4WNNB

Spt16-h2a-h2b fact histone complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
98
structure length
98
Chain Sequence
b'MKKRSKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A.1
publication title FACT Disrupts Nucleosome Structure by Binding H2A-H2B with Conserved Peptide Motifs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 35
structure length 98
sequence length 98
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wnnB00
3B0BA 3W99A 1P34C 3AZHD 5DNND 2HIOA 4WU9D 4XUJD 4R8PD 5AV5B 4J8WA 4H9PB 3MNND 5AV6A 5AV8D 1M1AD 1S32C 5AV9C 1P3MD 5B32G 3REHC 5AY8C 5AVCB 4KGCA 3MGPA 5B24B 5GSUB 3MGQB 3VH6A 1KX4C 5DNMB 3LZ1A 1B67A 4JJNC 3AV2D 4KUDB 1P3FD 4WU8C 3MGRA 5AVBA 3X1TC 2PYOA 5F99C 3W98A 1P3PD 3RELD 4XZQC 3TU4D 1P3OA 5FUGA 3UTBC 3B0CT 4M6BA 4YS3D 5GT3D 4H9RA 5B33D 3C1CD 3AV1C 3AZLA 1ZLAA 5B32C 3O62C 3VH5T 2HIOB 3KWQD 3X1SC 4J8XD 2IO5B 3X1UA 4J8WB 3NQUA 3NQJA 5AV6B 4NFTA 5B2IA 1BH8A 2AROC 3UT9C 2F8ND 4ZBJB 4KGCB 3MGPB 3AZMC 1P3KD 3WKJA 1KX3A 3AZKA 3LZ1B 5B0YD 3AFAD 3MVDA 4QLCC 5CPKD 3W99D 3MGRB 5AVBB 2PYOB 3W98B 1TZYA 5AV5C 3A6ND 1EQZA 2HIOD 1P3GA 3VH6T 3MGSD 3WTPD 4NE3A 1P3OB 5FUGB 3WA9C 3B6FB 4H9RB 5CPIB 3B0DC 3AZHA 3AZLB 1ZLAB 4H9NA 4J8UB 4WU9A 4R8PA 5B24C 5GSUC 3MNNA 3MGQC 3AZGD 2YFVA 3X1UB 2CV5D 3REID 1M1AA 3NQUB 5DNMC 3NQJB 1P3MA 4KUDC 5B2IB 3LELC 1BH8B 3AYWD 3AZNA 1HQ3D 2NZDA 3W98D 5AVBD 5GXQD 3WKJB 2BYMA 3WAAC 4X23D 5B1MA 3AZKB 1P3FA 3R45A 3MVDB 3REJA 1TAFA 5B2JD 1P3PA 2IO5C 5B40B 1TZYB 1EQZB 4J8WC 3TU4A 5AV6C 4Z5TD 5G49A 5BO0A 1P3GB 1N1JA 3VH6W 1WWIA 5GT3A 4YS3A 5B33A 3C1CA 5BT1D 4UUZA 1BH9A 3AZHB 5DNNB 4LD9C 4ZBJC 3KWQA 4H9NB 4KGCC 5B1LD 3MGPC 4XUJB 4R8PB 3C1BD 4WU9B 1A7WA 3MNNB 2YFVB 5AV8B 1M1AB 1M19D 5BNXA 1P3MB 4J8VC 2F8NA 2BYKA 4YM6D 1KX3D 1M18A 1P34D 1P3AC 1P3KA 3AZID 1P3OC 2BYMB 3KXBD 3B6FC 5B0YA 5CPIC 3AV2B 5CPKA 1ZLAC 1P3FB 4J8UC 3R45B 3REJB 1TAFB 1S32D 3A6NA 1P3PB 3AZFD 4Z2MG 1F1EA 3REHD 3RELB 5GT0D 3WTPA 3MGSA 5B0ZA 3TU4B 5G49B 5BO0B 5B31C 1N1JB 5B2IC 1HTAA 4ZUXD 5GT3B 4YS3B 5B33B 3C1CB 3AZJD 2F8NK 1R4VA 1P3LD 4UUZB 1U35A 4H9SC 4AWLB 1BH9B 1P3BD 1KX4D 3KWQB 4Z2MH 4J8XB 3AZGA 3AZND 3WKJC 2CV5A 2NQBD 4WZSB 3REIA 2NZDD 3AZKC 4EO5B 1ID3C 5BNXB 3MVDC 3AN2C 3AYWA 4XZQD 1F66D 2F8NB 1HQ3A 5B1MD 3UTBD 5B40C 1TZYC 1EQZC 3REJD 5GXQA 4E44A 3B6GD 1P3KB 3AZEC 3O62D 4X23A 3KUYD 3W96C 5B0YB 3AFAB 3UTAD 3AZHC 5DNNC 5CPKB 5B2JA 3W99B 4WU9C 4XUJC 4R8PC 1P3IA 1AOIA 3A6NB 5CP6A 3MNNC 4Z5TA 3LZ0D 5AV8C 3MGSB 3WTPB 1P3MC 1KX5A 4KHAA 1ULYA 5B1LA 3C1BA 1JFIA 4QLCD 4Z66C 3AZGB 1M18D 2F8NG 2CV5B 3REIB 1M19A 4E45A 3AV2C 3W97D 1P3FC 4YM6A 3AYWB 1P3PC 1HQ3B 1P34A 5JRGD 3RELC 3TU4C 5GXQB 3AZIA 2FJ7D 2F8NH 3KXBA 5GT3C 4X23B 5B33C 3C1CC 5B0ZD 5B2JB 1S32A 5AV9A 3KWQC 4J8XC 3AZFA 1P3IB 3REHA 3LELD 1U35D 5AVCC 5GT0A 4NE5A 4Z5TB 4ZUXA 3AZJA 1P3LA 5E5AD 1P3BA 1KX4A 3WAAD 4JJNA 5B1LB 3C1BB 5BNVA 3X1VD 2NQBA 1JFIB 5BS7C 1M19B 3AFAC 5CPKC 4XZQA 3W99C 1F66A 5JA4A 4YM6B 3UTBA 1KX3B 1P34B 5CPJD 2HIOC 3B6GA 3WTPC 1P3ID 3AZIB 3O62A 1AOID 4LD9D 3KUYA 5CP6D 3KXBB 3UTAA 1KX5D 2RVQD 1S32B 3AZFB 2JSSA 3UT9A 3LZ0A 3AZGC 3REHB 2CV5C 2YFWA 5GT0B 4G92B 2LY8A 4ZUXB 3AZMA 1P3AD 3LJAD 3AZJB 3REKD 3LZ1C 1P3LB 1HQ3C 1P3BB 1KX4B 4CSRA 3MGRC 5AVBC 2PYOC 5GXQC 4QLCA 3W98C 3AZNB 5BNVB 2NQBB 2NZDB 1WWSA 3W97A 2HUEB 4H9PA 5B2JC 4XZQB 1F66B 5JA4B 5B1MB 3UTBB 5JRGA 3WA9A 3AZLC 4Z5TC 5AV9D 2FJ7A 3B6GB 3O62B 5B24A 3X1UC 1H3OA 3KUYB 5BT1C 5AY8D 3UTAB 5DNMA 2L5AA 4H9OA 3C1BC 1ID3D 3LELA 5C3IB 3AN2D 3LZ0B 4JJND 2YFWB 3VH5A 1M19C 4WU8D 3X1TD 5F99D 5E5AA 4YM6C 3AZMB 1KX3C 4HGAB 3WAAA 5KDMA 3W96D 2BYKB 4CSRB 3X1VA 4QLCB 3AZIC 1M18B 3AV1D 3KXBC 1P3GC 3W97B 5B32D 3X1SD 3AZFC 5JRGB 5CPJA 3WA9B 5GT0C 3B0DB 4LD9A 4G92C 2FJ7B 2AROD 3UT9D 4ZUXC 1M1AC 3AZJC 1H3OB 5B0ZB 1P3LC 4Z66D 1P3BC 3AZMD 4J8VA 4H9OB 3AZNC 3LELB 1U35B 2NQBC 2NZDC 2HUEC 4WNNA 1P3AA 3LJAA 3REKA 1F66C 5AV5D 5E5AB 5B1MC 1Q9CA 3B6FA 3WAAB 3REJC 5CPIA 5KDMB 3B6GC 4J8UA 3X1VB 3WA9D 3KUYC 4DRAA 3UTAC 3WTPE 5AVCD 4G91B 4YS3C 5B31A 5B24D 5GSUD 3MGQD 1BFMA 5C3IC 4AWLC 3LZ0C 5CPJB 5DNMD 4H9SA 4KUDD 1AOIB 4LD9B 2CWEA 5CP6B 5AY8A 4HGAC 4EO5C 4CAYA 1KX5B 4KHAB 3V9RA 1ID3A 4NE6A 4J8VB 3AN2A 1M18C 1KU5A 5B40A 1P3KC 4WU8A 3W97C 3X1TA 4WNNB 5F99A 1P3AB 3LJAB 3AZEA 3REKB 5B0YC 4J8WD 5JRGC 3B0CW 3W96A 5AV6D 5DNNA 4H9QA 3A6NC 2FJ7C 3AV1A 4XUJA 3VH5W 3MGSC 5CHLB 5B0ZC 5B32A 3X1SA 5AV8A 4KGCD 3MGPD 5B31B 4DRBA 1U35C 3LZ1D 5AV9B 4J8VD 2AROA 3REIC 3MGRD 2PYOD 4Z66A 5E5AC 5AY8B 4CAYB 3AV2A 3V9RB 3AYWC 1ID3B 1P3OD 3X1VC 3AN2B 3B6FD 3KSYA 4JJNB 5CPID 1B6WA 3AZLD 1ZLAD 4WU8B 4J8UD 3RELA 3X1TB 4G91C 5AV5A 5F99B 4X23C 3AZEB 3X1UD 5CPJC 3W96B 5B31D 1P3IC 5B2ID 4H9QB 1AOIC 3AV1B 5CP6C 4J8XA 5B31G 5AVCA 5B32B 1KX5C 2RVQC 3X1SB 5GSUA 3MGQA 4WV4B 3WKJD 5B1LC 3AZKD 4KUDA 3MVDD 2AROB 3UT9B 3LJAC 3REKC 5B40D 1TZYD 4Z66B 1EQZD 5BS7A 1P3GD 3AFAA 3AZED
chains in the Genus database with same CATH superfamily
3B0BA 3W99A 1P34C 3AZHD 5DNND 2HIOA 2Y2IA 4WU9D 4XUJD 4R8PD 5AV5B 4J8WA 4H9PB 3MNND 5AV6A 5AV8D 1M1AD 1S32C 5AV9C 1P3MD 5B32G 3REHC 2Y2HA 5AY8C 5AVCB 4KGCA 3MGPA 5B24B 5GSUB 3MGQB 3VH6A 1KX4C 5DNMB 3LZ1A 1B67A 4JJNC 3AV2D 4KUDB 1P3FD 4WU8C 3MGRA 5AVBA 3X1TC 2PYOA 5F99C 3W98A 1P3PD 3H0RC 3RELD 4XZQC 3TU4D 1P3OA 5FUGA 3UTBC 3B0CT 4M6BA 5GT3D 4H9RA 5B33D 4YS3D 3C1CD 3AV1C 3EPHA 3AZLA 1ZLAA 5B32C 3O62C 3VH5T 2HIOB 3KWQD 2ZY2A 4J8XD 3X1SC 2IO5B 3A1IA 3X1UA 4J8WB 2UWXA 3NQUA 3NQJA 5AV6B 4NFTA 5B2IA 1BH8A 2AROC 3UT9C 2F8ND 4ZBJB 4KGCB 3MGPB 3AZMC 1P3KD 2DF4C 2W8SA 3WKJA 1KX3A 3AZKA 3LZ1B 5B0YD 3AFAD 3MVDA 4QLCC 5CPKD 3W99D 3MGRB 5AVBB 2PYOB 3W98B 1TZYA 3H0LC 5AV5C 3A6ND 1EQZA 2HIOD 1P3GA 3VH6T 3MGSD 3WTPD 4NE3A 1P3OB 5FUGB 3WA9C 3B6FB 4H9RB 5CPIB 3B0DC 3AZHA 3AZLB 1ZLAB 4H9NA 4J8UB 4WU9A 4R8PA 5B24C 5GSUC 3MNNA 3MGQC 3AZGD 2YFVA 3X1UB 2CV5D 3REID 1M1AA 3NQUB 5DNMC 3NQJB 1P3MA 4KUDC 5B2IB 3LELC 1BH8B 3AYWD 3AZNA 1HQ3D 2NZDA 3W98D 5AVBD 5GXQD 3WKJB 2BYMA 3WAAC 4DQYB 4X23D 5B1MA 3AZKB 1P3FA 3R45A 3MVDB 3REJA 1TAFA 5B2JD 1P3PA 2IO5C 5B40B 1TZYB 1EQZB 4J8WC 3TU4A 5AV6C 4Z5TD 5G49A 5BO0A 1P3GB 1N1JA 3VH6W 1WWIA 5GT3A 4YS3A 5B33A 3C1CA 5BT1D 4UUZA 1BH9A 3AZHB 5DNNB 4LD9C 4ZBJC 3KWQA 4H9NB 4KGCC 5B1LD 3MGPC 4XUJB 4R8PB 3C1BD 4WU9B 3P5JB 1A7WA 3MNNB 2YFVB 5AV8B 1M1AB 1M19D 5BNXA 1P3MB 4J8VC 2F8NA 2BYKA 4YM6D 1KX3D 1M18A 1P34D 2Y2LA 1P3AC 1P3KA 3AZID 1P3OC 2BYMB 3KXBD 3B6FC 5B0YA 5CPIC 3AV2B 5CPKA 1ZLAC 1P3FB 4J8UC 3R45B 3REJB 1TAFB 1S32D 3A6NA 1P3PB 3AZFD 4Z2MG 1F1EA 3REHD 3RELB 5GT0D 3WTPA 3MGSA 5B0ZA 3TU4B 3AL0C 5G49B 5BO0B 5B31C 1N1JB 2BG1A 5B2IC 1HTAA 4ZUXD 5GT3B 4YS3B 5B33B 3C1CB 3AZJD 2F8NK 1R4VA 1P3LD 4UUZB 2F2AC 3FDDA 4H9SC 4AWLB 1BH9B 1U35A 2Y2MA 1P3BD 1KX4D 3KWQB 4Z2MH 4J8XB 3AZGA 3AZND 3WKJC 2CV5A 2NQBD 4WZSB 3REIA 2NZDD 3AZKC 4EO5B 1ID3C 5BNXB 3MVDC 3AN2C 3AYWA 4XZQD 1F66D 2F8NB 1HQ3A 5B1MD 3UTBD 5B40C 1TZYC 1EQZC 3REJD 5GXQA 4E44A 3B6GD 1P3KB 3AZEC 3O62D 4X23A 3KUYD 3W96C 5B0YB 3AFAB 3UTAD 3AZHC 5DNNC 5CPKB 5B2JA 3W99B 4WU9C 4XUJC 4R8PC 1P3IA 1AOIA 3A6NB 5CP6A 3MNNC 4Z5TA 3LZ0D 5AV8C 3MGSB 3WTPB 1P3MC 1KX5A 4KHAA 1T3UA 1ULYA 2XD5A 5B1LA 3C1BA 1JFIA 4QLCD 4Z66C 2ZY5A 3AZGB 1M18D 2F8NG 2CV5B 3REIB 1M19A 4E45A 3AV2C 3W97D 1P3FC 4YM6A 3AYWB 1P3PC 1HQ3B 1P34A 5JRGD 3RELC 3TU4C 5GXQB 3AZIA 2FJ7D 2F8NH 3KXBA 5GT3C 4X23B 5B33C 3C1CC 3EPJA 5B0ZD 5B2JB 1S32A 5AV9A 3KWQC 4J8XC 3AZFA 1P3IB 3REHA 3LELD 1U35D 4NE5A 5GT0A 5AVCC 4Z5TB 3F6TA 2VQRA 4ZUXA 3AZJA 1P3LA 5E5AD 1P3BA 1KX4A 3WAAD 4JJNA 2JE5A 5B1LB 3C1BB 5BNVA 3X1VD 2NQBA 1JFIB 5BS7C 1M19B 1W2EA 3AFAC 5CPKC 4XZQA 3W99C 1F66A 5JA4A 4YM6B 3UTBA 1KX3B 3H0MC 1P34B 5CPJD 2HIOC 3B6GA 2Y2KA 3WTPC 1P3ID 3AZIB 3O62A 1AOID 4LD9D 3KUYA 5CP6D 3KXBB 3UTAA 1KX5D 2RVQD 1S32B 3AZFB 2JSSA 3UT9A 3LZ0A 3AZGC 3REHB 2CV5C 2YFWA 5GT0B 4G92B 2Y2OA 2LY8A 4ZUXB 3AZMA 1P3AD 3LJAD 3AZJB 3REKD 3LZ1C 1P3LB 1HQ3C 1P3BB 1KX4B 4CSRA 3MGRC 5AVBC 2PYOC 5GXQC 4QLCA 3W98C 3AZNB 5BNVB 2NQBB 2NZDB 1WWSA 3W97A 2HUEB 4H9PA 5B2JC 4XZQB 1F66B 5JA4B 5B1MB 3UTBB 5JRGA 3WA9A 3AZLC 4Z5TC 3EPKA 5AV9D 2FJ7A 3B6GB 2JCHA 3O62B 5B24A 3X1UC 1H3OA 1Z2CB 3KUYB 5BT1C 2ZM5A 2XD1A 5AY8D 3UTAB 5DNMA 2L5AA 4H9OA 3C1BC 1ID3D 3LELA 5C3IB 3AN2D 3IP4C 3LZ0B 4JJND 2YFWB 3VH5A 1M19C 2Y2JA 4WU8D 2RIQA 3X1TD 5F99D 5E5AA 4YM6C 3AZMB 1KX3C 4HGAB 3WAAA 4WJ3C 5KDMA 3W96D 2BYKB 4CSRB 3X1VA 4QLCB 3AZIC 1M18B 3AV1D 3KXBC 1P3GC 2Y2QA 3W97B 5B32D 3X1SD 3AZFC 5JRGB 5CPJA 3WA9B 5GT0C 3A1KA 3B0DB 4LD9A 4G92C 2FJ7B 2AROD 3UT9D 4ZUXC 1M1AC 3AZJC 1H3OB 5B0ZB 1P3LC 4Z66D 3EPLA 1P3BC 3AZMD 4J8VA 4H9OB 3AZNC 3LELB 1U35B 2NQBC 2NZDC 2HUEC 4WNNA 1P3AA 3LJAA 3REKA 1F66C 2Y2GA 5AV5D 3KFUG 5E5AB 5B1MC 1Q9CA 3B6FA 3WAAB 3REJC 5CPIA 5KDMB 3B6GC 4J8UA 3X1VB 3WA9D 3KUYC 4DRAA 3UTAC 3WTPE 5AVCD 4G91B 4YS3C 5B31A 5B24D 5GSUD 3MGQD 1BFMA 5C3IC 4AWLC 3LZ0C 5CPJB 5DNMD 4H9SA 4KUDD 1AOIB 4LD9B 2CWEA 5CP6B 5AY8A 2G5IC 4HGAC 4EO5C 4CAYA 1KX5B 4KHAB 3V9RA 1ID3A 4NE6A 4J8VB 1PZRA 3AN2A 1M18C 1KU5A 5B40A 1P3KC 4WU8A 3W97C 3X1TA 4WNNB 5F99A 2ZY3A 1P3AB 3LJAB 3AZEA 3REKB 5B0YC 2J8PA 4J8WD 5JRGC 3B0CW 3W96A 5AV6D 5DNNA 4H9QA 3A6NC 2FJ7C 3AV1A 2DQNC 4XUJA 3VH5W 3MGSC 5CHLB 5B0ZC 5B32A 3X1SA 5AV8A 4KGCD 3MGPD 5B31B 4DRBA 1U35C 3LZ1D 5AV9B 4J8VD 2AROA 3REIC 3MGRD 2PYOD 4Z66A 5E5AC 5AY8B 2Y2NA 4CAYB 3AV2A 3V9RB 3AYWC 1ID3B 1P3OD 3X1VC 3AN2B 2Y2PA 3B6FD 3KSYA 4JJNB 5CPID 1B6WA 3AZLD 1ZLAD 4WU8B 4J8UD 3RELA 3X1TB 4G91C 5AV5A 5F99B 4X23C 3AZEB 3X1UD 2G5HC 5CPJC 3W96B 5B31D 2ZY4A 1P3IC 5B2ID 4H9QB 1AOIC 3AV1B 5CP6C 4J8XA 5B31G 5AVCA 5B32B 1KX5C 2RVQC 3X1SB 5GSUA 3MGQA 4WV4B 3WKJD 5B1LC 3AZKD 4KUDA 4UPKA 3MVDD 2AROB 3UT9B 3EG5B 3LJAC 3REKC 5B40D 2FFFB 1TZYD 4Z66B 1EQZD 5BS7A 1P3GD 3AFAA 3AZED
chains in the Genus database with same CATH topology
3B0BA 3W99A 1P34C 3AZHD 5DNND 2HIOA 2Y2IA 4WU9D 4XUJD 4R8PD 5AV5B 4J8WA 4H9PB 3MNND 5AV6A 5AV8D 1M1AD 1S32C 5AV9C 1P3MD 5B32G 3REHC 2Y2HA 5AY8C 5AVCB 4KGCA 3MGPA 5B24B 5GSUB 3MGQB 3VH6A 1KX4C 5DNMB 3LZ1A 1B67A 4JJNC 3AV2D 4KUDB 1P3FD 4WU8C 3MGRA 5AVBA 3X1TC 2PYOA 5F99C 3W98A 1P3PD 3H0RC 3RELD 4XZQC 3TU4D 1P3OA 5FUGA 3UTBC 3B0CT 4M6BA 5GT3D 4H9RA 5B33D 4YS3D 3C1CD 3AV1C 3EPHA 3AZLA 1ZLAA 5B32C 3O62C 3VH5T 2HIOB 3KWQD 2ZY2A 4J8XD 3X1SC 2IO5B 3A1IA 3X1UA 4J8WB 2UWXA 3NQUA 3NQJA 5AV6B 4NFTA 5B2IA 1BH8A 2AROC 3UT9C 2F8ND 4ZBJB 4KGCB 3MGPB 3AZMC 1P3KD 2DF4C 2W8SA 3WKJA 1KX3A 3AZKA 3LZ1B 5B0YD 3AFAD 3MVDA 4QLCC 5CPKD 3W99D 3MGRB 5AVBB 2PYOB 3W98B 1TZYA 3H0LC 5AV5C 3A6ND 1EQZA 2HIOD 1P3GA 3VH6T 3MGSD 3WTPD 4NE3A 1P3OB 5FUGB 3WA9C 3B6FB 4H9RB 5CPIB 3B0DC 3AZHA 3AZLB 1ZLAB 4H9NA 4J8UB 4WU9A 4R8PA 5B24C 5GSUC 3MNNA 3MGQC 3AZGD 2YFVA 3X1UB 2CV5D 3REID 1M1AA 3NQUB 5DNMC 3NQJB 1P3MA 4KUDC 5B2IB 3LELC 1BH8B 3AYWD 3AZNA 1HQ3D 2NZDA 3W98D 5AVBD 5GXQD 3WKJB 2BYMA 3WAAC 4DQYB 4X23D 5B1MA 3AZKB 1P3FA 3R45A 3MVDB 3REJA 1TAFA 5B2JD 1P3PA 2IO5C 5B40B 1TZYB 1EQZB 4J8WC 3TU4A 5AV6C 4Z5TD 5G49A 5BO0A 1P3GB 1N1JA 3VH6W 1WWIA 5GT3A 4YS3A 5B33A 3C1CA 5BT1D 4UUZA 1BH9A 3AZHB 5DNNB 4LD9C 4ZBJC 3KWQA 4H9NB 4KGCC 5B1LD 3MGPC 4XUJB 4R8PB 3C1BD 4WU9B 3P5JB 1A7WA 3MNNB 2YFVB 5AV8B 1M1AB 1M19D 5BNXA 1P3MB 4J8VC 2F8NA 2BYKA 4YM6D 1KX3D 1M18A 1P34D 2Y2LA 1P3AC 1P3KA 3AZID 1P3OC 2BYMB 3KXBD 3B6FC 5B0YA 5CPIC 3AV2B 5CPKA 1ZLAC 1P3FB 4J8UC 3R45B 3REJB 1TAFB 1S32D 3A6NA 1P3PB 3AZFD 4Z2MG 1F1EA 3REHD 3RELB 5GT0D 3WTPA 3MGSA 5B0ZA 3TU4B 3AL0C 5G49B 5BO0B 5B31C 1N1JB 2BG1A 5B2IC 1HTAA 4ZUXD 5GT3B 4YS3B 5B33B 3C1CB 3AZJD 2F8NK 1R4VA 1P3LD 4UUZB 2F2AC 3FDDA 4H9SC 4AWLB 1BH9B 1U35A 2Y2MA 1P3BD 1KX4D 3KWQB 4Z2MH 4J8XB 3AZGA 3AZND 3WKJC 2CV5A 2NQBD 4WZSB 3REIA 2NZDD 3AZKC 4EO5B 1ID3C 5BNXB 3MVDC 3AN2C 3AYWA 4XZQD 1F66D 2F8NB 1HQ3A 5B1MD 3UTBD 5B40C 1TZYC 1EQZC 3REJD 5GXQA 4E44A 3B6GD 1P3KB 3AZEC 3O62D 4X23A 3KUYD 3W96C 5B0YB 3AFAB 3UTAD 3AZHC 5DNNC 5CPKB 5B2JA 3W99B 4WU9C 4XUJC 4R8PC 1P3IA 1AOIA 3A6NB 5CP6A 3MNNC 4Z5TA 3LZ0D 5AV8C 3MGSB 3WTPB 1P3MC 1KX5A 4KHAA 1T3UA 1ULYA 2XD5A 5B1LA 3C1BA 1JFIA 4QLCD 4Z66C 2ZY5A 3AZGB 1M18D 2F8NG 2CV5B 3REIB 1M19A 4E45A 3AV2C 3W97D 1P3FC 4YM6A 3AYWB 1P3PC 1HQ3B 1P34A 5JRGD 3RELC 3TU4C 5GXQB 3AZIA 2FJ7D 2F8NH 3KXBA 5GT3C 4X23B 5B33C 3C1CC 3EPJA 5B0ZD 5B2JB 1S32A 5AV9A 3KWQC 4J8XC 3AZFA 1P3IB 3REHA 3LELD 1U35D 4NE5A 5GT0A 5AVCC 4Z5TB 3F6TA 2VQRA 4ZUXA 3AZJA 1P3LA 5E5AD 1P3BA 1KX4A 3WAAD 4JJNA 2JE5A 5B1LB 3C1BB 5BNVA 3X1VD 2NQBA 1JFIB 5BS7C 1M19B 1W2EA 3AFAC 5CPKC 4XZQA 3W99C 1F66A 5JA4A 4YM6B 3UTBA 1KX3B 3H0MC 1P34B 5CPJD 2HIOC 3B6GA 2Y2KA 3WTPC 1P3ID 3AZIB 3O62A 1AOID 4LD9D 3KUYA 5CP6D 3KXBB 3UTAA 1KX5D 2RVQD 1S32B 3AZFB 2JSSA 3UT9A 3LZ0A 3AZGC 3REHB 2CV5C 2YFWA 5GT0B 4G92B 2Y2OA 2LY8A 4ZUXB 3AZMA 1P3AD 3LJAD 3AZJB 3REKD 3LZ1C 1P3LB 1HQ3C 1P3BB 1KX4B 4CSRA 3MGRC 5AVBC 2PYOC 5GXQC 4QLCA 3W98C 3AZNB 5BNVB 2NQBB 2NZDB 1WWSA 3W97A 2HUEB 4H9PA 5B2JC 4XZQB 1F66B 5JA4B 5B1MB 3UTBB 5JRGA 3WA9A 3AZLC 4Z5TC 3EPKA 5AV9D 2FJ7A 3B6GB 2JCHA 3O62B 5B24A 3X1UC 1H3OA 1Z2CB 3KUYB 5BT1C 2ZM5A 2XD1A 5AY8D 3UTAB 5DNMA 2L5AA 4H9OA 3C1BC 1ID3D 3LELA 5C3IB 3AN2D 3IP4C 3LZ0B 4JJND 2YFWB 3VH5A 1M19C 2Y2JA 4WU8D 2RIQA 3X1TD 5F99D 5E5AA 4YM6C 3AZMB 1KX3C 4HGAB 3WAAA 4WJ3C 5KDMA 3W96D 2BYKB 4CSRB 3X1VA 4QLCB 3AZIC 1M18B 3AV1D 3KXBC 1P3GC 2Y2QA 3W97B 5B32D 3X1SD 3AZFC 5JRGB 5CPJA 3WA9B 5GT0C 3A1KA 3B0DB 4LD9A 4G92C 2FJ7B 2AROD 3UT9D 4ZUXC 1M1AC 3AZJC 1H3OB 5B0ZB 1P3LC 4Z66D 3EPLA 1P3BC 3AZMD 4J8VA 4H9OB 3AZNC 3LELB 1U35B 2NQBC 2NZDC 2HUEC 4WNNA 1P3AA 3LJAA 3REKA 1F66C 2Y2GA 5AV5D 3KFUG 5E5AB 5B1MC 1Q9CA 3B6FA 3WAAB 3REJC 5CPIA 5KDMB 3B6GC 4J8UA 3X1VB 3WA9D 3KUYC 4DRAA 3UTAC 3WTPE 5AVCD 4G91B 4YS3C 5B31A 5B24D 5GSUD 3MGQD 1BFMA 5C3IC 4AWLC 3LZ0C 5CPJB 5DNMD 4H9SA 4KUDD 1AOIB 4LD9B 2CWEA 5CP6B 5AY8A 2G5IC 4HGAC 4EO5C 4CAYA 1KX5B 4KHAB 3V9RA 1ID3A 4NE6A 4J8VB 1PZRA 3AN2A 1M18C 1KU5A 5B40A 1P3KC 4WU8A 3W97C 3X1TA 4WNNB 5F99A 2ZY3A 1P3AB 3LJAB 3AZEA 3REKB 5B0YC 2J8PA 4J8WD 5JRGC 3B0CW 3W96A 5AV6D 5DNNA 4H9QA 3A6NC 2FJ7C 3AV1A 2DQNC 4XUJA 3VH5W 3MGSC 5CHLB 5B0ZC 5B32A 3X1SA 5AV8A 4KGCD 3MGPD 5B31B 4DRBA 1U35C 3LZ1D 5AV9B 4J8VD 2AROA 3REIC 3MGRD 2PYOD 4Z66A 5E5AC 5AY8B 2Y2NA 4CAYB 3AV2A 3V9RB 3AYWC 1ID3B 1P3OD 3X1VC 3AN2B 2Y2PA 3B6FD 3KSYA 4JJNB 5CPID 1B6WA 3AZLD 1ZLAD 4WU8B 4J8UD 3RELA 3X1TB 4G91C 5AV5A 5F99B 4X23C 3AZEB 3X1UD 2G5HC 5CPJC 3W96B 5B31D 2ZY4A 1P3IC 5B2ID 4H9QB 1AOIC 3AV1B 5CP6C 4J8XA 5B31G 5AVCA 5B32B 1KX5C 2RVQC 3X1SB 5GSUA 3MGQA 4WV4B 3WKJD 5B1LC 3AZKD 4KUDA 4UPKA 3MVDD 2AROB 3UT9B 3EG5B 3LJAC 3REKC 5B40D 2FFFB 1TZYD 4Z66B 1EQZD 5BS7A 1P3GD 3AFAA 3AZED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0B A;  3W99 A;  1P34 C;  3AZH D;  5DNN D;  2HIO A;  4WU9 D;  4XUJ D;  4R8P D;  5AV5 B;  4J8W A;  4H9P B;  3MNN D;  5AV6 A;  5AV8 D;  1M1A D;  1S32 C;  5AV9 C;  1P3M D;  5B32 G;  3REH C;  5AY8 C;  5AVC B;  4KGC A;  3MGP A;  5B24 B;  5GSU B;  3MGQ B;  3VH6 A;  1KX4 C;  5DNM B;  3LZ1 A;  1B67 A;  4JJN C;  3AV2 D;  4KUD B;  1P3F D;  4WU8 C;  3MGR A;  5AVB A;  3X1T C;  2PYO A;  5F99 C;  3W98 A;  1P3P D;  3REL D;  4XZQ C;  3TU4 D;  1P3O A;  5FUG A;  3UTB C;  3B0C T;  4M6B A;  4YS3 D;  5GT3 D;  4H9R A;  5B33 D;  3C1C D;  3AV1 C;  3AZL A;  1ZLA A;  5B32 C;  3O62 C;  3VH5 T;  2HIO B;  3KWQ D;  3X1S C;  4J8X D;  2IO5 B;  3X1U A;  4J8W B;  3NQU A;  3NQJ A;  5AV6 B;  4NFT A;  5B2I A;  1BH8 A;  2ARO C;  3UT9 C;  2F8N D;  4ZBJ B;  4KGC B;  3MGP B;  3AZM C;  1P3K D;  3WKJ A;  1KX3 A;  3AZK A;  3LZ1 B;  5B0Y D;  3AFA D;  3MVD A;  4QLC C;  5CPK D;  3W99 D;  3MGR B;  5AVB B;  2PYO B;  3W98 B;  1TZY A;  5AV5 C;  3A6N D;  1EQZ A;  2HIO D;  1P3G A;  3VH6 T;  3MGS D;  3WTP D;  4NE3 A;  1P3O B;  5FUG B;  3WA9 C;  3B6F B;  4H9R B;  5CPI B;  3B0D C;  3AZH A;  3AZL B;  1ZLA B;  4H9N A;  4J8U B;  4WU9 A;  4R8P A;  5B24 C;  5GSU C;  3MNN A;  3MGQ C;  3AZG D;  2YFV A;  3X1U B;  2CV5 D;  3REI D;  1M1A A;  3NQU B;  5DNM C;  3NQJ B;  1P3M A;  4KUD C;  5B2I B;  3LEL C;  1BH8 B;  3AYW D;  3AZN A;  1HQ3 D;  2NZD A;  3W98 D;  5AVB D;  5GXQ D;  3WKJ B;  2BYM A;  3WAA C;  4X23 D;  5B1M A;  3AZK B;  1P3F A;  3R45 A;  3MVD B;  3REJ A;  1TAF A;  5B2J D;  1P3P A;  2IO5 C;  5B40 B;  1TZY B;  1EQZ B;  4J8W C;  3TU4 A;  5AV6 C;  4Z5T D;  5G49 A;  5BO0 A;  1P3G B;  1N1J A;  3VH6 W;  1WWI A;  5GT3 A;  4YS3 A;  5B33 A;  3C1C A;  5BT1 D;  4UUZ A;  1BH9 A;  3AZH B;  5DNN B;  4LD9 C;  4ZBJ C;  3KWQ A;  4H9N B;  4KGC C;  5B1L D;  3MGP C;  4XUJ B;  4R8P B;  3C1B D;  4WU9 B;  1A7W A;  3MNN B;  2YFV B;  5AV8 B;  1M1A B;  1M19 D;  5BNX A;  1P3M B;  4J8V C;  2F8N A;  2BYK A;  4YM6 D;  1KX3 D;  1M18 A;  1P34 D;  1P3A C;  1P3K A;  3AZI D;  1P3O C;  2BYM B;  3KXB D;  3B6F C;  5B0Y A;  5CPI C;  3AV2 B;  5CPK A;  1ZLA C;  1P3F B;  4J8U C;  3R45 B;  3REJ B;  1TAF B;  1S32 D;  3A6N A;  1P3P B;  3AZF D;  4Z2M G;  1F1E A;  3REH D;  3REL B;  5GT0 D;  3WTP A;  3MGS A;  5B0Z A;  3TU4 B;  5G49 B;  5BO0 B;  5B31 C;  1N1J B;  5B2I C;  1HTA A;  4ZUX D;  5GT3 B;  4YS3 B;  5B33 B;  3C1C B;  3AZJ D;  2F8N K;  1R4V A;  1P3L D;  4UUZ B;  1U35 A;  4H9S C;  4AWL B;  1BH9 B;  1P3B D;  1KX4 D;  3KWQ B;  4Z2M H;  4J8X B;  3AZG A;  3AZN D;  3WKJ C;  2CV5 A;  2NQB D;  4WZS B;  3REI A;  2NZD D;  3AZK C;  4EO5 B;  1ID3 C;  5BNX B;  3MVD C;  3AN2 C;  3AYW A;  4XZQ D;  1F66 D;  2F8N B;  1HQ3 A;  5B1M D;  3UTB D;  5B40 C;  1TZY C;  1EQZ C;  3REJ D;  5GXQ A;  4E44 A;  3B6G D;  1P3K B;  3AZE C;  3O62 D;  4X23 A;  3KUY D;  3W96 C;  5B0Y B;  3AFA B;  3UTA D;  3AZH C;  5DNN C;  5CPK B;  5B2J A;  3W99 B;  4WU9 C;  4XUJ C;  4R8P C;  1P3I A;  1AOI A;  3A6N B;  5CP6 A;  3MNN C;  4Z5T A;  3LZ0 D;  5AV8 C;  3MGS B;  3WTP B;  1P3M C;  1KX5 A;  4KHA A;  1ULY A;  5B1L A;  3C1B A;  1JFI A;  4QLC D;  4Z66 C;  3AZG B;  1M18 D;  2F8N G;  2CV5 B;  3REI B;  1M19 A;  4E45 A;  3AV2 C;  3W97 D;  1P3F C;  4YM6 A;  3AYW B;  1P3P C;  1HQ3 B;  1P34 A;  5JRG D;  3REL C;  3TU4 C;  5GXQ B;  3AZI A;  2FJ7 D;  2F8N H;  3KXB A;  5GT3 C;  4X23 B;  5B33 C;  3C1C C;  5B0Z D;  5B2J B;  1S32 A;  5AV9 A;  3KWQ C;  4J8X C;  3AZF A;  1P3I B;  3REH A;  3LEL D;  1U35 D;  5AVC C;  5GT0 A;  4NE5 A;  4Z5T B;  4ZUX A;  3AZJ A;  1P3L A;  5E5A D;  1P3B A;  1KX4 A;  3WAA D;  4JJN A;  5B1L B;  3C1B B;  5BNV A;  3X1V D;  2NQB A;  1JFI B;  5BS7 C;  1M19 B;  3AFA C;  5CPK C;  4XZQ A;  3W99 C;  1F66 A;  5JA4 A;  4YM6 B;  3UTB A;  1KX3 B;  1P34 B;  5CPJ D;  2HIO C;  3B6G A;  3WTP C;  1P3I D;  3AZI B;  3O62 A;  1AOI D;  4LD9 D;  3KUY A;  5CP6 D;  3KXB B;  3UTA A;  1KX5 D;  2RVQ D;  1S32 B;  3AZF B;  2JSS A;  3UT9 A;  3LZ0 A;  3AZG C;  3REH B;  2CV5 C;  2YFW A;  5GT0 B;  4G92 B;  2LY8 A;  4ZUX B;  3AZM A;  1P3A D;  3LJA D;  3AZJ B;  3REK D;  3LZ1 C;  1P3L B;  1HQ3 C;  1P3B B;  1KX4 B;  4CSR A;  3MGR C;  5AVB C;  2PYO C;  5GXQ C;  4QLC A;  3W98 C;  3AZN B;  5BNV B;  2NQB B;  2NZD B;  1WWS A;  3W97 A;  2HUE B;  4H9P A;  5B2J C;  4XZQ B;  1F66 B;  5JA4 B;  5B1M B;  3UTB B;  5JRG A;  3WA9 A;  3AZL C;  4Z5T C;  5AV9 D;  2FJ7 A;  3B6G B;  3O62 B;  5B24 A;  3X1U C;  1H3O A;  3KUY B;  5BT1 C;  5AY8 D;  3UTA B;  5DNM A;  2L5A A;  4H9O A;  3C1B C;  1ID3 D;  3LEL A;  5C3I B;  3AN2 D;  3LZ0 B;  4JJN D;  2YFW B;  3VH5 A;  1M19 C;  4WU8 D;  3X1T D;  5F99 D;  5E5A A;  4YM6 C;  3AZM B;  1KX3 C;  4HGA B;  3WAA A;  5KDM A;  3W96 D;  2BYK B;  4CSR B;  3X1V A;  4QLC B;  3AZI C;  1M18 B;  3AV1 D;  3KXB C;  1P3G C;  3W97 B;  5B32 D;  3X1S D;  3AZF C;  5JRG B;  5CPJ A;  3WA9 B;  5GT0 C;  3B0D B;  4LD9 A;  4G92 C;  2FJ7 B;  2ARO D;  3UT9 D;  4ZUX C;  1M1A C;  3AZJ C;  1H3O B;  5B0Z B;  1P3L C;  4Z66 D;  1P3B C;  3AZM D;  4J8V A;  4H9O B;  3AZN C;  3LEL B;  1U35 B;  2NQB C;  2NZD C;  2HUE C;  4WNN A;  1P3A A;  3LJA A;  3REK A;  1F66 C;  5AV5 D;  5E5A B;  5B1M C;  1Q9C A;  3B6F A;  3WAA B;  3REJ C;  5CPI A;  5KDM B;  3B6G C;  4J8U A;  3X1V B;  3WA9 D;  3KUY C;  4DRA A;  3UTA C;  3WTP E;  5AVC D;  4G91 B;  4YS3 C;  5B31 A;  5B24 D;  5GSU D;  3MGQ D;  1BFM A;  5C3I C;  4AWL C;  3LZ0 C;  5CPJ B;  5DNM D;  4H9S A;  4KUD D;  1AOI B;  4LD9 B;  2CWE A;  5CP6 B;  5AY8 A;  4HGA C;  4EO5 C;  4CAY A;  1KX5 B;  4KHA B;  3V9R A;  1ID3 A;  4NE6 A;  4J8V B;  3AN2 A;  1M18 C;  1KU5 A;  5B40 A;  1P3K C;  4WU8 A;  3W97 C;  3X1T A;  4WNN B;  5F99 A;  1P3A B;  3LJA B;  3AZE A;  3REK B;  5B0Y C;  4J8W D;  5JRG C;  3B0C W;  3W96 A;  5AV6 D;  5DNN A;  4H9Q A;  3A6N C;  2FJ7 C;  3AV1 A;  4XUJ A;  3VH5 W;  3MGS C;  5CHL B;  5B0Z C;  5B32 A;  3X1S A;  5AV8 A;  4KGC D;  3MGP D;  5B31 B;  4DRB A;  1U35 C;  3LZ1 D;  5AV9 B;  4J8V D;  2ARO A;  3REI C;  3MGR D;  2PYO D;  4Z66 A;  5E5A C;  5AY8 B;  4CAY B;  3AV2 A;  3V9R B;  3AYW C;  1ID3 B;  1P3O D;  3X1V C;  3AN2 B;  3B6F D;  3KSY A;  4JJN B;  5CPI D;  1B6W A;  3AZL D;  1ZLA D;  4WU8 B;  4J8U D;  3REL A;  3X1T B;  4G91 C;  5AV5 A;  5F99 B;  4X23 C;  3AZE B;  3X1U D;  5CPJ C;  3W96 B;  5B31 D;  1P3I C;  5B2I D;  4H9Q B;  1AOI C;  3AV1 B;  5CP6 C;  4J8X A;  5B31 G;  5AVC A;  5B32 B;  1KX5 C;  2RVQ C;  3X1S B;  5GSU A;  3MGQ A;  4WV4 B;  3WKJ D;  5B1L C;  3AZK D;  4KUD A;  3MVD D;  2ARO B;  3UT9 B;  3LJA C;  3REK C;  5B40 D;  1TZY D;  4Z66 B;  1EQZ D;  5BS7 A;  1P3G D;  3AFA A;  3AZE D; 
#chains in the Genus database with same CATH topology
 3B0B A;  3W99 A;  1P34 C;  3AZH D;  5DNN D;  2HIO A;  2Y2I A;  4WU9 D;  4XUJ D;  4R8P D;  5AV5 B;  4J8W A;  4H9P B;  3MNN D;  5AV6 A;  5AV8 D;  1M1A D;  1S32 C;  5AV9 C;  1P3M D;  5B32 G;  3REH C;  2Y2H A;  5AY8 C;  5AVC B;  4KGC A;  3MGP A;  5B24 B;  5GSU B;  3MGQ B;  3VH6 A;  1KX4 C;  5DNM B;  3LZ1 A;  1B67 A;  4JJN C;  3AV2 D;  4KUD B;  1P3F D;  4WU8 C;  3MGR A;  5AVB A;  3X1T C;  2PYO A;  5F99 C;  3W98 A;  1P3P D;  3H0R C;  3REL D;  4XZQ C;  3TU4 D;  1P3O A;  5FUG A;  3UTB C;  3B0C T;  4M6B A;  5GT3 D;  4H9R A;  5B33 D;  4YS3 D;  3C1C D;  3AV1 C;  3EPH A;  3AZL A;  1ZLA A;  5B32 C;  3O62 C;  3VH5 T;  2HIO B;  3KWQ D;  2ZY2 A;  4J8X D;  3X1S C;  2IO5 B;  3A1I A;  3X1U A;  4J8W B;  2UWX A;  3NQU A;  3NQJ A;  5AV6 B;  4NFT A;  5B2I A;  1BH8 A;  2ARO C;  3UT9 C;  2F8N D;  4ZBJ B;  4KGC B;  3MGP B;  3AZM C;  1P3K D;  2DF4 C;  2W8S A;  3WKJ A;  1KX3 A;  3AZK A;  3LZ1 B;  5B0Y D;  3AFA D;  3MVD A;  4QLC C;  5CPK D;  3W99 D;  3MGR B;  5AVB B;  2PYO B;  3W98 B;  1TZY A;  3H0L C;  5AV5 C;  3A6N D;  1EQZ A;  2HIO D;  1P3G A;  3VH6 T;  3MGS D;  3WTP D;  4NE3 A;  1P3O B;  5FUG B;  3WA9 C;  3B6F B;  4H9R B;  5CPI B;  3B0D C;  3AZH A;  3AZL B;  1ZLA B;  4H9N A;  4J8U B;  4WU9 A;  4R8P A;  5B24 C;  5GSU C;  3MNN A;  3MGQ C;  3AZG D;  2YFV A;  3X1U B;  2CV5 D;  3REI D;  1M1A A;  3NQU B;  5DNM C;  3NQJ B;  1P3M A;  4KUD C;  5B2I B;  3LEL C;  1BH8 B;  3AYW D;  3AZN A;  1HQ3 D;  2NZD A;  3W98 D;  5AVB D;  5GXQ D;  3WKJ B;  2BYM A;  3WAA C;  4DQY B;  4X23 D;  5B1M A;  3AZK B;  1P3F A;  3R45 A;  3MVD B;  3REJ A;  1TAF A;  5B2J D;  1P3P A;  2IO5 C;  5B40 B;  1TZY B;  1EQZ B;  4J8W C;  3TU4 A;  5AV6 C;  4Z5T D;  5G49 A;  5BO0 A;  1P3G B;  1N1J A;  3VH6 W;  1WWI A;  5GT3 A;  4YS3 A;  5B33 A;  3C1C A;  5BT1 D;  4UUZ A;  1BH9 A;  3AZH B;  5DNN B;  4LD9 C;  4ZBJ C;  3KWQ A;  4H9N B;  4KGC C;  5B1L D;  3MGP C;  4XUJ B;  4R8P B;  3C1B D;  4WU9 B;  3P5J B;  1A7W A;  3MNN B;  2YFV B;  5AV8 B;  1M1A B;  1M19 D;  5BNX A;  1P3M B;  4J8V C;  2F8N A;  2BYK A;  4YM6 D;  1KX3 D;  1M18 A;  1P34 D;  2Y2L A;  1P3A C;  1P3K A;  3AZI D;  1P3O C;  2BYM B;  3KXB D;  3B6F C;  5B0Y A;  5CPI C;  3AV2 B;  5CPK A;  1ZLA C;  1P3F B;  4J8U C;  3R45 B;  3REJ B;  1TAF B;  1S32 D;  3A6N A;  1P3P B;  3AZF D;  4Z2M G;  1F1E A;  3REH D;  3REL B;  5GT0 D;  3WTP A;  3MGS A;  5B0Z A;  3TU4 B;  3AL0 C;  5G49 B;  5BO0 B;  5B31 C;  1N1J B;  2BG1 A;  5B2I C;  1HTA A;  4ZUX D;  5GT3 B;  4YS3 B;  5B33 B;  3C1C B;  3AZJ D;  2F8N K;  1R4V A;  1P3L D;  4UUZ B;  2F2A C;  3FDD A;  4H9S C;  4AWL B;  1BH9 B;  1U35 A;  2Y2M A;  1P3B D;  1KX4 D;  3KWQ B;  4Z2M H;  4J8X B;  3AZG A;  3AZN D;  3WKJ C;  2CV5 A;  2NQB D;  4WZS B;  3REI A;  2NZD D;  3AZK C;  4EO5 B;  1ID3 C;  5BNX B;  3MVD C;  3AN2 C;  3AYW A;  4XZQ D;  1F66 D;  2F8N B;  1HQ3 A;  5B1M D;  3UTB D;  5B40 C;  1TZY C;  1EQZ C;  3REJ D;  5GXQ A;  4E44 A;  3B6G D;  1P3K B;  3AZE C;  3O62 D;  4X23 A;  3KUY D;  3W96 C;  5B0Y B;  3AFA B;  3UTA D;  3AZH C;  5DNN C;  5CPK B;  5B2J A;  3W99 B;  4WU9 C;  4XUJ C;  4R8P C;  1P3I A;  1AOI A;  3A6N B;  5CP6 A;  3MNN C;  4Z5T A;  3LZ0 D;  5AV8 C;  3MGS B;  3WTP B;  1P3M C;  1KX5 A;  4KHA A;  1T3U A;  1ULY A;  2XD5 A;  5B1L A;  3C1B A;  1JFI A;  4QLC D;  4Z66 C;  2ZY5 A;  3AZG B;  1M18 D;  2F8N G;  2CV5 B;  3REI B;  1M19 A;  4E45 A;  3AV2 C;  3W97 D;  1P3F C;  4YM6 A;  3AYW B;  1P3P C;  1HQ3 B;  1P34 A;  5JRG D;  3REL C;  3TU4 C;  5GXQ B;  3AZI A;  2FJ7 D;  2F8N H;  3KXB A;  5GT3 C;  4X23 B;  5B33 C;  3C1C C;  3EPJ A;  5B0Z D;  5B2J B;  1S32 A;  5AV9 A;  3KWQ C;  4J8X C;  3AZF A;  1P3I B;  3REH A;  3LEL D;  1U35 D;  4NE5 A;  5GT0 A;  5AVC C;  4Z5T B;  3F6T A;  2VQR A;  4ZUX A;  3AZJ A;  1P3L A;  5E5A D;  1P3B A;  1KX4 A;  3WAA D;  4JJN A;  2JE5 A;  5B1L B;  3C1B B;  5BNV A;  3X1V D;  2NQB A;  1JFI B;  5BS7 C;  1M19 B;  1W2E A;  3AFA C;  5CPK C;  4XZQ A;  3W99 C;  1F66 A;  5JA4 A;  4YM6 B;  3UTB A;  1KX3 B;  3H0M C;  1P34 B;  5CPJ D;  2HIO C;  3B6G A;  2Y2K A;  3WTP C;  1P3I D;  3AZI B;  3O62 A;  1AOI D;  4LD9 D;  3KUY A;  5CP6 D;  3KXB B;  3UTA A;  1KX5 D;  2RVQ D;  1S32 B;  3AZF B;  2JSS A;  3UT9 A;  3LZ0 A;  3AZG C;  3REH B;  2CV5 C;  2YFW A;  5GT0 B;  4G92 B;  2Y2O A;  2LY8 A;  4ZUX B;  3AZM A;  1P3A D;  3LJA D;  3AZJ B;  3REK D;  3LZ1 C;  1P3L B;  1HQ3 C;  1P3B B;  1KX4 B;  4CSR A;  3MGR C;  5AVB C;  2PYO C;  5GXQ C;  4QLC A;  3W98 C;  3AZN B;  5BNV B;  2NQB B;  2NZD B;  1WWS A;  3W97 A;  2HUE B;  4H9P A;  5B2J C;  4XZQ B;  1F66 B;  5JA4 B;  5B1M B;  3UTB B;  5JRG A;  3WA9 A;  3AZL C;  4Z5T C;  3EPK A;  5AV9 D;  2FJ7 A;  3B6G B;  2JCH A;  3O62 B;  5B24 A;  3X1U C;  1H3O A;  1Z2C B;  3KUY B;  5BT1 C;  2ZM5 A;  2XD1 A;  5AY8 D;  3UTA B;  5DNM A;  2L5A A;  4H9O A;  3C1B C;  1ID3 D;  3LEL A;  5C3I B;  3AN2 D;  3IP4 C;  3LZ0 B;  4JJN D;  2YFW B;  3VH5 A;  1M19 C;  2Y2J A;  4WU8 D;  2RIQ A;  3X1T D;  5F99 D;  5E5A A;  4YM6 C;  3AZM B;  1KX3 C;  4HGA B;  3WAA A;  4WJ3 C;  5KDM A;  3W96 D;  2BYK B;  4CSR B;  3X1V A;  4QLC B;  3AZI C;  1M18 B;  3AV1 D;  3KXB C;  1P3G C;  2Y2Q A;  3W97 B;  5B32 D;  3X1S D;  3AZF C;  5JRG B;  5CPJ A;  3WA9 B;  5GT0 C;  3A1K A;  3B0D B;  4LD9 A;  4G92 C;  2FJ7 B;  2ARO D;  3UT9 D;  4ZUX C;  1M1A C;  3AZJ C;  1H3O B;  5B0Z B;  1P3L C;  4Z66 D;  3EPL A;  1P3B C;  3AZM D;  4J8V A;  4H9O B;  3AZN C;  3LEL B;  1U35 B;  2NQB C;  2NZD C;  2HUE C;  4WNN A;  1P3A A;  3LJA A;  3REK A;  1F66 C;  2Y2G A;  5AV5 D;  3KFU G;  5E5A B;  5B1M C;  1Q9C A;  3B6F A;  3WAA B;  3REJ C;  5CPI A;  5KDM B;  3B6G C;  4J8U A;  3X1V B;  3WA9 D;  3KUY C;  4DRA A;  3UTA C;  3WTP E;  5AVC D;  4G91 B;  4YS3 C;  5B31 A;  5B24 D;  5GSU D;  3MGQ D;  1BFM A;  5C3I C;  4AWL C;  3LZ0 C;  5CPJ B;  5DNM D;  4H9S A;  4KUD D;  1AOI B;  4LD9 B;  2CWE A;  5CP6 B;  5AY8 A;  2G5I C;  4HGA C;  4EO5 C;  4CAY A;  1KX5 B;  4KHA B;  3V9R A;  1ID3 A;  4NE6 A;  4J8V B;  1PZR A;  3AN2 A;  1M18 C;  1KU5 A;  5B40 A;  1P3K C;  4WU8 A;  3W97 C;  3X1T A;  4WNN B;  5F99 A;  2ZY3 A;  1P3A B;  3LJA B;  3AZE A;  3REK B;  5B0Y C;  2J8P A;  4J8W D;  5JRG C;  3B0C W;  3W96 A;  5AV6 D;  5DNN A;  4H9Q A;  3A6N C;  2FJ7 C;  3AV1 A;  2DQN C;  4XUJ A;  3VH5 W;  3MGS C;  5CHL B;  5B0Z C;  5B32 A;  3X1S A;  5AV8 A;  4KGC D;  3MGP D;  5B31 B;  4DRB A;  1U35 C;  3LZ1 D;  5AV9 B;  4J8V D;  2ARO A;  3REI C;  3MGR D;  2PYO D;  4Z66 A;  5E5A C;  5AY8 B;  2Y2N A;  4CAY B;  3AV2 A;  3V9R B;  3AYW C;  1ID3 B;  1P3O D;  3X1V C;  3AN2 B;  2Y2P A;  3B6F D;  3KSY A;  4JJN B;  5CPI D;  1B6W A;  3AZL D;  1ZLA D;  4WU8 B;  4J8U D;  3REL A;  3X1T B;  4G91 C;  5AV5 A;  5F99 B;  4X23 C;  3AZE B;  3X1U D;  2G5H C;  5CPJ C;  3W96 B;  5B31 D;  2ZY4 A;  1P3I C;  5B2I D;  4H9Q B;  1AOI C;  3AV1 B;  5CP6 C;  4J8X A;  5B31 G;  5AVC A;  5B32 B;  1KX5 C;  2RVQ C;  3X1S B;  5GSU A;  3MGQ A;  4WV4 B;  3WKJ D;  5B1L C;  3AZK D;  4KUD A;  4UPK A;  3MVD D;  2ARO B;  3UT9 B;  3EG5 B;  3LJA C;  3REK C;  5B40 D;  2FFF B;  1TZY D;  4Z66 B;  1EQZ D;  5BS7 A;  1P3G D;  3AFA A;  3AZE D; 
#chains in the Genus database with same CATH homology
 3B0B A;  3W99 A;  1P34 C;  3AZH D;  5DNN D;  2HIO A;  2Y2I A;  4WU9 D;  4XUJ D;  4R8P D;  5AV5 B;  4J8W A;  4H9P B;  3MNN D;  5AV6 A;  5AV8 D;  1M1A D;  1S32 C;  5AV9 C;  1P3M D;  5B32 G;  3REH C;  2Y2H A;  5AY8 C;  5AVC B;  4KGC A;  3MGP A;  5B24 B;  5GSU B;  3MGQ B;  3VH6 A;  1KX4 C;  5DNM B;  3LZ1 A;  1B67 A;  4JJN C;  3AV2 D;  4KUD B;  1P3F D;  4WU8 C;  3MGR A;  5AVB A;  3X1T C;  2PYO A;  5F99 C;  3W98 A;  1P3P D;  3H0R C;  3REL D;  4XZQ C;  3TU4 D;  1P3O A;  5FUG A;  3UTB C;  3B0C T;  4M6B A;  5GT3 D;  4H9R A;  5B33 D;  4YS3 D;  3C1C D;  3AV1 C;  3EPH A;  3AZL A;  1ZLA A;  5B32 C;  3O62 C;  3VH5 T;  2HIO B;  3KWQ D;  2ZY2 A;  4J8X D;  3X1S C;  2IO5 B;  3A1I A;  3X1U A;  4J8W B;  2UWX A;  3NQU A;  3NQJ A;  5AV6 B;  4NFT A;  5B2I A;  1BH8 A;  2ARO C;  3UT9 C;  2F8N D;  4ZBJ B;  4KGC B;  3MGP B;  3AZM C;  1P3K D;  2DF4 C;  2W8S A;  3WKJ A;  1KX3 A;  3AZK A;  3LZ1 B;  5B0Y D;  3AFA D;  3MVD A;  4QLC C;  5CPK D;  3W99 D;  3MGR B;  5AVB B;  2PYO B;  3W98 B;  1TZY A;  3H0L C;  5AV5 C;  3A6N D;  1EQZ A;  2HIO D;  1P3G A;  3VH6 T;  3MGS D;  3WTP D;  4NE3 A;  1P3O B;  5FUG B;  3WA9 C;  3B6F B;  4H9R B;  5CPI B;  3B0D C;  3AZH A;  3AZL B;  1ZLA B;  4H9N A;  4J8U B;  4WU9 A;  4R8P A;  5B24 C;  5GSU C;  3MNN A;  3MGQ C;  3AZG D;  2YFV A;  3X1U B;  2CV5 D;  3REI D;  1M1A A;  3NQU B;  5DNM C;  3NQJ B;  1P3M A;  4KUD C;  5B2I B;  3LEL C;  1BH8 B;  3AYW D;  3AZN A;  1HQ3 D;  2NZD A;  3W98 D;  5AVB D;  5GXQ D;  3WKJ B;  2BYM A;  3WAA C;  4DQY B;  4X23 D;  5B1M A;  3AZK B;  1P3F A;  3R45 A;  3MVD B;  3REJ A;  1TAF A;  5B2J D;  1P3P A;  2IO5 C;  5B40 B;  1TZY B;  1EQZ B;  4J8W C;  3TU4 A;  5AV6 C;  4Z5T D;  5G49 A;  5BO0 A;  1P3G B;  1N1J A;  3VH6 W;  1WWI A;  5GT3 A;  4YS3 A;  5B33 A;  3C1C A;  5BT1 D;  4UUZ A;  1BH9 A;  3AZH B;  5DNN B;  4LD9 C;  4ZBJ C;  3KWQ A;  4H9N B;  4KGC C;  5B1L D;  3MGP C;  4XUJ B;  4R8P B;  3C1B D;  4WU9 B;  3P5J B;  1A7W A;  3MNN B;  2YFV B;  5AV8 B;  1M1A B;  1M19 D;  5BNX A;  1P3M B;  4J8V C;  2F8N A;  2BYK A;  4YM6 D;  1KX3 D;  1M18 A;  1P34 D;  2Y2L A;  1P3A C;  1P3K A;  3AZI D;  1P3O C;  2BYM B;  3KXB D;  3B6F C;  5B0Y A;  5CPI C;  3AV2 B;  5CPK A;  1ZLA C;  1P3F B;  4J8U C;  3R45 B;  3REJ B;  1TAF B;  1S32 D;  3A6N A;  1P3P B;  3AZF D;  4Z2M G;  1F1E A;  3REH D;  3REL B;  5GT0 D;  3WTP A;  3MGS A;  5B0Z A;  3TU4 B;  3AL0 C;  5G49 B;  5BO0 B;  5B31 C;  1N1J B;  2BG1 A;  5B2I C;  1HTA A;  4ZUX D;  5GT3 B;  4YS3 B;  5B33 B;  3C1C B;  3AZJ D;  2F8N K;  1R4V A;  1P3L D;  4UUZ B;  2F2A C;  3FDD A;  4H9S C;  4AWL B;  1BH9 B;  1U35 A;  2Y2M A;  1P3B D;  1KX4 D;  3KWQ B;  4Z2M H;  4J8X B;  3AZG A;  3AZN D;  3WKJ C;  2CV5 A;  2NQB D;  4WZS B;  3REI A;  2NZD D;  3AZK C;  4EO5 B;  1ID3 C;  5BNX B;  3MVD C;  3AN2 C;  3AYW A;  4XZQ D;  1F66 D;  2F8N B;  1HQ3 A;  5B1M D;  3UTB D;  5B40 C;  1TZY C;  1EQZ C;  3REJ D;  5GXQ A;  4E44 A;  3B6G D;  1P3K B;  3AZE C;  3O62 D;  4X23 A;  3KUY D;  3W96 C;  5B0Y B;  3AFA B;  3UTA D;  3AZH C;  5DNN C;  5CPK B;  5B2J A;  3W99 B;  4WU9 C;  4XUJ C;  4R8P C;  1P3I A;  1AOI A;  3A6N B;  5CP6 A;  3MNN C;  4Z5T A;  3LZ0 D;  5AV8 C;  3MGS B;  3WTP B;  1P3M C;  1KX5 A;  4KHA A;  1T3U A;  1ULY A;  2XD5 A;  5B1L A;  3C1B A;  1JFI A;  4QLC D;  4Z66 C;  2ZY5 A;  3AZG B;  1M18 D;  2F8N G;  2CV5 B;  3REI B;  1M19 A;  4E45 A;  3AV2 C;  3W97 D;  1P3F C;  4YM6 A;  3AYW B;  1P3P C;  1HQ3 B;  1P34 A;  5JRG D;  3REL C;  3TU4 C;  5GXQ B;  3AZI A;  2FJ7 D;  2F8N H;  3KXB A;  5GT3 C;  4X23 B;  5B33 C;  3C1C C;  3EPJ A;  5B0Z D;  5B2J B;  1S32 A;  5AV9 A;  3KWQ C;  4J8X C;  3AZF A;  1P3I B;  3REH A;  3LEL D;  1U35 D;  4NE5 A;  5GT0 A;  5AVC C;  4Z5T B;  3F6T A;  2VQR A;  4ZUX A;  3AZJ A;  1P3L A;  5E5A D;  1P3B A;  1KX4 A;  3WAA D;  4JJN A;  2JE5 A;  5B1L B;  3C1B B;  5BNV A;  3X1V D;  2NQB A;  1JFI B;  5BS7 C;  1M19 B;  1W2E A;  3AFA C;  5CPK C;  4XZQ A;  3W99 C;  1F66 A;  5JA4 A;  4YM6 B;  3UTB A;  1KX3 B;  3H0M C;  1P34 B;  5CPJ D;  2HIO C;  3B6G A;  2Y2K A;  3WTP C;  1P3I D;  3AZI B;  3O62 A;  1AOI D;  4LD9 D;  3KUY A;  5CP6 D;  3KXB B;  3UTA A;  1KX5 D;  2RVQ D;  1S32 B;  3AZF B;  2JSS A;  3UT9 A;  3LZ0 A;  3AZG C;  3REH B;  2CV5 C;  2YFW A;  5GT0 B;  4G92 B;  2Y2O A;  2LY8 A;  4ZUX B;  3AZM A;  1P3A D;  3LJA D;  3AZJ B;  3REK D;  3LZ1 C;  1P3L B;  1HQ3 C;  1P3B B;  1KX4 B;  4CSR A;  3MGR C;  5AVB C;  2PYO C;  5GXQ C;  4QLC A;  3W98 C;  3AZN B;  5BNV B;  2NQB B;  2NZD B;  1WWS A;  3W97 A;  2HUE B;  4H9P A;  5B2J C;  4XZQ B;  1F66 B;  5JA4 B;  5B1M B;  3UTB B;  5JRG A;  3WA9 A;  3AZL C;  4Z5T C;  3EPK A;  5AV9 D;  2FJ7 A;  3B6G B;  2JCH A;  3O62 B;  5B24 A;  3X1U C;  1H3O A;  1Z2C B;  3KUY B;  5BT1 C;  2ZM5 A;  2XD1 A;  5AY8 D;  3UTA B;  5DNM A;  2L5A A;  4H9O A;  3C1B C;  1ID3 D;  3LEL A;  5C3I B;  3AN2 D;  3IP4 C;  3LZ0 B;  4JJN D;  2YFW B;  3VH5 A;  1M19 C;  2Y2J A;  4WU8 D;  2RIQ A;  3X1T D;  5F99 D;  5E5A A;  4YM6 C;  3AZM B;  1KX3 C;  4HGA B;  3WAA A;  4WJ3 C;  5KDM A;  3W96 D;  2BYK B;  4CSR B;  3X1V A;  4QLC B;  3AZI C;  1M18 B;  3AV1 D;  3KXB C;  1P3G C;  2Y2Q A;  3W97 B;  5B32 D;  3X1S D;  3AZF C;  5JRG B;  5CPJ A;  3WA9 B;  5GT0 C;  3A1K A;  3B0D B;  4LD9 A;  4G92 C;  2FJ7 B;  2ARO D;  3UT9 D;  4ZUX C;  1M1A C;  3AZJ C;  1H3O B;  5B0Z B;  1P3L C;  4Z66 D;  3EPL A;  1P3B C;  3AZM D;  4J8V A;  4H9O B;  3AZN C;  3LEL B;  1U35 B;  2NQB C;  2NZD C;  2HUE C;  4WNN A;  1P3A A;  3LJA A;  3REK A;  1F66 C;  2Y2G A;  5AV5 D;  3KFU G;  5E5A B;  5B1M C;  1Q9C A;  3B6F A;  3WAA B;  3REJ C;  5CPI A;  5KDM B;  3B6G C;  4J8U A;  3X1V B;  3WA9 D;  3KUY C;  4DRA A;  3UTA C;  3WTP E;  5AVC D;  4G91 B;  4YS3 C;  5B31 A;  5B24 D;  5GSU D;  3MGQ D;  1BFM A;  5C3I C;  4AWL C;  3LZ0 C;  5CPJ B;  5DNM D;  4H9S A;  4KUD D;  1AOI B;  4LD9 B;  2CWE A;  5CP6 B;  5AY8 A;  2G5I C;  4HGA C;  4EO5 C;  4CAY A;  1KX5 B;  4KHA B;  3V9R A;  1ID3 A;  4NE6 A;  4J8V B;  1PZR A;  3AN2 A;  1M18 C;  1KU5 A;  5B40 A;  1P3K C;  4WU8 A;  3W97 C;  3X1T A;  4WNN B;  5F99 A;  2ZY3 A;  1P3A B;  3LJA B;  3AZE A;  3REK B;  5B0Y C;  2J8P A;  4J8W D;  5JRG C;  3B0C W;  3W96 A;  5AV6 D;  5DNN A;  4H9Q A;  3A6N C;  2FJ7 C;  3AV1 A;  2DQN C;  4XUJ A;  3VH5 W;  3MGS C;  5CHL B;  5B0Z C;  5B32 A;  3X1S A;  5AV8 A;  4KGC D;  3MGP D;  5B31 B;  4DRB A;  1U35 C;  3LZ1 D;  5AV9 B;  4J8V D;  2ARO A;  3REI C;  3MGR D;  2PYO D;  4Z66 A;  5E5A C;  5AY8 B;  2Y2N A;  4CAY B;  3AV2 A;  3V9R B;  3AYW C;  1ID3 B;  1P3O D;  3X1V C;  3AN2 B;  2Y2P A;  3B6F D;  3KSY A;  4JJN B;  5CPI D;  1B6W A;  3AZL D;  1ZLA D;  4WU8 B;  4J8U D;  3REL A;  3X1T B;  4G91 C;  5AV5 A;  5F99 B;  4X23 C;  3AZE B;  3X1U D;  2G5H C;  5CPJ C;  3W96 B;  5B31 D;  2ZY4 A;  1P3I C;  5B2I D;  4H9Q B;  1AOI C;  3AV1 B;  5CP6 C;  4J8X A;  5B31 G;  5AVC A;  5B32 B;  1KX5 C;  2RVQ C;  3X1S B;  5GSU A;  3MGQ A;  4WV4 B;  3WKJ D;  5B1L C;  3AZK D;  4KUD A;  4UPK A;  3MVD D;  2ARO B;  3UT9 B;  3EG5 B;  3LJA C;  3REK C;  5B40 D;  2FFF B;  1TZY D;  4Z66 B;  1EQZ D;  5BS7 A;  1P3G D;  3AFA A;  3AZE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...