5GSUC

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
KSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuC00
3C1BB 2CV5A 4G92C 5B31B 3WTPD 4QLCB 5B32A 5F99B 3AYWD 3WTPC 1P34D 1P3AA 3RELB 3VH6A 5B32G 5AV9B 3REIC 4YS3B 5AY8B 1P34C 1H3OB 1BH9A 4J8UB 3B6FD 3A6ND 2HUEB 3AZEA 3A6NC 3VH6W 5B2IA 3AV1A 1P3LB 1F1EA 4R8PD 5JA4A 4XZQD 1P3GA 3MNND 3KWQD 3MGSB 5GSUA 3LELB 1M1AC 3WAAD 2PYOD 5GT3D 4XZQC 5BO0A 5CPIB 2F8NH 4WU8B 3MNNC 3O62B 3KWQC 5GT3C 2HIOC 1M19C 3W96D 3MVDA 5B33C 5BNXA 3AZLA 3W99A 5AVBA 5DNMD 3B6GB 3KXBB 3TU4D 1F66C 3MGPB 4Z5TD 3C1CC 3UTAD 4G91B 3V9RB 3X1TB 5AV5B 5B31C 3NQJB 5GXQD 5GT0B 4LD9B 1P3MD 5GXQC 3REIA 2AROB 3LJAA 5E5AC 5AV9C 3MGRC 1P3MC 5B2JC 3AZJA 4Z66D 3AZMA 5AV8B 4AWLC 5JRGA 3REKB 4Z66C 4X23A 4XUJD 3X1SD 3AV2B 2NZDD 3AFAB 3AZFA 5KDMB 5G49B 2HUEC 4XUJC 3X1SC 1Q9CA 4J8XB 2NZDC 3AZND 1KX4B 5CP6C 4H9OB 3AZIB 3AZKA 1HQ3B 3X1VA 1P3OA 2HIOA 2YFVA 1M19A 1JFIB 4H9SC 5DNND 5B33A 3X1UD 3W98B 5DNNC 3NQUA 3UT9B 3LZ1A 1F66A 2FJ7A 3C1CA 2CV5D 3C1BA 1P3IB 5FUGB 4Z2MH 5B31A 2CV5C 1P3BB 5CPJB 4J8WB 5C3IB 4QLCA 5B32D 5F99A 1P3AD 4KUDB 2RVQC 3RELA 3WA9B 5AV9A 4YS3A 5B2JA 1B67A 1KX5B 4UUZB 5AVCD 1ID3B 1H3OA 4JJNB 4J8UA 1TAFB 4DRBA 3KUYB 3AZED 3AV1D 1A7WA 5B2ID 1P3LA 5B40B 5CP6A 3AZHC 3AZEC 1P3GD 3AV1C 5B2IC 1P3KB 5GSUD 3MGSA 4WU8A 1N1JB 3B0DB 5AV6B 3AYWB 3WKJC 3MVDD 1BFMA 1BH8B 3W99D 3AZLD 5AVBD 3B0CW 2F8NB 3B6GA 3VH6T 3KXBA 3W99C 3AZLC 4J8VB 3B6FB 3V9RA 4CAYB 2BYMB 3X1TA 4KHAB 2NQBB 4J8WC 4ZUXC 3NQJA 2YFWB 4R8PB 5GT0A 3REID 3LJAD 5B24C 1P3FB 2AROA 3WAAB 2PYOB 3AZJD 3REHC 3LJAC 4WNNB 3AZMD 1U35B 5AV8A 5JRGD 3AZJC 3REJB 3REKA 4X23D 3AZMC 3W96B 5JRGC 3AV2A 4X23C 3AFAA 1WWIA 3AZFD 5KDMA 5G49A 5DNMB 4J8XA 3AZFC 3AZHA 3TU4B 4Z5TB 3UTAB 4H9OA 1M1AD 3AZKD 3AZIA 1HQ3A 3VH5W 3X1VD 1TZYC 1EQZC 5B1MC 3AZKC 1P3OD 2HIOD 4WU9C 3X1VC 1M19D 4ZBJC 3WKJA 4EO5C 1P3OC 5B33D 1JFIA 4H9NB 1KX3B 3LZ1D 1F66D 2LY8A 3UT9A 2FJ7D 3C1CD 5CPKC 2IO5B 3C1BD 3LZ1C 2FJ7C 5FUGA 5B31D 1M18B 3WTPE 3C1BC 5B1LB 1P3BA 4QLCD 1WWSA 4ZUXA 4J8WA 2F8NK 5F99D 3AZNB 4M6BA 4QLCC 3RELD 3W97B 5F99C 5B24A 1AOIB 5E5AD 5AV9D 4YS3D 3MGRD 5B2JD 3WA9A 4NE5A 3REHA 3RELC 1KX5A 4UUZA 4H9PB 4YS3C 3LZ0B 5AY8C 2JSSA 4J8UD 4JJNA 3X1UB 5BNVB 4J8UC 4CSRB 5BS7C 3KUYA 1P3LD 5CP6D 1P3LC 1P3KA 3MGSD 4H9RA 1TZYA 1EQZA 5B1MA 4KGCB 4E44A 4WU8D 3MGSC 5B32B 3LELC 4WU9A 5CPIC 5AV6A 3O62C 4WU8C 1P3AB 3B0BA 1BH8A 1ZLAB 5BT1C 4YM6B 2F8NA 3B6GD 5AVCB 3KXBD 5CPKA 3AZGB 1P3PB 4J8VA 2BYKB 3B6GC 5B0YB 3KXBC 3MGPC 4CAYA 3X1TD 4KHAA 4HGAB 2NQBA 4G91C 3X1TC 5AV5C 2RVQD 5GT0D 5JA4B 4R8PA 1S32B 5B31G 5CHLB 3MGQB 2AROD 5GSUB 3AN2B 1P3FA 5GT0C 4LD9C 3B0CT 2AROC 4WNNA 5AY8A 5AV8D 1U35A 3REKD 3REJA 3MVDB 5AV8C 3AV2D 3REKC 3AFAD 5BS7A 5AVBB 5B0ZB 3AV2C 5DNMA 4J8XD 3UTBB 3AZHD 3AFAC 3UTAA 3AZID 4J8XC 4G92B 1KX4C 3AZIC 3LELA 1HQ3C 5CPIA 3WTPB 3WKJD 2CWEA 3O62A 3REIB 1P34B 4H9NA 1KX3A 3UT9D 3W98C 3UT9C 3MGPA 3VH5T 1M18A 1P3BD 3R45B 5B1LA 4ZUXD 3A6NB 4J8WD 1P3IC 5AV5A 1P3BC 5CPJC 5C3IC 5B24D 3W97A 1M1AB 1AOIA 3MGQC 4LD9A 4XZQB 4KUDC 3REHD 1KX5D 3MNNB 3KWQB 3WA9C 4H9PA 5GT3B 2YFVB 3LZ0A 1M19B 1KX5C 4NE3A 3VH5A 5B33B 1ID3C 4JJNC 4DRAA 3KUYD 4CSRA 3NQUB 3C1CB 3KUYC 1P3KD 5B40C 1KX4A 1TZYD 1EQZD 1KU5A 5B1MD 1P3KC 4KGCA 4WU9D 5AV6D 4H9QB 4WZSB 5GXQB 3B0DC 5AV6C 3AYWC 5E5AB 3MGRB 1P3MB 1ZLAA 5B2JB 4YM6A 2F8ND 3W98A 4AWLB 5CPKD 5AVCA 4Z66B 3AZGA 4J8VD 1P3PA 2BYKA 5B0YA 4J8VC 2NQBD 1P3IA 4XUJB 3X1SB 3B6FC 2NZDB 5CPJA 2NQBC 5CP6B 3KSYA 1S32A 3MGQA 1P3FD 4KUDA 3AN2A 4R8PC 5AY8D 1P3FC 1U35D 3WAAC 2PYOC 3REJD 1U35C 1ID3A 5DNNB 3REJC 1TAFA 3W96C 1ULYA 5B0ZA 4E45A 3UTBA 2L5AA 5B40A 5DNMC 3TU4C 4Z5TC 2CV5B 3UTAC 3LELD 5CPID 3WTPA 3O62D 1N1JA 5BT1D 3AYWA 1P34A 1HTAA 1KX3D 1KX3C 3MGPD 1BH9B 2IO5C 2F8NG 1M18D 1B6WA 3B6FA 5B1LD 2BYMA 3R45A 3A6NA 5AV5D 1M18C 3AZHB 3AZEB 5B1LC 3AV1B 5B2IB 3W97D 1M1AA 1AOID 3AZNC 2YFWA 1P3GB 4LD9D 4XZQA 3W97C 3MNNA 3KWQA 1AOIC 5BO0B 3WAAA 2PYOA 5GT3A 3LZ0D 3WKJB 3LZ0C 3W96A 5BNXB 3X1UC 3AZLB 3W99B 4NE6A 3TU4A 1KX4D 4Z5TA 4KGCD 1HQ3D 4ZUXB 4KGCC 4H9QA 5B32C 5GXQA 4WV4B 5B24B 1ZLAD 5E5AA 3MGRA 4YM6D 1P3AC 1P3MA 3REHB 3LJAB 3W98D 1ZLAC 3AZJB 4YM6C 3AZGD 1P3PD 4Z66A 3AZMB 5B0YD 5JRGB 5AVCC 3AZGC 1P3PC 4X23B 1P3ID 5B0YC 4XUJA 3X1SA 2NZDA 3AZFB 5CPJD 4HGAC 1S32D 3MGQD 3AZNA 4KUDD 4H9RB 3AN2D 1TZYB 1EQZB 5B1MB 3AZKB 1S32C 1P3GC 3WA9D 4WU9B 5GSUC 3AN2C 4ZBJB 3X1VB 4EO5B 1P3OB 4H9SA 4NFTA 2HIOB 1ID3D 4Z2MG 4JJND 5DNNA 3MVDC 3X1UA 5B0ZD 5BNVA 1R4VA 3UTBD 5CPKB 5AVBC 3LZ1B 5B0ZC 5B40D 1F66B 2FJ7B 3UTBC
chains in the Genus database with same CATH superfamily
3C1BB 2CV5A 4G92C 5B31B 2BG1A 3WTPD 4QLCB 5B32A 5F99B 3AYWD 3WTPC 1P34D 1P3AA 3RELB 3VH6A 5B32G 5AV9B 3REIC 4YS3B 2DQNC 5AY8B 1P34C 1H3OB 1BH9A 4J8UB 3B6FD 3A6ND 3EPLA 2HUEB 2UWXA 3AZEA 3A6NC 3VH6W 5B2IA 3AV1A 1P3LB 2Y2NA 1F1EA 4R8PD 5JA4A 4XZQD 1P3GA 3EPKA 3MNND 3KWQD 3MGSB 5GSUA 3LELB 1M1AC 3EPHA 3WAAD 2PYOD 5GT3D 4XZQC 5BO0A 5CPIB 2F8NH 4WU8B 3MNNC 3O62B 3KWQC 5GT3C 2HIOC 1M19C 3W96D 2Y2PA 3MVDA 5B33C 5BNXA 3EPJA 3AZLA 5AVBA 3W99A 5DNMD 3B6GB 3KXBB 3TU4D 1F66C 3MGPB 4Z5TD 3C1CC 3UTAD 3IP4C 4G91B 3V9RB 3X1TB 5AV5B 5B31C 3EG5B 2XD1A 3A1KA 3FDDA 3NQJB 5GXQD 2Y2GA 5GT0B 4LD9B 1P3MD 5GXQC 3REIA 2AROB 3LJAA 2Y2IA 5E5AC 5AV9C 3MGRC 1P3MC 5B2JC 2G5IC 3AZJA 4Z66D 3AZMA 5AV8B 2ZY4A 4AWLC 5JRGA 3REKB 4Z66C 4X23A 4XUJD 3X1SD 3AV2B 2NZDD 3AFAB 3AZFA 5KDMB 5G49B 2HUEC 4XUJC 3X1SC 1Q9CA 4J8XB 2NZDC 3AZND 1KX4B 2DF4C 5CP6C 4H9OB 2Y2MA 2Y2KA 3AZIB 3AZKA 1HQ3B 3X1VA 1P3OA 2HIOA 2YFVA 1M19A 1JFIB 4H9SC 5DNND 5B33A 3X1UD 3W98B 5DNNC 3NQUA 3UT9B 1T3UA 3LZ1A 1F66A 2FJ7A 3C1CA 2CV5D 3C1BA 1P3IB 5FUGB 4Z2MH 5B31A 2CV5C 4DQYB 5CPJB 4J8WB 1P3BB 5C3IB 4QLCA 5B32D 5F99A 1P3AD 4KUDB 2RVQC 3RELA 3WA9B 5AV9A 4YS3A 5B2JA 1B67A 1KX5B 4UUZB 5AVCD 1ID3B 1H3OA 4JJNB 4J8UA 1TAFB 4DRBA 2JE5A 3KUYB 3AZED 3AV1D 1A7WA 5B2ID 1P3LA 5B40B 5CP6A 3AZHC 3AZEC 1P3GD 3AV1C 5B2IC 1P3KB 5GSUD 3MGSA 2F2AC 4WU8A 1N1JB 3B0DB 5AV6B 3AYWB 3WKJC 3MVDD 1BFMA 3H0LC 1BH8B 3W99D 3AZLD 5AVBD 3B0CW 2F8NB 3B6GA 3VH6T 3KXBA 3W99C 3AZLC 4J8VB 3B6FB 3V9RA 4CAYB 2BYMB 3X1TA 4KHAB 2NQBB 4J8WC 4ZUXC 3NQJA 2YFWB 4R8PB 5GT0A 3REID 3LJAD 5B24C 1P3FB 2AROA 3WAAB 2PYOB 3AZJD 2RIQA 3REHC 3LJAC 4WNNB 3AZMD 1U35B 5AV8A 5JRGD 3AZJC 3REJB 3REKA 4X23D 3AZMC 3W96B 5JRGC 3AV2A 4X23C 3AFAA 1WWIA 3AZFD 5KDMA 1PZRA 5G49A 5DNMB 4J8XA 2Y2LA 3AZFC 3AZHA 3TU4B 4Z5TB 3UTAB 4H9OA 1M1AD 3AZKD 3AZIA 1HQ3A 3VH5W 3X1VD 1TZYC 1EQZC 5B1MC 3AZKC 1P3OD 2HIOD 4WU9C 3X1VC 1M19D 4ZBJC 3WKJA 3P5JB 4EO5C 1P3OC 5B33D 1JFIA 4H9NB 1KX3B 3LZ1D 1F66D 2LY8A 3UT9A 2FJ7D 3C1CD 5CPKC 2IO5B 3C1BD 3LZ1C 2G5HC 2ZY3A 2FJ7C 5FUGA 5B31D 1M18B 3WTPE 3C1BC 5B1LB 1P3BA 4QLCD 1WWSA 4ZUXA 4J8WA 2F8NK 5F99D 3AZNB 4M6BA 4QLCC 3RELD 3W97B 5F99C 5B24A 1AOIB 5E5AD 5AV9D 4YS3D 3MGRD 5B2JD 3WA9A 4NE5A 3REHA 3RELC 1KX5A 4UUZA 4H9PB 4YS3C 3LZ0B 5AY8C 2JSSA 4J8UD 4JJNA 3X1UB 5BNVB 4J8UC 4CSRB 5BS7C 3KUYA 1P3LD 5CP6D 1P3LC 1P3KA 3MGSD 4H9RA 1TZYA 1EQZA 5B1MA 4KGCB 4E44A 4WU8D 3MGSC 5B32B 3LELC 4WU9A 5CPIC 5AV6A 3O62C 4WU8C 1P3AB 3B0BA 1BH8A 1ZLAB 5BT1C 4YM6B 3KFUG 2F8NA 3B6GD 5AVCB 3KXBD 5CPKA 1W2EA 3AZGB 1P3PB 4J8VA 2BYKB 3B6GC 5B0YB 3KXBC 4WJ3C 3MGPC 4CAYA 3X1TD 4KHAA 2FFFB 4HGAB 2NQBA 4G91C 3X1TC 3H0MC 5AV5C 2RVQD 5GT0D 5JA4B 4R8PA 1S32B 5B31G 5CHLB 3MGQB 2AROD 5GSUB 3AN2B 1P3FA 5GT0C 4LD9C 3B0CT 2AROC 4WNNA 2ZY5A 5AY8A 5AV8D 1U35A 3REKD 3REJA 3MVDB 5AV8C 3AV2D 3REKC 3AFAD 5BS7A 5AVBB 5B0ZB 3AV2C 5DNMA 4J8XD 3UTBB 3AZHD 3AFAC 3UTAA 3AZID 4J8XC 4G92B 1KX4C 3AZIC 3LELA 1HQ3C 5CPIA 3WTPB 3WKJD 2CWEA 3O62A 3REIB 1P34B 4H9NA 1KX3A 3UT9D 3W98C 3UT9C 3MGPA 3VH5T 1M18A 1P3BD 3R45B 5B1LA 4ZUXD 3A6NB 4J8WD 1P3IC 5AV5A 3F6TA 1P3BC 5CPJC 5C3IC 5B24D 3W97A 1M1AB 1AOIA 3MGQC 4LD9A 4XZQB 4KUDC 3REHD 1KX5D 3MNNB 3KWQB 3WA9C 4H9PA 5GT3B 2YFVB 3LZ0A 1M19B 1KX5C 4NE3A 3VH5A 5B33B 1ID3C 4JJNC 4DRAA 3KUYD 4CSRA 3NQUB 3C1CB 3KUYC 1P3KD 5B40C 1KX4A 1TZYD 1EQZD 1KU5A 5B1MD 1P3KC 4KGCA 4WU9D 5AV6D 4H9QB 4WZSB 3AL0C 5GXQB 3B0DC 5AV6C 3AYWC 5E5AB 3MGRB 1P3MB 1ZLAA 5B2JB 4YM6A 2F8ND 3W98A 3A1IA 4AWLB 5CPKD 5AVCA 4Z66B 3AZGA 4J8VD 1P3PA 2BYKA 5B0YA 2FJ7B 4J8VC 2NQBD 1P3IA 4XUJB 3X1SB 3B6FC 2NZDB 5CPJA 2NQBC 5CP6B 3KSYA 1S32A 3MGQA 1P3FD 4KUDA 2W8SA 3AN2A 4R8PC 5AY8D 1P3FC 1U35D 3WAAC 2PYOC 3REJD 1U35C 1ID3A 5DNNB 3REJC 1TAFA 3W96C 4UPKA 1ULYA 5B0ZA 2Y2HA 2ZY2A 4E45A 3UTBA 2L5AA 5B40A 5DNMC 3TU4C 4Z5TC 2CV5B 3UTAC 3LELD 5CPID 2J8PA 3WTPA 3O62D 1N1JA 5BT1D 3AYWA 1P34A 1HTAA 1KX3D 2Y2JA 1KX3C 3MGPD 1BH9B 2IO5C 2F8NG 1M18D 1B6WA 3B6FA 5B1LD 2BYMA 3R45A 3A6NA 5AV5D 1M18C 3AZHB 3AZEB 5B1LC 3AV1B 2VQRA 5B2IB 3W97D 1M1AA 1AOID 3AZNC 2YFWA 1P3GB 4LD9D 4XZQA 3W97C 3MNNA 3KWQA 1AOIC 5BO0B 3WAAA 2PYOA 5GT3A 3LZ0D 3WKJB 3LZ0C 2ZM5A 3W96A 2Y2QA 5BNXB 3X1UC 3AZLB 3W99B 4NE6A 3TU4A 1KX4D 4Z5TA 4KGCD 1HQ3D 4ZUXB 4KGCC 4H9QA 5B32C 5GXQA 4WV4B 5B24B 1ZLAD 5E5AA 3MGRA 4YM6D 1P3AC 1P3MA 3REHB 3LJAB 3W98D 1ZLAC 3AZJB 4YM6C 3AZGD 1P3PD 1Z2CB 4Z66A 3AZMB 5B0YD 5JRGB 5AVCC 3AZGC 1P3PC 4X23B 1P3ID 2JCHA 5B0YC 4XUJA 3X1SA 2NZDA 3AZFB 5CPJD 4HGAC 1S32D 3MGQD 3AZNA 4KUDD 4H9RB 3AN2D 1TZYB 1EQZB 5B1MB 3AZKB 1S32C 1P3GC 3WA9D 4WU9B 2Y2OA 5GSUC 4ZBJB 3AN2C 3X1VB 4EO5B 1P3OB 4H9SA 4NFTA 2HIOB 1ID3D 4Z2MG 4JJND 5DNNA 3MVDC 3X1UA 5B0ZD 3H0RC 5BNVA 1R4VA 3UTBD 5CPKB 5AVBC 3LZ1B 5B0ZC 5B40D 2XD5A 1F66B 3UTBC
chains in the Genus database with same CATH topology
3C1BB 2CV5A 4G92C 5B31B 2BG1A 3WTPD 4QLCB 5B32A 5F99B 3AYWD 3WTPC 1P34D 1P3AA 3RELB 3VH6A 5B32G 5AV9B 3REIC 4YS3B 2DQNC 5AY8B 1P34C 1H3OB 1BH9A 4J8UB 3B6FD 3A6ND 3EPLA 2HUEB 2UWXA 3AZEA 3A6NC 3VH6W 5B2IA 3AV1A 1P3LB 2Y2NA 1F1EA 4R8PD 5JA4A 4XZQD 1P3GA 3EPKA 3MNND 3KWQD 3MGSB 5GSUA 3LELB 1M1AC 3EPHA 3WAAD 2PYOD 5GT3D 4XZQC 5BO0A 5CPIB 2F8NH 4WU8B 3MNNC 3O62B 3KWQC 5GT3C 2HIOC 1M19C 3W96D 2Y2PA 3MVDA 5B33C 5BNXA 3EPJA 3AZLA 5AVBA 3W99A 5DNMD 3B6GB 3KXBB 3TU4D 1F66C 3MGPB 4Z5TD 3C1CC 3UTAD 3IP4C 4G91B 3V9RB 3X1TB 5AV5B 5B31C 3EG5B 2XD1A 3A1KA 3FDDA 3NQJB 5GXQD 2Y2GA 5GT0B 4LD9B 1P3MD 5GXQC 3REIA 2AROB 3LJAA 2Y2IA 5E5AC 5AV9C 3MGRC 1P3MC 5B2JC 2G5IC 3AZJA 4Z66D 3AZMA 5AV8B 2ZY4A 4AWLC 5JRGA 3REKB 4Z66C 4X23A 4XUJD 3X1SD 3AV2B 2NZDD 3AFAB 3AZFA 5KDMB 5G49B 2HUEC 4XUJC 3X1SC 1Q9CA 4J8XB 2NZDC 3AZND 1KX4B 2DF4C 5CP6C 4H9OB 2Y2MA 2Y2KA 3AZIB 3AZKA 1HQ3B 3X1VA 1P3OA 2HIOA 2YFVA 1M19A 1JFIB 4H9SC 5DNND 5B33A 3X1UD 3W98B 5DNNC 3NQUA 3UT9B 1T3UA 3LZ1A 1F66A 2FJ7A 3C1CA 2CV5D 3C1BA 1P3IB 5FUGB 4Z2MH 5B31A 2CV5C 4DQYB 5CPJB 4J8WB 1P3BB 5C3IB 4QLCA 5B32D 5F99A 1P3AD 4KUDB 2RVQC 3RELA 3WA9B 5AV9A 4YS3A 5B2JA 1B67A 1KX5B 4UUZB 5AVCD 1ID3B 1H3OA 4JJNB 4J8UA 1TAFB 4DRBA 2JE5A 3KUYB 3AZED 3AV1D 1A7WA 5B2ID 1P3LA 5B40B 5CP6A 3AZHC 3AZEC 1P3GD 3AV1C 5B2IC 1P3KB 5GSUD 3MGSA 2F2AC 4WU8A 1N1JB 3B0DB 5AV6B 3AYWB 3WKJC 3MVDD 1BFMA 3H0LC 1BH8B 3W99D 3AZLD 5AVBD 3B0CW 2F8NB 3B6GA 3VH6T 3KXBA 3W99C 3AZLC 4J8VB 3B6FB 3V9RA 4CAYB 2BYMB 3X1TA 4KHAB 2NQBB 4J8WC 4ZUXC 3NQJA 2YFWB 4R8PB 5GT0A 3REID 3LJAD 5B24C 1P3FB 2AROA 3WAAB 2PYOB 3AZJD 2RIQA 3REHC 3LJAC 4WNNB 3AZMD 1U35B 5AV8A 5JRGD 3AZJC 3REJB 3REKA 4X23D 3AZMC 3W96B 5JRGC 3AV2A 4X23C 3AFAA 1WWIA 3AZFD 5KDMA 1PZRA 5G49A 5DNMB 4J8XA 2Y2LA 3AZFC 3AZHA 3TU4B 4Z5TB 3UTAB 4H9OA 1M1AD 3AZKD 3AZIA 1HQ3A 3VH5W 3X1VD 1TZYC 1EQZC 5B1MC 3AZKC 1P3OD 2HIOD 4WU9C 3X1VC 1M19D 4ZBJC 3WKJA 3P5JB 4EO5C 1P3OC 5B33D 1JFIA 4H9NB 1KX3B 3LZ1D 1F66D 2LY8A 3UT9A 2FJ7D 3C1CD 5CPKC 2IO5B 3C1BD 3LZ1C 2G5HC 2ZY3A 2FJ7C 5FUGA 5B31D 1M18B 3WTPE 3C1BC 5B1LB 1P3BA 4QLCD 1WWSA 4ZUXA 4J8WA 2F8NK 5F99D 3AZNB 4M6BA 4QLCC 3RELD 3W97B 5F99C 5B24A 1AOIB 5E5AD 5AV9D 4YS3D 3MGRD 5B2JD 3WA9A 4NE5A 3REHA 3RELC 1KX5A 4UUZA 4H9PB 4YS3C 3LZ0B 5AY8C 2JSSA 4J8UD 4JJNA 3X1UB 5BNVB 4J8UC 4CSRB 5BS7C 3KUYA 1P3LD 5CP6D 1P3LC 1P3KA 3MGSD 4H9RA 1TZYA 1EQZA 5B1MA 4KGCB 4E44A 4WU8D 3MGSC 5B32B 3LELC 4WU9A 5CPIC 5AV6A 3O62C 4WU8C 1P3AB 3B0BA 1BH8A 1ZLAB 5BT1C 4YM6B 3KFUG 2F8NA 3B6GD 5AVCB 3KXBD 5CPKA 1W2EA 3AZGB 1P3PB 4J8VA 2BYKB 3B6GC 5B0YB 3KXBC 4WJ3C 3MGPC 4CAYA 3X1TD 4KHAA 2FFFB 4HGAB 2NQBA 4G91C 3X1TC 3H0MC 5AV5C 2RVQD 5GT0D 5JA4B 4R8PA 1S32B 5B31G 5CHLB 3MGQB 2AROD 5GSUB 3AN2B 1P3FA 5GT0C 4LD9C 3B0CT 2AROC 4WNNA 2ZY5A 5AY8A 5AV8D 1U35A 3REKD 3REJA 3MVDB 5AV8C 3AV2D 3REKC 3AFAD 5BS7A 5AVBB 5B0ZB 3AV2C 5DNMA 4J8XD 3UTBB 3AZHD 3AFAC 3UTAA 3AZID 4J8XC 4G92B 1KX4C 3AZIC 3LELA 1HQ3C 5CPIA 3WTPB 3WKJD 2CWEA 3O62A 3REIB 1P34B 4H9NA 1KX3A 3UT9D 3W98C 3UT9C 3MGPA 3VH5T 1M18A 1P3BD 3R45B 5B1LA 4ZUXD 3A6NB 4J8WD 1P3IC 5AV5A 3F6TA 1P3BC 5CPJC 5C3IC 5B24D 3W97A 1M1AB 1AOIA 3MGQC 4LD9A 4XZQB 4KUDC 3REHD 1KX5D 3MNNB 3KWQB 3WA9C 4H9PA 5GT3B 2YFVB 3LZ0A 1M19B 1KX5C 4NE3A 3VH5A 5B33B 1ID3C 4JJNC 4DRAA 3KUYD 4CSRA 3NQUB 3C1CB 3KUYC 1P3KD 5B40C 1KX4A 1TZYD 1EQZD 1KU5A 5B1MD 1P3KC 4KGCA 4WU9D 5AV6D 4H9QB 4WZSB 3AL0C 5GXQB 3B0DC 5AV6C 3AYWC 5E5AB 3MGRB 1P3MB 1ZLAA 5B2JB 4YM6A 2F8ND 3W98A 3A1IA 4AWLB 5CPKD 5AVCA 4Z66B 3AZGA 4J8VD 1P3PA 2BYKA 5B0YA 2FJ7B 4J8VC 2NQBD 1P3IA 4XUJB 3X1SB 3B6FC 2NZDB 5CPJA 2NQBC 5CP6B 3KSYA 1S32A 3MGQA 1P3FD 4KUDA 2W8SA 3AN2A 4R8PC 5AY8D 1P3FC 1U35D 3WAAC 2PYOC 3REJD 1U35C 1ID3A 5DNNB 3REJC 1TAFA 3W96C 4UPKA 1ULYA 5B0ZA 2Y2HA 2ZY2A 4E45A 3UTBA 2L5AA 5B40A 5DNMC 3TU4C 4Z5TC 2CV5B 3UTAC 3LELD 5CPID 2J8PA 3WTPA 3O62D 1N1JA 5BT1D 3AYWA 1P34A 1HTAA 1KX3D 2Y2JA 1KX3C 3MGPD 1BH9B 2IO5C 2F8NG 1M18D 1B6WA 3B6FA 5B1LD 2BYMA 3R45A 3A6NA 5AV5D 1M18C 3AZHB 3AZEB 5B1LC 3AV1B 2VQRA 5B2IB 3W97D 1M1AA 1AOID 3AZNC 2YFWA 1P3GB 4LD9D 4XZQA 3W97C 3MNNA 3KWQA 1AOIC 5BO0B 3WAAA 2PYOA 5GT3A 3LZ0D 3WKJB 3LZ0C 2ZM5A 3W96A 2Y2QA 5BNXB 3X1UC 3AZLB 3W99B 4NE6A 3TU4A 1KX4D 4Z5TA 4KGCD 1HQ3D 4ZUXB 4KGCC 4H9QA 5B32C 5GXQA 4WV4B 5B24B 1ZLAD 5E5AA 3MGRA 4YM6D 1P3AC 1P3MA 3REHB 3LJAB 3W98D 1ZLAC 3AZJB 4YM6C 3AZGD 1P3PD 1Z2CB 4Z66A 3AZMB 5B0YD 5JRGB 5AVCC 3AZGC 1P3PC 4X23B 1P3ID 2JCHA 5B0YC 4XUJA 3X1SA 2NZDA 3AZFB 5CPJD 4HGAC 1S32D 3MGQD 3AZNA 4KUDD 4H9RB 3AN2D 1TZYB 1EQZB 5B1MB 3AZKB 1S32C 1P3GC 3WA9D 4WU9B 2Y2OA 5GSUC 4ZBJB 3AN2C 3X1VB 4EO5B 1P3OB 4H9SA 4NFTA 2HIOB 1ID3D 4Z2MG 4JJND 5DNNA 3MVDC 3X1UA 5B0ZD 3H0RC 5BNVA 1R4VA 3UTBD 5CPKB 5AVBC 3LZ1B 5B0ZC 5B40D 2XD5A 1F66B 3UTBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B B;  2CV5 A;  4G92 C;  5B31 B;  3WTP D;  4QLC B;  5B32 A;  5F99 B;  3AYW D;  3WTP C;  1P34 D;  1P3A A;  3REL B;  3VH6 A;  5B32 G;  5AV9 B;  3REI C;  4YS3 B;  5AY8 B;  1P34 C;  1H3O B;  1BH9 A;  4J8U B;  3B6F D;  3A6N D;  2HUE B;  3AZE A;  3A6N C;  3VH6 W;  5B2I A;  3AV1 A;  1P3L B;  1F1E A;  4R8P D;  5JA4 A;  4XZQ D;  1P3G A;  3MNN D;  3KWQ D;  3MGS B;  5GSU A;  3LEL B;  1M1A C;  3WAA D;  2PYO D;  5GT3 D;  4XZQ C;  5BO0 A;  5CPI B;  2F8N H;  4WU8 B;  3MNN C;  3O62 B;  3KWQ C;  5GT3 C;  2HIO C;  1M19 C;  3W96 D;  3MVD A;  5B33 C;  5BNX A;  3AZL A;  3W99 A;  5AVB A;  5DNM D;  3B6G B;  3KXB B;  3TU4 D;  1F66 C;  3MGP B;  4Z5T D;  3C1C C;  3UTA D;  4G91 B;  3V9R B;  3X1T B;  5AV5 B;  5B31 C;  3NQJ B;  5GXQ D;  5GT0 B;  4LD9 B;  1P3M D;  5GXQ C;  3REI A;  2ARO B;  3LJA A;  5E5A C;  5AV9 C;  3MGR C;  1P3M C;  5B2J C;  3AZJ A;  4Z66 D;  3AZM A;  5AV8 B;  4AWL C;  5JRG A;  3REK B;  4Z66 C;  4X23 A;  4XUJ D;  3X1S D;  3AV2 B;  2NZD D;  3AFA B;  3AZF A;  5KDM B;  5G49 B;  2HUE C;  4XUJ C;  3X1S C;  1Q9C A;  4J8X B;  2NZD C;  3AZN D;  1KX4 B;  5CP6 C;  4H9O B;  3AZI B;  3AZK A;  1HQ3 B;  3X1V A;  1P3O A;  2HIO A;  2YFV A;  1M19 A;  1JFI B;  4H9S C;  5DNN D;  5B33 A;  3X1U D;  3W98 B;  5DNN C;  3NQU A;  3UT9 B;  3LZ1 A;  1F66 A;  2FJ7 A;  3C1C A;  2CV5 D;  3C1B A;  1P3I B;  5FUG B;  4Z2M H;  5B31 A;  2CV5 C;  1P3B B;  5CPJ B;  4J8W B;  5C3I B;  4QLC A;  5B32 D;  5F99 A;  1P3A D;  4KUD B;  2RVQ C;  3REL A;  3WA9 B;  5AV9 A;  4YS3 A;  5B2J A;  1B67 A;  1KX5 B;  4UUZ B;  5AVC D;  1ID3 B;  1H3O A;  4JJN B;  4J8U A;  1TAF B;  4DRB A;  3KUY B;  3AZE D;  3AV1 D;  1A7W A;  5B2I D;  1P3L A;  5B40 B;  5CP6 A;  3AZH C;  3AZE C;  1P3G D;  3AV1 C;  5B2I C;  1P3K B;  5GSU D;  3MGS A;  4WU8 A;  1N1J B;  3B0D B;  5AV6 B;  3AYW B;  3WKJ C;  3MVD D;  1BFM A;  1BH8 B;  3W99 D;  3AZL D;  5AVB D;  3B0C W;  2F8N B;  3B6G A;  3VH6 T;  3KXB A;  3W99 C;  3AZL C;  4J8V B;  3B6F B;  3V9R A;  4CAY B;  2BYM B;  3X1T A;  4KHA B;  2NQB B;  4J8W C;  4ZUX C;  3NQJ A;  2YFW B;  4R8P B;  5GT0 A;  3REI D;  3LJA D;  5B24 C;  1P3F B;  2ARO A;  3WAA B;  2PYO B;  3AZJ D;  3REH C;  3LJA C;  4WNN B;  3AZM D;  1U35 B;  5AV8 A;  5JRG D;  3AZJ C;  3REJ B;  3REK A;  4X23 D;  3AZM C;  3W96 B;  5JRG C;  3AV2 A;  4X23 C;  3AFA A;  1WWI A;  3AZF D;  5KDM A;  5G49 A;  5DNM B;  4J8X A;  3AZF C;  3AZH A;  3TU4 B;  4Z5T B;  3UTA B;  4H9O A;  1M1A D;  3AZK D;  3AZI A;  1HQ3 A;  3VH5 W;  3X1V D;  1TZY C;  1EQZ C;  5B1M C;  3AZK C;  1P3O D;  2HIO D;  4WU9 C;  3X1V C;  1M19 D;  4ZBJ C;  3WKJ A;  4EO5 C;  1P3O C;  5B33 D;  1JFI A;  4H9N B;  1KX3 B;  3LZ1 D;  1F66 D;  2LY8 A;  3UT9 A;  2FJ7 D;  3C1C D;  5CPK C;  2IO5 B;  3C1B D;  3LZ1 C;  2FJ7 C;  5FUG A;  5B31 D;  1M18 B;  3WTP E;  3C1B C;  5B1L B;  1P3B A;  4QLC D;  1WWS A;  4ZUX A;  4J8W A;  2F8N K;  5F99 D;  3AZN B;  4M6B A;  4QLC C;  3REL D;  3W97 B;  5F99 C;  5B24 A;  1AOI B;  5E5A D;  5AV9 D;  4YS3 D;  3MGR D;  5B2J D;  3WA9 A;  4NE5 A;  3REH A;  3REL C;  1KX5 A;  4UUZ A;  4H9P B;  4YS3 C;  3LZ0 B;  5AY8 C;  2JSS A;  4J8U D;  4JJN A;  3X1U B;  5BNV B;  4J8U C;  4CSR B;  5BS7 C;  3KUY A;  1P3L D;  5CP6 D;  1P3L C;  1P3K A;  3MGS D;  4H9R A;  1TZY A;  1EQZ A;  5B1M A;  4KGC B;  4E44 A;  4WU8 D;  3MGS C;  5B32 B;  3LEL C;  4WU9 A;  5CPI C;  5AV6 A;  3O62 C;  4WU8 C;  1P3A B;  3B0B A;  1BH8 A;  1ZLA B;  5BT1 C;  4YM6 B;  2F8N A;  3B6G D;  5AVC B;  3KXB D;  5CPK A;  3AZG B;  1P3P B;  4J8V A;  2BYK B;  3B6G C;  5B0Y B;  3KXB C;  3MGP C;  4CAY A;  3X1T D;  4KHA A;  4HGA B;  2NQB A;  4G91 C;  3X1T C;  5AV5 C;  2RVQ D;  5GT0 D;  5JA4 B;  4R8P A;  1S32 B;  5B31 G;  5CHL B;  3MGQ B;  2ARO D;  5GSU B;  3AN2 B;  1P3F A;  5GT0 C;  4LD9 C;  3B0C T;  2ARO C;  4WNN A;  5AY8 A;  5AV8 D;  1U35 A;  3REK D;  3REJ A;  3MVD B;  5AV8 C;  3AV2 D;  3REK C;  3AFA D;  5BS7 A;  5AVB B;  5B0Z B;  3AV2 C;  5DNM A;  4J8X D;  3UTB B;  3AZH D;  3AFA C;  3UTA A;  3AZI D;  4J8X C;  4G92 B;  1KX4 C;  3AZI C;  3LEL A;  1HQ3 C;  5CPI A;  3WTP B;  3WKJ D;  2CWE A;  3O62 A;  3REI B;  1P34 B;  4H9N A;  1KX3 A;  3UT9 D;  3W98 C;  3UT9 C;  3MGP A;  3VH5 T;  1M18 A;  1P3B D;  3R45 B;  5B1L A;  4ZUX D;  3A6N B;  4J8W D;  1P3I C;  5AV5 A;  1P3B C;  5CPJ C;  5C3I C;  5B24 D;  3W97 A;  1M1A B;  1AOI A;  3MGQ C;  4LD9 A;  4XZQ B;  4KUD C;  3REH D;  1KX5 D;  3MNN B;  3KWQ B;  3WA9 C;  4H9P A;  5GT3 B;  2YFV B;  3LZ0 A;  1M19 B;  1KX5 C;  4NE3 A;  3VH5 A;  5B33 B;  1ID3 C;  4JJN C;  4DRA A;  3KUY D;  4CSR A;  3NQU B;  3C1C B;  3KUY C;  1P3K D;  5B40 C;  1KX4 A;  1TZY D;  1EQZ D;  1KU5 A;  5B1M D;  1P3K C;  4KGC A;  4WU9 D;  5AV6 D;  4H9Q B;  4WZS B;  5GXQ B;  3B0D C;  5AV6 C;  3AYW C;  5E5A B;  3MGR B;  1P3M B;  1ZLA A;  5B2J B;  4YM6 A;  2F8N D;  3W98 A;  4AWL B;  5CPK D;  5AVC A;  4Z66 B;  3AZG A;  4J8V D;  1P3P A;  2BYK A;  5B0Y A;  4J8V C;  2NQB D;  1P3I A;  4XUJ B;  3X1S B;  3B6F C;  2NZD B;  5CPJ A;  2NQB C;  5CP6 B;  3KSY A;  1S32 A;  3MGQ A;  1P3F D;  4KUD A;  3AN2 A;  4R8P C;  5AY8 D;  1P3F C;  1U35 D;  3WAA C;  2PYO C;  3REJ D;  1U35 C;  1ID3 A;  5DNN B;  3REJ C;  1TAF A;  3W96 C;  1ULY A;  5B0Z A;  4E45 A;  3UTB A;  2L5A A;  5B40 A;  5DNM C;  3TU4 C;  4Z5T C;  2CV5 B;  3UTA C;  3LEL D;  5CPI D;  3WTP A;  3O62 D;  1N1J A;  5BT1 D;  3AYW A;  1P34 A;  1HTA A;  1KX3 D;  1KX3 C;  3MGP D;  1BH9 B;  2IO5 C;  2F8N G;  1M18 D;  1B6W A;  3B6F A;  5B1L D;  2BYM A;  3R45 A;  3A6N A;  5AV5 D;  1M18 C;  3AZH B;  3AZE B;  5B1L C;  3AV1 B;  5B2I B;  3W97 D;  1M1A A;  1AOI D;  3AZN C;  2YFW A;  1P3G B;  4LD9 D;  4XZQ A;  3W97 C;  3MNN A;  3KWQ A;  1AOI C;  5BO0 B;  3WAA A;  2PYO A;  5GT3 A;  3LZ0 D;  3WKJ B;  3LZ0 C;  3W96 A;  5BNX B;  3X1U C;  3AZL B;  3W99 B;  4NE6 A;  3TU4 A;  1KX4 D;  4Z5T A;  4KGC D;  1HQ3 D;  4ZUX B;  4KGC C;  4H9Q A;  5B32 C;  5GXQ A;  4WV4 B;  5B24 B;  1ZLA D;  5E5A A;  3MGR A;  4YM6 D;  1P3A C;  1P3M A;  3REH B;  3LJA B;  3W98 D;  1ZLA C;  3AZJ B;  4YM6 C;  3AZG D;  1P3P D;  4Z66 A;  3AZM B;  5B0Y D;  5JRG B;  5AVC C;  3AZG C;  1P3P C;  4X23 B;  1P3I D;  5B0Y C;  4XUJ A;  3X1S A;  2NZD A;  3AZF B;  5CPJ D;  4HGA C;  1S32 D;  3MGQ D;  3AZN A;  4KUD D;  4H9R B;  3AN2 D;  1TZY B;  1EQZ B;  5B1M B;  3AZK B;  1S32 C;  1P3G C;  3WA9 D;  4WU9 B;  5GSU C;  3AN2 C;  4ZBJ B;  3X1V B;  4EO5 B;  1P3O B;  4H9S A;  4NFT A;  2HIO B;  1ID3 D;  4Z2M G;  4JJN D;  5DNN A;  3MVD C;  3X1U A;  5B0Z D;  5BNV A;  1R4V A;  3UTB D;  5CPK B;  5AVB C;  3LZ1 B;  5B0Z C;  5B40 D;  1F66 B;  2FJ7 B;  3UTB C; 
#chains in the Genus database with same CATH topology
 3C1B B;  2CV5 A;  4G92 C;  5B31 B;  2BG1 A;  3WTP D;  4QLC B;  5B32 A;  5F99 B;  3AYW D;  3WTP C;  1P34 D;  1P3A A;  3REL B;  3VH6 A;  5B32 G;  5AV9 B;  3REI C;  4YS3 B;  2DQN C;  5AY8 B;  1P34 C;  1H3O B;  1BH9 A;  4J8U B;  3B6F D;  3A6N D;  3EPL A;  2HUE B;  2UWX A;  3AZE A;  3A6N C;  3VH6 W;  5B2I A;  3AV1 A;  1P3L B;  2Y2N A;  1F1E A;  4R8P D;  5JA4 A;  4XZQ D;  1P3G A;  3EPK A;  3MNN D;  3KWQ D;  3MGS B;  5GSU A;  3LEL B;  1M1A C;  3EPH A;  3WAA D;  2PYO D;  5GT3 D;  4XZQ C;  5BO0 A;  5CPI B;  2F8N H;  4WU8 B;  3MNN C;  3O62 B;  3KWQ C;  5GT3 C;  2HIO C;  1M19 C;  3W96 D;  2Y2P A;  3MVD A;  5B33 C;  5BNX A;  3EPJ A;  3AZL A;  5AVB A;  3W99 A;  5DNM D;  3B6G B;  3KXB B;  3TU4 D;  1F66 C;  3MGP B;  4Z5T D;  3C1C C;  3UTA D;  3IP4 C;  4G91 B;  3V9R B;  3X1T B;  5AV5 B;  5B31 C;  3EG5 B;  2XD1 A;  3A1K A;  3FDD A;  3NQJ B;  5GXQ D;  2Y2G A;  5GT0 B;  4LD9 B;  1P3M D;  5GXQ C;  3REI A;  2ARO B;  3LJA A;  2Y2I A;  5E5A C;  5AV9 C;  3MGR C;  1P3M C;  5B2J C;  2G5I C;  3AZJ A;  4Z66 D;  3AZM A;  5AV8 B;  2ZY4 A;  4AWL C;  5JRG A;  3REK B;  4Z66 C;  4X23 A;  4XUJ D;  3X1S D;  3AV2 B;  2NZD D;  3AFA B;  3AZF A;  5KDM B;  5G49 B;  2HUE C;  4XUJ C;  3X1S C;  1Q9C A;  4J8X B;  2NZD C;  3AZN D;  1KX4 B;  2DF4 C;  5CP6 C;  4H9O B;  2Y2M A;  2Y2K A;  3AZI B;  3AZK A;  1HQ3 B;  3X1V A;  1P3O A;  2HIO A;  2YFV A;  1M19 A;  1JFI B;  4H9S C;  5DNN D;  5B33 A;  3X1U D;  3W98 B;  5DNN C;  3NQU A;  3UT9 B;  1T3U A;  3LZ1 A;  1F66 A;  2FJ7 A;  3C1C A;  2CV5 D;  3C1B A;  1P3I B;  5FUG B;  4Z2M H;  5B31 A;  2CV5 C;  4DQY B;  5CPJ B;  4J8W B;  1P3B B;  5C3I B;  4QLC A;  5B32 D;  5F99 A;  1P3A D;  4KUD B;  2RVQ C;  3REL A;  3WA9 B;  5AV9 A;  4YS3 A;  5B2J A;  1B67 A;  1KX5 B;  4UUZ B;  5AVC D;  1ID3 B;  1H3O A;  4JJN B;  4J8U A;  1TAF B;  4DRB A;  2JE5 A;  3KUY B;  3AZE D;  3AV1 D;  1A7W A;  5B2I D;  1P3L A;  5B40 B;  5CP6 A;  3AZH C;  3AZE C;  1P3G D;  3AV1 C;  5B2I C;  1P3K B;  5GSU D;  3MGS A;  2F2A C;  4WU8 A;  1N1J B;  3B0D B;  5AV6 B;  3AYW B;  3WKJ C;  3MVD D;  1BFM A;  3H0L C;  1BH8 B;  3W99 D;  3AZL D;  5AVB D;  3B0C W;  2F8N B;  3B6G A;  3VH6 T;  3KXB A;  3W99 C;  3AZL C;  4J8V B;  3B6F B;  3V9R A;  4CAY B;  2BYM B;  3X1T A;  4KHA B;  2NQB B;  4J8W C;  4ZUX C;  3NQJ A;  2YFW B;  4R8P B;  5GT0 A;  3REI D;  3LJA D;  5B24 C;  1P3F B;  2ARO A;  3WAA B;  2PYO B;  3AZJ D;  2RIQ A;  3REH C;  3LJA C;  4WNN B;  3AZM D;  1U35 B;  5AV8 A;  5JRG D;  3AZJ C;  3REJ B;  3REK A;  4X23 D;  3AZM C;  3W96 B;  5JRG C;  3AV2 A;  4X23 C;  3AFA A;  1WWI A;  3AZF D;  5KDM A;  1PZR A;  5G49 A;  5DNM B;  4J8X A;  2Y2L A;  3AZF C;  3AZH A;  3TU4 B;  4Z5T B;  3UTA B;  4H9O A;  1M1A D;  3AZK D;  3AZI A;  1HQ3 A;  3VH5 W;  3X1V D;  1TZY C;  1EQZ C;  5B1M C;  3AZK C;  1P3O D;  2HIO D;  4WU9 C;  3X1V C;  1M19 D;  4ZBJ C;  3WKJ A;  3P5J B;  4EO5 C;  1P3O C;  5B33 D;  1JFI A;  4H9N B;  1KX3 B;  3LZ1 D;  1F66 D;  2LY8 A;  3UT9 A;  2FJ7 D;  3C1C D;  5CPK C;  2IO5 B;  3C1B D;  3LZ1 C;  2G5H C;  2ZY3 A;  2FJ7 C;  5FUG A;  5B31 D;  1M18 B;  3WTP E;  3C1B C;  5B1L B;  1P3B A;  4QLC D;  1WWS A;  4ZUX A;  4J8W A;  2F8N K;  5F99 D;  3AZN B;  4M6B A;  4QLC C;  3REL D;  3W97 B;  5F99 C;  5B24 A;  1AOI B;  5E5A D;  5AV9 D;  4YS3 D;  3MGR D;  5B2J D;  3WA9 A;  4NE5 A;  3REH A;  3REL C;  1KX5 A;  4UUZ A;  4H9P B;  4YS3 C;  3LZ0 B;  5AY8 C;  2JSS A;  4J8U D;  4JJN A;  3X1U B;  5BNV B;  4J8U C;  4CSR B;  5BS7 C;  3KUY A;  1P3L D;  5CP6 D;  1P3L C;  1P3K A;  3MGS D;  4H9R A;  1TZY A;  1EQZ A;  5B1M A;  4KGC B;  4E44 A;  4WU8 D;  3MGS C;  5B32 B;  3LEL C;  4WU9 A;  5CPI C;  5AV6 A;  3O62 C;  4WU8 C;  1P3A B;  3B0B A;  1BH8 A;  1ZLA B;  5BT1 C;  4YM6 B;  3KFU G;  2F8N A;  3B6G D;  5AVC B;  3KXB D;  5CPK A;  1W2E A;  3AZG B;  1P3P B;  4J8V A;  2BYK B;  3B6G C;  5B0Y B;  3KXB C;  4WJ3 C;  3MGP C;  4CAY A;  3X1T D;  4KHA A;  2FFF B;  4HGA B;  2NQB A;  4G91 C;  3X1T C;  3H0M C;  5AV5 C;  2RVQ D;  5GT0 D;  5JA4 B;  4R8P A;  1S32 B;  5B31 G;  5CHL B;  3MGQ B;  2ARO D;  5GSU B;  3AN2 B;  1P3F A;  5GT0 C;  4LD9 C;  3B0C T;  2ARO C;  4WNN A;  2ZY5 A;  5AY8 A;  5AV8 D;  1U35 A;  3REK D;  3REJ A;  3MVD B;  5AV8 C;  3AV2 D;  3REK C;  3AFA D;  5BS7 A;  5AVB B;  5B0Z B;  3AV2 C;  5DNM A;  4J8X D;  3UTB B;  3AZH D;  3AFA C;  3UTA A;  3AZI D;  4J8X C;  4G92 B;  1KX4 C;  3AZI C;  3LEL A;  1HQ3 C;  5CPI A;  3WTP B;  3WKJ D;  2CWE A;  3O62 A;  3REI B;  1P34 B;  4H9N A;  1KX3 A;  3UT9 D;  3W98 C;  3UT9 C;  3MGP A;  3VH5 T;  1M18 A;  1P3B D;  3R45 B;  5B1L A;  4ZUX D;  3A6N B;  4J8W D;  1P3I C;  5AV5 A;  3F6T A;  1P3B C;  5CPJ C;  5C3I C;  5B24 D;  3W97 A;  1M1A B;  1AOI A;  3MGQ C;  4LD9 A;  4XZQ B;  4KUD C;  3REH D;  1KX5 D;  3MNN B;  3KWQ B;  3WA9 C;  4H9P A;  5GT3 B;  2YFV B;  3LZ0 A;  1M19 B;  1KX5 C;  4NE3 A;  3VH5 A;  5B33 B;  1ID3 C;  4JJN C;  4DRA A;  3KUY D;  4CSR A;  3NQU B;  3C1C B;  3KUY C;  1P3K D;  5B40 C;  1KX4 A;  1TZY D;  1EQZ D;  1KU5 A;  5B1M D;  1P3K C;  4KGC A;  4WU9 D;  5AV6 D;  4H9Q B;  4WZS B;  3AL0 C;  5GXQ B;  3B0D C;  5AV6 C;  3AYW C;  5E5A B;  3MGR B;  1P3M B;  1ZLA A;  5B2J B;  4YM6 A;  2F8N D;  3W98 A;  3A1I A;  4AWL B;  5CPK D;  5AVC A;  4Z66 B;  3AZG A;  4J8V D;  1P3P A;  2BYK A;  5B0Y A;  2FJ7 B;  4J8V C;  2NQB D;  1P3I A;  4XUJ B;  3X1S B;  3B6F C;  2NZD B;  5CPJ A;  2NQB C;  5CP6 B;  3KSY A;  1S32 A;  3MGQ A;  1P3F D;  4KUD A;  2W8S A;  3AN2 A;  4R8P C;  5AY8 D;  1P3F C;  1U35 D;  3WAA C;  2PYO C;  3REJ D;  1U35 C;  1ID3 A;  5DNN B;  3REJ C;  1TAF A;  3W96 C;  4UPK A;  1ULY A;  5B0Z A;  2Y2H A;  2ZY2 A;  4E45 A;  3UTB A;  2L5A A;  5B40 A;  5DNM C;  3TU4 C;  4Z5T C;  2CV5 B;  3UTA C;  3LEL D;  5CPI D;  2J8P A;  3WTP A;  3O62 D;  1N1J A;  5BT1 D;  3AYW A;  1P34 A;  1HTA A;  1KX3 D;  2Y2J A;  1KX3 C;  3MGP D;  1BH9 B;  2IO5 C;  2F8N G;  1M18 D;  1B6W A;  3B6F A;  5B1L D;  2BYM A;  3R45 A;  3A6N A;  5AV5 D;  1M18 C;  3AZH B;  3AZE B;  5B1L C;  3AV1 B;  2VQR A;  5B2I B;  3W97 D;  1M1A A;  1AOI D;  3AZN C;  2YFW A;  1P3G B;  4LD9 D;  4XZQ A;  3W97 C;  3MNN A;  3KWQ A;  1AOI C;  5BO0 B;  3WAA A;  2PYO A;  5GT3 A;  3LZ0 D;  3WKJ B;  3LZ0 C;  2ZM5 A;  3W96 A;  2Y2Q A;  5BNX B;  3X1U C;  3AZL B;  3W99 B;  4NE6 A;  3TU4 A;  1KX4 D;  4Z5T A;  4KGC D;  1HQ3 D;  4ZUX B;  4KGC C;  4H9Q A;  5B32 C;  5GXQ A;  4WV4 B;  5B24 B;  1ZLA D;  5E5A A;  3MGR A;  4YM6 D;  1P3A C;  1P3M A;  3REH B;  3LJA B;  3W98 D;  1ZLA C;  3AZJ B;  4YM6 C;  3AZG D;  1P3P D;  1Z2C B;  4Z66 A;  3AZM B;  5B0Y D;  5JRG B;  5AVC C;  3AZG C;  1P3P C;  4X23 B;  1P3I D;  2JCH A;  5B0Y C;  4XUJ A;  3X1S A;  2NZD A;  3AZF B;  5CPJ D;  4HGA C;  1S32 D;  3MGQ D;  3AZN A;  4KUD D;  4H9R B;  3AN2 D;  1TZY B;  1EQZ B;  5B1M B;  3AZK B;  1S32 C;  1P3G C;  3WA9 D;  4WU9 B;  2Y2O A;  5GSU C;  4ZBJ B;  3AN2 C;  3X1V B;  4EO5 B;  1P3O B;  4H9S A;  4NFT A;  2HIO B;  1ID3 D;  4Z2M G;  4JJN D;  5DNN A;  3MVD C;  3X1U A;  5B0Z D;  3H0R C;  5BNV A;  1R4V A;  3UTB D;  5CPK B;  5AVB C;  3LZ1 B;  5B0Z C;  5B40 D;  2XD5 A;  1F66 B;  3UTB C; 
#chains in the Genus database with same CATH homology
 3C1B B;  2CV5 A;  4G92 C;  5B31 B;  2BG1 A;  3WTP D;  4QLC B;  5B32 A;  5F99 B;  3AYW D;  3WTP C;  1P34 D;  1P3A A;  3REL B;  3VH6 A;  5B32 G;  5AV9 B;  3REI C;  4YS3 B;  2DQN C;  5AY8 B;  1P34 C;  1H3O B;  1BH9 A;  4J8U B;  3B6F D;  3A6N D;  3EPL A;  2HUE B;  2UWX A;  3AZE A;  3A6N C;  3VH6 W;  5B2I A;  3AV1 A;  1P3L B;  2Y2N A;  1F1E A;  4R8P D;  5JA4 A;  4XZQ D;  1P3G A;  3EPK A;  3MNN D;  3KWQ D;  3MGS B;  5GSU A;  3LEL B;  1M1A C;  3EPH A;  3WAA D;  2PYO D;  5GT3 D;  4XZQ C;  5BO0 A;  5CPI B;  2F8N H;  4WU8 B;  3MNN C;  3O62 B;  3KWQ C;  5GT3 C;  2HIO C;  1M19 C;  3W96 D;  2Y2P A;  3MVD A;  5B33 C;  5BNX A;  3EPJ A;  3AZL A;  5AVB A;  3W99 A;  5DNM D;  3B6G B;  3KXB B;  3TU4 D;  1F66 C;  3MGP B;  4Z5T D;  3C1C C;  3UTA D;  3IP4 C;  4G91 B;  3V9R B;  3X1T B;  5AV5 B;  5B31 C;  3EG5 B;  2XD1 A;  3A1K A;  3FDD A;  3NQJ B;  5GXQ D;  2Y2G A;  5GT0 B;  4LD9 B;  1P3M D;  5GXQ C;  3REI A;  2ARO B;  3LJA A;  2Y2I A;  5E5A C;  5AV9 C;  3MGR C;  1P3M C;  5B2J C;  2G5I C;  3AZJ A;  4Z66 D;  3AZM A;  5AV8 B;  2ZY4 A;  4AWL C;  5JRG A;  3REK B;  4Z66 C;  4X23 A;  4XUJ D;  3X1S D;  3AV2 B;  2NZD D;  3AFA B;  3AZF A;  5KDM B;  5G49 B;  2HUE C;  4XUJ C;  3X1S C;  1Q9C A;  4J8X B;  2NZD C;  3AZN D;  1KX4 B;  2DF4 C;  5CP6 C;  4H9O B;  2Y2M A;  2Y2K A;  3AZI B;  3AZK A;  1HQ3 B;  3X1V A;  1P3O A;  2HIO A;  2YFV A;  1M19 A;  1JFI B;  4H9S C;  5DNN D;  5B33 A;  3X1U D;  3W98 B;  5DNN C;  3NQU A;  3UT9 B;  1T3U A;  3LZ1 A;  1F66 A;  2FJ7 A;  3C1C A;  2CV5 D;  3C1B A;  1P3I B;  5FUG B;  4Z2M H;  5B31 A;  2CV5 C;  4DQY B;  5CPJ B;  4J8W B;  1P3B B;  5C3I B;  4QLC A;  5B32 D;  5F99 A;  1P3A D;  4KUD B;  2RVQ C;  3REL A;  3WA9 B;  5AV9 A;  4YS3 A;  5B2J A;  1B67 A;  1KX5 B;  4UUZ B;  5AVC D;  1ID3 B;  1H3O A;  4JJN B;  4J8U A;  1TAF B;  4DRB A;  2JE5 A;  3KUY B;  3AZE D;  3AV1 D;  1A7W A;  5B2I D;  1P3L A;  5B40 B;  5CP6 A;  3AZH C;  3AZE C;  1P3G D;  3AV1 C;  5B2I C;  1P3K B;  5GSU D;  3MGS A;  2F2A C;  4WU8 A;  1N1J B;  3B0D B;  5AV6 B;  3AYW B;  3WKJ C;  3MVD D;  1BFM A;  3H0L C;  1BH8 B;  3W99 D;  3AZL D;  5AVB D;  3B0C W;  2F8N B;  3B6G A;  3VH6 T;  3KXB A;  3W99 C;  3AZL C;  4J8V B;  3B6F B;  3V9R A;  4CAY B;  2BYM B;  3X1T A;  4KHA B;  2NQB B;  4J8W C;  4ZUX C;  3NQJ A;  2YFW B;  4R8P B;  5GT0 A;  3REI D;  3LJA D;  5B24 C;  1P3F B;  2ARO A;  3WAA B;  2PYO B;  3AZJ D;  2RIQ A;  3REH C;  3LJA C;  4WNN B;  3AZM D;  1U35 B;  5AV8 A;  5JRG D;  3AZJ C;  3REJ B;  3REK A;  4X23 D;  3AZM C;  3W96 B;  5JRG C;  3AV2 A;  4X23 C;  3AFA A;  1WWI A;  3AZF D;  5KDM A;  1PZR A;  5G49 A;  5DNM B;  4J8X A;  2Y2L A;  3AZF C;  3AZH A;  3TU4 B;  4Z5T B;  3UTA B;  4H9O A;  1M1A D;  3AZK D;  3AZI A;  1HQ3 A;  3VH5 W;  3X1V D;  1TZY C;  1EQZ C;  5B1M C;  3AZK C;  1P3O D;  2HIO D;  4WU9 C;  3X1V C;  1M19 D;  4ZBJ C;  3WKJ A;  3P5J B;  4EO5 C;  1P3O C;  5B33 D;  1JFI A;  4H9N B;  1KX3 B;  3LZ1 D;  1F66 D;  2LY8 A;  3UT9 A;  2FJ7 D;  3C1C D;  5CPK C;  2IO5 B;  3C1B D;  3LZ1 C;  2G5H C;  2ZY3 A;  2FJ7 C;  5FUG A;  5B31 D;  1M18 B;  3WTP E;  3C1B C;  5B1L B;  1P3B A;  4QLC D;  1WWS A;  4ZUX A;  4J8W A;  2F8N K;  5F99 D;  3AZN B;  4M6B A;  4QLC C;  3REL D;  3W97 B;  5F99 C;  5B24 A;  1AOI B;  5E5A D;  5AV9 D;  4YS3 D;  3MGR D;  5B2J D;  3WA9 A;  4NE5 A;  3REH A;  3REL C;  1KX5 A;  4UUZ A;  4H9P B;  4YS3 C;  3LZ0 B;  5AY8 C;  2JSS A;  4J8U D;  4JJN A;  3X1U B;  5BNV B;  4J8U C;  4CSR B;  5BS7 C;  3KUY A;  1P3L D;  5CP6 D;  1P3L C;  1P3K A;  3MGS D;  4H9R A;  1TZY A;  1EQZ A;  5B1M A;  4KGC B;  4E44 A;  4WU8 D;  3MGS C;  5B32 B;  3LEL C;  4WU9 A;  5CPI C;  5AV6 A;  3O62 C;  4WU8 C;  1P3A B;  3B0B A;  1BH8 A;  1ZLA B;  5BT1 C;  4YM6 B;  3KFU G;  2F8N A;  3B6G D;  5AVC B;  3KXB D;  5CPK A;  1W2E A;  3AZG B;  1P3P B;  4J8V A;  2BYK B;  3B6G C;  5B0Y B;  3KXB C;  4WJ3 C;  3MGP C;  4CAY A;  3X1T D;  4KHA A;  2FFF B;  4HGA B;  2NQB A;  4G91 C;  3X1T C;  3H0M C;  5AV5 C;  2RVQ D;  5GT0 D;  5JA4 B;  4R8P A;  1S32 B;  5B31 G;  5CHL B;  3MGQ B;  2ARO D;  5GSU B;  3AN2 B;  1P3F A;  5GT0 C;  4LD9 C;  3B0C T;  2ARO C;  4WNN A;  2ZY5 A;  5AY8 A;  5AV8 D;  1U35 A;  3REK D;  3REJ A;  3MVD B;  5AV8 C;  3AV2 D;  3REK C;  3AFA D;  5BS7 A;  5AVB B;  5B0Z B;  3AV2 C;  5DNM A;  4J8X D;  3UTB B;  3AZH D;  3AFA C;  3UTA A;  3AZI D;  4J8X C;  4G92 B;  1KX4 C;  3AZI C;  3LEL A;  1HQ3 C;  5CPI A;  3WTP B;  3WKJ D;  2CWE A;  3O62 A;  3REI B;  1P34 B;  4H9N A;  1KX3 A;  3UT9 D;  3W98 C;  3UT9 C;  3MGP A;  3VH5 T;  1M18 A;  1P3B D;  3R45 B;  5B1L A;  4ZUX D;  3A6N B;  4J8W D;  1P3I C;  5AV5 A;  3F6T A;  1P3B C;  5CPJ C;  5C3I C;  5B24 D;  3W97 A;  1M1A B;  1AOI A;  3MGQ C;  4LD9 A;  4XZQ B;  4KUD C;  3REH D;  1KX5 D;  3MNN B;  3KWQ B;  3WA9 C;  4H9P A;  5GT3 B;  2YFV B;  3LZ0 A;  1M19 B;  1KX5 C;  4NE3 A;  3VH5 A;  5B33 B;  1ID3 C;  4JJN C;  4DRA A;  3KUY D;  4CSR A;  3NQU B;  3C1C B;  3KUY C;  1P3K D;  5B40 C;  1KX4 A;  1TZY D;  1EQZ D;  1KU5 A;  5B1M D;  1P3K C;  4KGC A;  4WU9 D;  5AV6 D;  4H9Q B;  4WZS B;  3AL0 C;  5GXQ B;  3B0D C;  5AV6 C;  3AYW C;  5E5A B;  3MGR B;  1P3M B;  1ZLA A;  5B2J B;  4YM6 A;  2F8N D;  3W98 A;  3A1I A;  4AWL B;  5CPK D;  5AVC A;  4Z66 B;  3AZG A;  4J8V D;  1P3P A;  2BYK A;  5B0Y A;  2FJ7 B;  4J8V C;  2NQB D;  1P3I A;  4XUJ B;  3X1S B;  3B6F C;  2NZD B;  5CPJ A;  2NQB C;  5CP6 B;  3KSY A;  1S32 A;  3MGQ A;  1P3F D;  4KUD A;  2W8S A;  3AN2 A;  4R8P C;  5AY8 D;  1P3F C;  1U35 D;  3WAA C;  2PYO C;  3REJ D;  1U35 C;  1ID3 A;  5DNN B;  3REJ C;  1TAF A;  3W96 C;  4UPK A;  1ULY A;  5B0Z A;  2Y2H A;  2ZY2 A;  4E45 A;  3UTB A;  2L5A A;  5B40 A;  5DNM C;  3TU4 C;  4Z5T C;  2CV5 B;  3UTA C;  3LEL D;  5CPI D;  2J8P A;  3WTP A;  3O62 D;  1N1J A;  5BT1 D;  3AYW A;  1P34 A;  1HTA A;  1KX3 D;  2Y2J A;  1KX3 C;  3MGP D;  1BH9 B;  2IO5 C;  2F8N G;  1M18 D;  1B6W A;  3B6F A;  5B1L D;  2BYM A;  3R45 A;  3A6N A;  5AV5 D;  1M18 C;  3AZH B;  3AZE B;  5B1L C;  3AV1 B;  2VQR A;  5B2I B;  3W97 D;  1M1A A;  1AOI D;  3AZN C;  2YFW A;  1P3G B;  4LD9 D;  4XZQ A;  3W97 C;  3MNN A;  3KWQ A;  1AOI C;  5BO0 B;  3WAA A;  2PYO A;  5GT3 A;  3LZ0 D;  3WKJ B;  3LZ0 C;  2ZM5 A;  3W96 A;  2Y2Q A;  5BNX B;  3X1U C;  3AZL B;  3W99 B;  4NE6 A;  3TU4 A;  1KX4 D;  4Z5T A;  4KGC D;  1HQ3 D;  4ZUX B;  4KGC C;  4H9Q A;  5B32 C;  5GXQ A;  4WV4 B;  5B24 B;  1ZLA D;  5E5A A;  3MGR A;  4YM6 D;  1P3A C;  1P3M A;  3REH B;  3LJA B;  3W98 D;  1ZLA C;  3AZJ B;  4YM6 C;  3AZG D;  1P3P D;  1Z2C B;  4Z66 A;  3AZM B;  5B0Y D;  5JRG B;  5AVC C;  3AZG C;  1P3P C;  4X23 B;  1P3I D;  2JCH A;  5B0Y C;  4XUJ A;  3X1S A;  2NZD A;  3AZF B;  5CPJ D;  4HGA C;  1S32 D;  3MGQ D;  3AZN A;  4KUD D;  4H9R B;  3AN2 D;  1TZY B;  1EQZ B;  5B1M B;  3AZK B;  1S32 C;  1P3G C;  3WA9 D;  4WU9 B;  2Y2O A;  5GSU C;  4ZBJ B;  3AN2 C;  3X1V B;  4EO5 B;  1P3O B;  4H9S A;  4NFT A;  2HIO B;  1ID3 D;  4Z2M G;  4JJN D;  5DNN A;  3MVD C;  3X1U A;  5B0Z D;  3H0R C;  5BNV A;  1R4V A;  3UTB D;  5CPK B;  5AVB C;  3LZ1 B;  5B0Z C;  5B40 D;  2XD5 A;  1F66 B;  3UTB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...