4Z2MH

Crystal structure of human spt16 mid-aid/h3-h4 tetramer fact histone complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
71
structure length
71
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna binding protein
molecule keywords FACT complex subunit SPT16
publication title Integrated molecular mechanism directing nucleosome reorganization by human FACT.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 71
sequence length 71
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z2mH00
3KWQD 1ZLAB 3V9RB 3MGSA 5B2IB 4J8XB 3A6ND 3C1CB 2HUEB 5AVCA 3X1TD 1TZYB 1P3GC 3W98B 3KUYD 2HIOA 3AZND 4J8WB 2BYMA 3MNND 3AZGD 5AV8D 3W96C 5DNMA 5E5AC 3MGPC 5BS7A 2PYOB 5F99D 3AFAD 4WU9C 5CPIA 1P3AA 5B0ZD 3WKJB 4E44A 2AROD 1P34A 4AWLC 5CPKA 1P3LD 4CSRA 3LZ1B 1P3KB 5DNNC 4H9SC 5B24A 1ZLAC 5B33A 4E45A 3B0CW 5B2IC 4J8XC 3AN2A 5KDMB 3C1CC 2HUEC 3X1UA 3UTBA 1TZYC 3AZMA 2F8NG 3TU4D 3W98C 5B1MB 4J8WC 3AZIA 3WTPB 4R8PA 3B6FC 2PYOC 4G92B 5E5AD 3MGPD 5B1LA 1WWIA 3WKJC 5B40A 1EQZB 2F8NH 5JA4A 3REHD 1S32B 3LZ1C 4X23A 5AV5B 1P3KC 4H9QB 3AZFB 3WA9B 5DNND 4WU8C 1ZLAD 5CP6A 2FJ7B 5B2ID 4XZQB 3X1SB 3WAAB 4H9PA 3W98D 5B1MC 4LD9C 3WTPC 5AV6A 4J8WD 4G92C 5B2JB 2PYOD 4CAYA 3LELB 2CV5A 1P3MC 1EQZC 3MVDA 3WKJD 4J8UA 3AV1A 4G91B 3AV2A 1S32C 4QLCB 5AV5C 4H9OA 3LZ1D 1TAFA 3AZFC 3AZKD 3WA9C 1P3KD 1KX3B 3AZJA 1H3OA 3W97D 1JFIB 5BO0B 2FJ7C 4ZUXD 4Z66B 4XZQC 3X1SC 3WAAC 4KGCA 3A6NB 1BH8A 2BYKA 1P3OB 1M18D 5B1MD 1F66A 3KXBA 1P3IB 2F8NK 5AVBB 4YM6A 5B2JC 5GSUB 3LELC 5AV8B 3REKA 5AY8C 3KWQA 4WNNA 5BNXA 1N1JB 1EQZD 4G91C 1F1EA 5B0ZB 3B0CT 4QLCC 1S32D 4WZSB 3LZ0D 3REIB 5AV5D 3X1TA 3AZFD 5GT3B 3KUYA 4KUDA 4Z66C 3MNNA 3AZGA 1M19A 3UTAA 3AZEB 2FJ7D 5F99A 3AFAA 3A6NC 3WAAD 4H9RB 4Z2MG 1P3OC 1KX5B 1M1AB 2AROA 5B31B 5AVBC 3MGQB 1P3LA 4XUJB 5GSUC 5B2JD 5AV8C 3C1BB 3LELD 3AYWA 1ID3B 2YFWB 3R45A 5B0ZC 1P3BB 1U35B 2NZDB 4QLCD 3REIC 5CPJB 5GT3C 1P3GA 1KX3D 3B6GB 1BH9B 1HQ3B 3AZEC 4Z66D 5JRGD 3W96A 3NQUA 3MGPA 5B0YD 4WU9A 1P3OD 1M1AC 1KX5C 2F8NB 5B31C 2YFVA 4Z5TB 3MGQC 3TU4C 1P3ID 5GXQB 5AVBD 3UT9B 4XUJC 3MGSB 4NFTA 5GSUD 4HGAB 5DNNA 4H9SA 1ZLAA 3V9RA 1U35C 5B2IA 2NZDC 4J8XA 4EO5B 3C1CA 3REHC 3W99A 3REID 1TZYA 2NQBB 3B6GC 5GT3D 3AZKB 4JJND 1HQ3C 4YS3B 3AZED 3W97B 3B6FA 4ZUXB 3WKJA 1KX5D 1M1AD 3RELB 4Z5TC 5B31D 5B24B 4J8VB 5GXQC 3MGQD 3UT9C 1M18B 3MGSC 3LZ1A 4XUJD 4HGAC 3NQJB 3C1BD 1ID3D 2LY8A 4WU8A 1BFMA 3AZMB 1P3BD 4EO5C 5KDMA 1U35D 2NZDD 1P3FA 1AOID 4R8PB 2NQBC 3REJB 5CPJD 3LZ0B 3AZKC 3B6GD 3X1VD 5B1MA 5BNVB 4YS3C 4LD9A 3WTPA 1HQ3D 3W97C 5JA4B 4ZUXC 5BT1C 1P3MA 1EQZA 3RELC 2F8ND 4J8VC 4KHAA 4Z5TD 1S32A 1M18C 4DRAA 5GXQD 3UT9D 3MGSD 5AV5A 4H9QA 3AZFA 3WA9A 1P3PB 1B67A 2FJ7A 5B32B 3WTPE 4XZQA 2HIOD 3REJC 3X1SA 3WAAA 2NQBD 3LZ0C 5CPID 1P3AD 4YS3D 3LJAB 5FUGB 4UUZB 5G49B 1P34D 5B2JA 3AV2B 5BT1D 3LELA 5CPKD 5JRGB 2JSSA 5AY8A 1KX4B 5B0YB 3VH5W 3AZHB 3RELD 3AZLB 5B24D 3AZJB 4J8VD 4QLCA 3MGRB 4M6BA 5AV9B 1P3PC 3X1UD 3UTBD 3AZMD 5BO0A 5B32C 4NE5A 4Z66A 5GT0B 4DRBA 4R8PD 3B0DB 3A6NA 3REJD 1P3OA 5B1LD 1KX3C 5BNXB 3B0BA 3LJAC 5AVBA 5B40D 4JJNB 3AZNA 3AV2C 2CWEA 5GSUA 5JRGC 5AV8A 1R4VA 1KX4C 5B0YC 3AZHC 1N1JA 3AZLC 3AZJC 5B0ZA 3MGRC 1HTAA 3REIA 1P3IC 1M19B 5AV9C 5GT3A 1P3PD 1B6WA 5B32D 2IO5B 5GT0C 4Z2MH 3B0DC 4H9RA 4H9NB 1KX5A 1M1AA 1AOIB 1KU5A 5B31A 3AYWB 2CV5D 3MGQA 3TU4A 3LJAD 3R45B 4JJNC 3X1VB 5CHLB 4XUJA 3AV2D 4NE3A 2YFWA 3O62B 5E5AA 1KX4D 3AZHD 3AZLD 1U35A 2NZDA 3AZJD 3MGRD 3REHA 3W96B 5AV9D 3C1BC 1ID3C 4KGCD 1HQ3A 2IO5C 5AVCB 5GT0D 1P3BC 4YM6D 2HIOB 1AOIC 2BYMB 4WV4B 5CPJC 5DNMB 4Z5TA 1ULYA 3VH5T 3X1VC 5GXQA 5CPIB 3UT9A 3W98A 1WWSA 2RVQC 4J8WA 1P3AB 3O62C 3W99B 1P34B 2PYOA 3VH5A 5CPKB 5B31G 4CSRB 4KUDD 5B33B 1M19D 3UTAD 2NQBA 3B6FB 3AN2B 3AZKA 1P3KA 4YS3A 5AVCC 3W97A 3X1UB 3UTBB 4ZUXA 3KSYA 2HIOC 3AZIB 5DNMC 3RELA 3AYWD 5BS7C 4J8VA 4WU8B 5CPIC 1M18A 5B1LB 1P3AC 3NQJA 2RVQD 5B40B 3W99C 1P34C 1P3FB 3O62D 5CPKC 4X23B 1P3GD 5B24C 4LD9B 5B33C 2L5AA 1Q9CA 3REJA 5CP6B 3LZ0A 3AN2C 3VH6W 3W96D 4WU9D 5BNVA 3X1UC 4ZBJB 3UTBC 3AZMC 1P3MB 5AVCD 4KHAB 4H9PB 3AZIC 5AV6B 4R8PC 5C3IB 5DNMD 1A7WA 5B1LC 4CAYB 2CV5B 5B40C 4J8XD 3MVDB 1P3FC 4J8UB 3C1CD 3AV1B 3W99D 1P3PA 4X23C 1TZYD 5B32A 4H9OB 1TAFB 5B33D 1H3OB 5CP6C 3B6FD 3AN2D 4ZBJC 5AY8B 1KX3A 3LJAA 5FUGA 4UUZA 4KGCB 5G49A 1BH8B 4NE6A 2BYKB 1JFIA 5JRGA 5AV6C 1KX4A 5B0YA 3KXBB 5C3IC 3AZID 3AZHA 1F66B 4YM6B 3AZLA 4WU8D 3MGRA 2CV5C 3REKB 3MVDC 3KWQB 4WNNB 1P3IA 4J8UC 3AV1C 5AV9A 1P3FD 4X23D 3X1TB 5GT0A 4LD9D 3WTPD 3KUYB 3AZNB 4KUDB 5CP6D 3MNNB 3AZGB 3UTAB 5B32G 5F99B 3AFAB 1P3MD 4KGCC 4JJNA 3AZEA 2AROB 1F66C 3KXBC 5AV6D 4YM6C 1P3LB 3WA9D 3REKC 3KWQC 3MVDD 4XZQD 4J8UD 3AV1D 3C1BA 3X1SD 1ID3A 3VH6T 3X1TC 1P3BA 3TU4B 3KUYC 1P3GB 3AZNC 4KUDC 4H9NA 3MNNC 3AZGC 1M19C 3VH6A 3UTAC 1AOIA 5CPJA 3NQUB 5E5AB 5AY8D 5F99C 3AFAC 3MGPB 3B6GA 3X1VA 4WU9B 1BH9A 2AROC 3O62A 2YFVB 3REHB 1F66D 3KXBD 4AWLB 1P3LC 2F8NA 3AYWC 5DNNB 3REKD
chains in the Genus database with same CATH superfamily
3KWQD 1ZLAB 1W2EA 3V9RB 3MGSA 5B2IB 4J8XB 3A6ND 3C1CB 2HUEB 5AVCA 3X1TD 1TZYB 1P3GC 3W98B 3KUYD 2HIOA 3AZND 4J8WB 2BYMA 3MNND 3AZGD 5AV8D 3W96C 5DNMA 5E5AC 3MGPC 5BS7A 2PYOB 5F99D 3AFAD 4WU9C 5CPIA 1P3AA 5B0ZD 3WKJB 4E44A 2ZY4A 2AROD 1P34A 4AWLC 5CPKA 2UWXA 1P3LD 4CSRA 3LZ1B 1P3KB 5DNNC 4H9SC 5B24A 1ZLAC 5B33A 4E45A 3B0CW 5B2IC 4J8XC 3AN2A 5KDMB 3C1CC 2HUEC 3X1UA 3UTBA 1TZYC 3AZMA 2F8NG 2G5IC 3TU4D 3W98C 5B1MB 4J8WC 3AZIA 3WTPB 4R8PA 3B6FC 3KFUG 2PYOC 4G92B 5E5AD 3MGPD 5B1LA 1WWIA 3WKJC 5B40A 1EQZB 2F8NH 5JA4A 3P5JB 3REHD 1S32B 3LZ1C 4X23A 5AV5B 1P3KC 4H9QB 3AZFB 3WA9B 5DNND 4WU8C 1ZLAD 5CP6A 2FJ7B 5B2ID 4XZQB 3X1SB 3WAAB 2JE5A 4H9PA 3W98D 5B1MC 4LD9C 3WTPC 5AV6A 4J8WD 4G92C 5B2JB 2PYOD 4CAYA 3LELB 2CV5A 1P3MC 3EG5B 3MVDA 1EQZC 3WKJD 3A1IA 4J8UA 3AV1A 4G91B 3AV2A 1S32C 3H0MC 4QLCB 5AV5C 4H9OA 3LZ1D 1TAFA 3AZFC 3AZKD 3WA9C 1P3KD 3EPKA 1KX3B 3AZJA 1H3OA 3H0LC 3W97D 1JFIB 5BO0B 2FJ7C 4ZUXD 4Z66B 4XZQC 3X1SC 3WAAC 4KGCA 3A6NB 1BH8A 2BYKA 1P3OB 1M18D 4UPKA 5B1MD 1F66A 3KXBA 1P3IB 2F8NK 5AVBB 4YM6A 5B2JC 2Y2LA 5GSUB 3LELC 5AV8B 3REKA 5AY8C 2BG1A 4WNNA 5BNXA 3KWQA 1N1JB 1EQZD 4G91C 1F1EA 5B0ZB 3B0CT 4QLCC 1S32D 4WZSB 3LZ0D 3REIB 5AV5D 3X1TA 3AZFD 2Y2PA 5GT3B 3KUYA 2F2AC 4KUDA 4Z66C 3MNNA 3AZGA 1M19A 3UTAA 3AZEB 3F6TA 2FJ7D 5F99A 3AFAA 3A6NC 3WAAD 2Y2KA 4H9RB 4Z2MG 1P3OC 1KX5B 1M1AB 2AROA 5B31B 4WJ3C 5AVBC 3MGQB 1P3LA 4XUJB 5GSUC 5B2JD 5AV8C 3C1BB 3LELD 3AYWA 1ID3B 2YFWB 2ZM5A 3R45A 5B0ZC 1P3BB 1U35B 2NZDB 2Y2QA 4QLCD 3REIC 5CPJB 5GT3C 1P3GA 1KX3D 3B6GB 1Z2CB 1BH9B 1HQ3B 3AZEC 4Z66D 5JRGD 2J8PA 3W96A 3NQUA 3MGPA 5B0YD 4WU9A 1P3OD 1M1AC 1KX5C 2F8NB 5B31C 2YFVA 4Z5TB 3MGQC 3TU4C 1P3ID 5GXQB 5AVBD 3UT9B 4XUJC 3MGSB 4NFTA 5GSUD 4HGAB 5DNNA 4H9SA 1ZLAA 4DQYB 3V9RA 1U35C 5B2IA 2NZDC 3A1KA 4J8XA 4EO5B 3C1CA 3REHC 3W99A 3REID 1TZYA 2NQBB 3B6GC 5GT3D 3AZKB 4JJND 1HQ3C 3AL0C 4YS3B 3AZED 3W97B 3B6FA 4ZUXB 3WKJA 1KX5D 1M1AD 3RELB 4Z5TC 5B31D 5B24B 4J8VB 5GXQC 3MGQD 3UT9C 1M18B 3MGSC 3LZ1A 4XUJD 4HGAC 3NQJB 3C1BD 1ID3D 2LY8A 4WU8A 1BFMA 3AZMB 2JCHA 1P3BD 4EO5C 5KDMA 1U35D 2NZDD 1P3FA 1AOID 4R8PB 2NQBC 3REJB 5CPJD 3LZ0B 3AZKC 3B6GD 3X1VD 5B1MA 5BNVB 4YS3C 4LD9A 3WTPA 1HQ3D 3W97C 5JA4B 4ZUXC 5BT1C 3H0RC 1P3MA 1EQZA 3RELC 2F8ND 2XD5A 4J8VC 2Y2OA 4KHAA 4Z5TD 1S32A 1M18C 4DRAA 5GXQD 3UT9D 3MGSD 5AV5A 4H9QA 3AZFA 3WA9A 1P3PB 1B67A 2FJ7A 5B32B 4XZQA 3WTPE 2HIOD 3REJC 3X1SA 3WAAA 2NQBD 3LZ0C 5CPID 1P3AD 4YS3D 3LJAB 2DQNC 4UUZB 5FUGB 5G49B 1P34D 5B2JA 3AV2B 5BT1D 3LELA 5CPKD 5JRGB 2JSSA 5AY8A 1KX4B 5B0YB 3VH5W 3AZHB 3RELD 3AZLB 5B24D 3AZJB 4J8VD 4QLCA 3MGRB 3FDDA 4M6BA 2DF4C 5AV9B 1P3PC 3X1UD 3UTBD 3AZMD 5BO0A 5B32C 4NE5A 4Z66A 5GT0B 4DRBA 4R8PD 3B0DB 3A6NA 3REJD 1P3OA 5B1LD 1KX3C 5BNXB 2Y2JA 3B0BA 5AVBA 5B40D 3LJAC 4JJNB 3AZNA 3AV2C 2CWEA 5GSUA 5JRGC 5AV8A 1R4VA 1KX4C 5B0YC 3AZHC 1N1JA 3AZLC 3AZJC 5B0ZA 3MGRC 1HTAA 3REIA 1P3IC 1M19B 3EPJA 5AV9C 5GT3A 1P3PD 1B6WA 5B32D 2IO5B 5GT0C 4Z2MH 3B0DC 4H9RA 4H9NB 1KX5A 1M1AA 1AOIB 1KU5A 5B31A 3AYWB 2CV5D 3MGQA 3TU4A 3LJAD 3R45B 4JJNC 3X1VB 5CHLB 4XUJA 3AV2D 4NE3A 2YFWA 3O62B 2Y2HA 5E5AA 1KX4D 3AZHD 3AZLD 1U35A 2NZDA 3AZJD 3MGRD 3REHA 3W96B 5AV9D 3C1BC 1ID3C 4KGCD 1HQ3A 2IO5C 5AVCB 5GT0D 1P3BC 2Y2MA 4YM6D 2HIOB 1PZRA 1AOIC 2BYMB 4WV4B 5CPJC 5DNMB 4Z5TA 1ULYA 3VH5T 3X1VC 5GXQA 5CPIB 3UT9A 3W98A 1WWSA 2RVQC 4J8WA 1P3AB 3O62C 3W99B 1P34B 2PYOA 3VH5A 5CPKB 5B31G 4CSRB 2ZY5A 4KUDD 5B33B 1M19D 3UTAD 2NQBA 3B6FB 3AN2B 3AZKA 1P3KA 4YS3A 5AVCC 3W97A 3X1UB 3UTBB 2Y2IA 4ZUXA 3KSYA 2XD1A 2Y2GA 2HIOC 3AZIB 5DNMC 3RELA 3AYWD 5BS7C 4J8VA 4WU8B 5CPIC 1M18A 5B1LB 1P3AC 3NQJA 2RVQD 5B40B 3W99C 1P34C 1P3FB 3O62D 5CPKC 4X23B 2G5HC 1P3GD 5B24C 2Y2NA 4LD9B 5B33C 2L5AA 1Q9CA 3REJA 5CP6B 3LZ0A 3AN2C 3VH6W 3W96D 4WU9D 5BNVA 3X1UC 4ZBJB 3UTBC 3AZMC 1P3MB 5AVCD 4KHAB 4H9PB 3AZIC 5AV6B 4R8PC 5C3IB 2VQRA 5DNMD 1A7WA 5B1LC 4CAYB 2CV5B 5B40C 4J8XD 3MVDB 1P3FC 4J8UB 3C1CD 3AV1B 3W99D 1P3PA 4X23C 1TZYD 5B32A 4H9OB 1TAFB 5B33D 1H3OB 5CP6C 3B6FD 3AN2D 2RIQA 4ZBJC 5AY8B 1KX3A 3LJAA 5FUGA 2ZY3A 4UUZA 5G49A 1BH8B 4NE6A 2BYKB 1JFIA 4KGCB 5JRGA 5AV6C 1KX4A 5B0YA 3KXBB 5C3IC 3AZID 3AZHA 1F66B 4YM6B 3AZLA 4WU8D 3MGRA 2CV5C 3REKB 3MVDC 3KWQB 4WNNB 1P3IA 4J8UC 3AV1C 5AV9A 1P3FD 2FFFB 4X23D 3X1TB 5GT0A 4LD9D 3WTPD 3KUYB 3AZNB 4KUDB 5CP6D 3MNNB 3AZGB 3UTAB 5B32G 5F99B 3AFAB 1P3MD 4KGCC 2W8SA 4JJNA 3AZEA 3IP4C 2AROB 1F66C 3KXBC 5AV6D 4YM6C 1P3LB 3WA9D 3REKC 3KWQC 3MVDD 4XZQD 4J8UD 3AV1D 3EPHA 3C1BA 3X1SD 1ID3A 3VH6T 3X1TC 1T3UA 1P3BA 3TU4B 3KUYC 1P3GB 3EPLA 3AZNC 4KUDC 4H9NA 3MNNC 3AZGC 1M19C 3VH6A 3UTAC 1AOIA 5CPJA 3NQUB 5E5AB 5AY8D 5F99C 3AFAC 3MGPB 3B6GA 3X1VA 4WU9B 1BH9A 2AROC 3O62A 2YFVB 3REHB 1F66D 3KXBD 4AWLB 1P3LC 2F8NA 2ZY2A 3AYWC 5DNNB 3REKD
chains in the Genus database with same CATH topology
3KWQD 1ZLAB 1W2EA 3V9RB 3MGSA 5B2IB 4J8XB 3A6ND 3C1CB 2HUEB 5AVCA 3X1TD 1TZYB 1P3GC 3W98B 3KUYD 2HIOA 3AZND 4J8WB 2BYMA 3MNND 3AZGD 5AV8D 3W96C 5DNMA 5E5AC 3MGPC 5BS7A 2PYOB 5F99D 3AFAD 4WU9C 5CPIA 1P3AA 5B0ZD 3WKJB 4E44A 2ZY4A 2AROD 1P34A 4AWLC 5CPKA 2UWXA 1P3LD 4CSRA 3LZ1B 1P3KB 5DNNC 4H9SC 5B24A 1ZLAC 5B33A 4E45A 3B0CW 5B2IC 4J8XC 3AN2A 5KDMB 3C1CC 2HUEC 3X1UA 3UTBA 1TZYC 3AZMA 2F8NG 2G5IC 3TU4D 3W98C 5B1MB 4J8WC 3AZIA 3WTPB 4R8PA 3B6FC 3KFUG 2PYOC 4G92B 5E5AD 3MGPD 5B1LA 1WWIA 3WKJC 5B40A 1EQZB 2F8NH 5JA4A 3P5JB 3REHD 1S32B 3LZ1C 4X23A 5AV5B 1P3KC 4H9QB 3AZFB 3WA9B 5DNND 4WU8C 1ZLAD 5CP6A 2FJ7B 5B2ID 4XZQB 3X1SB 3WAAB 2JE5A 4H9PA 3W98D 5B1MC 4LD9C 3WTPC 5AV6A 4J8WD 4G92C 5B2JB 2PYOD 4CAYA 3LELB 2CV5A 1P3MC 3EG5B 3MVDA 1EQZC 3WKJD 3A1IA 4J8UA 3AV1A 4G91B 3AV2A 1S32C 3H0MC 4QLCB 5AV5C 4H9OA 3LZ1D 1TAFA 3AZFC 3AZKD 3WA9C 1P3KD 3EPKA 1KX3B 3AZJA 1H3OA 3H0LC 3W97D 1JFIB 5BO0B 2FJ7C 4ZUXD 4Z66B 4XZQC 3X1SC 3WAAC 4KGCA 3A6NB 1BH8A 2BYKA 1P3OB 1M18D 4UPKA 5B1MD 1F66A 3KXBA 1P3IB 2F8NK 5AVBB 4YM6A 5B2JC 2Y2LA 5GSUB 3LELC 5AV8B 3REKA 5AY8C 2BG1A 4WNNA 5BNXA 3KWQA 1N1JB 1EQZD 4G91C 1F1EA 5B0ZB 3B0CT 4QLCC 1S32D 4WZSB 3LZ0D 3REIB 5AV5D 3X1TA 3AZFD 2Y2PA 5GT3B 3KUYA 2F2AC 4KUDA 4Z66C 3MNNA 3AZGA 1M19A 3UTAA 3AZEB 3F6TA 2FJ7D 5F99A 3AFAA 3A6NC 3WAAD 2Y2KA 4H9RB 4Z2MG 1P3OC 1KX5B 1M1AB 2AROA 5B31B 4WJ3C 5AVBC 3MGQB 1P3LA 4XUJB 5GSUC 5B2JD 5AV8C 3C1BB 3LELD 3AYWA 1ID3B 2YFWB 2ZM5A 3R45A 5B0ZC 1P3BB 1U35B 2NZDB 2Y2QA 4QLCD 3REIC 5CPJB 5GT3C 1P3GA 1KX3D 3B6GB 1Z2CB 1BH9B 1HQ3B 3AZEC 4Z66D 5JRGD 2J8PA 3W96A 3NQUA 3MGPA 5B0YD 4WU9A 1P3OD 1M1AC 1KX5C 2F8NB 5B31C 2YFVA 4Z5TB 3MGQC 3TU4C 1P3ID 5GXQB 5AVBD 3UT9B 4XUJC 3MGSB 4NFTA 5GSUD 4HGAB 5DNNA 4H9SA 1ZLAA 4DQYB 3V9RA 1U35C 5B2IA 2NZDC 3A1KA 4J8XA 4EO5B 3C1CA 3REHC 3W99A 3REID 1TZYA 2NQBB 3B6GC 5GT3D 3AZKB 4JJND 1HQ3C 3AL0C 4YS3B 3AZED 3W97B 3B6FA 4ZUXB 3WKJA 1KX5D 1M1AD 3RELB 4Z5TC 5B31D 5B24B 4J8VB 5GXQC 3MGQD 3UT9C 1M18B 3MGSC 3LZ1A 4XUJD 4HGAC 3NQJB 3C1BD 1ID3D 2LY8A 4WU8A 1BFMA 3AZMB 2JCHA 1P3BD 4EO5C 5KDMA 1U35D 2NZDD 1P3FA 1AOID 4R8PB 2NQBC 3REJB 5CPJD 3LZ0B 3AZKC 3B6GD 3X1VD 5B1MA 5BNVB 4YS3C 4LD9A 3WTPA 1HQ3D 3W97C 5JA4B 4ZUXC 5BT1C 3H0RC 1P3MA 1EQZA 3RELC 2F8ND 2XD5A 4J8VC 2Y2OA 4KHAA 4Z5TD 1S32A 1M18C 4DRAA 5GXQD 3UT9D 3MGSD 5AV5A 4H9QA 3AZFA 3WA9A 1P3PB 1B67A 2FJ7A 5B32B 4XZQA 3WTPE 2HIOD 3REJC 3X1SA 3WAAA 2NQBD 3LZ0C 5CPID 1P3AD 4YS3D 3LJAB 2DQNC 4UUZB 5FUGB 5G49B 1P34D 5B2JA 3AV2B 5BT1D 3LELA 5CPKD 5JRGB 2JSSA 5AY8A 1KX4B 5B0YB 3VH5W 3AZHB 3RELD 3AZLB 5B24D 3AZJB 4J8VD 4QLCA 3MGRB 3FDDA 4M6BA 2DF4C 5AV9B 1P3PC 3X1UD 3UTBD 3AZMD 5BO0A 5B32C 4NE5A 4Z66A 5GT0B 4DRBA 4R8PD 3B0DB 3A6NA 3REJD 1P3OA 5B1LD 1KX3C 5BNXB 2Y2JA 3B0BA 5AVBA 5B40D 3LJAC 4JJNB 3AZNA 3AV2C 2CWEA 5GSUA 5JRGC 5AV8A 1R4VA 1KX4C 5B0YC 3AZHC 1N1JA 3AZLC 3AZJC 5B0ZA 3MGRC 1HTAA 3REIA 1P3IC 1M19B 3EPJA 5AV9C 5GT3A 1P3PD 1B6WA 5B32D 2IO5B 5GT0C 4Z2MH 3B0DC 4H9RA 4H9NB 1KX5A 1M1AA 1AOIB 1KU5A 5B31A 3AYWB 2CV5D 3MGQA 3TU4A 3LJAD 3R45B 4JJNC 3X1VB 5CHLB 4XUJA 3AV2D 4NE3A 2YFWA 3O62B 2Y2HA 5E5AA 1KX4D 3AZHD 3AZLD 1U35A 2NZDA 3AZJD 3MGRD 3REHA 3W96B 5AV9D 3C1BC 1ID3C 4KGCD 1HQ3A 2IO5C 5AVCB 5GT0D 1P3BC 2Y2MA 4YM6D 2HIOB 1PZRA 1AOIC 2BYMB 4WV4B 5CPJC 5DNMB 4Z5TA 1ULYA 3VH5T 3X1VC 5GXQA 5CPIB 3UT9A 3W98A 1WWSA 2RVQC 4J8WA 1P3AB 3O62C 3W99B 1P34B 2PYOA 3VH5A 5CPKB 5B31G 4CSRB 2ZY5A 4KUDD 5B33B 1M19D 3UTAD 2NQBA 3B6FB 3AN2B 3AZKA 1P3KA 4YS3A 5AVCC 3W97A 3X1UB 3UTBB 2Y2IA 4ZUXA 3KSYA 2XD1A 2Y2GA 2HIOC 3AZIB 5DNMC 3RELA 3AYWD 5BS7C 4J8VA 4WU8B 5CPIC 1M18A 5B1LB 1P3AC 3NQJA 2RVQD 5B40B 3W99C 1P34C 1P3FB 3O62D 5CPKC 4X23B 2G5HC 1P3GD 5B24C 2Y2NA 4LD9B 5B33C 2L5AA 1Q9CA 3REJA 5CP6B 3LZ0A 3AN2C 3VH6W 3W96D 4WU9D 5BNVA 3X1UC 4ZBJB 3UTBC 3AZMC 1P3MB 5AVCD 4KHAB 4H9PB 3AZIC 5AV6B 4R8PC 5C3IB 2VQRA 5DNMD 1A7WA 5B1LC 4CAYB 2CV5B 5B40C 4J8XD 3MVDB 1P3FC 4J8UB 3C1CD 3AV1B 3W99D 1P3PA 4X23C 1TZYD 5B32A 4H9OB 1TAFB 5B33D 1H3OB 5CP6C 3B6FD 3AN2D 2RIQA 4ZBJC 5AY8B 1KX3A 3LJAA 5FUGA 2ZY3A 4UUZA 5G49A 1BH8B 4NE6A 2BYKB 1JFIA 4KGCB 5JRGA 5AV6C 1KX4A 5B0YA 3KXBB 5C3IC 3AZID 3AZHA 1F66B 4YM6B 3AZLA 4WU8D 3MGRA 2CV5C 3REKB 3MVDC 3KWQB 4WNNB 1P3IA 4J8UC 3AV1C 5AV9A 1P3FD 2FFFB 4X23D 3X1TB 5GT0A 4LD9D 3WTPD 3KUYB 3AZNB 4KUDB 5CP6D 3MNNB 3AZGB 3UTAB 5B32G 5F99B 3AFAB 1P3MD 4KGCC 2W8SA 4JJNA 3AZEA 3IP4C 2AROB 1F66C 3KXBC 5AV6D 4YM6C 1P3LB 3WA9D 3REKC 3KWQC 3MVDD 4XZQD 4J8UD 3AV1D 3EPHA 3C1BA 3X1SD 1ID3A 3VH6T 3X1TC 1T3UA 1P3BA 3TU4B 3KUYC 1P3GB 3EPLA 3AZNC 4KUDC 4H9NA 3MNNC 3AZGC 1M19C 3VH6A 3UTAC 1AOIA 5CPJA 3NQUB 5E5AB 5AY8D 5F99C 3AFAC 3MGPB 3B6GA 3X1VA 4WU9B 1BH9A 2AROC 3O62A 2YFVB 3REHB 1F66D 3KXBD 4AWLB 1P3LC 2F8NA 2ZY2A 3AYWC 5DNNB 3REKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWQ D;  1ZLA B;  3V9R B;  3MGS A;  5B2I B;  4J8X B;  3A6N D;  3C1C B;  2HUE B;  5AVC A;  3X1T D;  1TZY B;  1P3G C;  3W98 B;  3KUY D;  2HIO A;  3AZN D;  4J8W B;  2BYM A;  3MNN D;  3AZG D;  5AV8 D;  3W96 C;  5DNM A;  5E5A C;  3MGP C;  5BS7 A;  2PYO B;  5F99 D;  3AFA D;  4WU9 C;  5CPI A;  1P3A A;  5B0Z D;  3WKJ B;  4E44 A;  2ARO D;  1P34 A;  4AWL C;  5CPK A;  1P3L D;  4CSR A;  3LZ1 B;  1P3K B;  5DNN C;  4H9S C;  5B24 A;  1ZLA C;  5B33 A;  4E45 A;  3B0C W;  5B2I C;  4J8X C;  3AN2 A;  5KDM B;  3C1C C;  2HUE C;  3X1U A;  3UTB A;  1TZY C;  3AZM A;  2F8N G;  3TU4 D;  3W98 C;  5B1M B;  4J8W C;  3AZI A;  3WTP B;  4R8P A;  3B6F C;  2PYO C;  4G92 B;  5E5A D;  3MGP D;  5B1L A;  1WWI A;  3WKJ C;  5B40 A;  1EQZ B;  2F8N H;  5JA4 A;  3REH D;  1S32 B;  3LZ1 C;  4X23 A;  5AV5 B;  1P3K C;  4H9Q B;  3AZF B;  3WA9 B;  5DNN D;  4WU8 C;  1ZLA D;  5CP6 A;  2FJ7 B;  5B2I D;  4XZQ B;  3X1S B;  3WAA B;  4H9P A;  3W98 D;  5B1M C;  4LD9 C;  3WTP C;  5AV6 A;  4J8W D;  4G92 C;  5B2J B;  2PYO D;  4CAY A;  3LEL B;  2CV5 A;  1P3M C;  1EQZ C;  3MVD A;  3WKJ D;  4J8U A;  3AV1 A;  4G91 B;  3AV2 A;  1S32 C;  4QLC B;  5AV5 C;  4H9O A;  3LZ1 D;  1TAF A;  3AZF C;  3AZK D;  3WA9 C;  1P3K D;  1KX3 B;  3AZJ A;  1H3O A;  3W97 D;  1JFI B;  5BO0 B;  2FJ7 C;  4ZUX D;  4Z66 B;  4XZQ C;  3X1S C;  3WAA C;  4KGC A;  3A6N B;  1BH8 A;  2BYK A;  1P3O B;  1M18 D;  5B1M D;  1F66 A;  3KXB A;  1P3I B;  2F8N K;  5AVB B;  4YM6 A;  5B2J C;  5GSU B;  3LEL C;  5AV8 B;  3REK A;  5AY8 C;  3KWQ A;  4WNN A;  5BNX A;  1N1J B;  1EQZ D;  4G91 C;  1F1E A;  5B0Z B;  3B0C T;  4QLC C;  1S32 D;  4WZS B;  3LZ0 D;  3REI B;  5AV5 D;  3X1T A;  3AZF D;  5GT3 B;  3KUY A;  4KUD A;  4Z66 C;  3MNN A;  3AZG A;  1M19 A;  3UTA A;  3AZE B;  2FJ7 D;  5F99 A;  3AFA A;  3A6N C;  3WAA D;  4H9R B;  4Z2M G;  1P3O C;  1KX5 B;  1M1A B;  2ARO A;  5B31 B;  5AVB C;  3MGQ B;  1P3L A;  4XUJ B;  5GSU C;  5B2J D;  5AV8 C;  3C1B B;  3LEL D;  3AYW A;  1ID3 B;  2YFW B;  3R45 A;  5B0Z C;  1P3B B;  1U35 B;  2NZD B;  4QLC D;  3REI C;  5CPJ B;  5GT3 C;  1P3G A;  1KX3 D;  3B6G B;  1BH9 B;  1HQ3 B;  3AZE C;  4Z66 D;  5JRG D;  3W96 A;  3NQU A;  3MGP A;  5B0Y D;  4WU9 A;  1P3O D;  1M1A C;  1KX5 C;  2F8N B;  5B31 C;  2YFV A;  4Z5T B;  3MGQ C;  3TU4 C;  1P3I D;  5GXQ B;  5AVB D;  3UT9 B;  4XUJ C;  3MGS B;  4NFT A;  5GSU D;  4HGA B;  5DNN A;  4H9S A;  1ZLA A;  3V9R A;  1U35 C;  5B2I A;  2NZD C;  4J8X A;  4EO5 B;  3C1C A;  3REH C;  3W99 A;  3REI D;  1TZY A;  2NQB B;  3B6G C;  5GT3 D;  3AZK B;  4JJN D;  1HQ3 C;  4YS3 B;  3AZE D;  3W97 B;  3B6F A;  4ZUX B;  3WKJ A;  1KX5 D;  1M1A D;  3REL B;  4Z5T C;  5B31 D;  5B24 B;  4J8V B;  5GXQ C;  3MGQ D;  3UT9 C;  1M18 B;  3MGS C;  3LZ1 A;  4XUJ D;  4HGA C;  3NQJ B;  3C1B D;  1ID3 D;  2LY8 A;  4WU8 A;  1BFM A;  3AZM B;  1P3B D;  4EO5 C;  5KDM A;  1U35 D;  2NZD D;  1P3F A;  1AOI D;  4R8P B;  2NQB C;  3REJ B;  5CPJ D;  3LZ0 B;  3AZK C;  3B6G D;  3X1V D;  5B1M A;  5BNV B;  4YS3 C;  4LD9 A;  3WTP A;  1HQ3 D;  3W97 C;  5JA4 B;  4ZUX C;  5BT1 C;  1P3M A;  1EQZ A;  3REL C;  2F8N D;  4J8V C;  4KHA A;  4Z5T D;  1S32 A;  1M18 C;  4DRA A;  5GXQ D;  3UT9 D;  3MGS D;  5AV5 A;  4H9Q A;  3AZF A;  3WA9 A;  1P3P B;  1B67 A;  2FJ7 A;  5B32 B;  3WTP E;  4XZQ A;  2HIO D;  3REJ C;  3X1S A;  3WAA A;  2NQB D;  3LZ0 C;  5CPI D;  1P3A D;  4YS3 D;  3LJA B;  5FUG B;  4UUZ B;  5G49 B;  1P34 D;  5B2J A;  3AV2 B;  5BT1 D;  3LEL A;  5CPK D;  5JRG B;  2JSS A;  5AY8 A;  1KX4 B;  5B0Y B;  3VH5 W;  3AZH B;  3REL D;  3AZL B;  5B24 D;  3AZJ B;  4J8V D;  4QLC A;  3MGR B;  4M6B A;  5AV9 B;  1P3P C;  3X1U D;  3UTB D;  3AZM D;  5BO0 A;  5B32 C;  4NE5 A;  4Z66 A;  5GT0 B;  4DRB A;  4R8P D;  3B0D B;  3A6N A;  3REJ D;  1P3O A;  5B1L D;  1KX3 C;  5BNX B;  3B0B A;  3LJA C;  5AVB A;  5B40 D;  4JJN B;  3AZN A;  3AV2 C;  2CWE A;  5GSU A;  5JRG C;  5AV8 A;  1R4V A;  1KX4 C;  5B0Y C;  3AZH C;  1N1J A;  3AZL C;  3AZJ C;  5B0Z A;  3MGR C;  1HTA A;  3REI A;  1P3I C;  1M19 B;  5AV9 C;  5GT3 A;  1P3P D;  1B6W A;  5B32 D;  2IO5 B;  5GT0 C;  4Z2M H;  3B0D C;  4H9R A;  4H9N B;  1KX5 A;  1M1A A;  1AOI B;  1KU5 A;  5B31 A;  3AYW B;  2CV5 D;  3MGQ A;  3TU4 A;  3LJA D;  3R45 B;  4JJN C;  3X1V B;  5CHL B;  4XUJ A;  3AV2 D;  4NE3 A;  2YFW A;  3O62 B;  5E5A A;  1KX4 D;  3AZH D;  3AZL D;  1U35 A;  2NZD A;  3AZJ D;  3MGR D;  3REH A;  3W96 B;  5AV9 D;  3C1B C;  1ID3 C;  4KGC D;  1HQ3 A;  2IO5 C;  5AVC B;  5GT0 D;  1P3B C;  4YM6 D;  2HIO B;  1AOI C;  2BYM B;  4WV4 B;  5CPJ C;  5DNM B;  4Z5T A;  1ULY A;  3VH5 T;  3X1V C;  5GXQ A;  5CPI B;  3UT9 A;  3W98 A;  1WWS A;  2RVQ C;  4J8W A;  1P3A B;  3O62 C;  3W99 B;  1P34 B;  2PYO A;  3VH5 A;  5CPK B;  5B31 G;  4CSR B;  4KUD D;  5B33 B;  1M19 D;  3UTA D;  2NQB A;  3B6F B;  3AN2 B;  3AZK A;  1P3K A;  4YS3 A;  5AVC C;  3W97 A;  3X1U B;  3UTB B;  4ZUX A;  3KSY A;  2HIO C;  3AZI B;  5DNM C;  3REL A;  3AYW D;  5BS7 C;  4J8V A;  4WU8 B;  5CPI C;  1M18 A;  5B1L B;  1P3A C;  3NQJ A;  2RVQ D;  5B40 B;  3W99 C;  1P34 C;  1P3F B;  3O62 D;  5CPK C;  4X23 B;  1P3G D;  5B24 C;  4LD9 B;  5B33 C;  2L5A A;  1Q9C A;  3REJ A;  5CP6 B;  3LZ0 A;  3AN2 C;  3VH6 W;  3W96 D;  4WU9 D;  5BNV A;  3X1U C;  4ZBJ B;  3UTB C;  3AZM C;  1P3M B;  5AVC D;  4KHA B;  4H9P B;  3AZI C;  5AV6 B;  4R8P C;  5C3I B;  5DNM D;  1A7W A;  5B1L C;  4CAY B;  2CV5 B;  5B40 C;  4J8X D;  3MVD B;  1P3F C;  4J8U B;  3C1C D;  3AV1 B;  3W99 D;  1P3P A;  4X23 C;  1TZY D;  5B32 A;  4H9O B;  1TAF B;  5B33 D;  1H3O B;  5CP6 C;  3B6F D;  3AN2 D;  4ZBJ C;  5AY8 B;  1KX3 A;  3LJA A;  5FUG A;  4UUZ A;  4KGC B;  5G49 A;  1BH8 B;  4NE6 A;  2BYK B;  1JFI A;  5JRG A;  5AV6 C;  1KX4 A;  5B0Y A;  3KXB B;  5C3I C;  3AZI D;  3AZH A;  1F66 B;  4YM6 B;  3AZL A;  4WU8 D;  3MGR A;  2CV5 C;  3REK B;  3MVD C;  3KWQ B;  4WNN B;  1P3I A;  4J8U C;  3AV1 C;  5AV9 A;  1P3F D;  4X23 D;  3X1T B;  5GT0 A;  4LD9 D;  3WTP D;  3KUY B;  3AZN B;  4KUD B;  5CP6 D;  3MNN B;  3AZG B;  3UTA B;  5B32 G;  5F99 B;  3AFA B;  1P3M D;  4KGC C;  4JJN A;  3AZE A;  2ARO B;  1F66 C;  3KXB C;  5AV6 D;  4YM6 C;  1P3L B;  3WA9 D;  3REK C;  3KWQ C;  3MVD D;  4XZQ D;  4J8U D;  3AV1 D;  3C1B A;  3X1S D;  1ID3 A;  3VH6 T;  3X1T C;  1P3B A;  3TU4 B;  3KUY C;  1P3G B;  3AZN C;  4KUD C;  4H9N A;  3MNN C;  3AZG C;  1M19 C;  3VH6 A;  3UTA C;  1AOI A;  5CPJ A;  3NQU B;  5E5A B;  5AY8 D;  5F99 C;  3AFA C;  3MGP B;  3B6G A;  3X1V A;  4WU9 B;  1BH9 A;  2ARO C;  3O62 A;  2YFV B;  3REH B;  1F66 D;  3KXB D;  4AWL B;  1P3L C;  2F8N A;  3AYW C;  5DNN B;  3REK D; 
#chains in the Genus database with same CATH topology
 3KWQ D;  1ZLA B;  1W2E A;  3V9R B;  3MGS A;  5B2I B;  4J8X B;  3A6N D;  3C1C B;  2HUE B;  5AVC A;  3X1T D;  1TZY B;  1P3G C;  3W98 B;  3KUY D;  2HIO A;  3AZN D;  4J8W B;  2BYM A;  3MNN D;  3AZG D;  5AV8 D;  3W96 C;  5DNM A;  5E5A C;  3MGP C;  5BS7 A;  2PYO B;  5F99 D;  3AFA D;  4WU9 C;  5CPI A;  1P3A A;  5B0Z D;  3WKJ B;  4E44 A;  2ZY4 A;  2ARO D;  1P34 A;  4AWL C;  5CPK A;  2UWX A;  1P3L D;  4CSR A;  3LZ1 B;  1P3K B;  5DNN C;  4H9S C;  5B24 A;  1ZLA C;  5B33 A;  4E45 A;  3B0C W;  5B2I C;  4J8X C;  3AN2 A;  5KDM B;  3C1C C;  2HUE C;  3X1U A;  3UTB A;  1TZY C;  3AZM A;  2F8N G;  2G5I C;  3TU4 D;  3W98 C;  5B1M B;  4J8W C;  3AZI A;  3WTP B;  4R8P A;  3B6F C;  3KFU G;  2PYO C;  4G92 B;  5E5A D;  3MGP D;  5B1L A;  1WWI A;  3WKJ C;  5B40 A;  1EQZ B;  2F8N H;  5JA4 A;  3P5J B;  3REH D;  1S32 B;  3LZ1 C;  4X23 A;  5AV5 B;  1P3K C;  4H9Q B;  3AZF B;  3WA9 B;  5DNN D;  4WU8 C;  1ZLA D;  5CP6 A;  2FJ7 B;  5B2I D;  4XZQ B;  3X1S B;  3WAA B;  2JE5 A;  4H9P A;  3W98 D;  5B1M C;  4LD9 C;  3WTP C;  5AV6 A;  4J8W D;  4G92 C;  5B2J B;  2PYO D;  4CAY A;  3LEL B;  2CV5 A;  1P3M C;  3EG5 B;  3MVD A;  1EQZ C;  3WKJ D;  3A1I A;  4J8U A;  3AV1 A;  4G91 B;  3AV2 A;  1S32 C;  3H0M C;  4QLC B;  5AV5 C;  4H9O A;  3LZ1 D;  1TAF A;  3AZF C;  3AZK D;  3WA9 C;  1P3K D;  3EPK A;  1KX3 B;  3AZJ A;  1H3O A;  3H0L C;  3W97 D;  1JFI B;  5BO0 B;  2FJ7 C;  4ZUX D;  4Z66 B;  4XZQ C;  3X1S C;  3WAA C;  4KGC A;  3A6N B;  1BH8 A;  2BYK A;  1P3O B;  1M18 D;  4UPK A;  5B1M D;  1F66 A;  3KXB A;  1P3I B;  2F8N K;  5AVB B;  4YM6 A;  5B2J C;  2Y2L A;  5GSU B;  3LEL C;  5AV8 B;  3REK A;  5AY8 C;  2BG1 A;  4WNN A;  5BNX A;  3KWQ A;  1N1J B;  1EQZ D;  4G91 C;  1F1E A;  5B0Z B;  3B0C T;  4QLC C;  1S32 D;  4WZS B;  3LZ0 D;  3REI B;  5AV5 D;  3X1T A;  3AZF D;  2Y2P A;  5GT3 B;  3KUY A;  2F2A C;  4KUD A;  4Z66 C;  3MNN A;  3AZG A;  1M19 A;  3UTA A;  3AZE B;  3F6T A;  2FJ7 D;  5F99 A;  3AFA A;  3A6N C;  3WAA D;  2Y2K A;  4H9R B;  4Z2M G;  1P3O C;  1KX5 B;  1M1A B;  2ARO A;  5B31 B;  4WJ3 C;  5AVB C;  3MGQ B;  1P3L A;  4XUJ B;  5GSU C;  5B2J D;  5AV8 C;  3C1B B;  3LEL D;  3AYW A;  1ID3 B;  2YFW B;  2ZM5 A;  3R45 A;  5B0Z C;  1P3B B;  1U35 B;  2NZD B;  2Y2Q A;  4QLC D;  3REI C;  5CPJ B;  5GT3 C;  1P3G A;  1KX3 D;  3B6G B;  1Z2C B;  1BH9 B;  1HQ3 B;  3AZE C;  4Z66 D;  5JRG D;  2J8P A;  3W96 A;  3NQU A;  3MGP A;  5B0Y D;  4WU9 A;  1P3O D;  1M1A C;  1KX5 C;  2F8N B;  5B31 C;  2YFV A;  4Z5T B;  3MGQ C;  3TU4 C;  1P3I D;  5GXQ B;  5AVB D;  3UT9 B;  4XUJ C;  3MGS B;  4NFT A;  5GSU D;  4HGA B;  5DNN A;  4H9S A;  1ZLA A;  4DQY B;  3V9R A;  1U35 C;  5B2I A;  2NZD C;  3A1K A;  4J8X A;  4EO5 B;  3C1C A;  3REH C;  3W99 A;  3REI D;  1TZY A;  2NQB B;  3B6G C;  5GT3 D;  3AZK B;  4JJN D;  1HQ3 C;  3AL0 C;  4YS3 B;  3AZE D;  3W97 B;  3B6F A;  4ZUX B;  3WKJ A;  1KX5 D;  1M1A D;  3REL B;  4Z5T C;  5B31 D;  5B24 B;  4J8V B;  5GXQ C;  3MGQ D;  3UT9 C;  1M18 B;  3MGS C;  3LZ1 A;  4XUJ D;  4HGA C;  3NQJ B;  3C1B D;  1ID3 D;  2LY8 A;  4WU8 A;  1BFM A;  3AZM B;  2JCH A;  1P3B D;  4EO5 C;  5KDM A;  1U35 D;  2NZD D;  1P3F A;  1AOI D;  4R8P B;  2NQB C;  3REJ B;  5CPJ D;  3LZ0 B;  3AZK C;  3B6G D;  3X1V D;  5B1M A;  5BNV B;  4YS3 C;  4LD9 A;  3WTP A;  1HQ3 D;  3W97 C;  5JA4 B;  4ZUX C;  5BT1 C;  3H0R C;  1P3M A;  1EQZ A;  3REL C;  2F8N D;  2XD5 A;  4J8V C;  2Y2O A;  4KHA A;  4Z5T D;  1S32 A;  1M18 C;  4DRA A;  5GXQ D;  3UT9 D;  3MGS D;  5AV5 A;  4H9Q A;  3AZF A;  3WA9 A;  1P3P B;  1B67 A;  2FJ7 A;  5B32 B;  4XZQ A;  3WTP E;  2HIO D;  3REJ C;  3X1S A;  3WAA A;  2NQB D;  3LZ0 C;  5CPI D;  1P3A D;  4YS3 D;  3LJA B;  2DQN C;  4UUZ B;  5FUG B;  5G49 B;  1P34 D;  5B2J A;  3AV2 B;  5BT1 D;  3LEL A;  5CPK D;  5JRG B;  2JSS A;  5AY8 A;  1KX4 B;  5B0Y B;  3VH5 W;  3AZH B;  3REL D;  3AZL B;  5B24 D;  3AZJ B;  4J8V D;  4QLC A;  3MGR B;  3FDD A;  4M6B A;  2DF4 C;  5AV9 B;  1P3P C;  3X1U D;  3UTB D;  3AZM D;  5BO0 A;  5B32 C;  4NE5 A;  4Z66 A;  5GT0 B;  4DRB A;  4R8P D;  3B0D B;  3A6N A;  3REJ D;  1P3O A;  5B1L D;  1KX3 C;  5BNX B;  2Y2J A;  3B0B A;  5AVB A;  5B40 D;  3LJA C;  4JJN B;  3AZN A;  3AV2 C;  2CWE A;  5GSU A;  5JRG C;  5AV8 A;  1R4V A;  1KX4 C;  5B0Y C;  3AZH C;  1N1J A;  3AZL C;  3AZJ C;  5B0Z A;  3MGR C;  1HTA A;  3REI A;  1P3I C;  1M19 B;  3EPJ A;  5AV9 C;  5GT3 A;  1P3P D;  1B6W A;  5B32 D;  2IO5 B;  5GT0 C;  4Z2M H;  3B0D C;  4H9R A;  4H9N B;  1KX5 A;  1M1A A;  1AOI B;  1KU5 A;  5B31 A;  3AYW B;  2CV5 D;  3MGQ A;  3TU4 A;  3LJA D;  3R45 B;  4JJN C;  3X1V B;  5CHL B;  4XUJ A;  3AV2 D;  4NE3 A;  2YFW A;  3O62 B;  2Y2H A;  5E5A A;  1KX4 D;  3AZH D;  3AZL D;  1U35 A;  2NZD A;  3AZJ D;  3MGR D;  3REH A;  3W96 B;  5AV9 D;  3C1B C;  1ID3 C;  4KGC D;  1HQ3 A;  2IO5 C;  5AVC B;  5GT0 D;  1P3B C;  2Y2M A;  4YM6 D;  2HIO B;  1PZR A;  1AOI C;  2BYM B;  4WV4 B;  5CPJ C;  5DNM B;  4Z5T A;  1ULY A;  3VH5 T;  3X1V C;  5GXQ A;  5CPI B;  3UT9 A;  3W98 A;  1WWS A;  2RVQ C;  4J8W A;  1P3A B;  3O62 C;  3W99 B;  1P34 B;  2PYO A;  3VH5 A;  5CPK B;  5B31 G;  4CSR B;  2ZY5 A;  4KUD D;  5B33 B;  1M19 D;  3UTA D;  2NQB A;  3B6F B;  3AN2 B;  3AZK A;  1P3K A;  4YS3 A;  5AVC C;  3W97 A;  3X1U B;  3UTB B;  2Y2I A;  4ZUX A;  3KSY A;  2XD1 A;  2Y2G A;  2HIO C;  3AZI B;  5DNM C;  3REL A;  3AYW D;  5BS7 C;  4J8V A;  4WU8 B;  5CPI C;  1M18 A;  5B1L B;  1P3A C;  3NQJ A;  2RVQ D;  5B40 B;  3W99 C;  1P34 C;  1P3F B;  3O62 D;  5CPK C;  4X23 B;  2G5H C;  1P3G D;  5B24 C;  2Y2N A;  4LD9 B;  5B33 C;  2L5A A;  1Q9C A;  3REJ A;  5CP6 B;  3LZ0 A;  3AN2 C;  3VH6 W;  3W96 D;  4WU9 D;  5BNV A;  3X1U C;  4ZBJ B;  3UTB C;  3AZM C;  1P3M B;  5AVC D;  4KHA B;  4H9P B;  3AZI C;  5AV6 B;  4R8P C;  5C3I B;  2VQR A;  5DNM D;  1A7W A;  5B1L C;  4CAY B;  2CV5 B;  5B40 C;  4J8X D;  3MVD B;  1P3F C;  4J8U B;  3C1C D;  3AV1 B;  3W99 D;  1P3P A;  4X23 C;  1TZY D;  5B32 A;  4H9O B;  1TAF B;  5B33 D;  1H3O B;  5CP6 C;  3B6F D;  3AN2 D;  2RIQ A;  4ZBJ C;  5AY8 B;  1KX3 A;  3LJA A;  5FUG A;  2ZY3 A;  4UUZ A;  5G49 A;  1BH8 B;  4NE6 A;  2BYK B;  1JFI A;  4KGC B;  5JRG A;  5AV6 C;  1KX4 A;  5B0Y A;  3KXB B;  5C3I C;  3AZI D;  3AZH A;  1F66 B;  4YM6 B;  3AZL A;  4WU8 D;  3MGR A;  2CV5 C;  3REK B;  3MVD C;  3KWQ B;  4WNN B;  1P3I A;  4J8U C;  3AV1 C;  5AV9 A;  1P3F D;  2FFF B;  4X23 D;  3X1T B;  5GT0 A;  4LD9 D;  3WTP D;  3KUY B;  3AZN B;  4KUD B;  5CP6 D;  3MNN B;  3AZG B;  3UTA B;  5B32 G;  5F99 B;  3AFA B;  1P3M D;  4KGC C;  2W8S A;  4JJN A;  3AZE A;  3IP4 C;  2ARO B;  1F66 C;  3KXB C;  5AV6 D;  4YM6 C;  1P3L B;  3WA9 D;  3REK C;  3KWQ C;  3MVD D;  4XZQ D;  4J8U D;  3AV1 D;  3EPH A;  3C1B A;  3X1S D;  1ID3 A;  3VH6 T;  3X1T C;  1T3U A;  1P3B A;  3TU4 B;  3KUY C;  1P3G B;  3EPL A;  3AZN C;  4KUD C;  4H9N A;  3MNN C;  3AZG C;  1M19 C;  3VH6 A;  3UTA C;  1AOI A;  5CPJ A;  3NQU B;  5E5A B;  5AY8 D;  5F99 C;  3AFA C;  3MGP B;  3B6G A;  3X1V A;  4WU9 B;  1BH9 A;  2ARO C;  3O62 A;  2YFV B;  3REH B;  1F66 D;  3KXB D;  4AWL B;  1P3L C;  2F8N A;  2ZY2 A;  3AYW C;  5DNN B;  3REK D; 
#chains in the Genus database with same CATH homology
 3KWQ D;  1ZLA B;  1W2E A;  3V9R B;  3MGS A;  5B2I B;  4J8X B;  3A6N D;  3C1C B;  2HUE B;  5AVC A;  3X1T D;  1TZY B;  1P3G C;  3W98 B;  3KUY D;  2HIO A;  3AZN D;  4J8W B;  2BYM A;  3MNN D;  3AZG D;  5AV8 D;  3W96 C;  5DNM A;  5E5A C;  3MGP C;  5BS7 A;  2PYO B;  5F99 D;  3AFA D;  4WU9 C;  5CPI A;  1P3A A;  5B0Z D;  3WKJ B;  4E44 A;  2ZY4 A;  2ARO D;  1P34 A;  4AWL C;  5CPK A;  2UWX A;  1P3L D;  4CSR A;  3LZ1 B;  1P3K B;  5DNN C;  4H9S C;  5B24 A;  1ZLA C;  5B33 A;  4E45 A;  3B0C W;  5B2I C;  4J8X C;  3AN2 A;  5KDM B;  3C1C C;  2HUE C;  3X1U A;  3UTB A;  1TZY C;  3AZM A;  2F8N G;  2G5I C;  3TU4 D;  3W98 C;  5B1M B;  4J8W C;  3AZI A;  3WTP B;  4R8P A;  3B6F C;  3KFU G;  2PYO C;  4G92 B;  5E5A D;  3MGP D;  5B1L A;  1WWI A;  3WKJ C;  5B40 A;  1EQZ B;  2F8N H;  5JA4 A;  3P5J B;  3REH D;  1S32 B;  3LZ1 C;  4X23 A;  5AV5 B;  1P3K C;  4H9Q B;  3AZF B;  3WA9 B;  5DNN D;  4WU8 C;  1ZLA D;  5CP6 A;  2FJ7 B;  5B2I D;  4XZQ B;  3X1S B;  3WAA B;  2JE5 A;  4H9P A;  3W98 D;  5B1M C;  4LD9 C;  3WTP C;  5AV6 A;  4J8W D;  4G92 C;  5B2J B;  2PYO D;  4CAY A;  3LEL B;  2CV5 A;  1P3M C;  3EG5 B;  3MVD A;  1EQZ C;  3WKJ D;  3A1I A;  4J8U A;  3AV1 A;  4G91 B;  3AV2 A;  1S32 C;  3H0M C;  4QLC B;  5AV5 C;  4H9O A;  3LZ1 D;  1TAF A;  3AZF C;  3AZK D;  3WA9 C;  1P3K D;  3EPK A;  1KX3 B;  3AZJ A;  1H3O A;  3H0L C;  3W97 D;  1JFI B;  5BO0 B;  2FJ7 C;  4ZUX D;  4Z66 B;  4XZQ C;  3X1S C;  3WAA C;  4KGC A;  3A6N B;  1BH8 A;  2BYK A;  1P3O B;  1M18 D;  4UPK A;  5B1M D;  1F66 A;  3KXB A;  1P3I B;  2F8N K;  5AVB B;  4YM6 A;  5B2J C;  2Y2L A;  5GSU B;  3LEL C;  5AV8 B;  3REK A;  5AY8 C;  2BG1 A;  4WNN A;  5BNX A;  3KWQ A;  1N1J B;  1EQZ D;  4G91 C;  1F1E A;  5B0Z B;  3B0C T;  4QLC C;  1S32 D;  4WZS B;  3LZ0 D;  3REI B;  5AV5 D;  3X1T A;  3AZF D;  2Y2P A;  5GT3 B;  3KUY A;  2F2A C;  4KUD A;  4Z66 C;  3MNN A;  3AZG A;  1M19 A;  3UTA A;  3AZE B;  3F6T A;  2FJ7 D;  5F99 A;  3AFA A;  3A6N C;  3WAA D;  2Y2K A;  4H9R B;  4Z2M G;  1P3O C;  1KX5 B;  1M1A B;  2ARO A;  5B31 B;  4WJ3 C;  5AVB C;  3MGQ B;  1P3L A;  4XUJ B;  5GSU C;  5B2J D;  5AV8 C;  3C1B B;  3LEL D;  3AYW A;  1ID3 B;  2YFW B;  2ZM5 A;  3R45 A;  5B0Z C;  1P3B B;  1U35 B;  2NZD B;  2Y2Q A;  4QLC D;  3REI C;  5CPJ B;  5GT3 C;  1P3G A;  1KX3 D;  3B6G B;  1Z2C B;  1BH9 B;  1HQ3 B;  3AZE C;  4Z66 D;  5JRG D;  2J8P A;  3W96 A;  3NQU A;  3MGP A;  5B0Y D;  4WU9 A;  1P3O D;  1M1A C;  1KX5 C;  2F8N B;  5B31 C;  2YFV A;  4Z5T B;  3MGQ C;  3TU4 C;  1P3I D;  5GXQ B;  5AVB D;  3UT9 B;  4XUJ C;  3MGS B;  4NFT A;  5GSU D;  4HGA B;  5DNN A;  4H9S A;  1ZLA A;  4DQY B;  3V9R A;  1U35 C;  5B2I A;  2NZD C;  3A1K A;  4J8X A;  4EO5 B;  3C1C A;  3REH C;  3W99 A;  3REI D;  1TZY A;  2NQB B;  3B6G C;  5GT3 D;  3AZK B;  4JJN D;  1HQ3 C;  3AL0 C;  4YS3 B;  3AZE D;  3W97 B;  3B6F A;  4ZUX B;  3WKJ A;  1KX5 D;  1M1A D;  3REL B;  4Z5T C;  5B31 D;  5B24 B;  4J8V B;  5GXQ C;  3MGQ D;  3UT9 C;  1M18 B;  3MGS C;  3LZ1 A;  4XUJ D;  4HGA C;  3NQJ B;  3C1B D;  1ID3 D;  2LY8 A;  4WU8 A;  1BFM A;  3AZM B;  2JCH A;  1P3B D;  4EO5 C;  5KDM A;  1U35 D;  2NZD D;  1P3F A;  1AOI D;  4R8P B;  2NQB C;  3REJ B;  5CPJ D;  3LZ0 B;  3AZK C;  3B6G D;  3X1V D;  5B1M A;  5BNV B;  4YS3 C;  4LD9 A;  3WTP A;  1HQ3 D;  3W97 C;  5JA4 B;  4ZUX C;  5BT1 C;  3H0R C;  1P3M A;  1EQZ A;  3REL C;  2F8N D;  2XD5 A;  4J8V C;  2Y2O A;  4KHA A;  4Z5T D;  1S32 A;  1M18 C;  4DRA A;  5GXQ D;  3UT9 D;  3MGS D;  5AV5 A;  4H9Q A;  3AZF A;  3WA9 A;  1P3P B;  1B67 A;  2FJ7 A;  5B32 B;  4XZQ A;  3WTP E;  2HIO D;  3REJ C;  3X1S A;  3WAA A;  2NQB D;  3LZ0 C;  5CPI D;  1P3A D;  4YS3 D;  3LJA B;  2DQN C;  4UUZ B;  5FUG B;  5G49 B;  1P34 D;  5B2J A;  3AV2 B;  5BT1 D;  3LEL A;  5CPK D;  5JRG B;  2JSS A;  5AY8 A;  1KX4 B;  5B0Y B;  3VH5 W;  3AZH B;  3REL D;  3AZL B;  5B24 D;  3AZJ B;  4J8V D;  4QLC A;  3MGR B;  3FDD A;  4M6B A;  2DF4 C;  5AV9 B;  1P3P C;  3X1U D;  3UTB D;  3AZM D;  5BO0 A;  5B32 C;  4NE5 A;  4Z66 A;  5GT0 B;  4DRB A;  4R8P D;  3B0D B;  3A6N A;  3REJ D;  1P3O A;  5B1L D;  1KX3 C;  5BNX B;  2Y2J A;  3B0B A;  5AVB A;  5B40 D;  3LJA C;  4JJN B;  3AZN A;  3AV2 C;  2CWE A;  5GSU A;  5JRG C;  5AV8 A;  1R4V A;  1KX4 C;  5B0Y C;  3AZH C;  1N1J A;  3AZL C;  3AZJ C;  5B0Z A;  3MGR C;  1HTA A;  3REI A;  1P3I C;  1M19 B;  3EPJ A;  5AV9 C;  5GT3 A;  1P3P D;  1B6W A;  5B32 D;  2IO5 B;  5GT0 C;  4Z2M H;  3B0D C;  4H9R A;  4H9N B;  1KX5 A;  1M1A A;  1AOI B;  1KU5 A;  5B31 A;  3AYW B;  2CV5 D;  3MGQ A;  3TU4 A;  3LJA D;  3R45 B;  4JJN C;  3X1V B;  5CHL B;  4XUJ A;  3AV2 D;  4NE3 A;  2YFW A;  3O62 B;  2Y2H A;  5E5A A;  1KX4 D;  3AZH D;  3AZL D;  1U35 A;  2NZD A;  3AZJ D;  3MGR D;  3REH A;  3W96 B;  5AV9 D;  3C1B C;  1ID3 C;  4KGC D;  1HQ3 A;  2IO5 C;  5AVC B;  5GT0 D;  1P3B C;  2Y2M A;  4YM6 D;  2HIO B;  1PZR A;  1AOI C;  2BYM B;  4WV4 B;  5CPJ C;  5DNM B;  4Z5T A;  1ULY A;  3VH5 T;  3X1V C;  5GXQ A;  5CPI B;  3UT9 A;  3W98 A;  1WWS A;  2RVQ C;  4J8W A;  1P3A B;  3O62 C;  3W99 B;  1P34 B;  2PYO A;  3VH5 A;  5CPK B;  5B31 G;  4CSR B;  2ZY5 A;  4KUD D;  5B33 B;  1M19 D;  3UTA D;  2NQB A;  3B6F B;  3AN2 B;  3AZK A;  1P3K A;  4YS3 A;  5AVC C;  3W97 A;  3X1U B;  3UTB B;  2Y2I A;  4ZUX A;  3KSY A;  2XD1 A;  2Y2G A;  2HIO C;  3AZI B;  5DNM C;  3REL A;  3AYW D;  5BS7 C;  4J8V A;  4WU8 B;  5CPI C;  1M18 A;  5B1L B;  1P3A C;  3NQJ A;  2RVQ D;  5B40 B;  3W99 C;  1P34 C;  1P3F B;  3O62 D;  5CPK C;  4X23 B;  2G5H C;  1P3G D;  5B24 C;  2Y2N A;  4LD9 B;  5B33 C;  2L5A A;  1Q9C A;  3REJ A;  5CP6 B;  3LZ0 A;  3AN2 C;  3VH6 W;  3W96 D;  4WU9 D;  5BNV A;  3X1U C;  4ZBJ B;  3UTB C;  3AZM C;  1P3M B;  5AVC D;  4KHA B;  4H9P B;  3AZI C;  5AV6 B;  4R8P C;  5C3I B;  2VQR A;  5DNM D;  1A7W A;  5B1L C;  4CAY B;  2CV5 B;  5B40 C;  4J8X D;  3MVD B;  1P3F C;  4J8U B;  3C1C D;  3AV1 B;  3W99 D;  1P3P A;  4X23 C;  1TZY D;  5B32 A;  4H9O B;  1TAF B;  5B33 D;  1H3O B;  5CP6 C;  3B6F D;  3AN2 D;  2RIQ A;  4ZBJ C;  5AY8 B;  1KX3 A;  3LJA A;  5FUG A;  2ZY3 A;  4UUZ A;  5G49 A;  1BH8 B;  4NE6 A;  2BYK B;  1JFI A;  4KGC B;  5JRG A;  5AV6 C;  1KX4 A;  5B0Y A;  3KXB B;  5C3I C;  3AZI D;  3AZH A;  1F66 B;  4YM6 B;  3AZL A;  4WU8 D;  3MGR A;  2CV5 C;  3REK B;  3MVD C;  3KWQ B;  4WNN B;  1P3I A;  4J8U C;  3AV1 C;  5AV9 A;  1P3F D;  2FFF B;  4X23 D;  3X1T B;  5GT0 A;  4LD9 D;  3WTP D;  3KUY B;  3AZN B;  4KUD B;  5CP6 D;  3MNN B;  3AZG B;  3UTA B;  5B32 G;  5F99 B;  3AFA B;  1P3M D;  4KGC C;  2W8S A;  4JJN A;  3AZE A;  3IP4 C;  2ARO B;  1F66 C;  3KXB C;  5AV6 D;  4YM6 C;  1P3L B;  3WA9 D;  3REK C;  3KWQ C;  3MVD D;  4XZQ D;  4J8U D;  3AV1 D;  3EPH A;  3C1B A;  3X1S D;  1ID3 A;  3VH6 T;  3X1T C;  1T3U A;  1P3B A;  3TU4 B;  3KUY C;  1P3G B;  3EPL A;  3AZN C;  4KUD C;  4H9N A;  3MNN C;  3AZG C;  1M19 C;  3VH6 A;  3UTA C;  1AOI A;  5CPJ A;  3NQU B;  5E5A B;  5AY8 D;  5F99 C;  3AFA C;  3MGP B;  3B6G A;  3X1V A;  4WU9 B;  1BH9 A;  2ARO C;  3O62 A;  2YFV B;  3REH B;  1F66 D;  3KXB D;  4AWL B;  1P3L C;  2F8N A;  2ZY2 A;  3AYW C;  5DNN B;  3REK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...