A;  2W8S A;  1B6W A;  1P3A A;  1ID3 A;  5JRG B;  2NZD A;  5B2I A;  3TU4 D;  3X1V A;  4QLC B;  2BYM B;  2ARO B;  4H9S C;  5DNM A;  2Y2H A;  1P3B B;  3KUY A;  5AV6 B;  3MNN D;  4XUJ D;  5BS7 C;  3AL0 C;  1U35 A;  4J8X C;  4WU8 D;  5AY8 B;  3AV1 B;  4J8V B;  5CPK A;  2ZY5 A;  3MGR B;  3AFA A;  4E44 A;  3MNN B;  3WKJ C;  2ARO A;  2BYM A;  2ZY3 A;  3REL D;  1U35 C;  1KX3 B;  3VH6 A;  5GXQ C;  3WA9 B;  3B6G A;  3REI B;  1P3M C;  5AV9 D;  3AZJ A;  2Y2P A;  2YFW B;  1EQZ C;  3AFA C;  2Y2G A;  5GT3 C;  5B2I D;  4XZQ B;  5B0Z B;  3KXB B;  1KU5 A;  1P3M A;  3AFA D;  1P3L B;  4H9N A;  5B2I C;  4ZBJ C;  5JA4 A;  5B32 A;  3X1S C;  3MGP D;  4WU9 B;  4H9S A;  3X1U C;  1U35 B;  1KX3 C;  5AVC C;  3AZE B;  4CAY A;  1KX4 C;  1M1A C;  5GT3 B;  2F2A C;  3VH5 T;  1TAF A;  5CPJ A;  5F99 B;  1KX3 D;  3B6F B;  3R45 B;  4E45 A;  1P34 D;  4JJN D;  3WKJ A;  4H9O B;  5B31 G;  1KX4 D;  2F8N D;  5AVB A;  2RVQ D;  3W97 A;  5GT0 C;  2NQB B;  5BT1 C;  5B2J B;  3X1U B;  3REH B;  1W2E A;  2JSS A;  3EPH A;  1P3P C;  3REL C;  3W99 C;  3LJA D;  5E5A D;  3WTP D;  3MGS C;  3UT9 B;  4J8U A;  3C1B A;  3W98 C;  3H0R C;  2JCH A;  5AY8 D;  4ZUX D;  1HQ3 B;  3NQU A;  5GT0 B;  5B0Y D;  1P3O D;  3AZI D;  4J8U D;  1P3F A;  4YS3 B;  3VH6 W;  3H0L C;  3W97 D;  3W98 D;  4WJ3 C;  1P3P B;  1HQ3 D;  2YFW A;  1HTA A;  4QLC D;  5DNM B;  5B31 D;  1F1E A;  2YFV A;  5AV8 D;  2HIO C;  4KHA B;  1H3O B;  4UUZ B;  2VQR A;  3W96 C;  4KUD B;  1P3K D;  2G5H C;  1BH8 A;  4QLC C;  4J8V A;  4Z66 D;  4WNN A;  1P3G C;  1P34 C;  1P3L D;  5CPI D;  4YS3 A;  4H9P A;  1P3P A;  3W96 D;  2BYK B;  3EPL A;  4DQY B;  2BG1 A;  1P3G D;  4J8X B;  1M19 D;  4KUD A;  3MGS A;  3AV1 C;  1ZLA B;  3LEL B;  3AYW C;  1M1A D;  3A1I A;  3AZM B;  5DNN C;  1KX5 B;  4X23 D;  4KGC D;  1F66 A;  1S32 A;  1M19 B;  5GSU B;  5AV9 A;  4Z5T C;  5CP6 D;  3REH A;  3KXB A;  1TZY D;  4XZQ C;  3UTA D;  3B0D C;  5B40 B;  5G49 B;  5CPK D;  3AZI B;  1Q9C A;  3C1C C;  3AZJ B;  3W96 A;  1KX5 A;  3AZN D;  2PYO B;  4ZBJ B;  3UT9 A;  2CV5 D;  5B31 C;  4Z66 A;  3AZF D;  3A6N B;  5GT3 A;  3C1C D;  3VH6 T;  3AZN B;  2PYO D;  3NQJ A;  3X1T D;  1T3U A;  4J8W B;  5AV5 C;  4DRB A;  3TU4 A;  1M1A B;  3EPJ A;  4CSR A;  3AV2 C;  2FJ7 D;  5BO0 A;  3KXB D;  5B1L D;  3KWQ C;  3MGQ B;  3KFU G;  3O62 B; 
#chains in the Genus database with same CATH homology
 2DQN C;  3LZ1 C;  3MVD B;  3REH C;  1Z2C B;  3MGP C;  4EO5 B;  3O62 D;  3W99 B;  2Y2L A;  4H9P B;  4J8W C;  3X1U D;  4LD9 D;  5B33 C;  3A1K A;  5FUG A;  4WU9 A;  3AV2 B;  3MGS B;  2XD5 A;  5AVB C;  5JRG C;  4J8X A;  3W98 B;  5AY8 A;  5E5A A;  1P3I B;  2YFV B;  1P3B C;  1M18 C;  5GSU A;  3AYW D;  2RVQ C;  3B6G B;  1KX3 A;  1EQZ A;  5BT1 D;  5DNM C;  3NQU B;  2RIQ A;  5B33 B;  5E5A B;  4AWL C;  3W97 B;  3C1B C;  3W98 A;  3MNN C;  2NQB A;  2HUE B;  3X1T B;  5BNV A;  1B67 A;  5B1M B;  1P3G B;  5B1L B;  5BS7 A;  3MGQ D;  3A6N A;  3UT9 D;  2CV5 A;  3AZN A;  3B6G C;  5B33 A;  5CPI B;  3REI D;  1P3A B;  5CP6 A;  1ID3 B;  2NZD B;  5JRG A;  5BNV B;  4AWL B;  4Z2M H;  2F8N G;  3B6G D;  3AZK A;  4LD9 B;  2FJ7 C;  5GSU C;  2ZM5 A;  4YM6 A;  3AN2 D;  3AZE C;  2F8N A;  4X23 B;  5GT0 A;  3WAA A;  4G92 C;  1F66 B;  3V9R A;  3B6F C;  5B40 C;  1M19 A;  2PYO A;  5B32 C;  3A6N D;  3B0B A;  3X1V C;  3W99 A;  3REJ C;  3KUY D;  5DNM D;  1KX5 D;  3A6N C;  1P3A D;  4WU8 A;  1ID3 D;  2F8N H;  2NZD D;  4Z2M G;  4DRA A;  5B0Y B;  5GT0 D;  4H9Q B;  4X23 C;  1P3O B;  3AN2 B;  4Z5T D;  1M18 D;  2XD1 A;  3AZM A;  4NE6 A;  4NFT A;  3VH5 W;  1S32 D;  3AZJ D;  3LZ0 D;  4CAY B;  5AV6 C;  3AV1 A;  3AZE A;  3LZ1 B;  2UWX A;  4H9Q A;  5DNN A;  2ARO D;  5GXQ D;  1P3I A;  4J8V C;  1P3G A;  5B2J D;  4EO5 C;  4J8U C;  2HIO B;  2Y2Q A;  5AV5 D;  3WA9 C;  3LJA B;  4G91 C;  1EQZ B;  5B32 G;  5B40 D;  3REI C;  2HIO D;  2G5I C;  3LZ1 A;  3AV2 D;  3WKJ D;  3X1V D;  2NQB D;  1M18 B;  3WA9 A;  5B0Z C;  5CPJ D;  3EG5 B;  2CWE A;  2F8N B;  2HIO A;  3LZ1 D;  2DF4 C;  3AZG C;  1P34 A;  3IP4 C;  3W97 C;  5AV5 A;  5DNN B;  2HUE C;  5C3I C;  3AZL C;  5AV8 B;  5F99 A;  4JJN C;  3AV1 D;  5AVC B;  2CV5 B;  1KX4 B;  4NE5 A;  5DNN D;  2FFF B;  3O62 A;  1P3K C;  1ULY A;  5BNX A;  4Z66 B;  3AZK B;  1P3B D;  4LD9 A;  3B0D B;  5F99 C;  5B1M A;  5CPI C;  4YM6 D;  3AZG B;  3AN2 A;  1TZY A;  3B0C T;  1P3A C;  1ID3 C;  2Y2N A;  2NZD C;  5KDM A;  2L5A A;  4CSR B;  4J8W A;  4Z5T A;  4YM6 B;  4M6B A;  1KX4 A;  4XZQ A;  3AZM D;  5B0Z A;  4ZUX C;  3REL B;  2CV5 C;  3LZ0 B;  3UTB A;  3F6T A;  1P3K B;  5GT3 D;  3LEL A;  3C1C A;  1ZLA A;  2LY8 A;  3REK C;  3UT9 C;  3X1T A;  2ARO C;  4H9N B;  5B0Z D;  1HQ3 C;  5B32 B;  4XUJ A;  3W99 D;  5JA4 B;  3KWQ B;  3MGQ C;  2F8N K;  3WAA D;  3AZG D;  3FDD A;  4YS3 C;  3AZK D;  3KSY A;  1BH9 B;  3REK D;  2ZY4 A;  2Y2O A;  5AY8 C;  3KUY B;  5KDM B;  3UTB D;  3MGR C;  1BH8 B;  5CP6 B;  5B0Y C;  1P3B A;  1P3O C;  3WKJ B;  3AN2 C;  1WWS A;  5GSU D;  3AYW A;  3WTP B;  1AOI C;  1F66 D;  4KGC A;  5AVB B;  5CPK B;  3B6F D;  3AFA B;  5F99 D;  5B0Y A;  1P3O A;  5B33 D;  1P3F C;  4KUD D;  4R8P C;  3TU4 B;  3KXB C;  3NQJ B;  1M1A A;  4KGC C;  2J8P A;  5AVC A;  3KUY C;  1P3L C;  3H0M C;  1ZLA C;  1P3P D;  3AZM C;  1KX5 C;  4J8U B;  5E5A C;  1JFI A;  2JE5 A;  5B24 D;  1AOI B;  1P3L A;  5CPK C;  5B40 A;  1M19 C;  5G49 A;  4Z5T B;  1P3F B;  5B24 A;  4R8P B;  3TU4 C;  3REJ A;  4HGA B;  5AV6 D;  5AV9 B;  3AZI C;  3AZJ C;  3AZF C;  3AV2 A;  3B0C W;  1JFI B;  5FUG B;  3C1C B;  1AOI A;  4J8X D;  4WU8 C;  1TAF B;  5CPJ B;  5B2J C;  5BNX B;  3MGR D;  3R45 A;  2IO5 C;  5B31 B;  3AZI A;  3B6F A;  5C3I B;  3AZL B;  2FJ7 B;  3MGP A;  5B24 B;  4WU9 D;  4JJN B;  1AOI D;  3AZN C;  3C1B D;  5B2J A;  2BYK A;  3X1U A;  5AV5 B;  5AV6 A;  4HGA C;  1P3M D;  1TZY B;  3AZK C;  4R8P D;  3REH D;  1WWI A;  1N1J B;  3X1V B;  4WU8 B;  5CPJ C;  2FJ7 A;  3P5J B;  5CHL B;  3MGP B;  4JJN A;  1M18 A;  4NE3 A;  5B1L A;  5AVB D;  3EPK A;  3AZH D;  3X1S D;  3AZL D;  4ZUX B;  5AVC D;  3AZF A;  2ZY2 A;  3W96 B;  4KUD C;  4XUJ B;  1TZY C;  4XZQ D;  5GXQ B;  3X1S A;  3MNN A;  3KWQ A;  3AZH A;  1P3I C;  3REK B;  1P3M B;  1P34 B;  4KHA A;  4J8W D;  1ZLA D;  3LEL D;  2Y2M A;  5B32 D;  3WAA B;  3UTA A;  5JRG D;  4WNN B;  4X23 A;  4QLC A;  4WV4 B;  3REI A;  5B2I B;  3LEL C;  5B1M D;  3AZH B;  3AYW B;  5CP6 C;  3X1S B;  4WU9 C;  5BO0 B;  3REK A;  3X1T C;  3UTA C;  1A7W A;  3C1B B;  4XUJ C;  3MGQ A;  3WTP C;  3LJA C;  3VH5 A;  3AZG A;  4G91 B;  3MGS D;  4H9O A;  4UPK A;  5B1M C;  5B1L C;  3KWQ D;  5CPI A;  3REL A;  1BFM A;  1U35 D;  3WTP A;  3WAA C;  2Y2K A;  3AZL A;  4KGC B;  1S32 C;  4YS3 D;  1EQZ D;  3WTP E;  5AV8 A;  2PYO C;  1H3O A;  1PZR A;  4UUZ A;  3AZH C;  2NQB C;  2Y2J A;  1P3K A;  3UTB C;  3UTA B;  4WZS B;  4LD9 C;  4J8V D;  1BH9 A;  5AV8 C;  4R8P A;  4H9R B;  1HQ3 A;  4G92 B;  3WA9 D;  1F66 C;  5B31 A;  3MVD D;  4Z66 C;  5AV9 C;  1R4V A;  1S32 B;  3AZF B;  2Y2I A;  1P3F D;  3AZE D;  4ZUX A;  3LJA A;  3O62 C;  5GXQ A;  3V9R B;  3MGR A;  3LZ0 A;  3UTB B;  3REJ B;  3MVD C;  2IO5 B;  4H9R A;  4YM6 C;  1P3I D;  1N1J A;  5B24 C;  3REJ D;  3LZ0 C;  3MVD A;  2W8S A;  1B6W A;  1P3A A;  1ID3 A;  5JRG B;  2NZD A;  5B2I A;  3TU4 D;  3X1V A;  4QLC B;  2BYM B;  2ARO B;  4H9S C;  5DNM A;  2Y2H A;  1P3B B;  3KUY A;  5AV6 B;  3MNN D;  4XUJ D;  5BS7 C;  3AL0 C;  1U35 A;  4J8X C;  4WU8 D;  5AY8 B;  3AV1 B;  4J8V B;  5CPK A;  2ZY5 A;  3MGR B;  3AFA A;  4E44 A;  3MNN B;  3WKJ C;  2ARO A;  2BYM A;  2ZY3 A;  3REL D;  1U35 C;  1KX3 B;  3VH6 A;  5GXQ C;  3WA9 B;  3B6G A;  3REI B;  1P3M C;  5AV9 D;  3AZJ A;  2Y2P A;  2YFW B;  1EQZ C;  3AFA C;  2Y2G A;  5GT3 C;  5B2I D;  4XZQ B;  5B0Z B;  3KXB B;  1KU5 A;  1P3M A;  3AFA D;  1P3L B;  4H9N A;  5B2I C;  4ZBJ C;  5JA4 A;  5B32 A;  3X1S C;  3MGP D;  4WU9 B;  4H9S A;  3X1U C;  1U35 B;  1KX3 C;  5AVC C;  3AZE B;  4CAY A;  1KX4 C;  1M1A C;  5GT3 B;  2F2A C;  3VH5 T;  1TAF A;  5CPJ A;  5F99 B;  1KX3 D;  3B6F B;  3R45 B;  4E45 A;  1P34 D;  4JJN D;  3WKJ A;  4H9O B;  5B31 G;  1KX4 D;  2F8N D;  5AVB A;  2RVQ D;  3W97 A;  5GT0 C;  2NQB B;  5BT1 C;  5B2J B;  3X1U B;  3REH B;  1W2E A;  2JSS A;  3EPH A;  1P3P C;  3REL C;  3W99 C;  3LJA D;  5E5A D;  3WTP D;  3MGS C;  3UT9 B;  4J8U A;  3C1B A;  3W98 C;  3H0R C;  2JCH A;  5AY8 D;  4ZUX D;  1HQ3 B;  3NQU A;  5GT0 B;  5B0Y D;  1P3O D;  3AZI D;  4J8U D;  1P3F A;  4YS3 B;  3VH6 W;  3H0L C;  3W97 D;  3W98 D;  4WJ3 C;  1P3P B;  1HQ3 D;  2YFW A;  1HTA A;  4QLC D;  5DNM B;  5B31 D;  1F1E A;  2YFV A;  5AV8 D;  2HIO C;  4KHA B;  1H3O B;  4UUZ B;  2VQR A;  3W96 C;  4KUD B;  1P3K D;  2G5H C;  1BH8 A;  4QLC C;  4J8V A;  4Z66 D;  4WNN A;  1P3G C;  1P34 C;  1P3L D;  5CPI D;  4YS3 A;  4H9P A;  1P3P A;  3W96 D;  2BYK B;  3EPL A;  4DQY B;  2BG1 A;  1P3G D;  4J8X B;  1M19 D;  4KUD A;  3MGS A;  3AV1 C;  1ZLA B;  3LEL B;  3AYW C;  1M1A D;  3A1I A;  3AZM B;  5DNN C;  1KX5 B;  4X23 D;  4KGC D;  1F66 A;  1S32 A;  1M19 B;  5GSU B;  5AV9 A;  4Z5T C;  5CP6 D;  3REH A;  3KXB A;  1TZY D;  4XZQ C;  3UTA D;  3B0D C;  5B40 B;  5G49 B;  5CPK D;  3AZI B;  1Q9C A;  3C1C C;  3AZJ B;  3W96 A;  1KX5 A;  3AZN D;  2PYO B;  4ZBJ B;  3UT9 A;  2CV5 D;  5B31 C;  4Z66 A;  3AZF D;  3A6N B;  5GT3 A;  3C1C D;  3VH6 T;  3AZN B;  2PYO D;  3NQJ A;  3X1T D;  1T3U A;  4J8W B;  5AV5 C;  4DRB A;  3TU4 A;  1M1A B;  3EPJ A;  4CSR A;  3AV2 C;  2FJ7 D;  5BO0 A;  3KXB D;  5B1L D;  3KWQ C;  3MGQ B;  3KFU G;  3O62 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...