4WNNB

Spt16-h2a-h2b fact histone complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
98
structure length
98
Chain Sequence
MKKRSKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H2A.1
publication title FACT Disrupts Nucleosome Structure by Binding H2A-H2B with Conserved Peptide Motifs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 35
structure length 98
sequence length 98
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wnnB00
5AV5A 1P3AA 5CPID 1KX5B 3REHC 2NQBD 1M18D 3MVDA 4J8XC 3MGPB 2IO5C 4J8VC 1M1AD 4CSRB 5B2JC 5B31C 4Z66B 5B2IB 4KGCC 1Q9CA 3AFAC 4JJNC 5GT0B 5FUGA 1H3OB 1B67A 2FJ7C 3UTBC 1P3GA 4X23C 1P3LD 3WTPA 3NQJB 5C3IC 5BS7A 3C1BD 3KUYC 3MGSA 5B32D 4J8WC 1P34B 4XZQA 1U35B 5B1LB 2HIOB 3MGRA 4KUDC 1A7WA 4H9SA 5F99B 3X1VC 3MGQA 2NZDC 4J8XD 1F66A 5B2JD 2YFVB 5AVCA 5CPIB 4YS3A 4KGCD 3AFAD 1M18B 3LZ0A 4Z5TA 1HQ3A 3A6ND 1M1AB 5AVBD 3LZ1D 3O62B 3WA9B 3UTBD 5B0ZC 1P3KB 1P3PA 1S32C 2JSSA 1AOID 5BO0B 1R4VA 2CV5C 4QLCA 1TZYC 3UTAD 3W99A 4YM6A 3KUYD 3AV2C 4J8UC 4WU8A 3AZHD 2F8ND 3W98C 3AZJA 1P3IB 3TU4D 4ZUXA 2AROA 1KX5C 3B6GD 3MNNB 3MGPC 1JFIA 3W96B 5JRGA 3NQUB 4XZQD 4Z66C 5B2IC 3KWQC 1P3OB 5G49A 5GT0C 5B0ZD 1F66D 5GXQB 4WNNB 5AV6D 3AZID 1S32D 3A6NB 1TAFB 3V9RB 3LZ1B 3B6FD 3WAAA 4WV4B 3AV1A 3MVDB 3KXBD 4J8UD 5BT1C 4CAYA 3AZFD 1AOIB 2PYOD 3X1UD 3AZED 2RVQC 1P34C 3UTAB 1U35C 5B1LC 3REKA 2HIOC 5FUGB 3AZHB 1KX5D 5F99C 5GSUA 3MGPD 3AZGA 3LJAA 3TU4B 5E5AA 4Z66D 5CPIC 3WTPB 1M18C 1M1AC 5B33A 3O62C 3MGSB 4XZQB 4UUZB 4XUJA 1P3KC 4HGAB 3MGRB 5GT3A 3MGQB 3AN2D 1F66B 5BT1D 5AV6B 3AZIB 5AV9A 3RELA 3B6FB 5B1MA 5AVCB 1ZLAA 2RVQD 3W97A 4R8PA 1U35D 1BH8B 4M6BA 4Z5TB 5B1LD 3AZND 5CPKD 3KXBB 1P3IC 2HIOD 5DNMA 3C1CA 3AZMA 3AZFB 3C1BC 1BH9A 3X1UB 5B32C 3AZEB 1EQZA 4WU9A 3MNNC 3REID 3W96C 3REJA 4DRBA 3VH6W 3LELA 4YM6B 3O62D 3WA9D 4G92B 1P3KD 5BNXA 3REHA 5GXQC 3A6NC 4J8VA 4ZUXB 2F8NK 5AVBC 5AV8D 2AROB 3LZ1C 4AWLB 5B31A 5JA4A 1WWSA 3MVDC 2BYMB 4JJNA 1JFIB 5JRGB 3AZLA 3AN2B 1P3ID 1AOIC 1ID3D 5B0YA 2FJ7A 3UTAC 5DNNA 5G49B 4X23A 3AZHC 3AZKA 4H9PA 3AZNB 5CPKB 3MNND 3WAAB 3W96D 3TU4C 4WZSB 1KX4A 4LD9A 3WTPC 4J8WA 1P3OD 3AYWD 3B6GC 3X1TA 4CAYB 1KX3D 3REIB 4KUDA 5GXQD 5CPJD 3MGSC 3X1VA 2NZDA 4XZQC 3B0DB 5AV5D 1P3AD 1M19A 4HGAC 3REKB 3MGRC 3MGQC 5GSUB 3MVDD 4H9OA 1F66C 5AV6C 3AZIC 1P3MA 4H9QA 5E5AB 3B6FC 5AV8B 5AVCC 5B31G 1P3BA 1P3FA 4Z5TC 3VH6T 3KXBC 4Z2MH 5B33B 4EO5B 3AZFC 2F8NH 2PYOC 1ID3B 3X1UC 5CP6A 1TZYA 3VH6A 3AZEC 1P3GD 3AV2A 3WTPD 3W98A 3X1SA 5B24A 5KDMA 1WWIA 5AV9B 4YM6C 4Z2MG 3RELB 3MGSD 1KU5A 4ZBJB 5AY8A 3W97B 4G92C 2F8NG 3AYWB 3MGRD 3MGQD 4ZUXC 3AZMB 4CSRA 4AWLC 1KX3B 2AROC 5CPJB 3R45B 5B2IA 5AV5B 3KWQA 5AVCD 1P3AB 1N1JA 5GT0A 4YS3D 5B40A 5JRGC 3LZ0D 4Z5TD 3REJB 1HQ3D 3AN2C 2LY8A 4NFTA 2CWEA 3REHB 1P3PD 3NQJA 3AZNC 5CPKC 3WAAC 4QLCD 3B0CW 4E44A 3W99D 4YM6D 1P3GB 1P34A 4WU8D 3AZJD 3WKJA 4NE3A 3AZLB 3REIC 5F99A 5B0YB 4ZUXD 3B0DC 5DNNB 2AROD 3WA9C 3REKC 3AZKB 4H9PB 1ULYA 5GSUC 4NE5A 2NQBA 5C3IB 5JRGD 5E5AC 1KX4B 4LD9B 5AV8C 3X1TB 4YS3B 5B33C 4DRAA 2YFWA 4EO5C 3LZ0B 5BO0A 1HQ3B 1ID3C 3KSYA 3WAAD 3AV1D 1M19B 1P3LA 1P3PB 1P3MB 4H9QB 5AV9C 1P3BB 1P3FB 4ZBJC 4QLCB 3C1BA 3W97C 1F1EA 5B32A 3UT9A 3W99B 1P3OC 4WU8B 3REKD 3AYWC 3AZJB 5GSUD 1KX3C 3NQUA 5CPJC 3AZGD 3LJAD 5CP6B 4J8XA 4H9RA 5E5AD 5AV5C 5B2JA 1P3AC 3B0BA 3X1SB 4KGCA 5B24B 3B0CT 4WNNA 5KDMB 3AFAA 3VH5A 5B33D 3A6NA 1TAFA 3V9RA 5AVBA 5AY8B 3LZ1A 4XUJD 3UTBA 5GT3D 1AOIA 5BNVA 5AV9D 3RELD 3WTPE 5B1MD 3KWQB 1N1JB 3UTAA 3AV1B 1P3GC 1ZLAD 3W97D 4R8PD 3KUYA 5B40B 2F8NA 3AZLC 3AZHA 4E45A 5B0YC 2L5AA 5BS7C 5DNMD 3C1CD 3AZMD 5DNNC 3TU4A 1EQZD 3AZKC 5B32G 4G91B 4H9NA 4WU9D 3B6GA 4H9SC 3REJD 1KX4C 4LD9C 3LELD 3UT9D 3AZGB 4NE6A 3LJAB 4UUZA 3WKJB 3X1TC 4YS3C 3REHD 5B0ZA 3LZ0C 1HQ3C 5AV6A 4J8VD 3AZIA 1S32A 1M19C 5B31D 3B6FA 2CV5A 2BYKA 4XUJB 1BH8A 1P3PC 4KHAA 4JJND 2NQBB 1P3MC 3KXBA 5GT3B 4J8UA 3AZLD 5B0YD 1P3BC 2FJ7D 3AZFA 4QLCC 1P3FC 2PYOA 3X1UA 3W99C 5DNND 3AZEA 5B1MB 4X23D 1ZLAB 4WU8C 1B6WA 4R8PB 3AZKD 3AZJC 2YFWB 1KX5A 5CP6C 5DNMB 3MGPA 3C1CB 1KX4D 4LD9D 1BH9B 1P3LB 4J8WD 1EQZB 3X1SC 4Z66A 4WU9B 5B24C 3X1TD 2HUEB 4KUDD 2NZDD 3X1VD 3C1BB 5AY8C 1H3OA 3LELB 5B32B 3UT9B 1M19D 2BYMA 5BNXB 3AN2A 1P3MD 4J8XB 2IO5B 4H9RB 3VH5W 4J8VB 5B2JB 1BFMA 1P3BD 3AV1C 5B31B 1P3FD 5JA4B 5B40C 4KGCB 1U35A 3AFAB 4JJNB 3AZNA 5B1LA 5CPKA 2HIOA 5AVBB 2CV5D 5CP6D 1TZYD 3UTBB 2FJ7B 4G91C 3AV2D 4X23B 3W98D 2YFVA 3X1SD 5CPIA 3REIA 5B24D 5BNVB 1M18A 3AZGC 3LJAC 1M1AA 5AY8D 3O62A 3KUYB 1HTAA 3WKJC 3WA9A 2F8NB 4J8WB 1P3KA 5CHLB 4KUDB 2NZDB 3X1VB 5AV8A 5B2ID 4XUJC 4H9NB 3KWQD 2NQBC 3B6GB 5GT0D 5B40D 5GT3C 4H9OB 1P3IA 1ID3A 3RELC 5B1MC 1ZLAC 4R8PC 5B0ZB 1S32B 5DNMC 3MNNA 3C1CC 3AZMC 3W96A 2CV5B 2BYKB 1P3LC 1TZYB 1P34D 1EQZC 4KHAB 4WU9C 1P3OA 3AV2B 3WKJD 4J8UB 3AYWA 3VH5T 2HUEC 3W98B 5F99D 1KX3A 3REJC 2PYOB 5GXQA 5CPJA 3LELC 3UT9C 3R45A
chains in the Genus database with same CATH superfamily
5AV5A 1P3AA 5CPID 1KX5B 3REHC 2NQBD 1M18D 3MVDA 4J8XC 3MGPB 2IO5C 3EPJA 4J8VC 1M1AD 4CSRB 5B2JC 5B31C 4Z66B 5B2IB 4KGCC 1Q9CA 3AFAC 4JJNC 5GT0B 5FUGA 1H3OB 1B67A 2FJ7C 3UTBC 3EPHA 1P3GA 4X23C 1P3LD 3WTPA 3NQJB 5C3IC 5BS7A 3C1BD 3KUYC 3IP4C 3MGSA 5B32D 4J8WC 1P34B 4XZQA 1U35B 5B1LB 2HIOB 3MGRA 4KUDC 1A7WA 4H9SA 5F99B 3X1VC 3MGQA 2NZDC 4J8XD 1F66A 5B2JD 2Y2OA 2YFVB 5AVCA 2F2AC 5CPIB 4DQYB 4YS3A 4KGCD 3AFAD 1M18B 3LZ0A 4Z5TA 1HQ3A 3A6ND 1M1AB 5AVBD 3LZ1D 3O62B 3WA9B 3UTBD 5B0ZC 1P3KB 1P3PA 1S32C 2JSSA 1AOID 5BO0B 1R4VA 2CV5C 4QLCA 1TZYC 3UTAD 3W99A 4YM6A 3KUYD 3AV2C 4J8UC 4WU8A 3AZHD 2F8ND 3W98C 3AZJA 1P3IB 3TU4D 4ZUXA 2AROA 1KX5C 3B6GD 3MNNB 3MGPC 1JFIA 3W96B 5JRGA 3NQUB 4XZQD 4Z66C 5B2IC 3KWQC 1P3OB 5G49A 5GT0C 5B0ZD 1F66D 5GXQB 4WNNB 5AV6D 3AZID 1S32D 3A6NB 1TAFB 3V9RB 3LZ1B 3B6FD 3WAAA 4WV4B 3AV1A 3MVDB 3KXBD 4J8UD 5BT1C 4CAYA 3AZFD 1AOIB 2PYOD 3X1UD 3AZED 2RVQC 1P34C 3UTAB 1U35C 5B1LC 3REKA 2HIOC 5FUGB 3AZHB 1KX5D 5F99C 5GSUA 3MGPD 3AZGA 3LJAA 3TU4B 5E5AA 5CPIC 4Z66D 3WTPB 2Y2MA 1M18C 2XD5A 2ZY4A 1M1AC 3KFUG 5B33A 3O62C 3MGSB 3FDDA 4XZQB 4UUZB 4XUJA 1P3KC 1Z2CB 4HGAB 3MGRB 5GT3A 3MGQB 3AN2D 1F66B 5BT1D 5AV6B 3AZIB 5AV9A 3RELA 3B6FB 5B1MA 5AVCB 1ZLAA 2RVQD 3W97A 4R8PA 1U35D 1BH8B 4M6BA 4Z5TB 5B1LD 3AZND 5CPKD 3KXBB 1P3IC 3F6TA 2HIOD 5DNMA 3C1CA 3AZMA 3AZFB 3C1BC 1BH9A 2Y2KA 3X1UB 5B32C 3AZEB 1EQZA 4WU9A 2Y2IA 4WJ3C 3MNNC 3REID 3W96C 3REJA 4DRBA 3VH6W 3LELA 4YM6B 3O62D 2Y2LA 3WA9D 4G92B 1P3KD 5BNXA 3REHA 5GXQC 3A6NC 4J8VA 4ZUXB 2F8NK 5AVBC 5AV8D 2AROB 3LZ1C 4AWLB 5B31A 5JA4A 1WWSA 2G5HC 3MVDC 2BYMB 4JJNA 1JFIB 5JRGB 3AZLA 3H0LC 3AN2B 1P3ID 1AOIC 1ID3D 5B0YA 2FJ7A 3UTAC 5DNNA 5G49B 4X23A 3AZHC 3AZKA 4H9PA 3AZNB 5CPKB 3MNND 3WAAB 3W96D 3TU4C 4WZSB 1KX4A 4LD9A 3WTPC 4J8WA 1P3OD 3AYWD 3B6GC 3X1TA 4CAYB 2DF4C 1KX3D 3REIB 4KUDA 5GXQD 5CPJD 3MGSC 3X1VA 2NZDA 4XZQC 3B0DB 5AV5D 1P3AD 1M19A 4HGAC 3REKB 3MGRC 3AL0C 3MGQC 5GSUB 3MVDD 4H9OA 1F66C 5AV6C 3AZIC 1P3MA 4H9QA 5E5AB 2Y2QA 3B6FC 5AV8B 5AVCC 5B31G 1P3BA 1P3FA 4Z5TC 3VH6T 3KXBC 4Z2MH 5B33B 4EO5B 3AZFC 2F8NH 2PYOC 1ID3B 3X1UC 3H0MC 5CP6A 1TZYA 3VH6A 3AZEC 1P3GD 2ZY2A 3A1KA 3AV2A 2RIQA 3WTPD 3W98A 3X1SA 5B24A 5KDMA 2XD1A 1WWIA 5AV9B 4YM6C 4Z2MG 3RELB 3MGSD 1KU5A 4ZBJB 5AY8A 3W97B 2DQNC 4G92C 2F8NG 3AYWB 3MGRD 3MGQD 4ZUXC 3AZMB 4CSRA 1PZRA 4AWLC 2AROC 1KX3B 5CPJB 3R45B 5B2IA 5AV5B 3KWQA 5AVCD 1P3AB 1N1JA 5GT0A 4YS3D 5B40A 5JRGC 3LZ0D 4Z5TD 3REJB 1HQ3D 3AN2C 2LY8A 4NFTA 2CWEA 3REHB 1P3PD 3NQJA 3AZNC 5CPKC 3WAAC 4QLCD 2J8PA 3B0CW 4E44A 3W99D 4YM6D 1P3GB 2Y2GA 1P34A 4WU8D 3AZJD 3WKJA 4NE3A 3AZLB 3REIC 5F99A 5B0YB 2Y2PA 4ZUXD 3B0DC 5DNNB 2AROD 3WA9C 3REKC 3AZKB 2JCHA 4H9PB 1ULYA 5GSUC 4NE5A 2NQBA 2UWXA 5C3IB 5JRGD 5E5AC 1KX4B 4LD9B 5AV8C 3X1TB 4YS3B 5B33C 4DRAA 2YFWA 4EO5C 2G5IC 3LZ0B 5BO0A 1HQ3B 1ID3C 3KSYA 3WAAD 4UPKA 3AV1D 1M19B 1P3LA 1P3PB 1P3MB 4H9QB 2ZM5A 2JE5A 5AV9C 1P3BB 1P3FB 4ZBJC 4QLCB 3C1BA 3W97C 1F1EA 5B32A 3UT9A 3W99B 1P3OC 4WU8B 3REKD 3AYWC 3AZJB 5GSUD 1KX3C 3NQUA 5CPJC 3AZGD 3LJAD 5CP6B 4J8XA 2BG1A 4H9RA 5E5AD 5AV5C 5B2JA 1P3AC 3B0BA 3X1SB 4KGCA 5B24B 3B0CT 4WNNA 5KDMB 3AFAA 3VH5A 5B33D 3A6NA 1TAFA 3V9RA 5AVBA 5AY8B 3LZ1A 4XUJD 3UTBA 2W8SA 2Y2HA 5GT3D 1AOIA 5BNVA 5AV9D 3RELD 3WTPE 5B1MD 3KWQB 1N1JB 3EPLA 3UTAA 3AV1B 1P3GC 1ZLAD 4R8PD 3KUYA 5B40B 3W97D 2F8NA 3AZLC 3AZHA 4E45A 5B0YC 2L5AA 5BS7C 1T3UA 5DNMD 3C1CD 3AZMD 5DNNC 3TU4A 1EQZD 3AZKC 5B32G 4G91B 4H9NA 4WU9D 3B6GA 4H9SC 3REJD 1KX4C 4LD9C 3LELD 3UT9D 3AZGB 4NE6A 3LJAB 4UUZA 3WKJB 2VQRA 3X1TC 4YS3C 3REHD 5B0ZA 3LZ0C 3EG5B 1HQ3C 5AV6A 4J8VD 3AZIA 1S32A 1M19C 5B31D 3A1IA 3B6FA 2CV5A 2BYKA 4XUJB 1BH8A 1P3PC 4KHAA 4JJND 2NQBB 1P3MC 3KXBA 5GT3B 4J8UA 3AZLD 5B0YD 1P3BC 2FJ7D 3AZFA 4QLCC 1P3FC 2PYOA 3X1UA 3W99C 5DNND 3AZEA 5B1MB 4X23D 1ZLAB 4WU8C 1B6WA 4R8PB 3AZKD 3AZJC 2YFWB 1KX5A 2ZY3A 5CP6C 5DNMB 3MGPA 3C1CB 1KX4D 4LD9D 1BH9B 1P3LB 4J8WD 1EQZB 3X1SC 4Z66A 4WU9B 5B24C 3X1TD 2HUEB 4KUDD 2NZDD 3X1VD 3EPKA 5AY8C 3C1BB 1H3OA 3LELB 5B32B 3UT9B 1M19D 2BYMA 5BNXB 3AN2A 1P3MD 4J8XB 2IO5B 4H9RB 3VH5W 4J8VB 5B2JB 1BFMA 1P3BD 3AV1C 5B31B 1P3FD 5JA4B 5B40C 4KGCB 1U35A 3AFAB 4JJNB 3AZNA 5B1LA 5CPKA 2FFFB 2HIOA 5AVBB 2CV5D 2ZY5A 5CP6D 1TZYD 3UTBB 2FJ7B 4G91C 3AV2D 4X23B 3W98D 2YFVA 3X1SD 5CPIA 3REIA 5B24D 5BNVB 1M18A 3AZGC 3LJAC 1M1AA 5AY8D 3O62A 3KUYB 1HTAA 3WKJC 3WA9A 1W2EA 2F8NB 4J8WB 1P3KA 2Y2JA 5CHLB 4KUDB 2NZDB 3X1VB 5AV8A 3H0RC 5B2ID 4XUJC 4H9NB 3KWQD 2NQBC 3B6GB 5GT0D 5B40D 5GT3C 4H9OB 1P3IA 1ID3A 3RELC 5B1MC 1ZLAC 4R8PC 5B0ZB 1S32B 5DNMC 2Y2NA 3MNNA 3C1CC 3AZMC 3W96A 2CV5B 2BYKB 1P3LC 1TZYB 1P34D 1EQZC 4KHAB 4WU9C 1P3OA 3AV2B 3WKJD 4J8UB 3AYWA 3VH5T 2HUEC 3W98B 5F99D 1KX3A 3REJC 2PYOB 3P5JB 5GXQA 5CPJA 3LELC 3UT9C 3R45A
chains in the Genus database with same CATH topology
5AV5A 1P3AA 5CPID 1KX5B 3REHC 2NQBD 1M18D 3MVDA 4J8XC 3MGPB 2IO5C 3EPJA 4J8VC 1M1AD 4CSRB 5B2JC 5B31C 4Z66B 5B2IB 4KGCC 1Q9CA 3AFAC 4JJNC 5GT0B 5FUGA 1H3OB 1B67A 2FJ7C 3UTBC 3EPHA 1P3GA 4X23C 1P3LD 3WTPA 3NQJB 5C3IC 5BS7A 3C1BD 3KUYC 3IP4C 3MGSA 5B32D 4J8WC 1P34B 4XZQA 1U35B 5B1LB 2HIOB 3MGRA 4KUDC 1A7WA 4H9SA 5F99B 3X1VC 3MGQA 2NZDC 4J8XD 1F66A 5B2JD 2Y2OA 2YFVB 5AVCA 2F2AC 5CPIB 4DQYB 4YS3A 4KGCD 3AFAD 1M18B 3LZ0A 4Z5TA 1HQ3A 3A6ND 1M1AB 5AVBD 3LZ1D 3O62B 3WA9B 3UTBD 5B0ZC 1P3KB 1P3PA 1S32C 2JSSA 1AOID 5BO0B 1R4VA 2CV5C 4QLCA 1TZYC 3UTAD 3W99A 4YM6A 3KUYD 3AV2C 4J8UC 4WU8A 3AZHD 2F8ND 3W98C 3AZJA 1P3IB 3TU4D 4ZUXA 2AROA 1KX5C 3B6GD 3MNNB 3MGPC 1JFIA 3W96B 5JRGA 3NQUB 4XZQD 4Z66C 5B2IC 3KWQC 1P3OB 5G49A 5GT0C 5B0ZD 1F66D 5GXQB 4WNNB 5AV6D 3AZID 1S32D 3A6NB 1TAFB 3V9RB 3LZ1B 3B6FD 3WAAA 4WV4B 3AV1A 3MVDB 3KXBD 4J8UD 5BT1C 4CAYA 3AZFD 1AOIB 2PYOD 3X1UD 3AZED 2RVQC 1P34C 3UTAB 1U35C 5B1LC 3REKA 2HIOC 5FUGB 3AZHB 1KX5D 5F99C 5GSUA 3MGPD 3AZGA 3LJAA 3TU4B 5E5AA 5CPIC 4Z66D 3WTPB 2Y2MA 1M18C 2XD5A 2ZY4A 1M1AC 3KFUG 5B33A 3O62C 3MGSB 3FDDA 4XZQB 4UUZB 4XUJA 1P3KC 1Z2CB 4HGAB 3MGRB 5GT3A 3MGQB 3AN2D 1F66B 5BT1D 5AV6B 3AZIB 5AV9A 3RELA 3B6FB 5B1MA 5AVCB 1ZLAA 2RVQD 3W97A 4R8PA 1U35D 1BH8B 4M6BA 4Z5TB 5B1LD 3AZND 5CPKD 3KXBB 1P3IC 3F6TA 2HIOD 5DNMA 3C1CA 3AZMA 3AZFB 3C1BC 1BH9A 2Y2KA 3X1UB 5B32C 3AZEB 1EQZA 4WU9A 2Y2IA 4WJ3C 3MNNC 3REID 3W96C 3REJA 4DRBA 3VH6W 3LELA 4YM6B 3O62D 2Y2LA 3WA9D 4G92B 1P3KD 5BNXA 3REHA 5GXQC 3A6NC 4J8VA 4ZUXB 2F8NK 5AVBC 5AV8D 2AROB 3LZ1C 4AWLB 5B31A 5JA4A 1WWSA 2G5HC 3MVDC 2BYMB 4JJNA 1JFIB 5JRGB 3AZLA 3H0LC 3AN2B 1P3ID 1AOIC 1ID3D 5B0YA 2FJ7A 3UTAC 5DNNA 5G49B 4X23A 3AZHC 3AZKA 4H9PA 3AZNB 5CPKB 3MNND 3WAAB 3W96D 3TU4C 4WZSB 1KX4A 4LD9A 3WTPC 4J8WA 1P3OD 3AYWD 3B6GC 3X1TA 4CAYB 2DF4C 1KX3D 3REIB 4KUDA 5GXQD 5CPJD 3MGSC 3X1VA 2NZDA 4XZQC 3B0DB 5AV5D 1P3AD 1M19A 4HGAC 3REKB 3MGRC 3AL0C 3MGQC 5GSUB 3MVDD 4H9OA 1F66C 5AV6C 3AZIC 1P3MA 4H9QA 5E5AB 2Y2QA 3B6FC 5AV8B 5AVCC 5B31G 1P3BA 1P3FA 4Z5TC 3VH6T 3KXBC 4Z2MH 5B33B 4EO5B 3AZFC 2F8NH 2PYOC 1ID3B 3X1UC 3H0MC 5CP6A 1TZYA 3VH6A 3AZEC 1P3GD 2ZY2A 3A1KA 3AV2A 2RIQA 3WTPD 3W98A 3X1SA 5B24A 5KDMA 2XD1A 1WWIA 5AV9B 4YM6C 4Z2MG 3RELB 3MGSD 1KU5A 4ZBJB 5AY8A 3W97B 2DQNC 4G92C 2F8NG 3AYWB 3MGRD 3MGQD 4ZUXC 3AZMB 4CSRA 1PZRA 4AWLC 2AROC 1KX3B 5CPJB 3R45B 5B2IA 5AV5B 3KWQA 5AVCD 1P3AB 1N1JA 5GT0A 4YS3D 5B40A 5JRGC 3LZ0D 4Z5TD 3REJB 1HQ3D 3AN2C 2LY8A 4NFTA 2CWEA 3REHB 1P3PD 3NQJA 3AZNC 5CPKC 3WAAC 4QLCD 2J8PA 3B0CW 4E44A 3W99D 4YM6D 1P3GB 2Y2GA 1P34A 4WU8D 3AZJD 3WKJA 4NE3A 3AZLB 3REIC 5F99A 5B0YB 2Y2PA 4ZUXD 3B0DC 5DNNB 2AROD 3WA9C 3REKC 3AZKB 2JCHA 4H9PB 1ULYA 5GSUC 4NE5A 2NQBA 2UWXA 5C3IB 5JRGD 5E5AC 1KX4B 4LD9B 5AV8C 3X1TB 4YS3B 5B33C 4DRAA 2YFWA 4EO5C 2G5IC 3LZ0B 5BO0A 1HQ3B 1ID3C 3KSYA 3WAAD 4UPKA 3AV1D 1M19B 1P3LA 1P3PB 1P3MB 4H9QB 2ZM5A 2JE5A 5AV9C 1P3BB 1P3FB 4ZBJC 4QLCB 3C1BA 3W97C 1F1EA 5B32A 3UT9A 3W99B 1P3OC 4WU8B 3REKD 3AYWC 3AZJB 5GSUD 1KX3C 3NQUA 5CPJC 3AZGD 3LJAD 5CP6B 4J8XA 2BG1A 4H9RA 5E5AD 5AV5C 5B2JA 1P3AC 3B0BA 3X1SB 4KGCA 5B24B 3B0CT 4WNNA 5KDMB 3AFAA 3VH5A 5B33D 3A6NA 1TAFA 3V9RA 5AVBA 5AY8B 3LZ1A 4XUJD 3UTBA 2W8SA 2Y2HA 5GT3D 1AOIA 5BNVA 5AV9D 3RELD 3WTPE 5B1MD 3KWQB 1N1JB 3EPLA 3UTAA 3AV1B 1P3GC 1ZLAD 4R8PD 3KUYA 5B40B 3W97D 2F8NA 3AZLC 3AZHA 4E45A 5B0YC 2L5AA 5BS7C 1T3UA 5DNMD 3C1CD 3AZMD 5DNNC 3TU4A 1EQZD 3AZKC 5B32G 4G91B 4H9NA 4WU9D 3B6GA 4H9SC 3REJD 1KX4C 4LD9C 3LELD 3UT9D 3AZGB 4NE6A 3LJAB 4UUZA 3WKJB 2VQRA 3X1TC 4YS3C 3REHD 5B0ZA 3LZ0C 3EG5B 1HQ3C 5AV6A 4J8VD 3AZIA 1S32A 1M19C 5B31D 3A1IA 3B6FA 2CV5A 2BYKA 4XUJB 1BH8A 1P3PC 4KHAA 4JJND 2NQBB 1P3MC 3KXBA 5GT3B 4J8UA 3AZLD 5B0YD 1P3BC 2FJ7D 3AZFA 4QLCC 1P3FC 2PYOA 3X1UA 3W99C 5DNND 3AZEA 5B1MB 4X23D 1ZLAB 4WU8C 1B6WA 4R8PB 3AZKD 3AZJC 2YFWB 1KX5A 2ZY3A 5CP6C 5DNMB 3MGPA 3C1CB 1KX4D 4LD9D 1BH9B 1P3LB 4J8WD 1EQZB 3X1SC 4Z66A 4WU9B 5B24C 3X1TD 2HUEB 4KUDD 2NZDD 3X1VD 3EPKA 5AY8C 3C1BB 1H3OA 3LELB 5B32B 3UT9B 1M19D 2BYMA 5BNXB 3AN2A 1P3MD 4J8XB 2IO5B 4H9RB 3VH5W 4J8VB 5B2JB 1BFMA 1P3BD 3AV1C 5B31B 1P3FD 5JA4B 5B40C 4KGCB 1U35A 3AFAB 4JJNB 3AZNA 5B1LA 5CPKA 2FFFB 2HIOA 5AVBB 2CV5D 2ZY5A 5CP6D 1TZYD 3UTBB 2FJ7B 4G91C 3AV2D 4X23B 3W98D 2YFVA 3X1SD 5CPIA 3REIA 5B24D 5BNVB 1M18A 3AZGC 3LJAC 1M1AA 5AY8D 3O62A 3KUYB 1HTAA 3WKJC 3WA9A 1W2EA 2F8NB 4J8WB 1P3KA 2Y2JA 5CHLB 4KUDB 2NZDB 3X1VB 5AV8A 3H0RC 5B2ID 4XUJC 4H9NB 3KWQD 2NQBC 3B6GB 5GT0D 5B40D 5GT3C 4H9OB 1P3IA 1ID3A 3RELC 5B1MC 1ZLAC 4R8PC 5B0ZB 1S32B 5DNMC 2Y2NA 3MNNA 3C1CC 3AZMC 3W96A 2CV5B 2BYKB 1P3LC 1TZYB 1P34D 1EQZC 4KHAB 4WU9C 1P3OA 3AV2B 3WKJD 4J8UB 3AYWA 3VH5T 2HUEC 3W98B 5F99D 1KX3A 3REJC 2PYOB 3P5JB 5GXQA 5CPJA 3LELC 3UT9C 3R45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV5 A;  1P3A A;  5CPI D;  1KX5 B;  3REH C;  2NQB D;  1M18 D;  3MVD A;  4J8X C;  3MGP B;  2IO5 C;  4J8V C;  1M1A D;  4CSR B;  5B2J C;  5B31 C;  4Z66 B;  5B2I B;  4KGC C;  1Q9C A;  3AFA C;  4JJN C;  5GT0 B;  5FUG A;  1H3O B;  1B67 A;  2FJ7 C;  3UTB C;  1P3G A;  4X23 C;  1P3L D;  3WTP A;  3NQJ B;  5C3I C;  5BS7 A;  3C1B D;  3KUY C;  3MGS A;  5B32 D;  4J8W C;  1P34 B;  4XZQ A;  1U35 B;  5B1L B;  2HIO B;  3MGR A;  4KUD C;  1A7W A;  4H9S A;  5F99 B;  3X1V C;  3MGQ A;  2NZD C;  4J8X D;  1F66 A;  5B2J D;  2YFV B;  5AVC A;  5CPI B;  4YS3 A;  4KGC D;  3AFA D;  1M18 B;  3LZ0 A;  4Z5T A;  1HQ3 A;  3A6N D;  1M1A B;  5AVB D;  3LZ1 D;  3O62 B;  3WA9 B;  3UTB D;  5B0Z C;  1P3K B;  1P3P A;  1S32 C;  2JSS A;  1AOI D;  5BO0 B;  1R4V A;  2CV5 C;  4QLC A;  1TZY C;  3UTA D;  3W99 A;  4YM6 A;  3KUY D;  3AV2 C;  4J8U C;  4WU8 A;  3AZH D;  2F8N D;  3W98 C;  3AZJ A;  1P3I B;  3TU4 D;  4ZUX A;  2ARO A;  1KX5 C;  3B6G D;  3MNN B;  3MGP C;  1JFI A;  3W96 B;  5JRG A;  3NQU B;  4XZQ D;  4Z66 C;  5B2I C;  3KWQ C;  1P3O B;  5G49 A;  5GT0 C;  5B0Z D;  1F66 D;  5GXQ B;  4WNN B;  5AV6 D;  3AZI D;  1S32 D;  3A6N B;  1TAF B;  3V9R B;  3LZ1 B;  3B6F D;  3WAA A;  4WV4 B;  3AV1 A;  3MVD B;  3KXB D;  4J8U D;  5BT1 C;  4CAY A;  3AZF D;  1AOI B;  2PYO D;  3X1U D;  3AZE D;  2RVQ C;  1P34 C;  3UTA B;  1U35 C;  5B1L C;  3REK A;  2HIO C;  5FUG B;  3AZH B;  1KX5 D;  5F99 C;  5GSU A;  3MGP D;  3AZG A;  3LJA A;  3TU4 B;  5E5A A;  4Z66 D;  5CPI C;  3WTP B;  1M18 C;  1M1A C;  5B33 A;  3O62 C;  3MGS B;  4XZQ B;  4UUZ B;  4XUJ A;  1P3K C;  4HGA B;  3MGR B;  5GT3 A;  3MGQ B;  3AN2 D;  1F66 B;  5BT1 D;  5AV6 B;  3AZI B;  5AV9 A;  3REL A;  3B6F B;  5B1M A;  5AVC B;  1ZLA A;  2RVQ D;  3W97 A;  4R8P A;  1U35 D;  1BH8 B;  4M6B A;  4Z5T B;  5B1L D;  3AZN D;  5CPK D;  3KXB B;  1P3I C;  2HIO D;  5DNM A;  3C1C A;  3AZM A;  3AZF B;  3C1B C;  1BH9 A;  3X1U B;  5B32 C;  3AZE B;  1EQZ A;  4WU9 A;  3MNN C;  3REI D;  3W96 C;  3REJ A;  4DRB A;  3VH6 W;  3LEL A;  4YM6 B;  3O62 D;  3WA9 D;  4G92 B;  1P3K D;  5BNX A;  3REH A;  5GXQ C;  3A6N C;  4J8V A;  4ZUX B;  2F8N K;  5AVB C;  5AV8 D;  2ARO B;  3LZ1 C;  4AWL B;  5B31 A;  5JA4 A;  1WWS A;  3MVD C;  2BYM B;  4JJN A;  1JFI B;  5JRG B;  3AZL A;  3AN2 B;  1P3I D;  1AOI C;  1ID3 D;  5B0Y A;  2FJ7 A;  3UTA C;  5DNN A;  5G49 B;  4X23 A;  3AZH C;  3AZK A;  4H9P A;  3AZN B;  5CPK B;  3MNN D;  3WAA B;  3W96 D;  3TU4 C;  4WZS B;  1KX4 A;  4LD9 A;  3WTP C;  4J8W A;  1P3O D;  3AYW D;  3B6G C;  3X1T A;  4CAY B;  1KX3 D;  3REI B;  4KUD A;  5GXQ D;  5CPJ D;  3MGS C;  3X1V A;  2NZD A;  4XZQ C;  3B0D B;  5AV5 D;  1P3A D;  1M19 A;  4HGA C;  3REK B;  3MGR C;  3MGQ C;  5GSU B;  3MVD D;  4H9O A;  1F66 C;  5AV6 C;  3AZI C;  1P3M A;  4H9Q A;  5E5A B;  3B6F C;  5AV8 B;  5AVC C;  5B31 G;  1P3B A;  1P3F A;  4Z5T C;  3VH6 T;  3KXB C;  4Z2M H;  5B33 B;  4EO5 B;  3AZF C;  2F8N H;  2PYO C;  1ID3 B;  3X1U C;  5CP6 A;  1TZY A;  3VH6 A;  3AZE C;  1P3G D;  3AV2 A;  3WTP D;  3W98 A;  3X1S A;  5B24 A;  5KDM A;  1WWI A;  5AV9 B;  4YM6 C;  4Z2M G;  3REL B;  3MGS D;  1KU5 A;  4ZBJ B;  5AY8 A;  3W97 B;  4G92 C;  2F8N G;  3AYW B;  3MGR D;  3MGQ D;  4ZUX C;  3AZM B;  4CSR A;  4AWL C;  1KX3 B;  2ARO C;  5CPJ B;  3R45 B;  5B2I A;  5AV5 B;  3KWQ A;  5AVC D;  1P3A B;  1N1J A;  5GT0 A;  4YS3 D;  5B40 A;  5JRG C;  3LZ0 D;  4Z5T D;  3REJ B;  1HQ3 D;  3AN2 C;  2LY8 A;  4NFT A;  2CWE A;  3REH B;  1P3P D;  3NQJ A;  3AZN C;  5CPK C;  3WAA C;  4QLC D;  3B0C W;  4E44 A;  3W99 D;  4YM6 D;  1P3G B;  1P34 A;  4WU8 D;  3AZJ D;  3WKJ A;  4NE3 A;  3AZL B;  3REI C;  5F99 A;  5B0Y B;  4ZUX D;  3B0D C;  5DNN B;  2ARO D;  3WA9 C;  3REK C;  3AZK B;  4H9P B;  1ULY A;  5GSU C;  4NE5 A;  2NQB A;  5C3I B;  5JRG D;  5E5A C;  1KX4 B;  4LD9 B;  5AV8 C;  3X1T B;  4YS3 B;  5B33 C;  4DRA A;  2YFW A;  4EO5 C;  3LZ0 B;  5BO0 A;  1HQ3 B;  1ID3 C;  3KSY A;  3WAA D;  3AV1 D;  1M19 B;  1P3L A;  1P3P B;  1P3M B;  4H9Q B;  5AV9 C;  1P3B B;  1P3F B;  4ZBJ C;  4QLC B;  3C1B A;  3W97 C;  1F1E A;  5B32 A;  3UT9 A;  3W99 B;  1P3O C;  4WU8 B;  3REK D;  3AYW C;  3AZJ B;  5GSU D;  1KX3 C;  3NQU A;  5CPJ C;  3AZG D;  3LJA D;  5CP6 B;  4J8X A;  4H9R A;  5E5A D;  5AV5 C;  5B2J A;  1P3A C;  3B0B A;  3X1S B;  4KGC A;  5B24 B;  3B0C T;  4WNN A;  5KDM B;  3AFA A;  3VH5 A;  5B33 D;  3A6N A;  1TAF A;  3V9R A;  5AVB A;  5AY8 B;  3LZ1 A;  4XUJ D;  3UTB A;  5GT3 D;  1AOI A;  5BNV A;  5AV9 D;  3REL D;  3WTP E;  5B1M D;  3KWQ B;  1N1J B;  3UTA A;  3AV1 B;  1P3G C;  1ZLA D;  3W97 D;  4R8P D;  3KUY A;  5B40 B;  2F8N A;  3AZL C;  3AZH A;  4E45 A;  5B0Y C;  2L5A A;  5BS7 C;  5DNM D;  3C1C D;  3AZM D;  5DNN C;  3TU4 A;  1EQZ D;  3AZK C;  5B32 G;  4G91 B;  4H9N A;  4WU9 D;  3B6G A;  4H9S C;  3REJ D;  1KX4 C;  4LD9 C;  3LEL D;  3UT9 D;  3AZG B;  4NE6 A;  3LJA B;  4UUZ A;  3WKJ B;  3X1T C;  4YS3 C;  3REH D;  5B0Z A;  3LZ0 C;  1HQ3 C;  5AV6 A;  4J8V D;  3AZI A;  1S32 A;  1M19 C;  5B31 D;  3B6F A;  2CV5 A;  2BYK A;  4XUJ B;  1BH8 A;  1P3P C;  4KHA A;  4JJN D;  2NQB B;  1P3M C;  3KXB A;  5GT3 B;  4J8U A;  3AZL D;  5B0Y D;  1P3B C;  2FJ7 D;  3AZF A;  4QLC C;  1P3F C;  2PYO A;  3X1U A;  3W99 C;  5DNN D;  3AZE A;  5B1M B;  4X23 D;  1ZLA B;  4WU8 C;  1B6W A;  4R8P B;  3AZK D;  3AZJ C;  2YFW B;  1KX5 A;  5CP6 C;  5DNM B;  3MGP A;  3C1C B;  1KX4 D;  4LD9 D;  1BH9 B;  1P3L B;  4J8W D;  1EQZ B;  3X1S C;  4Z66 A;  4WU9 B;  5B24 C;  3X1T D;  2HUE B;  4KUD D;  2NZD D;  3X1V D;  3C1B B;  5AY8 C;  1H3O A;  3LEL B;  5B32 B;  3UT9 B;  1M19 D;  2BYM A;  5BNX B;  3AN2 A;  1P3M D;  4J8X B;  2IO5 B;  4H9R B;  3VH5 W;  4J8V B;  5B2J B;  1BFM A;  1P3B D;  3AV1 C;  5B31 B;  1P3F D;  5JA4 B;  5B40 C;  4KGC B;  1U35 A;  3AFA B;  4JJN B;  3AZN A;  5B1L A;  5CPK A;  2HIO A;  5AVB B;  2CV5 D;  5CP6 D;  1TZY D;  3UTB B;  2FJ7 B;  4G91 C;  3AV2 D;  4X23 B;  3W98 D;  2YFV A;  3X1S D;  5CPI A;  3REI A;  5B24 D;  5BNV B;  1M18 A;  3AZG C;  3LJA C;  1M1A A;  5AY8 D;  3O62 A;  3KUY B;  1HTA A;  3WKJ C;  3WA9 A;  2F8N B;  4J8W B;  1P3K A;  5CHL B;  4KUD B;  2NZD B;  3X1V B;  5AV8 A;  5B2I D;  4XUJ C;  4H9N B;  3KWQ D;  2NQB C;  3B6G B;  5GT0 D;  5B40 D;  5GT3 C;  4H9O B;  1P3I A;  1ID3 A;  3REL C;  5B1M C;  1ZLA C;  4R8P C;  5B0Z B;  1S32 B;  5DNM C;  3MNN A;  3C1C C;  3AZM C;  3W96 A;  2CV5 B;  2BYK B;  1P3L C;  1TZY B;  1P34 D;  1EQZ C;  4KHA B;  4WU9 C;  1P3O A;  3AV2 B;  3WKJ D;  4J8U B;  3AYW A;  3VH5 T;  2HUE C;  3W98 B;  5F99 D;  1KX3 A;  3REJ C;  2PYO B;  5GXQ A;  5CPJ A;  3LEL C;  3UT9 C;  3R45 A; 
#chains in the Genus database with same CATH topology
 5AV5 A;  1P3A A;  5CPI D;  1KX5 B;  3REH C;  2NQB D;  1M18 D;  3MVD A;  4J8X C;  3MGP B;  2IO5 C;  3EPJ A;  4J8V C;  1M1A D;  4CSR B;  5B2J C;  5B31 C;  4Z66 B;  5B2I B;  4KGC C;  1Q9C A;  3AFA C;  4JJN C;  5GT0 B;  5FUG A;  1H3O B;  1B67 A;  2FJ7 C;  3UTB C;  3EPH A;  1P3G A;  4X23 C;  1P3L D;  3WTP A;  3NQJ B;  5C3I C;  5BS7 A;  3C1B D;  3KUY C;  3IP4 C;  3MGS A;  5B32 D;  4J8W C;  1P34 B;  4XZQ A;  1U35 B;  5B1L B;  2HIO B;  3MGR A;  4KUD C;  1A7W A;  4H9S A;  5F99 B;  3X1V C;  3MGQ A;  2NZD C;  4J8X D;  1F66 A;  5B2J D;  2Y2O A;  2YFV B;  5AVC A;  2F2A C;  5CPI B;  4DQY B;  4YS3 A;  4KGC D;  3AFA D;  1M18 B;  3LZ0 A;  4Z5T A;  1HQ3 A;  3A6N D;  1M1A B;  5AVB D;  3LZ1 D;  3O62 B;  3WA9 B;  3UTB D;  5B0Z C;  1P3K B;  1P3P A;  1S32 C;  2JSS A;  1AOI D;  5BO0 B;  1R4V A;  2CV5 C;  4QLC A;  1TZY C;  3UTA D;  3W99 A;  4YM6 A;  3KUY D;  3AV2 C;  4J8U C;  4WU8 A;  3AZH D;  2F8N D;  3W98 C;  3AZJ A;  1P3I B;  3TU4 D;  4ZUX A;  2ARO A;  1KX5 C;  3B6G D;  3MNN B;  3MGP C;  1JFI A;  3W96 B;  5JRG A;  3NQU B;  4XZQ D;  4Z66 C;  5B2I C;  3KWQ C;  1P3O B;  5G49 A;  5GT0 C;  5B0Z D;  1F66 D;  5GXQ B;  4WNN B;  5AV6 D;  3AZI D;  1S32 D;  3A6N B;  1TAF B;  3V9R B;  3LZ1 B;  3B6F D;  3WAA A;  4WV4 B;  3AV1 A;  3MVD B;  3KXB D;  4J8U D;  5BT1 C;  4CAY A;  3AZF D;  1AOI B;  2PYO D;  3X1U D;  3AZE D;  2RVQ C;  1P34 C;  3UTA B;  1U35 C;  5B1L C;  3REK A;  2HIO C;  5FUG B;  3AZH B;  1KX5 D;  5F99 C;  5GSU A;  3MGP D;  3AZG A;  3LJA A;  3TU4 B;  5E5A A;  5CPI C;  4Z66 D;  3WTP B;  2Y2M A;  1M18 C;  2XD5 A;  2ZY4 A;  1M1A C;  3KFU G;  5B33 A;  3O62 C;  3MGS B;  3FDD A;  4XZQ B;  4UUZ B;  4XUJ A;  1P3K C;  1Z2C B;  4HGA B;  3MGR B;  5GT3 A;  3MGQ B;  3AN2 D;  1F66 B;  5BT1 D;  5AV6 B;  3AZI B;  5AV9 A;  3REL A;  3B6F B;  5B1M A;  5AVC B;  1ZLA A;  2RVQ D;  3W97 A;  4R8P A;  1U35 D;  1BH8 B;  4M6B A;  4Z5T B;  5B1L D;  3AZN D;  5CPK D;  3KXB B;  1P3I C;  3F6T A;  2HIO D;  5DNM A;  3C1C A;  3AZM A;  3AZF B;  3C1B C;  1BH9 A;  2Y2K A;  3X1U B;  5B32 C;  3AZE B;  1EQZ A;  4WU9 A;  2Y2I A;  4WJ3 C;  3MNN C;  3REI D;  3W96 C;  3REJ A;  4DRB A;  3VH6 W;  3LEL A;  4YM6 B;  3O62 D;  2Y2L A;  3WA9 D;  4G92 B;  1P3K D;  5BNX A;  3REH A;  5GXQ C;  3A6N C;  4J8V A;  4ZUX B;  2F8N K;  5AVB C;  5AV8 D;  2ARO B;  3LZ1 C;  4AWL B;  5B31 A;  5JA4 A;  1WWS A;  2G5H C;  3MVD C;  2BYM B;  4JJN A;  1JFI B;  5JRG B;  3AZL A;  3H0L C;  3AN2 B;  1P3I D;  1AOI C;  1ID3 D;  5B0Y A;  2FJ7 A;  3UTA C;  5DNN A;  5G49 B;  4X23 A;  3AZH C;  3AZK A;  4H9P A;  3AZN B;  5CPK B;  3MNN D;  3WAA B;  3W96 D;  3TU4 C;  4WZS B;  1KX4 A;  4LD9 A;  3WTP C;  4J8W A;  1P3O D;  3AYW D;  3B6G C;  3X1T A;  4CAY B;  2DF4 C;  1KX3 D;  3REI B;  4KUD A;  5GXQ D;  5CPJ D;  3MGS C;  3X1V A;  2NZD A;  4XZQ C;  3B0D B;  5AV5 D;  1P3A D;  1M19 A;  4HGA C;  3REK B;  3MGR C;  3AL0 C;  3MGQ C;  5GSU B;  3MVD D;  4H9O A;  1F66 C;  5AV6 C;  3AZI C;  1P3M A;  4H9Q A;  5E5A B;  2Y2Q A;  3B6F C;  5AV8 B;  5AVC C;  5B31 G;  1P3B A;  1P3F A;  4Z5T C;  3VH6 T;  3KXB C;  4Z2M H;  5B33 B;  4EO5 B;  3AZF C;  2F8N H;  2PYO C;  1ID3 B;  3X1U C;  3H0M C;  5CP6 A;  1TZY A;  3VH6 A;  3AZE C;  1P3G D;  2ZY2 A;  3A1K A;  3AV2 A;  2RIQ A;  3WTP D;  3W98 A;  3X1S A;  5B24 A;  5KDM A;  2XD1 A;  1WWI A;  5AV9 B;  4YM6 C;  4Z2M G;  3REL B;  3MGS D;  1KU5 A;  4ZBJ B;  5AY8 A;  3W97 B;  2DQN C;  4G92 C;  2F8N G;  3AYW B;  3MGR D;  3MGQ D;  4ZUX C;  3AZM B;  4CSR A;  1PZR A;  4AWL C;  2ARO C;  1KX3 B;  5CPJ B;  3R45 B;  5B2I A;  5AV5 B;  3KWQ A;  5AVC D;  1P3A B;  1N1J A;  5GT0 A;  4YS3 D;  5B40 A;  5JRG C;  3LZ0 D;  4Z5T D;  3REJ B;  1HQ3 D;  3AN2 C;  2LY8 A;  4NFT A;  2CWE A;  3REH B;  1P3P D;  3NQJ A;  3AZN C;  5CPK C;  3WAA C;  4QLC D;  2J8P A;  3B0C W;  4E44 A;  3W99 D;  4YM6 D;  1P3G B;  2Y2G A;  1P34 A;  4WU8 D;  3AZJ D;  3WKJ A;  4NE3 A;  3AZL B;  3REI C;  5F99 A;  5B0Y B;  2Y2P A;  4ZUX D;  3B0D C;  5DNN B;  2ARO D;  3WA9 C;  3REK C;  3AZK B;  2JCH A;  4H9P B;  1ULY A;  5GSU C;  4NE5 A;  2NQB A;  2UWX A;  5C3I B;  5JRG D;  5E5A C;  1KX4 B;  4LD9 B;  5AV8 C;  3X1T B;  4YS3 B;  5B33 C;  4DRA A;  2YFW A;  4EO5 C;  2G5I C;  3LZ0 B;  5BO0 A;  1HQ3 B;  1ID3 C;  3KSY A;  3WAA D;  4UPK A;  3AV1 D;  1M19 B;  1P3L A;  1P3P B;  1P3M B;  4H9Q B;  2ZM5 A;  2JE5 A;  5AV9 C;  1P3B B;  1P3F B;  4ZBJ C;  4QLC B;  3C1B A;  3W97 C;  1F1E A;  5B32 A;  3UT9 A;  3W99 B;  1P3O C;  4WU8 B;  3REK D;  3AYW C;  3AZJ B;  5GSU D;  1KX3 C;  3NQU A;  5CPJ C;  3AZG D;  3LJA D;  5CP6 B;  4J8X A;  2BG1 A;  4H9R A;  5E5A D;  5AV5 C;  5B2J A;  1P3A C;  3B0B A;  3X1S B;  4KGC A;  5B24 B;  3B0C T;  4WNN A;  5KDM B;  3AFA A;  3VH5 A;  5B33 D;  3A6N A;  1TAF A;  3V9R A;  5AVB A;  5AY8 B;  3LZ1 A;  4XUJ D;  3UTB A;  2W8S A;  2Y2H A;  5GT3 D;  1AOI A;  5BNV A;  5AV9 D;  3REL D;  3WTP E;  5B1M D;  3KWQ B;  1N1J B;  3EPL A;  3UTA A;  3AV1 B;  1P3G C;  1ZLA D;  4R8P D;  3KUY A;  5B40 B;  3W97 D;  2F8N A;  3AZL C;  3AZH A;  4E45 A;  5B0Y C;  2L5A A;  5BS7 C;  1T3U A;  5DNM D;  3C1C D;  3AZM D;  5DNN C;  3TU4 A;  1EQZ D;  3AZK C;  5B32 G;  4G91 B;  4H9N A;  4WU9 D;  3B6G A;  4H9S C;  3REJ D;  1KX4 C;  4LD9 C;  3LEL D;  3UT9 D;  3AZG B;  4NE6 A;  3LJA B;  4UUZ A;  3WKJ B;  2VQR A;  3X1T C;  4YS3 C;  3REH D;  5B0Z A;  3LZ0 C;  3EG5 B;  1HQ3 C;  5AV6 A;  4J8V D;  3AZI A;  1S32 A;  1M19 C;  5B31 D;  3A1I A;  3B6F A;  2CV5 A;  2BYK A;  4XUJ B;  1BH8 A;  1P3P C;  4KHA A;  4JJN D;  2NQB B;  1P3M C;  3KXB A;  5GT3 B;  4J8U A;  3AZL D;  5B0Y D;  1P3B C;  2FJ7 D;  3AZF A;  4QLC C;  1P3F C;  2PYO A;  3X1U A;  3W99 C;  5DNN D;  3AZE A;  5B1M B;  4X23 D;  1ZLA B;  4WU8 C;  1B6W A;  4R8P B;  3AZK D;  3AZJ C;  2YFW B;  1KX5 A;  2ZY3 A;  5CP6 C;  5DNM B;  3MGP A;  3C1C B;  1KX4 D;  4LD9 D;  1BH9 B;  1P3L B;  4J8W D;  1EQZ B;  3X1S C;  4Z66 A;  4WU9 B;  5B24 C;  3X1T D;  2HUE B;  4KUD D;  2NZD D;  3X1V D;  3EPK A;  5AY8 C;  3C1B B;  1H3O A;  3LEL B;  5B32 B;  3UT9 B;  1M19 D;  2BYM A;  5BNX B;  3AN2 A;  1P3M D;  4J8X B;  2IO5 B;  4H9R B;  3VH5 W;  4J8V B;  5B2J B;  1BFM A;  1P3B D;  3AV1 C;  5B31 B;  1P3F D;  5JA4 B;  5B40 C;  4KGC B;  1U35 A;  3AFA B;  4JJN B;  3AZN A;  5B1L A;  5CPK A;  2FFF B;  2HIO A;  5AVB B;  2CV5 D;  2ZY5 A;  5CP6 D;  1TZY D;  3UTB B;  2FJ7 B;  4G91 C;  3AV2 D;  4X23 B;  3W98 D;  2YFV A;  3X1S D;  5CPI A;  3REI A;  5B24 D;  5BNV B;  1M18 A;  3AZG C;  3LJA C;  1M1A A;  5AY8 D;  3O62 A;  3KUY B;  1HTA A;  3WKJ C;  3WA9 A;  1W2E A;  2F8N B;  4J8W B;  1P3K A;  2Y2J A;  5CHL B;  4KUD B;  2NZD B;  3X1V B;  5AV8 A;  3H0R C;  5B2I D;  4XUJ C;  4H9N B;  3KWQ D;  2NQB C;  3B6G B;  5GT0 D;  5B40 D;  5GT3 C;  4H9O B;  1P3I A;  1ID3 A;  3REL C;  5B1M C;  1ZLA C;  4R8P C;  5B0Z B;  1S32 B;  5DNM C;  2Y2N A;  3MNN A;  3C1C C;  3AZM C;  3W96 A;  2CV5 B;  2BYK B;  1P3L C;  1TZY B;  1P34 D;  1EQZ C;  4KHA B;  4WU9 C;  1P3O A;  3AV2 B;  3WKJ D;  4J8U B;  3AYW A;  3VH5 T;  2HUE C;  3W98 B;  5F99 D;  1KX3 A;  3REJ C;  2PYO B;  3P5J B;  5GXQ A;  5CPJ A;  3LEL C;  3UT9 C;  3R45 A; 
#chains in the Genus database with same CATH homology
 5AV5 A;  1P3A A;  5CPI D;  1KX5 B;  3REH C;  2NQB D;  1M18 D;  3MVD A;  4J8X C;  3MGP B;  2IO5 C;  3EPJ A;  4J8V C;  1M1A D;  4CSR B;  5B2J C;  5B31 C;  4Z66 B;  5B2I B;  4KGC C;  1Q9C A;  3AFA C;  4JJN C;  5GT0 B;  5FUG A;  1H3O B;  1B67 A;  2FJ7 C;  3UTB C;  3EPH A;  1P3G A;  4X23 C;  1P3L D;  3WTP A;  3NQJ B;  5C3I C;  5BS7 A;  3C1B D;  3KUY C;  3IP4 C;  3MGS A;  5B32 D;  4J8W C;  1P34 B;  4XZQ A;  1U35 B;  5B1L B;  2HIO B;  3MGR A;  4KUD C;  1A7W A;  4H9S A;  5F99 B;  3X1V C;  3MGQ A;  2NZD C;  4J8X D;  1F66 A;  5B2J D;  2Y2O A;  2YFV B;  5AVC A;  2F2A C;  5CPI B;  4DQY B;  4YS3 A;  4KGC D;  3AFA D;  1M18 B;  3LZ0 A;  4Z5T A;  1HQ3 A;  3A6N D;  1M1A B;  5AVB D;  3LZ1 D;  3O62 B;  3WA9 B;  3UTB D;  5B0Z C;  1P3K B;  1P3P A;  1S32 C;  2JSS A;  1AOI D;  5BO0 B;  1R4V A;  2CV5 C;  4QLC A;  1TZY C;  3UTA D;  3W99 A;  4YM6 A;  3KUY D;  3AV2 C;  4J8U C;  4WU8 A;  3AZH D;  2F8N D;  3W98 C;  3AZJ A;  1P3I B;  3TU4 D;  4ZUX A;  2ARO A;  1KX5 C;  3B6G D;  3MNN B;  3MGP C;  1JFI A;  3W96 B;  5JRG A;  3NQU B;  4XZQ D;  4Z66 C;  5B2I C;  3KWQ C;  1P3O B;  5G49 A;  5GT0 C;  5B0Z D;  1F66 D;  5GXQ B;  4WNN B;  5AV6 D;  3AZI D;  1S32 D;  3A6N B;  1TAF B;  3V9R B;  3LZ1 B;  3B6F D;  3WAA A;  4WV4 B;  3AV1 A;  3MVD B;  3KXB D;  4J8U D;  5BT1 C;  4CAY A;  3AZF D;  1AOI B;  2PYO D;  3X1U D;  3AZE D;  2RVQ C;  1P34 C;  3UTA B;  1U35 C;  5B1L C;  3REK A;  2HIO C;  5FUG B;  3AZH B;  1KX5 D;  5F99 C;  5GSU A;  3MGP D;  3AZG A;  3LJA A;  3TU4 B;  5E5A A;  5CPI C;  4Z66 D;  3WTP B;  2Y2M A;  1M18 C;  2XD5 A;  2ZY4 A;  1M1A C;  3KFU G;  5B33 A;  3O62 C;  3MGS B;  3FDD A;  4XZQ B;  4UUZ B;  4XUJ A;  1P3K C;  1Z2C B;  4HGA B;  3MGR B;  5GT3 A;  3MGQ B;  3AN2 D;  1F66 B;  5BT1 D;  5AV6 B;  3AZI B;  5AV9 A;  3REL A;  3B6F B;  5B1M A;  5AVC B;  1ZLA A;  2RVQ D;  3W97 A;  4R8P A;  1U35 D;  1BH8 B;  4M6B A;  4Z5T B;  5B1L D;  3AZN D;  5CPK D;  3KXB B;  1P3I C;  3F6T A;  2HIO D;  5DNM A;  3C1C A;  3AZM A;  3AZF B;  3C1B C;  1BH9 A;  2Y2K A;  3X1U B;  5B32 C;  3AZE B;  1EQZ A;  4WU9 A;  2Y2I A;  4WJ3 C;  3MNN C;  3REI D;  3W96 C;  3REJ A;  4DRB A;  3VH6 W;  3LEL A;  4YM6 B;  3O62 D;  2Y2L A;  3WA9 D;  4G92 B;  1P3K D;  5BNX A;  3REH A;  5GXQ C;  3A6N C;  4J8V A;  4ZUX B;  2F8N K;  5AVB C;  5AV8 D;  2ARO B;  3LZ1 C;  4AWL B;  5B31 A;  5JA4 A;  1WWS A;  2G5H C;  3MVD C;  2BYM B;  4JJN A;  1JFI B;  5JRG B;  3AZL A;  3H0L C;  3AN2 B;  1P3I D;  1AOI C;  1ID3 D;  5B0Y A;  2FJ7 A;  3UTA C;  5DNN A;  5G49 B;  4X23 A;  3AZH C;  3AZK A;  4H9P A;  3AZN B;  5CPK B;  3MNN D;  3WAA B;  3W96 D;  3TU4 C;  4WZS B;  1KX4 A;  4LD9 A;  3WTP C;  4J8W A;  1P3O D;  3AYW D;  3B6G C;  3X1T A;  4CAY B;  2DF4 C;  1KX3 D;  3REI B;  4KUD A;  5GXQ D;  5CPJ D;  3MGS C;  3X1V A;  2NZD A;  4XZQ C;  3B0D B;  5AV5 D;  1P3A D;  1M19 A;  4HGA C;  3REK B;  3MGR C;  3AL0 C;  3MGQ C;  5GSU B;  3MVD D;  4H9O A;  1F66 C;  5AV6 C;  3AZI C;  1P3M A;  4H9Q A;  5E5A B;  2Y2Q A;  3B6F C;  5AV8 B;  5AVC C;  5B31 G;  1P3B A;  1P3F A;  4Z5T C;  3VH6 T;  3KXB C;  4Z2M H;  5B33 B;  4EO5 B;  3AZF C;  2F8N H;  2PYO C;  1ID3 B;  3X1U C;  3H0M C;  5CP6 A;  1TZY A;  3VH6 A;  3AZE C;  1P3G D;  2ZY2 A;  3A1K A;  3AV2 A;  2RIQ A;  3WTP D;  3W98 A;  3X1S A;  5B24 A;  5KDM A;  2XD1 A;  1WWI A;  5AV9 B;  4YM6 C;  4Z2M G;  3REL B;  3MGS D;  1KU5 A;  4ZBJ B;  5AY8 A;  3W97 B;  2DQN C;  4G92 C;  2F8N G;  3AYW B;  3MGR D;  3MGQ D;  4ZUX C;  3AZM B;  4CSR A;  1PZR A;  4AWL C;  2ARO C;  1KX3 B;  5CPJ B;  3R45 B;  5B2I A;  5AV5 B;  3KWQ A;  5AVC D;  1P3A B;  1N1J A;  5GT0 A;  4YS3 D;  5B40 A;  5JRG C;  3LZ0 D;  4Z5T D;  3REJ B;  1HQ3 D;  3AN2 C;  2LY8 A;  4NFT A;  2CWE A;  3REH B;  1P3P D;  3NQJ A;  3AZN C;  5CPK C;  3WAA C;  4QLC D;  2J8P A;  3B0C W;  4E44 A;  3W99 D;  4YM6 D;  1P3G B;  2Y2G A;  1P34 A;  4WU8 D;  3AZJ D;  3WKJ A;  4NE3 A;  3AZL B;  3REI C;  5F99 A;  5B0Y B;  2Y2P A;  4ZUX D;  3B0D C;  5DNN B;  2ARO D;  3WA9 C;  3REK C;  3AZK B;  2JCH A;  4H9P B;  1ULY A;  5GSU C;  4NE5 A;  2NQB A;  2UWX A;  5C3I B;  5JRG D;  5E5A C;  1KX4 B;  4LD9 B;  5AV8 C;  3X1T B;  4YS3 B;  5B33 C;  4DRA A;  2YFW A;  4EO5 C;  2G5I C;  3LZ0 B;  5BO0 A;  1HQ3 B;  1ID3 C;  3KSY A;  3WAA D;  4UPK A;  3AV1 D;  1M19 B;  1P3L A;  1P3P B;  1P3M B;  4H9Q B;  2ZM5 A;  2JE5 A;  5AV9 C;  1P3B B;  1P3F B;  4ZBJ C;  4QLC B;  3C1B A;  3W97 C;  1F1E A;  5B32 A;  3UT9 A;  3W99 B;  1P3O C;  4WU8 B;  3REK D;  3AYW C;  3AZJ B;  5GSU D;  1KX3 C;  3NQU A;  5CPJ C;  3AZG D;  3LJA D;  5CP6 B;  4J8X A;  2BG1 A;  4H9R A;  5E5A D;  5AV5 C;  5B2J A;  1P3A C;  3B0B A;  3X1S B;  4KGC A;  5B24 B;  3B0C T;  4WNN A;  5KDM B;  3AFA A;  3VH5 A;  5B33 D;  3A6N A;  1TAF A;  3V9R A;  5AVB A;  5AY8 B;  3LZ1 A;  4XUJ D;  3UTB A;  2W8S A;  2Y2H A;  5GT3 D;  1AOI A;  5BNV A;  5AV9 D;  3REL D;  3WTP E;  5B1M D;  3KWQ B;  1N1J B;  3EPL A;  3UTA A;  3AV1 B;  1P3G C;  1ZLA D;  4R8P D;  3KUY A;  5B40 B;  3W97 D;  2F8N A;  3AZL C;  3AZH A;  4E45 A;  5B0Y C;  2L5A A;  5BS7 C;  1T3U A;  5DNM D;  3C1C D;  3AZM D;  5DNN C;  3TU4 A;  1EQZ D;  3AZK C;  5B32 G;  4G91 B;  4H9N A;  4WU9 D;  3B6G A;  4H9S C;  3REJ D;  1KX4 C;  4LD9 C;  3LEL D;  3UT9 D;  3AZG B;  4NE6 A;  3LJA B;  4UUZ A;  3WKJ B;  2VQR A;  3X1T C;  4YS3 C;  3REH D;  5B0Z A;  3LZ0 C;  3EG5 B;  1HQ3 C;  5AV6 A;  4J8V D;  3AZI A;  1S32 A;  1M19 C;  5B31 D;  3A1I A;  3B6F A;  2CV5 A;  2BYK A;  4XUJ B;  1BH8 A;  1P3P C;  4KHA A;  4JJN D;  2NQB B;  1P3M C;  3KXB A;  5GT3 B;  4J8U A;  3AZL D;  5B0Y D;  1P3B C;  2FJ7 D;  3AZF A;  4QLC C;  1P3F C;  2PYO A;  3X1U A;  3W99 C;  5DNN D;  3AZE A;  5B1M B;  4X23 D;  1ZLA B;  4WU8 C;  1B6W A;  4R8P B;  3AZK D;  3AZJ C;  2YFW B;  1KX5 A;  2ZY3 A;  5CP6 C;  5DNM B;  3MGP A;  3C1C B;  1KX4 D;  4LD9 D;  1BH9 B;  1P3L B;  4J8W D;  1EQZ B;  3X1S C;  4Z66 A;  4WU9 B;  5B24 C;  3X1T D;  2HUE B;  4KUD D;  2NZD D;  3X1V D;  3EPK A;  5AY8 C;  3C1B B;  1H3O A;  3LEL B;  5B32 B;  3UT9 B;  1M19 D;  2BYM A;  5BNX B;  3AN2 A;  1P3M D;  4J8X B;  2IO5 B;  4H9R B;  3VH5 W;  4J8V B;  5B2J B;  1BFM A;  1P3B D;  3AV1 C;  5B31 B;  1P3F D;  5JA4 B;  5B40 C;  4KGC B;  1U35 A;  3AFA B;  4JJN B;  3AZN A;  5B1L A;  5CPK A;  2FFF B;  2HIO A;  5AVB B;  2CV5 D;  2ZY5 A;  5CP6 D;  1TZY D;  3UTB B;  2FJ7 B;  4G91 C;  3AV2 D;  4X23 B;  3W98 D;  2YFV A;  3X1S D;  5CPI A;  3REI A;  5B24 D;  5BNV B;  1M18 A;  3AZG C;  3LJA C;  1M1A A;  5AY8 D;  3O62 A;  3KUY B;  1HTA A;  3WKJ C;  3WA9 A;  1W2E A;  2F8N B;  4J8W B;  1P3K A;  2Y2J A;  5CHL B;  4KUD B;  2NZD B;  3X1V B;  5AV8 A;  3H0R C;  5B2I D;  4XUJ C;  4H9N B;  3KWQ D;  2NQB C;  3B6G B;  5GT0 D;  5B40 D;  5GT3 C;  4H9O B;  1P3I A;  1ID3 A;  3REL C;  5B1M C;  1ZLA C;  4R8P C;  5B0Z B;  1S32 B;  5DNM C;  2Y2N A;  3MNN A;  3C1C C;  3AZM C;  3W96 A;  2CV5 B;  2BYK B;  1P3L C;  1TZY B;  1P34 D;  1EQZ C;  4KHA B;  4WU9 C;  1P3O A;  3AV2 B;  3WKJ D;  4J8U B;  3AYW A;  3VH5 T;  2HUE C;  3W98 B;  5F99 D;  1KX3 A;  3REJ C;  2PYO B;  3P5J B;  5GXQ A;  5CPJ A;  3LEL C;  3UT9 C;  3R45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...