5GSUC

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
KSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuC00
1M18B 5CP6B 4H9SC 3MNNB 1BH8B 3KXBB 5E5AB 2PYOA 3X1VC 4XZQB 3KWQA 1H3OB 5DNMC 4JJNA 1P3BA 1M1AA 5GT3D 5AV5D 3AN2B 3MGPD 3WAAD 3REIA 3RELB 5BT1D 4KGCC 4WV4B 3W98C 5CPKA 3WKJC 1EQZC 1F66D 3X1SB 5B32C 5AY8B 3REJD 4J8VB 1ZLAC 3UTAD 3AZKB 5B0ZD 4KUDA 2BYKB 1P3OA 2RVQD 3X1UB 5CPJA 1BH9B 1HQ3D 5CP6C 3AZHB 1M18C 3MGRA 2PYOD 3MNNC 3KXBC 5E5AC 4EO5B 1TZYA 3KWQD 1HTAA 3NQUB 4XZQC 4JJND 5B31G 1P3BD 1M1AD 2AROA 4H9SA 3MGSA 3W97A 5AV9B 3AN2C 3REID 3LZ0B 3RELC 5CPKD 2YFWB 5AY8C 2BYMA 1U35A 5DNNA 1KU5A 4J8VC 4KUDD 4NE5A 3AZKC 5AV6A 5GT3B 5AV5B 3REKC 1P3OD 3KSYA 4KGCA 3WAAB 3X1UC 5AVCC 3MGRD 3AZHC 3REHA 3X1TA 4EO5C 4J8XA 1TZYD 4HGAB 5G49B 2HUEB 3UTAB 2AROD 3MGSD 1BH8A 5E5AA 3W97D 2PYOB 5AV9C 3WTPE 3LZ0C 2L5AA 2CV5A 5DNMD 3B0CW 3LELA 2F8NH 4WU8A 4QLCA 3KWQB 1U35D 5DNND 1A7WA 1P3IA 4H9OA 2JSSA 3AZLB 5AV6D 1M1AB 3AN2A 5GT3C 5AV5C 4KGCD 3W99B 3RELA 3W98D 4KHAA 1B67A 3WAAC 3REIB 3REHD 4J8UA 4J8XD 1P3MB 4HGAC 3C1CA 3REKA 1AOIA 2HUEC 1KX3A 1P3OB 5AVCA 3KXBD 3AZMA 5CPJB 5E5AD 1S32A 3MGRB 1N1JA 2PYOC 2FJ7C 3WA9A 4XZQD 2CV5D 3LELD 4WU8D 4QLCD 1P3ID 1P3GA 3UTBA 2AROB 3AZLC 3MGSB 5AV9A 3AN2D 3AV2B 1M1AC 3RELD 3W97B 3W99C 3V9RA 4J8UD 5CPIB 1ID3A 1P3MC 2BYMB 1U35B 5DNNB 3C1CD 3REKD 1AOID 1KX3D 3B6FA 5AV6B 5AVCD 1P3OC 1JFIA 5CPJC 1S32D 3REHB 3X1TB 4NFTA 5JA4B 5AVBA 4H9QA 3WA9D 1TAFA 4J8XB 1P3GD 3UTBD 2AROC 4Z2MG 5AV9D 3MGSC 3AV2C 3WTPA 4G92C 3LZ0D 3W97C 1ID3D 5CPIC 2CV5B 3VH5W 3LELB 4WU8B 4QLCB 3AZLA 1P3IB 1U35C 5DNNC 4H9OB 3B6FD 1R4VA 2IO5C 4WNNA 5AV6C 3AV1A 3W99A 4KHAB 4J8UB 3REHC 3X1TC 1P3MA 4J8XC 4H9PA 3C1CB 3REKB 1KX4B 1AOIB 1KX3B 2F8NB 5AVCB 3LZ1A 3AZMB 5B0YA 3AYWB 3WTPD 1S32B 1M19A 1N1JB 4Z5TA 5B24C 3WA9B 4YM6A 4XUJA 2CV5C 3VH5A 3LELC 5B1MB 4QLCC 4WU8C 3AZLD 1P3AA 1P3GB 1P3IC 3UTBB 3AV2A 3UT9B 3W99D 3AV1D 3NQJA 5CPIA 3V9RB 3VH6W 3AZGB 1ID3B 4J8UC 1P3LC 3B0BA 1P3MD 5GSUA 2HIOB 3C1CC 1KX4C 1AOIC 1KX3C 4J8WA 5CPJD 3B6FB 4LD9C 1JFIB 3LZ1D 5B31A 3AZMC 3AYWC 5CHLB 1M19D 5JA4A 1S32C 5B32G 5AVBB 4H9QB 4YM6D 5B1LA 1TAFB 3WA9C 4XUJD 5JRGC 5B1MC 1P3AD 2NZDA 1P3GC 1P3KA 3AV2D 3UTBC 3W96C 3C1BA 3UT9C 5F99C 3WTPB 5B24A 5CPID 5C3IB 3R45B 3VH6A 3AZGC 1ID3C 3AZEA 5GSUD 1B6WA 3MVDA 5BNVA 4Z66A 2HIOC 4J8WD 3B6FC 4WNNB 3AV1B 5B31D 3X1TD 4CAYA 1P3LA 5FUGA 3O62C 5B1LD 5AVBC 5BO0A 1KX4A 4H9PB 4R8PA 4LD9A 2F8NA 2NZDD 1P3KD 4M6BA 3C1BD 3AYWA 5GT0B 3LZ1B 5B0YB 4DRBA 5B24D 1M19B 3WTPC 5B33C 4Z5TB 5JRGA 4ZUXB 5C3IC 4H9NA 4YM6B 3AZJA 3AZED 5B1MA 4XUJB 3W96A 1P3AB 3UT9A 5F99A 4G92B 4YS3B 3NQJB 3AV1C 4WU9B 3AZGA 1P3LD 1WWSA 5GSUB 1KX4D 2HIOA 3TU4C 4LD9D 2IO5B 2F8ND 4J8WB 3AZMD 3AYWD 3O62A 5B31B 4X23A 5GT0C 3LZ1C 2YFVA 5B0YC 1M19C 5JRGD 4Z5TC 5B1LB 3AZJD 4ZUXC 5B1MD 4YM6C 4XUJC 3W96D 3KUYA 3UT9D 2NZDB 1P3AC 1P3KB 5F99D 3C1BB 4Z2MH 5B33A 1P3FB 4H9RA 1P34A 4YS3C 5B24B 3LJAC 4WU9C 3AZGD 3R45A 5B2IA 5KDMB 3AZFA 3AZEB 3AZNA 1F1EA 5GSUC 5GXQA 3B6GB 2HIOD 1WWIA 3MVDB 5BNVB 4Z66B 5B40A 1P3PB 4J8WC 3REJA 3O62D 4X23D 5B31C 5B0ZA 4CAYB 1P3LB 5FUGB 5AVBD 1HQ3A 3TU4A 5B1LC 5BO0B 2LY8A 4R8PB 4WZSB 3AFAA 4LD9B 5BS7C 3KUYD 2NZDC 5GT0A 5AV8B 1P3KC 5B33D 3C1BC 1P34D 1P3FC 5B2ID 4ZUXA 4E44A 5JRGB 3AZFD 4H9NB 3AZJB 3AZEC 3AZND 5GXQD 4E45A 3B6GC 4ZBJB 3W96B 3MVDC 5B40D 5F99B 4YS3A 3B0CT 4Z66C 3LJAA 4WU9A 1P3PC 3MGQA 1KX5A 2NQBC 3AZIB 3TU4D 3AFAD 4G91B 4R8PC 4CSRA 4NE3A 5GT0D 5B0YD 5B2JA 5AV8C 2FJ7A 3A6NA 3O62B 4X23B 2YFVB 4Z5TD 4ZUXD 2CWEA 3X1VA 3AZJC 5BS7A 3KUYB 4ZBJC 5DNMA 5BNXA 1P3FA 4YS3D 3LJAD 4WU9D 3X1SC 5B33B 4H9RB 1P34B 3MGQD 1KX5D 5KDMA 5B2IB 3AZFB 3MGPB 3B6GA 3W98A 3AZNB 3AZIC 3WKJA 4UUZA 5GXQB 1EQZA 5B32A 4G91C 1P3PA 5B40B 1F66B 1ZLAA 3REJB 5B2JD 2FJ7D 2NQBA 3A6ND 5B0ZB 4X23C 1M18A 5CP6A 3MNNA 3KXBA 3X1VD 1HQ3B 3TU4B 3AFAB 4NE6A 3B0DB 1Q9CA 5AV8A 4XZQA 2F8NG 3KUYC 1H3OA 1P3FD 4JJNB 1P34C 1P3BB 5B2IC 4DRAA 3AZFC 3B6GD 3MGPC 3WKJD 3AZNC 3MVDD 1EQZD 5GXQC 5BT1C 4Z66D 5B32D 5CPKB 3X1SA 1P3PD 5AY8A 4J8VA 1ZLAD 3VH5T 3LJAB 5B40C 1F66C 3AZKA 2NQBD 3REJC 2BYKA 3MGQB 4KUDB 3UTAC 1KX5B 5B0ZC 3X1UA 1M18D 1BH9A 5CP6D 3AZIA 3AZHA 2RVQC 3MNND 2F8NK 4R8PD 1HQ3C 4AWLB 1BFMA 3AFAC 5AV8D 3B0DC 4CSRB 3NQUA 1TZYB 5B2JB 2FJ7B 3A6NB 3KWQC 4JJNC 1P3BC 1ULYA 3X1VB 3LZ0A 2YFWA 3REIC 3X1SD 5CPKC 5AY8D 5DNMB 5BNXB 4J8VD 3AZKD 5AV5A 5GT3A 4KUDC 3MGQC 1KX5C 3X1UD 3WAAA 3MGPA 3AZID 3AZHD 4KGCB 3W98B 3WKJB 4UUZB 3MGRC 1EQZB 4AWLC 3VH6T 5B32B 1F66A 1ZLAB 5G49A 3UTAA 2NQBB 1TZYC 5B2JC 3A6NC
chains in the Genus database with same CATH superfamily
1M18B 3F6TA 5CP6B 4H9SC 3MNNB 1BH8B 3KXBB 5E5AB 2PYOA 3X1VC 4XZQB 3KWQA 1H3OB 5DNMC 4JJNA 1P3BA 2ZY3A 1M1AA 5GT3D 5AV5D 3AN2B 3MGPD 3WAAD 1PZRA 3REIA 3RELB 5BT1D 4KGCC 2ZY4A 4WV4B 3W98C 5CPKA 3WKJC 1EQZC 1F66D 3X1SB 5B32C 4WJ3C 5AY8B 3REJD 4J8VB 1ZLAC 3UTAD 3AZKB 5B0ZD 4KUDA 2BYKB 1P3OA 2RVQD 3X1UB 5CPJA 1BH9B 2Y2HA 1HQ3D 5CP6C 3AZHB 1M18C 3MGRA 2PYOD 3MNNC 3KXBC 5E5AC 4EO5B 1TZYA 3KWQD 1HTAA 2Y2OA 3NQUB 4XZQC 4JJND 5B31G 1P3BD 1M1AD 2AROA 4H9SA 3MGSA 3W97A 5AV9B 3AN2C 3REID 3LZ0B 3RELC 5CPKD 2YFWB 2BG1A 5AY8C 2BYMA 1U35A 5DNNA 1KU5A 4J8VC 4KUDD 4NE5A 3AZKC 5AV6A 2Y2NA 5GT3B 5AV5B 3EG5B 3REKC 1P3OD 3H0LC 3KSYA 4KGCA 3WAAB 3X1UC 5AVCC 3MGRD 3AZHC 3REHA 3X1TA 4EO5C 4UPKA 4J8XA 1TZYD 4HGAB 5G49B 2HUEB 3UTAB 2XD5A 2AROD 3MGSD 1BH8A 5E5AA 3W97D 2PYOB 5AV9C 3WTPE 2Y2KA 3LZ0C 2L5AA 2CV5A 5DNMD 3B0CW 3LELA 2F8NH 4WU8A 4QLCA 3KWQB 1U35D 5DNND 1A7WA 1P3IA 4H9OA 2JSSA 3AZLB 5AV6D 1M1AB 3AN2A 5GT3C 5AV5C 4KGCD 3W99B 3RELA 3W98D 4KHAA 1B67A 3WAAC 4DQYB 3REIB 3REHD 4J8UA 4J8XD 1P3MB 4HGAC 3C1CA 3REKA 1AOIA 2HUEC 1KX3A 1P3OB 5AVCA 3KXBD 3AZMA 5CPJB 2F2AC 5E5AD 1S32A 3MGRB 1N1JA 2PYOC 2FJ7C 3IP4C 3WA9A 4XZQD 2CV5D 3LELD 4WU8D 4QLCD 1P3ID 1P3GA 3UTBA 2AROB 3AZLC 3MGSB 5AV9A 3AN2D 3AV2B 1M1AC 3RELD 3W97B 3W99C 3V9RA 4J8UD 5CPIB 1ID3A 3FDDA 1P3MC 2BYMB 1U35B 5DNNB 3C1CD 3REKD 1AOID 1KX3D 3B6FA 5AV6B 5AVCD 1P3OC 1JFIA 5CPJC 1S32D 3REHB 3X1TB 4NFTA 5JA4B 5AVBA 4H9QA 3WA9D 1TAFA 4J8XB 1P3GD 3UTBD 2AROC 4Z2MG 5AV9D 3MGSC 3AV2C 3WTPA 4G92C 3LZ0D 3W97C 1ID3D 5CPIC 2CV5B 3VH5W 3LELB 4WU8B 4QLCB 3AZLA 1P3IB 1U35C 5DNNC 2JE5A 4H9OB 3B6FD 1R4VA 2IO5C 4WNNA 5AV6C 3AV1A 3W99A 4KHAB 4J8UB 3REHC 3X1TC 1P3MA 1Z2CB 4J8XC 4H9PA 3C1CB 3REKB 1KX4B 1AOIB 1KX3B 2F8NB 5AVCB 3LZ1A 3AZMB 5B0YA 3AYWB 3WTPD 1S32B 1M19A 1N1JB 1W2EA 4Z5TA 5B24C 3WA9B 4YM6A 4XUJA 2CV5C 3VH5A 3LELC 5B1MB 4QLCC 4WU8C 3AZLD 3KFUG 1P3AA 1P3GB 1P3IC 3UTBB 3AV2A 3UT9B 3W99D 3AV1D 3NQJA 5CPIA 3V9RB 3VH6W 3AZGB 1ID3B 4J8UC 1P3LC 3B0BA 1P3MD 5GSUA 2HIOB 3A1IA 3C1CC 1KX4C 1AOIC 1KX3C 4J8WA 5CPJD 3B6FB 4LD9C 1JFIB 3LZ1D 5B31A 3AZMC 3AYWC 5CHLB 1M19D 5JA4A 1S32C 5B32G 5AVBB 4H9QB 5B1LA 4YM6D 1TAFB 3WA9C 4XUJD 2W8SA 5JRGC 5B1MC 1P3AD 2NZDA 1P3GC 1P3KA 3AV2D 3UTBC 3W96C 3C1BA 3UT9C 5F99C 3WTPB 5B24A 5CPID 5C3IB 3R45B 3VH6A 3AZGC 1ID3C 3AZEA 5GSUD 1B6WA 3MVDA 5BNVA 4Z66A 2HIOC 4J8WD 3B6FC 4WNNB 3AV1B 5B31D 3X1TD 4CAYA 1P3LA 5FUGA 3O62C 5B1LD 5AVBC 5BO0A 1KX4A 4H9PB 4R8PA 4LD9A 2F8NA 2NZDD 1P3KD 4M6BA 3C1BD 3AYWA 5GT0B 3LZ1B 5B0YB 4DRBA 5B24D 1M19B 3WTPC 5B33C 4Z5TB 5JRGA 4ZUXB 5C3IC 4H9NA 4YM6B 3AZJA 3AZED 5B1MA 4XUJB 3W96A 1P3AB 3UT9A 5F99A 4G92B 3A1KA 3H0MC 4YS3B 3NQJB 3AV1C 4WU9B 3AZGA 1P3LD 1WWSA 1T3UA 5GSUB 1KX4D 2HIOA 3TU4C 4LD9D 2IO5B 2ZY5A 2F8ND 4J8WB 3AZMD 3AYWD 2J8PA 3O62A 5B31B 4X23A 5GT0C 3LZ1C 2YFVA 5B0YC 1M19C 5JRGD 4Z5TC 5B1LB 3AZJD 4ZUXC 5B1MD 4YM6C 4XUJC 3W96D 2G5IC 3KUYA 3UT9D 2NZDB 2DQNC 1P3AC 1P3KB 5F99D 3C1BB 4Z2MH 5B33A 1P3FB 4H9RA 1P34A 2JCHA 5B24B 4YS3C 3LJAC 4WU9C 3AZGD 3R45A 5B2IA 5KDMB 3AZFA 3AZEB 3AZNA 1F1EA 5GSUC 5GXQA 3B6GB 2HIOD 1WWIA 3MVDB 5BNVB 4Z66B 5B40A 1P3PB 4J8WC 3REJA 3O62D 4X23D 5B31C 5B0ZA 4CAYB 1P3LB 5FUGB 5AVBD 1HQ3A 3TU4A 5B1LC 5BO0B 2LY8A 4R8PB 4WZSB 3AFAA 4LD9B 5BS7C 3KUYD 2NZDC 2ZY2A 5AV8B 5GT0A 1P3KC 5B33D 3C1BC 1P34D 1P3FC 5B2ID 4ZUXA 4E44A 5JRGB 3AZFD 4H9NB 3AZJB 3AZEC 3AZND 5GXQD 4E45A 3B6GC 4ZBJB 3W96B 2Y2MA 3MVDC 5B40D 5F99B 4YS3A 3B0CT 4Z66C 3LJAA 4WU9A 1P3PC 3MGQA 1KX5A 2Y2PA 2NQBC 2Y2GA 3AZIB 3TU4D 2DF4C 3AFAD 4G91B 4R8PC 4CSRA 4NE3A 5GT0D 5B0YD 5B2JA 5AV8C 2FJ7A 3A6NA 3O62B 4X23B 2YFVB 4Z5TD 4ZUXD 2CWEA 3X1VA 3AZJC 5BS7A 3KUYB 4ZBJC 2UWXA 5DNMA 5BNXA 1P3FA 4YS3D 3LJAD 2XD1A 4WU9D 3X1SC 5B33B 4H9RB 1P34B 3MGQD 2RIQA 1KX5D 5KDMA 5B2IB 3AZFB 3MGPB 3B6GA 3W98A 3AZNB 3AZIC 3WKJA 4UUZA 5GXQB 1EQZA 5B32A 3EPKA 4G91C 1P3PA 5B40B 1F66B 1ZLAA 3REJB 5B2JD 2FJ7D 2NQBA 3A6ND 5B0ZB 4X23C 1M18A 5CP6A 3MNNA 3KXBA 3X1VD 1HQ3B 3TU4B 2Y2IA 3AFAB 4NE6A 3B0DB 1Q9CA 5AV8A 4XZQA 2F8NG 3KUYC 1H3OA 1P3FD 3EPHA 3EPLA 4JJNB 3H0RC 1P34C 1P3BB 5B2IC 2Y2QA 4DRAA 3AZFC 3B6GD 3MGPC 2Y2JA 3WKJD 3AZNC 3MVDD 1EQZD 5GXQC 5BT1C 4Z66D 5B32D 5CPKB 3X1SA 1P3PD 5AY8A 4J8VA 1ZLAD 3VH5T 3LJAB 5B40C 1F66C 3AZKA 2NQBD 3REJC 2BYKA 3MGQB 3P5JB 4KUDB 3UTAC 1KX5B 5B0ZC 3X1UA 1M18D 1BH9A 5CP6D 3AZIA 3AZHA 2RVQC 3MNND 2F8NK 4R8PD 3AL0C 1HQ3C 2FFFB 4AWLB 1BFMA 3AFAC 5AV8D 3B0DC 4CSRB 3NQUA 1TZYB 5B2JB 2FJ7B 3A6NB 3KWQC 4JJNC 2Y2LA 1P3BC 1ULYA 3X1VB 3LZ0A 2YFWA 3REIC 3EPJA 3X1SD 5CPKC 5AY8D 5DNMB 5BNXB 4J8VD 3AZKD 5AV5A 5GT3A 4KUDC 3MGQC 2VQRA 1KX5C 3X1UD 3WAAA 3MGPA 3AZID 3AZHD 4KGCB 3W98B 3WKJB 4UUZB 3MGRC 2ZM5A 1EQZB 4AWLC 3VH6T 5B32B 2G5HC 1F66A 1ZLAB 5G49A 3UTAA 2NQBB 1TZYC 5B2JC 3A6NC
chains in the Genus database with same CATH topology
1M18B 3F6TA 5CP6B 4H9SC 3MNNB 1BH8B 3KXBB 5E5AB 2PYOA 3X1VC 4XZQB 3KWQA 1H3OB 5DNMC 4JJNA 1P3BA 2ZY3A 1M1AA 5GT3D 5AV5D 3AN2B 3MGPD 3WAAD 1PZRA 3REIA 3RELB 5BT1D 4KGCC 2ZY4A 4WV4B 3W98C 5CPKA 3WKJC 1EQZC 1F66D 3X1SB 5B32C 4WJ3C 5AY8B 3REJD 4J8VB 1ZLAC 3UTAD 3AZKB 5B0ZD 4KUDA 2BYKB 1P3OA 2RVQD 3X1UB 5CPJA 1BH9B 2Y2HA 1HQ3D 5CP6C 3AZHB 1M18C 3MGRA 2PYOD 3MNNC 3KXBC 5E5AC 4EO5B 1TZYA 3KWQD 1HTAA 2Y2OA 3NQUB 4XZQC 4JJND 5B31G 1P3BD 1M1AD 2AROA 4H9SA 3MGSA 3W97A 5AV9B 3AN2C 3REID 3LZ0B 3RELC 5CPKD 2YFWB 2BG1A 5AY8C 2BYMA 1U35A 5DNNA 1KU5A 4J8VC 4KUDD 4NE5A 3AZKC 5AV6A 2Y2NA 5GT3B 5AV5B 3EG5B 3REKC 1P3OD 3H0LC 3KSYA 4KGCA 3WAAB 3X1UC 5AVCC 3MGRD 3AZHC 3REHA 3X1TA 4EO5C 4UPKA 4J8XA 1TZYD 4HGAB 5G49B 2HUEB 3UTAB 2XD5A 2AROD 3MGSD 1BH8A 5E5AA 3W97D 2PYOB 5AV9C 3WTPE 2Y2KA 3LZ0C 2L5AA 2CV5A 5DNMD 3B0CW 3LELA 2F8NH 4WU8A 4QLCA 3KWQB 1U35D 5DNND 1A7WA 1P3IA 4H9OA 2JSSA 3AZLB 5AV6D 1M1AB 3AN2A 5GT3C 5AV5C 4KGCD 3W99B 3RELA 3W98D 4KHAA 1B67A 3WAAC 4DQYB 3REIB 3REHD 4J8UA 4J8XD 1P3MB 4HGAC 3C1CA 3REKA 1AOIA 2HUEC 1KX3A 1P3OB 5AVCA 3KXBD 3AZMA 5CPJB 2F2AC 5E5AD 1S32A 3MGRB 1N1JA 2PYOC 2FJ7C 3IP4C 3WA9A 4XZQD 2CV5D 3LELD 4WU8D 4QLCD 1P3ID 1P3GA 3UTBA 2AROB 3AZLC 3MGSB 5AV9A 3AN2D 3AV2B 1M1AC 3RELD 3W97B 3W99C 3V9RA 4J8UD 5CPIB 1ID3A 3FDDA 1P3MC 2BYMB 1U35B 5DNNB 3C1CD 3REKD 1AOID 1KX3D 3B6FA 5AV6B 5AVCD 1P3OC 1JFIA 5CPJC 1S32D 3REHB 3X1TB 4NFTA 5JA4B 5AVBA 4H9QA 3WA9D 1TAFA 4J8XB 1P3GD 3UTBD 2AROC 4Z2MG 5AV9D 3MGSC 3AV2C 3WTPA 4G92C 3LZ0D 3W97C 1ID3D 5CPIC 2CV5B 3VH5W 3LELB 4WU8B 4QLCB 3AZLA 1P3IB 1U35C 5DNNC 2JE5A 4H9OB 3B6FD 1R4VA 2IO5C 4WNNA 5AV6C 3AV1A 3W99A 4KHAB 4J8UB 3REHC 3X1TC 1P3MA 1Z2CB 4J8XC 4H9PA 3C1CB 3REKB 1KX4B 1AOIB 1KX3B 2F8NB 5AVCB 3LZ1A 3AZMB 5B0YA 3AYWB 3WTPD 1S32B 1M19A 1N1JB 1W2EA 4Z5TA 5B24C 3WA9B 4YM6A 4XUJA 2CV5C 3VH5A 3LELC 5B1MB 4QLCC 4WU8C 3AZLD 3KFUG 1P3AA 1P3GB 1P3IC 3UTBB 3AV2A 3UT9B 3W99D 3AV1D 3NQJA 5CPIA 3V9RB 3VH6W 3AZGB 1ID3B 4J8UC 1P3LC 3B0BA 1P3MD 5GSUA 2HIOB 3A1IA 3C1CC 1KX4C 1AOIC 1KX3C 4J8WA 5CPJD 3B6FB 4LD9C 1JFIB 3LZ1D 5B31A 3AZMC 3AYWC 5CHLB 1M19D 5JA4A 1S32C 5B32G 5AVBB 4H9QB 5B1LA 4YM6D 1TAFB 3WA9C 4XUJD 2W8SA 5JRGC 5B1MC 1P3AD 2NZDA 1P3GC 1P3KA 3AV2D 3UTBC 3W96C 3C1BA 3UT9C 5F99C 3WTPB 5B24A 5CPID 5C3IB 3R45B 3VH6A 3AZGC 1ID3C 3AZEA 5GSUD 1B6WA 3MVDA 5BNVA 4Z66A 2HIOC 4J8WD 3B6FC 4WNNB 3AV1B 5B31D 3X1TD 4CAYA 1P3LA 5FUGA 3O62C 5B1LD 5AVBC 5BO0A 1KX4A 4H9PB 4R8PA 4LD9A 2F8NA 2NZDD 1P3KD 4M6BA 3C1BD 3AYWA 5GT0B 3LZ1B 5B0YB 4DRBA 5B24D 1M19B 3WTPC 5B33C 4Z5TB 5JRGA 4ZUXB 5C3IC 4H9NA 4YM6B 3AZJA 3AZED 5B1MA 4XUJB 3W96A 1P3AB 3UT9A 5F99A 4G92B 3A1KA 3H0MC 4YS3B 3NQJB 3AV1C 4WU9B 3AZGA 1P3LD 1WWSA 1T3UA 5GSUB 1KX4D 2HIOA 3TU4C 4LD9D 2IO5B 2ZY5A 2F8ND 4J8WB 3AZMD 3AYWD 2J8PA 3O62A 5B31B 4X23A 5GT0C 3LZ1C 2YFVA 5B0YC 1M19C 5JRGD 4Z5TC 5B1LB 3AZJD 4ZUXC 5B1MD 4YM6C 4XUJC 3W96D 2G5IC 3KUYA 3UT9D 2NZDB 2DQNC 1P3AC 1P3KB 5F99D 3C1BB 4Z2MH 5B33A 1P3FB 4H9RA 1P34A 2JCHA 5B24B 4YS3C 3LJAC 4WU9C 3AZGD 3R45A 5B2IA 5KDMB 3AZFA 3AZEB 3AZNA 1F1EA 5GSUC 5GXQA 3B6GB 2HIOD 1WWIA 3MVDB 5BNVB 4Z66B 5B40A 1P3PB 4J8WC 3REJA 3O62D 4X23D 5B31C 5B0ZA 4CAYB 1P3LB 5FUGB 5AVBD 1HQ3A 3TU4A 5B1LC 5BO0B 2LY8A 4R8PB 4WZSB 3AFAA 4LD9B 5BS7C 3KUYD 2NZDC 2ZY2A 5AV8B 5GT0A 1P3KC 5B33D 3C1BC 1P34D 1P3FC 5B2ID 4ZUXA 4E44A 5JRGB 3AZFD 4H9NB 3AZJB 3AZEC 3AZND 5GXQD 4E45A 3B6GC 4ZBJB 3W96B 2Y2MA 3MVDC 5B40D 5F99B 4YS3A 3B0CT 4Z66C 3LJAA 4WU9A 1P3PC 3MGQA 1KX5A 2Y2PA 2NQBC 2Y2GA 3AZIB 3TU4D 2DF4C 3AFAD 4G91B 4R8PC 4CSRA 4NE3A 5GT0D 5B0YD 5B2JA 5AV8C 2FJ7A 3A6NA 3O62B 4X23B 2YFVB 4Z5TD 4ZUXD 2CWEA 3X1VA 3AZJC 5BS7A 3KUYB 4ZBJC 2UWXA 5DNMA 5BNXA 1P3FA 4YS3D 3LJAD 2XD1A 4WU9D 3X1SC 5B33B 4H9RB 1P34B 3MGQD 2RIQA 1KX5D 5KDMA 5B2IB 3AZFB 3MGPB 3B6GA 3W98A 3AZNB 3AZIC 3WKJA 4UUZA 5GXQB 1EQZA 5B32A 3EPKA 4G91C 1P3PA 5B40B 1F66B 1ZLAA 3REJB 5B2JD 2FJ7D 2NQBA 3A6ND 5B0ZB 4X23C 1M18A 5CP6A 3MNNA 3KXBA 3X1VD 1HQ3B 3TU4B 2Y2IA 3AFAB 4NE6A 3B0DB 1Q9CA 5AV8A 4XZQA 2F8NG 3KUYC 1H3OA 1P3FD 3EPHA 3EPLA 4JJNB 3H0RC 1P34C 1P3BB 5B2IC 2Y2QA 4DRAA 3AZFC 3B6GD 3MGPC 2Y2JA 3WKJD 3AZNC 3MVDD 1EQZD 5GXQC 5BT1C 4Z66D 5B32D 5CPKB 3X1SA 1P3PD 5AY8A 4J8VA 1ZLAD 3VH5T 3LJAB 5B40C 1F66C 3AZKA 2NQBD 3REJC 2BYKA 3MGQB 3P5JB 4KUDB 3UTAC 1KX5B 5B0ZC 3X1UA 1M18D 1BH9A 5CP6D 3AZIA 3AZHA 2RVQC 3MNND 2F8NK 4R8PD 3AL0C 1HQ3C 2FFFB 4AWLB 1BFMA 3AFAC 5AV8D 3B0DC 4CSRB 3NQUA 1TZYB 5B2JB 2FJ7B 3A6NB 3KWQC 4JJNC 2Y2LA 1P3BC 1ULYA 3X1VB 3LZ0A 2YFWA 3REIC 3EPJA 3X1SD 5CPKC 5AY8D 5DNMB 5BNXB 4J8VD 3AZKD 5AV5A 5GT3A 4KUDC 3MGQC 2VQRA 1KX5C 3X1UD 3WAAA 3MGPA 3AZID 3AZHD 4KGCB 3W98B 3WKJB 4UUZB 3MGRC 2ZM5A 1EQZB 4AWLC 3VH6T 5B32B 2G5HC 1F66A 1ZLAB 5G49A 3UTAA 2NQBB 1TZYC 5B2JC 3A6NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M18 B;  5CP6 B;  4H9S C;  3MNN B;  1BH8 B;  3KXB B;  5E5A B;  2PYO A;  3X1V C;  4XZQ B;  3KWQ A;  1H3O B;  5DNM C;  4JJN A;  1P3B A;  1M1A A;  5GT3 D;  5AV5 D;  3AN2 B;  3MGP D;  3WAA D;  3REI A;  3REL B;  5BT1 D;  4KGC C;  4WV4 B;  3W98 C;  5CPK A;  3WKJ C;  1EQZ C;  1F66 D;  3X1S B;  5B32 C;  5AY8 B;  3REJ D;  4J8V B;  1ZLA C;  3UTA D;  3AZK B;  5B0Z D;  4KUD A;  2BYK B;  1P3O A;  2RVQ D;  3X1U B;  5CPJ A;  1BH9 B;  1HQ3 D;  5CP6 C;  3AZH B;  1M18 C;  3MGR A;  2PYO D;  3MNN C;  3KXB C;  5E5A C;  4EO5 B;  1TZY A;  3KWQ D;  1HTA A;  3NQU B;  4XZQ C;  4JJN D;  5B31 G;  1P3B D;  1M1A D;  2ARO A;  4H9S A;  3MGS A;  3W97 A;  5AV9 B;  3AN2 C;  3REI D;  3LZ0 B;  3REL C;  5CPK D;  2YFW B;  5AY8 C;  2BYM A;  1U35 A;  5DNN A;  1KU5 A;  4J8V C;  4KUD D;  4NE5 A;  3AZK C;  5AV6 A;  5GT3 B;  5AV5 B;  3REK C;  1P3O D;  3KSY A;  4KGC A;  3WAA B;  3X1U C;  5AVC C;  3MGR D;  3AZH C;  3REH A;  3X1T A;  4EO5 C;  4J8X A;  1TZY D;  4HGA B;  5G49 B;  2HUE B;  3UTA B;  2ARO D;  3MGS D;  1BH8 A;  5E5A A;  3W97 D;  2PYO B;  5AV9 C;  3WTP E;  3LZ0 C;  2L5A A;  2CV5 A;  5DNM D;  3B0C W;  3LEL A;  2F8N H;  4WU8 A;  4QLC A;  3KWQ B;  1U35 D;  5DNN D;  1A7W A;  1P3I A;  4H9O A;  2JSS A;  3AZL B;  5AV6 D;  1M1A B;  3AN2 A;  5GT3 C;  5AV5 C;  4KGC D;  3W99 B;  3REL A;  3W98 D;  4KHA A;  1B67 A;  3WAA C;  3REI B;  3REH D;  4J8U A;  4J8X D;  1P3M B;  4HGA C;  3C1C A;  3REK A;  1AOI A;  2HUE C;  1KX3 A;  1P3O B;  5AVC A;  3KXB D;  3AZM A;  5CPJ B;  5E5A D;  1S32 A;  3MGR B;  1N1J A;  2PYO C;  2FJ7 C;  3WA9 A;  4XZQ D;  2CV5 D;  3LEL D;  4WU8 D;  4QLC D;  1P3I D;  1P3G A;  3UTB A;  2ARO B;  3AZL C;  3MGS B;  5AV9 A;  3AN2 D;  3AV2 B;  1M1A C;  3REL D;  3W97 B;  3W99 C;  3V9R A;  4J8U D;  5CPI B;  1ID3 A;  1P3M C;  2BYM B;  1U35 B;  5DNN B;  3C1C D;  3REK D;  1AOI D;  1KX3 D;  3B6F A;  5AV6 B;  5AVC D;  1P3O C;  1JFI A;  5CPJ C;  1S32 D;  3REH B;  3X1T B;  4NFT A;  5JA4 B;  5AVB A;  4H9Q A;  3WA9 D;  1TAF A;  4J8X B;  1P3G D;  3UTB D;  2ARO C;  4Z2M G;  5AV9 D;  3MGS C;  3AV2 C;  3WTP A;  4G92 C;  3LZ0 D;  3W97 C;  1ID3 D;  5CPI C;  2CV5 B;  3VH5 W;  3LEL B;  4WU8 B;  4QLC B;  3AZL A;  1P3I B;  1U35 C;  5DNN C;  4H9O B;  3B6F D;  1R4V A;  2IO5 C;  4WNN A;  5AV6 C;  3AV1 A;  3W99 A;  4KHA B;  4J8U B;  3REH C;  3X1T C;  1P3M A;  4J8X C;  4H9P A;  3C1C B;  3REK B;  1KX4 B;  1AOI B;  1KX3 B;  2F8N B;  5AVC B;  3LZ1 A;  3AZM B;  5B0Y A;  3AYW B;  3WTP D;  1S32 B;  1M19 A;  1N1J B;  4Z5T A;  5B24 C;  3WA9 B;  4YM6 A;  4XUJ A;  2CV5 C;  3VH5 A;  3LEL C;  5B1M B;  4QLC C;  4WU8 C;  3AZL D;  1P3A A;  1P3G B;  1P3I C;  3UTB B;  3AV2 A;  3UT9 B;  3W99 D;  3AV1 D;  3NQJ A;  5CPI A;  3V9R B;  3VH6 W;  3AZG B;  1ID3 B;  4J8U C;  1P3L C;  3B0B A;  1P3M D;  5GSU A;  2HIO B;  3C1C C;  1KX4 C;  1AOI C;  1KX3 C;  4J8W A;  5CPJ D;  3B6F B;  4LD9 C;  1JFI B;  3LZ1 D;  5B31 A;  3AZM C;  3AYW C;  5CHL B;  1M19 D;  5JA4 A;  1S32 C;  5B32 G;  5AVB B;  4H9Q B;  4YM6 D;  5B1L A;  1TAF B;  3WA9 C;  4XUJ D;  5JRG C;  5B1M C;  1P3A D;  2NZD A;  1P3G C;  1P3K A;  3AV2 D;  3UTB C;  3W96 C;  3C1B A;  3UT9 C;  5F99 C;  3WTP B;  5B24 A;  5CPI D;  5C3I B;  3R45 B;  3VH6 A;  3AZG C;  1ID3 C;  3AZE A;  5GSU D;  1B6W A;  3MVD A;  5BNV A;  4Z66 A;  2HIO C;  4J8W D;  3B6F C;  4WNN B;  3AV1 B;  5B31 D;  3X1T D;  4CAY A;  1P3L A;  5FUG A;  3O62 C;  5B1L D;  5AVB C;  5BO0 A;  1KX4 A;  4H9P B;  4R8P A;  4LD9 A;  2F8N A;  2NZD D;  1P3K D;  4M6B A;  3C1B D;  3AYW A;  5GT0 B;  3LZ1 B;  5B0Y B;  4DRB A;  5B24 D;  1M19 B;  3WTP C;  5B33 C;  4Z5T B;  5JRG A;  4ZUX B;  5C3I C;  4H9N A;  4YM6 B;  3AZJ A;  3AZE D;  5B1M A;  4XUJ B;  3W96 A;  1P3A B;  3UT9 A;  5F99 A;  4G92 B;  4YS3 B;  3NQJ B;  3AV1 C;  4WU9 B;  3AZG A;  1P3L D;  1WWS A;  5GSU B;  1KX4 D;  2HIO A;  3TU4 C;  4LD9 D;  2IO5 B;  2F8N D;  4J8W B;  3AZM D;  3AYW D;  3O62 A;  5B31 B;  4X23 A;  5GT0 C;  3LZ1 C;  2YFV A;  5B0Y C;  1M19 C;  5JRG D;  4Z5T C;  5B1L B;  3AZJ D;  4ZUX C;  5B1M D;  4YM6 C;  4XUJ C;  3W96 D;  3KUY A;  3UT9 D;  2NZD B;  1P3A C;  1P3K B;  5F99 D;  3C1B B;  4Z2M H;  5B33 A;  1P3F B;  4H9R A;  1P34 A;  4YS3 C;  5B24 B;  3LJA C;  4WU9 C;  3AZG D;  3R45 A;  5B2I A;  5KDM B;  3AZF A;  3AZE B;  3AZN A;  1F1E A;  5GSU C;  5GXQ A;  3B6G B;  2HIO D;  1WWI A;  3MVD B;  5BNV B;  4Z66 B;  5B40 A;  1P3P B;  4J8W C;  3REJ A;  3O62 D;  4X23 D;  5B31 C;  5B0Z A;  4CAY B;  1P3L B;  5FUG B;  5AVB D;  1HQ3 A;  3TU4 A;  5B1L C;  5BO0 B;  2LY8 A;  4R8P B;  4WZS B;  3AFA A;  4LD9 B;  5BS7 C;  3KUY D;  2NZD C;  5GT0 A;  5AV8 B;  1P3K C;  5B33 D;  3C1B C;  1P34 D;  1P3F C;  5B2I D;  4ZUX A;  4E44 A;  5JRG B;  3AZF D;  4H9N B;  3AZJ B;  3AZE C;  3AZN D;  5GXQ D;  4E45 A;  3B6G C;  4ZBJ B;  3W96 B;  3MVD C;  5B40 D;  5F99 B;  4YS3 A;  3B0C T;  4Z66 C;  3LJA A;  4WU9 A;  1P3P C;  3MGQ A;  1KX5 A;  2NQB C;  3AZI B;  3TU4 D;  3AFA D;  4G91 B;  4R8P C;  4CSR A;  4NE3 A;  5GT0 D;  5B0Y D;  5B2J A;  5AV8 C;  2FJ7 A;  3A6N A;  3O62 B;  4X23 B;  2YFV B;  4Z5T D;  4ZUX D;  2CWE A;  3X1V A;  3AZJ C;  5BS7 A;  3KUY B;  4ZBJ C;  5DNM A;  5BNX A;  1P3F A;  4YS3 D;  3LJA D;  4WU9 D;  3X1S C;  5B33 B;  4H9R B;  1P34 B;  3MGQ D;  1KX5 D;  5KDM A;  5B2I B;  3AZF B;  3MGP B;  3B6G A;  3W98 A;  3AZN B;  3AZI C;  3WKJ A;  4UUZ A;  5GXQ B;  1EQZ A;  5B32 A;  4G91 C;  1P3P A;  5B40 B;  1F66 B;  1ZLA A;  3REJ B;  5B2J D;  2FJ7 D;  2NQB A;  3A6N D;  5B0Z B;  4X23 C;  1M18 A;  5CP6 A;  3MNN A;  3KXB A;  3X1V D;  1HQ3 B;  3TU4 B;  3AFA B;  4NE6 A;  3B0D B;  1Q9C A;  5AV8 A;  4XZQ A;  2F8N G;  3KUY C;  1H3O A;  1P3F D;  4JJN B;  1P34 C;  1P3B B;  5B2I C;  4DRA A;  3AZF C;  3B6G D;  3MGP C;  3WKJ D;  3AZN C;  3MVD D;  1EQZ D;  5GXQ C;  5BT1 C;  4Z66 D;  5B32 D;  5CPK B;  3X1S A;  1P3P D;  5AY8 A;  4J8V A;  1ZLA D;  3VH5 T;  3LJA B;  5B40 C;  1F66 C;  3AZK A;  2NQB D;  3REJ C;  2BYK A;  3MGQ B;  4KUD B;  3UTA C;  1KX5 B;  5B0Z C;  3X1U A;  1M18 D;  1BH9 A;  5CP6 D;  3AZI A;  3AZH A;  2RVQ C;  3MNN D;  2F8N K;  4R8P D;  1HQ3 C;  4AWL B;  1BFM A;  3AFA C;  5AV8 D;  3B0D C;  4CSR B;  3NQU A;  1TZY B;  5B2J B;  2FJ7 B;  3A6N B;  3KWQ C;  4JJN C;  1P3B C;  1ULY A;  3X1V B;  3LZ0 A;  2YFW A;  3REI C;  3X1S D;  5CPK C;  5AY8 D;  5DNM B;  5BNX B;  4J8V D;  3AZK D;  5AV5 A;  5GT3 A;  4KUD C;  3MGQ C;  1KX5 C;  3X1U D;  3WAA A;  3MGP A;  3AZI D;  3AZH D;  4KGC B;  3W98 B;  3WKJ B;  4UUZ B;  3MGR C;  1EQZ B;  4AWL C;  3VH6 T;  5B32 B;  1F66 A;  1ZLA B;  5G49 A;  3UTA A;  2NQB B;  1TZY C;  5B2J C;  3A6N C; 
#chains in the Genus database with same CATH topology
 1M18 B;  3F6T A;  5CP6 B;  4H9S C;  3MNN B;  1BH8 B;  3KXB B;  5E5A B;  2PYO A;  3X1V C;  4XZQ B;  3KWQ A;  1H3O B;  5DNM C;  4JJN A;  1P3B A;  2ZY3 A;  1M1A A;  5GT3 D;  5AV5 D;  3AN2 B;  3MGP D;  3WAA D;  1PZR A;  3REI A;  3REL B;  5BT1 D;  4KGC C;  2ZY4 A;  4WV4 B;  3W98 C;  5CPK A;  3WKJ C;  1EQZ C;  1F66 D;  3X1S B;  5B32 C;  4WJ3 C;  5AY8 B;  3REJ D;  4J8V B;  1ZLA C;  3UTA D;  3AZK B;  5B0Z D;  4KUD A;  2BYK B;  1P3O A;  2RVQ D;  3X1U B;  5CPJ A;  1BH9 B;  2Y2H A;  1HQ3 D;  5CP6 C;  3AZH B;  1M18 C;  3MGR A;  2PYO D;  3MNN C;  3KXB C;  5E5A C;  4EO5 B;  1TZY A;  3KWQ D;  1HTA A;  2Y2O A;  3NQU B;  4XZQ C;  4JJN D;  5B31 G;  1P3B D;  1M1A D;  2ARO A;  4H9S A;  3MGS A;  3W97 A;  5AV9 B;  3AN2 C;  3REI D;  3LZ0 B;  3REL C;  5CPK D;  2YFW B;  2BG1 A;  5AY8 C;  2BYM A;  1U35 A;  5DNN A;  1KU5 A;  4J8V C;  4KUD D;  4NE5 A;  3AZK C;  5AV6 A;  2Y2N A;  5GT3 B;  5AV5 B;  3EG5 B;  3REK C;  1P3O D;  3H0L C;  3KSY A;  4KGC A;  3WAA B;  3X1U C;  5AVC C;  3MGR D;  3AZH C;  3REH A;  3X1T A;  4EO5 C;  4UPK A;  4J8X A;  1TZY D;  4HGA B;  5G49 B;  2HUE B;  3UTA B;  2XD5 A;  2ARO D;  3MGS D;  1BH8 A;  5E5A A;  3W97 D;  2PYO B;  5AV9 C;  3WTP E;  2Y2K A;  3LZ0 C;  2L5A A;  2CV5 A;  5DNM D;  3B0C W;  3LEL A;  2F8N H;  4WU8 A;  4QLC A;  3KWQ B;  1U35 D;  5DNN D;  1A7W A;  1P3I A;  4H9O A;  2JSS A;  3AZL B;  5AV6 D;  1M1A B;  3AN2 A;  5GT3 C;  5AV5 C;  4KGC D;  3W99 B;  3REL A;  3W98 D;  4KHA A;  1B67 A;  3WAA C;  4DQY B;  3REI B;  3REH D;  4J8U A;  4J8X D;  1P3M B;  4HGA C;  3C1C A;  3REK A;  1AOI A;  2HUE C;  1KX3 A;  1P3O B;  5AVC A;  3KXB D;  3AZM A;  5CPJ B;  2F2A C;  5E5A D;  1S32 A;  3MGR B;  1N1J A;  2PYO C;  2FJ7 C;  3IP4 C;  3WA9 A;  4XZQ D;  2CV5 D;  3LEL D;  4WU8 D;  4QLC D;  1P3I D;  1P3G A;  3UTB A;  2ARO B;  3AZL C;  3MGS B;  5AV9 A;  3AN2 D;  3AV2 B;  1M1A C;  3REL D;  3W97 B;  3W99 C;  3V9R A;  4J8U D;  5CPI B;  1ID3 A;  3FDD A;  1P3M C;  2BYM B;  1U35 B;  5DNN B;  3C1C D;  3REK D;  1AOI D;  1KX3 D;  3B6F A;  5AV6 B;  5AVC D;  1P3O C;  1JFI A;  5CPJ C;  1S32 D;  3REH B;  3X1T B;  4NFT A;  5JA4 B;  5AVB A;  4H9Q A;  3WA9 D;  1TAF A;  4J8X B;  1P3G D;  3UTB D;  2ARO C;  4Z2M G;  5AV9 D;  3MGS C;  3AV2 C;  3WTP A;  4G92 C;  3LZ0 D;  3W97 C;  1ID3 D;  5CPI C;  2CV5 B;  3VH5 W;  3LEL B;  4WU8 B;  4QLC B;  3AZL A;  1P3I B;  1U35 C;  5DNN C;  2JE5 A;  4H9O B;  3B6F D;  1R4V A;  2IO5 C;  4WNN A;  5AV6 C;  3AV1 A;  3W99 A;  4KHA B;  4J8U B;  3REH C;  3X1T C;  1P3M A;  1Z2C B;  4J8X C;  4H9P A;  3C1C B;  3REK B;  1KX4 B;  1AOI B;  1KX3 B;  2F8N B;  5AVC B;  3LZ1 A;  3AZM B;  5B0Y A;  3AYW B;  3WTP D;  1S32 B;  1M19 A;  1N1J B;  1W2E A;  4Z5T A;  5B24 C;  3WA9 B;  4YM6 A;  4XUJ A;  2CV5 C;  3VH5 A;  3LEL C;  5B1M B;  4QLC C;  4WU8 C;  3AZL D;  3KFU G;  1P3A A;  1P3G B;  1P3I C;  3UTB B;  3AV2 A;  3UT9 B;  3W99 D;  3AV1 D;  3NQJ A;  5CPI A;  3V9R B;  3VH6 W;  3AZG B;  1ID3 B;  4J8U C;  1P3L C;  3B0B A;  1P3M D;  5GSU A;  2HIO B;  3A1I A;  3C1C C;  1KX4 C;  1AOI C;  1KX3 C;  4J8W A;  5CPJ D;  3B6F B;  4LD9 C;  1JFI B;  3LZ1 D;  5B31 A;  3AZM C;  3AYW C;  5CHL B;  1M19 D;  5JA4 A;  1S32 C;  5B32 G;  5AVB B;  4H9Q B;  5B1L A;  4YM6 D;  1TAF B;  3WA9 C;  4XUJ D;  2W8S A;  5JRG C;  5B1M C;  1P3A D;  2NZD A;  1P3G C;  1P3K A;  3AV2 D;  3UTB C;  3W96 C;  3C1B A;  3UT9 C;  5F99 C;  3WTP B;  5B24 A;  5CPI D;  5C3I B;  3R45 B;  3VH6 A;  3AZG C;  1ID3 C;  3AZE A;  5GSU D;  1B6W A;  3MVD A;  5BNV A;  4Z66 A;  2HIO C;  4J8W D;  3B6F C;  4WNN B;  3AV1 B;  5B31 D;  3X1T D;  4CAY A;  1P3L A;  5FUG A;  3O62 C;  5B1L D;  5AVB C;  5BO0 A;  1KX4 A;  4H9P B;  4R8P A;  4LD9 A;  2F8N A;  2NZD D;  1P3K D;  4M6B A;  3C1B D;  3AYW A;  5GT0 B;  3LZ1 B;  5B0Y B;  4DRB A;  5B24 D;  1M19 B;  3WTP C;  5B33 C;  4Z5T B;  5JRG A;  4ZUX B;  5C3I C;  4H9N A;  4YM6 B;  3AZJ A;  3AZE D;  5B1M A;  4XUJ B;  3W96 A;  1P3A B;  3UT9 A;  5F99 A;  4G92 B;  3A1K A;  3H0M C;  4YS3 B;  3NQJ B;  3AV1 C;  4WU9 B;  3AZG A;  1P3L D;  1WWS A;  1T3U A;  5GSU B;  1KX4 D;  2HIO A;  3TU4 C;  4LD9 D;  2IO5 B;  2ZY5 A;  2F8N D;  4J8W B;  3AZM D;  3AYW D;  2J8P A;  3O62 A;  5B31 B;  4X23 A;  5GT0 C;  3LZ1 C;  2YFV A;  5B0Y C;  1M19 C;  5JRG D;  4Z5T C;  5B1L B;  3AZJ D;  4ZUX C;  5B1M D;  4YM6 C;  4XUJ C;  3W96 D;  2G5I C;  3KUY A;  3UT9 D;  2NZD B;  2DQN C;  1P3A C;  1P3K B;  5F99 D;  3C1B B;  4Z2M H;  5B33 A;  1P3F B;  4H9R A;  1P34 A;  2JCH A;  5B24 B;  4YS3 C;  3LJA C;  4WU9 C;  3AZG D;  3R45 A;  5B2I A;  5KDM B;  3AZF A;  3AZE B;  3AZN A;  1F1E A;  5GSU C;  5GXQ A;  3B6G B;  2HIO D;  1WWI A;  3MVD B;  5BNV B;  4Z66 B;  5B40 A;  1P3P B;  4J8W C;  3REJ A;  3O62 D;  4X23 D;  5B31 C;  5B0Z A;  4CAY B;  1P3L B;  5FUG B;  5AVB D;  1HQ3 A;  3TU4 A;  5B1L C;  5BO0 B;  2LY8 A;  4R8P B;  4WZS B;  3AFA A;  4LD9 B;  5BS7 C;  3KUY D;  2NZD C;  2ZY2 A;  5AV8 B;  5GT0 A;  1P3K C;  5B33 D;  3C1B C;  1P34 D;  1P3F C;  5B2I D;  4ZUX A;  4E44 A;  5JRG B;  3AZF D;  4H9N B;  3AZJ B;  3AZE C;  3AZN D;  5GXQ D;  4E45 A;  3B6G C;  4ZBJ B;  3W96 B;  2Y2M A;  3MVD C;  5B40 D;  5F99 B;  4YS3 A;  3B0C T;  4Z66 C;  3LJA A;  4WU9 A;  1P3P C;  3MGQ A;  1KX5 A;  2Y2P A;  2NQB C;  2Y2G A;  3AZI B;  3TU4 D;  2DF4 C;  3AFA D;  4G91 B;  4R8P C;  4CSR A;  4NE3 A;  5GT0 D;  5B0Y D;  5B2J A;  5AV8 C;  2FJ7 A;  3A6N A;  3O62 B;  4X23 B;  2YFV B;  4Z5T D;  4ZUX D;  2CWE A;  3X1V A;  3AZJ C;  5BS7 A;  3KUY B;  4ZBJ C;  2UWX A;  5DNM A;  5BNX A;  1P3F A;  4YS3 D;  3LJA D;  2XD1 A;  4WU9 D;  3X1S C;  5B33 B;  4H9R B;  1P34 B;  3MGQ D;  2RIQ A;  1KX5 D;  5KDM A;  5B2I B;  3AZF B;  3MGP B;  3B6G A;  3W98 A;  3AZN B;  3AZI C;  3WKJ A;  4UUZ A;  5GXQ B;  1EQZ A;  5B32 A;  3EPK A;  4G91 C;  1P3P A;  5B40 B;  1F66 B;  1ZLA A;  3REJ B;  5B2J D;  2FJ7 D;  2NQB A;  3A6N D;  5B0Z B;  4X23 C;  1M18 A;  5CP6 A;  3MNN A;  3KXB A;  3X1V D;  1HQ3 B;  3TU4 B;  2Y2I A;  3AFA B;  4NE6 A;  3B0D B;  1Q9C A;  5AV8 A;  4XZQ A;  2F8N G;  3KUY C;  1H3O A;  1P3F D;  3EPH A;  3EPL A;  4JJN B;  3H0R C;  1P34 C;  1P3B B;  5B2I C;  2Y2Q A;  4DRA A;  3AZF C;  3B6G D;  3MGP C;  2Y2J A;  3WKJ D;  3AZN C;  3MVD D;  1EQZ D;  5GXQ C;  5BT1 C;  4Z66 D;  5B32 D;  5CPK B;  3X1S A;  1P3P D;  5AY8 A;  4J8V A;  1ZLA D;  3VH5 T;  3LJA B;  5B40 C;  1F66 C;  3AZK A;  2NQB D;  3REJ C;  2BYK A;  3MGQ B;  3P5J B;  4KUD B;  3UTA C;  1KX5 B;  5B0Z C;  3X1U A;  1M18 D;  1BH9 A;  5CP6 D;  3AZI A;  3AZH A;  2RVQ C;  3MNN D;  2F8N K;  4R8P D;  3AL0 C;  1HQ3 C;  2FFF B;  4AWL B;  1BFM A;  3AFA C;  5AV8 D;  3B0D C;  4CSR B;  3NQU A;  1TZY B;  5B2J B;  2FJ7 B;  3A6N B;  3KWQ C;  4JJN C;  2Y2L A;  1P3B C;  1ULY A;  3X1V B;  3LZ0 A;  2YFW A;  3REI C;  3EPJ A;  3X1S D;  5CPK C;  5AY8 D;  5DNM B;  5BNX B;  4J8V D;  3AZK D;  5AV5 A;  5GT3 A;  4KUD C;  3MGQ C;  2VQR A;  1KX5 C;  3X1U D;  3WAA A;  3MGP A;  3AZI D;  3AZH D;  4KGC B;  3W98 B;  3WKJ B;  4UUZ B;  3MGR C;  2ZM5 A;  1EQZ B;  4AWL C;  3VH6 T;  5B32 B;  2G5H C;  1F66 A;  1ZLA B;  5G49 A;  3UTA A;  2NQB B;  1TZY C;  5B2J C;  3A6N C; 
#chains in the Genus database with same CATH homology
 1M18 B;  3F6T A;  5CP6 B;  4H9S C;  3MNN B;  1BH8 B;  3KXB B;  5E5A B;  2PYO A;  3X1V C;  4XZQ B;  3KWQ A;  1H3O B;  5DNM C;  4JJN A;  1P3B A;  2ZY3 A;  1M1A A;  5GT3 D;  5AV5 D;  3AN2 B;  3MGP D;  3WAA D;  1PZR A;  3REI A;  3REL B;  5BT1 D;  4KGC C;  2ZY4 A;  4WV4 B;  3W98 C;  5CPK A;  3WKJ C;  1EQZ C;  1F66 D;  3X1S B;  5B32 C;  4WJ3 C;  5AY8 B;  3REJ D;  4J8V B;  1ZLA C;  3UTA D;  3AZK B;  5B0Z D;  4KUD A;  2BYK B;  1P3O A;  2RVQ D;  3X1U B;  5CPJ A;  1BH9 B;  2Y2H A;  1HQ3 D;  5CP6 C;  3AZH B;  1M18 C;  3MGR A;  2PYO D;  3MNN C;  3KXB C;  5E5A C;  4EO5 B;  1TZY A;  3KWQ D;  1HTA A;  2Y2O A;  3NQU B;  4XZQ C;  4JJN D;  5B31 G;  1P3B D;  1M1A D;  2ARO A;  4H9S A;  3MGS A;  3W97 A;  5AV9 B;  3AN2 C;  3REI D;  3LZ0 B;  3REL C;  5CPK D;  2YFW B;  2BG1 A;  5AY8 C;  2BYM A;  1U35 A;  5DNN A;  1KU5 A;  4J8V C;  4KUD D;  4NE5 A;  3AZK C;  5AV6 A;  2Y2N A;  5GT3 B;  5AV5 B;  3EG5 B;  3REK C;  1P3O D;  3H0L C;  3KSY A;  4KGC A;  3WAA B;  3X1U C;  5AVC C;  3MGR D;  3AZH C;  3REH A;  3X1T A;  4EO5 C;  4UPK A;  4J8X A;  1TZY D;  4HGA B;  5G49 B;  2HUE B;  3UTA B;  2XD5 A;  2ARO D;  3MGS D;  1BH8 A;  5E5A A;  3W97 D;  2PYO B;  5AV9 C;  3WTP E;  2Y2K A;  3LZ0 C;  2L5A A;  2CV5 A;  5DNM D;  3B0C W;  3LEL A;  2F8N H;  4WU8 A;  4QLC A;  3KWQ B;  1U35 D;  5DNN D;  1A7W A;  1P3I A;  4H9O A;  2JSS A;  3AZL B;  5AV6 D;  1M1A B;  3AN2 A;  5GT3 C;  5AV5 C;  4KGC D;  3W99 B;  3REL A;  3W98 D;  4KHA A;  1B67 A;  3WAA C;  4DQY B;  3REI B;  3REH D;  4J8U A;  4J8X D;  1P3M B;  4HGA C;  3C1C A;  3REK A;  1AOI A;  2HUE C;  1KX3 A;  1P3O B;  5AVC A;  3KXB D;  3AZM A;  5CPJ B;  2F2A C;  5E5A D;  1S32 A;  3MGR B;  1N1J A;  2PYO C;  2FJ7 C;  3IP4 C;  3WA9 A;  4XZQ D;  2CV5 D;  3LEL D;  4WU8 D;  4QLC D;  1P3I D;  1P3G A;  3UTB A;  2ARO B;  3AZL C;  3MGS B;  5AV9 A;  3AN2 D;  3AV2 B;  1M1A C;  3REL D;  3W97 B;  3W99 C;  3V9R A;  4J8U D;  5CPI B;  1ID3 A;  3FDD A;  1P3M C;  2BYM B;  1U35 B;  5DNN B;  3C1C D;  3REK D;  1AOI D;  1KX3 D;  3B6F A;  5AV6 B;  5AVC D;  1P3O C;  1JFI A;  5CPJ C;  1S32 D;  3REH B;  3X1T B;  4NFT A;  5JA4 B;  5AVB A;  4H9Q A;  3WA9 D;  1TAF A;  4J8X B;  1P3G D;  3UTB D;  2ARO C;  4Z2M G;  5AV9 D;  3MGS C;  3AV2 C;  3WTP A;  4G92 C;  3LZ0 D;  3W97 C;  1ID3 D;  5CPI C;  2CV5 B;  3VH5 W;  3LEL B;  4WU8 B;  4QLC B;  3AZL A;  1P3I B;  1U35 C;  5DNN C;  2JE5 A;  4H9O B;  3B6F D;  1R4V A;  2IO5 C;  4WNN A;  5AV6 C;  3AV1 A;  3W99 A;  4KHA B;  4J8U B;  3REH C;  3X1T C;  1P3M A;  1Z2C B;  4J8X C;  4H9P A;  3C1C B;  3REK B;  1KX4 B;  1AOI B;  1KX3 B;  2F8N B;  5AVC B;  3LZ1 A;  3AZM B;  5B0Y A;  3AYW B;  3WTP D;  1S32 B;  1M19 A;  1N1J B;  1W2E A;  4Z5T A;  5B24 C;  3WA9 B;  4YM6 A;  4XUJ A;  2CV5 C;  3VH5 A;  3LEL C;  5B1M B;  4QLC C;  4WU8 C;  3AZL D;  3KFU G;  1P3A A;  1P3G B;  1P3I C;  3UTB B;  3AV2 A;  3UT9 B;  3W99 D;  3AV1 D;  3NQJ A;  5CPI A;  3V9R B;  3VH6 W;  3AZG B;  1ID3 B;  4J8U C;  1P3L C;  3B0B A;  1P3M D;  5GSU A;  2HIO B;  3A1I A;  3C1C C;  1KX4 C;  1AOI C;  1KX3 C;  4J8W A;  5CPJ D;  3B6F B;  4LD9 C;  1JFI B;  3LZ1 D;  5B31 A;  3AZM C;  3AYW C;  5CHL B;  1M19 D;  5JA4 A;  1S32 C;  5B32 G;  5AVB B;  4H9Q B;  5B1L A;  4YM6 D;  1TAF B;  3WA9 C;  4XUJ D;  2W8S A;  5JRG C;  5B1M C;  1P3A D;  2NZD A;  1P3G C;  1P3K A;  3AV2 D;  3UTB C;  3W96 C;  3C1B A;  3UT9 C;  5F99 C;  3WTP B;  5B24 A;  5CPI D;  5C3I B;  3R45 B;  3VH6 A;  3AZG C;  1ID3 C;  3AZE A;  5GSU D;  1B6W A;  3MVD A;  5BNV A;  4Z66 A;  2HIO C;  4J8W D;  3B6F C;  4WNN B;  3AV1 B;  5B31 D;  3X1T D;  4CAY A;  1P3L A;  5FUG A;  3O62 C;  5B1L D;  5AVB C;  5BO0 A;  1KX4 A;  4H9P B;  4R8P A;  4LD9 A;  2F8N A;  2NZD D;  1P3K D;  4M6B A;  3C1B D;  3AYW A;  5GT0 B;  3LZ1 B;  5B0Y B;  4DRB A;  5B24 D;  1M19 B;  3WTP C;  5B33 C;  4Z5T B;  5JRG A;  4ZUX B;  5C3I C;  4H9N A;  4YM6 B;  3AZJ A;  3AZE D;  5B1M A;  4XUJ B;  3W96 A;  1P3A B;  3UT9 A;  5F99 A;  4G92 B;  3A1K A;  3H0M C;  4YS3 B;  3NQJ B;  3AV1 C;  4WU9 B;  3AZG A;  1P3L D;  1WWS A;  1T3U A;  5GSU B;  1KX4 D;  2HIO A;  3TU4 C;  4LD9 D;  2IO5 B;  2ZY5 A;  2F8N D;  4J8W B;  3AZM D;  3AYW D;  2J8P A;  3O62 A;  5B31 B;  4X23 A;  5GT0 C;  3LZ1 C;  2YFV A;  5B0Y C;  1M19 C;  5JRG D;  4Z5T C;  5B1L B;  3AZJ D;  4ZUX C;  5B1M D;  4YM6 C;  4XUJ C;  3W96 D;  2G5I C;  3KUY A;  3UT9 D;  2NZD B;  2DQN C;  1P3A C;  1P3K B;  5F99 D;  3C1B B;  4Z2M H;  5B33 A;  1P3F B;  4H9R A;  1P34 A;  2JCH A;  5B24 B;  4YS3 C;  3LJA C;  4WU9 C;  3AZG D;  3R45 A;  5B2I A;  5KDM B;  3AZF A;  3AZE B;  3AZN A;  1F1E A;  5GSU C;  5GXQ A;  3B6G B;  2HIO D;  1WWI A;  3MVD B;  5BNV B;  4Z66 B;  5B40 A;  1P3P B;  4J8W C;  3REJ A;  3O62 D;  4X23 D;  5B31 C;  5B0Z A;  4CAY B;  1P3L B;  5FUG B;  5AVB D;  1HQ3 A;  3TU4 A;  5B1L C;  5BO0 B;  2LY8 A;  4R8P B;  4WZS B;  3AFA A;  4LD9 B;  5BS7 C;  3KUY D;  2NZD C;  2ZY2 A;  5AV8 B;  5GT0 A;  1P3K C;  5B33 D;  3C1B C;  1P34 D;  1P3F C;  5B2I D;  4ZUX A;  4E44 A;  5JRG B;  3AZF D;  4H9N B;  3AZJ B;  3AZE C;  3AZN D;  5GXQ D;  4E45 A;  3B6G C;  4ZBJ B;  3W96 B;  2Y2M A;  3MVD C;  5B40 D;  5F99 B;  4YS3 A;  3B0C T;  4Z66 C;  3LJA A;  4WU9 A;  1P3P C;  3MGQ A;  1KX5 A;  2Y2P A;  2NQB C;  2Y2G A;  3AZI B;  3TU4 D;  2DF4 C;  3AFA D;  4G91 B;  4R8P C;  4CSR A;  4NE3 A;  5GT0 D;  5B0Y D;  5B2J A;  5AV8 C;  2FJ7 A;  3A6N A;  3O62 B;  4X23 B;  2YFV B;  4Z5T D;  4ZUX D;  2CWE A;  3X1V A;  3AZJ C;  5BS7 A;  3KUY B;  4ZBJ C;  2UWX A;  5DNM A;  5BNX A;  1P3F A;  4YS3 D;  3LJA D;  2XD1 A;  4WU9 D;  3X1S C;  5B33 B;  4H9R B;  1P34 B;  3MGQ D;  2RIQ A;  1KX5 D;  5KDM A;  5B2I B;  3AZF B;  3MGP B;  3B6G A;  3W98 A;  3AZN B;  3AZI C;  3WKJ A;  4UUZ A;  5GXQ B;  1EQZ A;  5B32 A;  3EPK A;  4G91 C;  1P3P A;  5B40 B;  1F66 B;  1ZLA A;  3REJ B;  5B2J D;  2FJ7 D;  2NQB A;  3A6N D;  5B0Z B;  4X23 C;  1M18 A;  5CP6 A;  3MNN A;  3KXB A;  3X1V D;  1HQ3 B;  3TU4 B;  2Y2I A;  3AFA B;  4NE6 A;  3B0D B;  1Q9C A;  5AV8 A;  4XZQ A;  2F8N G;  3KUY C;  1H3O A;  1P3F D;  3EPH A;  3EPL A;  4JJN B;  3H0R C;  1P34 C;  1P3B B;  5B2I C;  2Y2Q A;  4DRA A;  3AZF C;  3B6G D;  3MGP C;  2Y2J A;  3WKJ D;  3AZN C;  3MVD D;  1EQZ D;  5GXQ C;  5BT1 C;  4Z66 D;  5B32 D;  5CPK B;  3X1S A;  1P3P D;  5AY8 A;  4J8V A;  1ZLA D;  3VH5 T;  3LJA B;  5B40 C;  1F66 C;  3AZK A;  2NQB D;  3REJ C;  2BYK A;  3MGQ B;  3P5J B;  4KUD B;  3UTA C;  1KX5 B;  5B0Z C;  3X1U A;  1M18 D;  1BH9 A;  5CP6 D;  3AZI A;  3AZH A;  2RVQ C;  3MNN D;  2F8N K;  4R8P D;  3AL0 C;  1HQ3 C;  2FFF B;  4AWL B;  1BFM A;  3AFA C;  5AV8 D;  3B0D C;  4CSR B;  3NQU A;  1TZY B;  5B2J B;  2FJ7 B;  3A6N B;  3KWQ C;  4JJN C;  2Y2L A;  1P3B C;  1ULY A;  3X1V B;  3LZ0 A;  2YFW A;  3REI C;  3EPJ A;  3X1S D;  5CPK C;  5AY8 D;  5DNM B;  5BNX B;  4J8V D;  3AZK D;  5AV5 A;  5GT3 A;  4KUD C;  3MGQ C;  2VQR A;  1KX5 C;  3X1U D;  3WAA A;  3MGP A;  3AZI D;  3AZH D;  4KGC B;  3W98 B;  3WKJ B;  4UUZ B;  3MGR C;  2ZM5 A;  1EQZ B;  4AWL C;  3VH6 T;  5B32 B;  2G5H C;  1F66 A;  1ZLA B;  5G49 A;  3UTA A;  2NQB B;  1TZY C;  5B2J C;  3A6N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...