3MNND

A ruthenium antitumour agent forms specific histone protein adducts in the nucleosome core
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title A ruthenium antimetastasis agent forms specific histone protein adducts in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mnnD00
4XZQD 5GT0D 3AZGC 5DNNB 2NZDA 1KX5C 4HGAC 5KDMA 3B6FD 3RELD 5DNMB 5CPJB 2L5AA 2NZDC 3WAAD 3KXBA 2CV5A 1P3OB 3KUYA 1P3GA 5GT3D 5BNVA 3AYWB 1F66D 5B0YA 3REHD 4WZSB 2NQBA 4XUJD 3KXBC 2CV5C 4XZQA 5GT0A 2F8NH 3AZMD 3KUYC 4AWLB 4LD9C 3B6FA 4WU9D 3RELA 2HUEC 2NQBC 3TU4B 4XZQC 5GT0C 3REJA 5AV8B 1KX4D 3WAAA 5AY8B 3LZ1B 3UT9B 3B6FC 3LZ0D 3RELC 1F66A 2BYKA 3REHA 1S32D 3W98D 1HQ3A 2YFWB 1P3PD 1N1JA 5C3IB 3WAAC 3AZFA 3C1CD 5JA4A 3AZGB 3AZMA 3AZJD 1M1AD 1KX5B 5GT3C 5AV9D 4HGAB 1F66C 3REHC 1P3MD 3W96D 3NQJB 5BO0B 4XUJC 1P3LD 2AROD 3KWQB 3AZMC 1P3IA 1KX4A 4X23D 5F99D 3X1TD 5KDMB 1H3OA 4WU9C 3MGSD 1S32A 3W98A 3B0DC 4YS3D 1P3PA 1P3IC 5CP6D 3KXBB 3B0CT 3NQJA 4R8PD 2CV5B 1KX4C 3C1CA 4KUDA 3AZJA 4ZUXD 1P3GB 4DRAA 1M1AA 2F8ND 5BNVB 3WTPE 5B0YB 1S32C 4H9RA 3W98C 1P3PC 2BYMA 2HUEB 2NQBB 1P3MA 3W96A 1P3LA 4XZQB 5GT0B 3C1CC 4JJND 3AZKD 2AROA 3MNNA 3AZJC 5FUGA 1M1AC 4X23A 5F99A 5AV9C 3B6FB 3RELB 3MGSA 5AVCD 3X1UD 1P3MC 3W96C 1P3LC 4YS3A 2AROC 5B33D 3REJB 4X23C 5F99C 3B0BA 3X1TC 1KU5A 1WWIA 3AV1B 4ZUXA 2F8NA 1F66B 2BYKB 5GSUA 5B1MD 3MGSC 3REHB 1HTAA 1HQ3B 1U35D 4YS3C 1N1JB 5CP6C 4YM6D 3AZFB 4R8PC 5B32D 3AZKA 3AZMB 2HIOD 3X1VD 4ZUXC 1P34D 5BS7A 5E5AD 5AVCA 3X1UA 4JJNC 3AZKC 1P3IB 1KX4B 5AV6D 1H3OB 3WTPD 5BS7C 5B1MA 1S32B 5AVCC 3X1UC 3W98B 4NE6A 3W99D 5B40B 1P3PB 3AFAD 5B33C 4YM6A 3C1CB 5B32A 3AZID 4KUDB 3AZJB 2HIOA 3X1VA 1M1AB 3VH6W 5B1LD 1P34A 3UTAD 5B1MC 4H9RB 3NQUA 1U35C 2BYMB 5E5AA 1P3MB 3R45A 1AOID 3W96B 1P3LB 2YFVA 4YM6C 5B32C 2AROB 3MNNB 5FUGB 2HIOC 3X1VC 2IO5B 3AZND 1M18D 4LD9A 4X23B 5F99B 1Q9CA 1P34C 5AVBD 5AV6A 3MGQD 3WTPA 5E5AC 3MGSB 1TAFA 4YS3B 3W99A 3AFAA 3LJAD 1TZYD 5CPKD 3AZIA 2RVQD 5AV6C 4ZUXB 2F8NB 3AZED 5AV5D 3WTPC 5B1LA 3A6ND 5GSUB 3UTAA 1P3FD 4Z66D 4J8XD 3W99C 3AFAC 4QLCD 5B31D 1AOIA 5GT3A 3AZKB 3KSYA 3O62D 3AZIC 1M18A 3W97D 5BT1D 5B1LC 5AVBA 3UTAC 3AV2D 4XUJA 5JRGD 3MGQA 5AVCB 3X1UB 1AOIC 3AZHD 3LELD 3AZNC 1M18C 4WV4B 2CWEA 4WU9A 5AVBC 4DRBA 1ID3D 3AZEA 1KX3D 3MGQC 5AV5A 3A6NA 4CAYA 1EQZD 2NZDB 4Z66A 5B2JD 3LJAC 1TZYC 4YM6B 3UTBD 5CPKC 2F8NG 3LZ0A 3V9RA 3O62A 2HIOB 2RVQC 3AZLB 3X1VB 3AZEC 3W97A 5AV5C 4J8VD 5G49A 4H9OA 3A6NC 1P34B 3AV2A 3NQUB 1P3FC 1JFIA 4Z66C 5E5AB 5JRGA 4J8XC 1P3KD 2PYOD 3R45B 4QLCC 3KUYB 2YFVB 3AZHA 5B2ID 5AV9A 3O62C 3LZ0C 3VH6A 3LELA 4LD9B 4NFTA 3W97C 5BT1C 3REID 1M19D 5AV6B 3AV2C 1ID3A 2F8NK 4J8WD 1KX3A 3WTPB 5JRGC 1TAFB 1EQZA 3W99B 5B2JA 3AFAB 3AZHC 1A7WA 3LELC 3X1TA 3UTBA 3AZIB 3VH5A 1ID3C 3MGRD 1KX3C 5B1LB 4J8VA 4UUZA 3UTAB 1EQZC 3B6GD 5CP6A 5B24D 1P3KA 5B2JC 4Z5TD 4R8PA 3WAAB 5B32G 2PYOA 1AOIB 3UTBC 5GT3B 5AV8D 4H9PA 5B2IA 1M18B 3X1SD 4J8VC 5AVBB 3REIA 1M19A 4XUJB 3MGQB 4J8WA 1P3KC 1R4VA 5JA4B 2PYOC 4JJNA 5B2IC 4WU9B 3REIC 1M19C 4KGCD 3AZEB 4H9SA 3MGRA 3WKJD 3B0DB 5AV5B 4J8WC 3A6NB 4CAYB 2LY8A 5B33A 4Z66B 3B6GA 5B24A 4Z5TA 3AN2D 3KWQD 3MVDD 3MGPD 3LZ0B 3V9RB 3O62B 4H9SC 3MGRC 1U35A 3W97B 5G49B 1ULYA 4H9OB 3X1SA 3AV2B 2FJ7D 1JFIB 3B6GC 5B24C 4Z5TC 5B0ZD 5CPID 3AZHB 5AV9B 5AV8C 3LELB 4G91C 3X1SC 1P3GD 1ID3B 4KGCA 5B0YD 1KX3B 3WKJA 5GXQD 1BH9A 1EQZB 4ZBJC 3AN2A 3X1TB 3UTBB 3VH5W 3KWQA 3MVDA 3MGPA 3C1BD 4KGCC 3WKJC 4J8VB 4UUZB 4J8UD 2FJ7A 5B31G 5CP6B 1P3KB 3WA9D 4M6BA 4R8PB 2PYOB 4EO5C 3AN2C 4NE3A 5B0ZA 3KWQC 3REJD 3MVDC 3MGPC 5CPIA 4H9PB 5B2IB 3AV1D 3REIB 1M19B 2FJ7C 4J8WB 1HQ3D 5GXQA 4JJNB 5CPIC 5B0ZC 3AZNA 4H9QA 3AZFD 4H9NA 4NE5A 1B6WA 4WNNA 1P3GC 3C1BA 3MGRB 5B0YC 5GXQC 3LJAA 4J8UA 3REKD 5B33B 3B6GB 3WA9A 1TZYA 5B24B 5CPKA 4Z5TB 1P3BD 1P3ID 4WU8D 4Z2MH 1BH8A 3C1BC 5B1MB 4G91B 4G92C 1U35B 4CSRA 1P3AD 1P3FA 3X1SB 3AV1A 4J8XA 3AZLD 1ZLAD 4J8UC 4QLCA 5B31A 3WA9C 5DNND 5B32B 5B40D 3REJC 4ZBJB 4KUDD 3AV1C 5DNMD 4KGCB 5CHLB 4E44A 5CPJD 3WKJB 5B31C 1HQ3C 5BNXA 1BH9B 3REKA 1P3OD 1P3BA 4EO5B 3AZFC 3AN2B 3AYWD 3MNND 3MVDB 4WU8A 3MGPB 1BFMA 1P3AA 1B67A 3AZLA 4KHAA 1ZLAA 3REKC 2FJ7B 1F1EA 5DNNA 1P3BC 5B40A 5B0ZB 5CPIB 4WU8C 1P3AC 3AZLC 1ZLAC 5DNMA 4Z2MG 5GSUD 3TU4D 5CPJA 5GXQB 5DNNC 5B40C 5AY8D 3VH6T 3AZNB 4H9QB 3LZ1D 1P3OA 4H9NB 3UT9D 1WWSA 4WNNB 3AYWA 4KUDC 3C1BB 5DNMC 4G92B 5CPJC 3LJAB 4J8UB 3WA9B 1TZYB 5CPKB 3AZGD 1P3OC 1KX5D 3VH5T 3AYWC 3MNNC 1BH8B 2IO5C 1ZLAB 1P3FB 4CSRB 4J8XB 4E45A 3TU4A 4QLCB 5B31B 2NZDD 5AV8A 4AWLC 3B0CW 5AY8A 3LZ1A 3UT9A 5JRGB 2YFWA 3TU4C 5GSUC 5BNXB 3KXBD 3REKB 2CV5D 5AY8C 3AZGA 3KUYD 3LZ1C 1P3BB 1KX5A 3UT9C 4WU8B 4LD9D 2JSSA 1P3AB 2NQBD 5B2JB 4KHAB 5C3IC 5BO0A
chains in the Genus database with same CATH superfamily
4XZQD 5GT0D 2ZY4A 3AZGC 5DNNB 2NZDA 1KX5C 4HGAC 5KDMA 3B6FD 3RELD 2RIQA 5DNMB 5CPJB 2L5AA 2NZDC 3WAAD 3KXBA 2CV5A 1P3OB 3KUYA 1P3GA 5GT3D 3EPJA 5BNVA 3AYWB 1F66D 5B0YA 3REHD 2Y2OA 4WZSB 2NQBA 4XUJD 3KXBC 2CV5C 4XZQA 5GT0A 2F8NH 4WJ3C 3AZMD 3KUYC 4AWLB 3EG5B 4LD9C 3B6FA 4WU9D 3RELA 2HUEC 2NQBC 3TU4B 4XZQC 5GT0C 3REJA 5AV8B 1KX4D 2Y2GA 3WAAA 5AY8B 3LZ1B 3UT9B 3B6FC 3LZ0D 3RELC 1F66A 2BYKA 3REHA 1S32D 3W98D 1HQ3A 2YFWB 1P3PD 1N1JA 5C3IB 3WAAC 3AZFA 3C1CD 2VQRA 5JA4A 3AZGB 3AZMA 3AZJD 1M1AD 1KX5B 5GT3C 3H0MC 5AV9D 4HGAB 1F66C 2ZY5A 3REHC 3H0RC 1P3MD 3W96D 3NQJB 5BO0B 4XUJC 1P3LD 2AROD 3KWQB 3AZMC 1P3IA 1KX4A 4X23D 5F99D 3X1TD 5KDMB 1H3OA 4WU9C 3MGSD 1S32A 3W98A 3B0DC 4YS3D 1P3PA 1P3IC 2XD5A 5CP6D 3KXBB 3B0CT 3NQJA 4R8PD 2CV5B 1KX4C 3C1CA 4KUDA 3AZJA 4ZUXD 1P3GB 4DRAA 1M1AA 2F8ND 5BNVB 3WTPE 5B0YB 1S32C 4H9RA 3W98C 1P3PC 2BYMA 1PZRA 2HUEB 2NQBB 1P3MA 3W96A 1P3LA 4XZQB 5GT0B 3C1CC 3F6TA 3H0LC 4JJND 3AZKD 2AROA 3MNNA 3AZJC 5FUGA 1M1AC 4X23A 5F99A 5AV9C 3B6FB 3RELB 3MGSA 5AVCD 3X1UD 1P3MC 3W96C 1P3LC 4YS3A 2FFFB 2AROC 5B33D 3REJB 4X23C 5F99C 2XD1A 3B0BA 3X1TC 1KU5A 1WWIA 3AV1B 4ZUXA 2F8NA 2Y2KA 1F66B 2BYKB 5GSUA 5B1MD 3MGSC 3REHB 1HTAA 1HQ3B 1U35D 4YS3C 1N1JB 5CP6C 4YM6D 3AZFB 4R8PC 5B32D 3AZKA 3AZMB 2HIOD 3X1VD 4ZUXC 1P34D 5BS7A 5E5AD 5AVCA 3X1UA 4JJNC 3AZKC 1P3IB 1KX4B 2W8SA 5AV6D 1H3OB 3WTPD 5BS7C 5B1MA 1S32B 5AVCC 3X1UC 3W98B 4NE6A 3W99D 5B40B 1P3PB 3AFAD 5B33C 4YM6A 3C1CB 2JE5A 5B32A 3AZID 4KUDB 3AZJB 2HIOA 3X1VA 1M1AB 3VH6W 5B1LD 1P34A 3UTAD 5B1MC 4H9RB 3NQUA 1U35C 2BYMB 5E5AA 1P3MB 3R45A 1AOID 3W96B 1P3LB 2YFVA 4YM6C 5B32C 2AROB 3MNNB 5FUGB 2HIOC 3X1VC 2IO5B 3AZND 2ZM5A 1M18D 4X23B 5F99B 1Q9CA 1P34C 5AVBD 5AV6A 3MGQD 3WTPA 2ZY3A 5E5AC 3MGSB 1TAFA 2G5HC 2DQNC 4YS3B 3W99A 3AFAA 2Y2MA 3LJAD 1W2EA 1TZYD 5CPKD 4LD9A 3AZIA 2RVQD 5AV6C 4ZUXB 2F8NB 3AZED 5AV5D 3WTPC 5B1LA 3A6ND 5GSUB 3UTAA 1P3FD 4Z66D 3EPLA 4J8XD 3W99C 3AFAC 4QLCD 5B31D 1AOIA 5GT3A 3AZKB 3KSYA 3O62D 3AZIC 1M18A 3W97D 5BT1D 5B1LC 3FDDA 5AVBA 3UTAC 3AV2D 4XUJA 5JRGD 3MGQA 5AVCB 3X1UB 1AOIC 2BG1A 3AZHD 3LELD 3AZNC 1M18C 4WV4B 2CWEA 4WU9A 5AVBC 4DRBA 1ID3D 3AZEA 1KX3D 3MGQC 5AV5A 3A6NA 3IP4C 4CAYA 1EQZD 2NZDB 4Z66A 5B2JD 3LJAC 1TZYC 2DF4C 4YM6B 3UTBD 5CPKC 2F8NG 3LZ0A 3V9RA 3O62A 2HIOB 2RVQC 3AZLB 3X1VB 3AZEC 3W97A 5AV5C 4J8VD 5G49A 4H9OA 3A6NC 1P34B 2Y2HA 3AV2A 3NQUB 1P3FC 3EPHA 1JFIA 4Z66C 5E5AB 5JRGA 4J8XC 1P3KD 2PYOD 3R45B 4QLCC 3KUYB 2YFVB 3AZHA 5B2ID 5AV9A 3O62C 3LZ0C 3VH6A 3LELA 4LD9B 4NFTA 3W97C 5BT1C 3REID 1M19D 5AV6B 3AV2C 1ID3A 2F8NK 4J8WD 1KX3A 3WTPB 5JRGC 1TAFB 1EQZA 3W99B 5B2JA 3AFAB 3AZHC 1A7WA 3LELC 3X1TA 3UTBA 3AZIB 3VH5A 1ID3C 3MGRD 1KX3C 5B1LB 4J8VA 4UUZA 3UTAB 1EQZC 3B6GD 5CP6A 5B24D 1P3KA 5B2JC 4Z5TD 4R8PA 3WAAB 5B32G 2PYOA 1AOIB 3UTBC 5GT3B 5AV8D 4H9PA 5B2IA 1M18B 3X1SD 4J8VC 5AVBB 3REIA 3P5JB 1M19A 2Y2LA 4XUJB 3MGQB 4J8WA 1P3KC 1R4VA 5JA4B 2PYOC 4JJNA 5B2IC 4WU9B 3REIC 1M19C 4KGCD 3AZEB 4H9SA 3MGRA 3WKJD 3B0DB 5AV5B 4J8WC 3A6NB 4CAYB 2LY8A 5B33A 4Z66B 3B6GA 5B24A 4Z5TA 3AN2D 3KWQD 3MVDD 3MGPD 3LZ0B 3V9RB 3O62B 4DQYB 4H9SC 3MGRC 1U35A 3W97B 5G49B 1ULYA 4H9OB 3X1SA 3AV2B 2FJ7D 1JFIB 3B6GC 5B24C 4Z5TC 2UWXA 5B0ZD 5CPID 3AZHB 2JCHA 5AV9B 5AV8C 3LELB 4G91C 3X1SC 1P3GD 1ID3B 1Z2CB 4KGCA 5B0YD 1KX3B 3WKJA 5GXQD 1BH9A 1EQZB 4ZBJC 3AN2A 3X1TB 3UTBB 3VH5W 3KWQA 3MVDA 3MGPA 2Y2NA 3C1BD 4KGCC 3WKJC 4J8VB 4UUZB 4J8UD 3A1KA 2FJ7A 1T3UA 5B31G 5CP6B 1P3KB 3WA9D 4M6BA 4R8PB 2PYOB 4EO5C 3AN2C 4NE3A 5B0ZA 3KWQC 3REJD 3MVDC 3MGPC 5CPIA 4H9PB 5B2IB 3AV1D 3REIB 1M19B 2FJ7C 4J8WB 1HQ3D 5GXQA 4JJNB 5CPIC 5B0ZC 3AZNA 4H9QA 3AZFD 4H9NA 2Y2IA 4NE5A 1B6WA 4WNNA 1P3GC 3C1BA 3MGRB 5B0YC 5GXQC 3LJAA 4J8UA 3REKD 5B33B 3B6GB 3WA9A 1TZYA 2J8PA 5B24B 4Z5TB 5CPKA 1P3BD 1P3ID 4WU8D 4Z2MH 1BH8A 3C1BC 5B1MB 4G91B 4G92C 1U35B 4CSRA 2F2AC 1P3AD 3X1SB 1P3FA 3AV1A 4J8XA 3AZLD 1ZLAD 4J8UC 4UPKA 4QLCA 5B31A 3WA9C 5DNND 5B32B 5B40D 3REJC 4ZBJB 4KUDD 3AV1C 5DNMD 4KGCB 5CHLB 4E44A 5CPJD 3WKJB 5B31C 1HQ3C 5BNXA 1BH9B 3REKA 1P3OD 1P3BA 4EO5B 3AZFC 3AN2B 3AYWD 3MNND 3MVDB 4WU8A 3MGPB 1BFMA 1P3AA 1B67A 3AZLA 4KHAA 1ZLAA 3REKC 2FJ7B 1F1EA 5DNNA 1P3BC 5B40A 5B0ZB 5CPIB 3EPKA 4WU8C 1P3AC 3AZLC 1ZLAC 5DNMA 4Z2MG 5GSUD 3TU4D 5CPJA 5GXQB 3KFUG 5DNNC 5B40C 5AY8D 3VH6T 3AZNB 4H9QB 3LZ1D 1P3OA 2Y2JA 4H9NB 3UT9D 1WWSA 4WNNB 2ZY2A 3AYWA 4KUDC 3C1BB 5DNMC 4G92B 5CPJC 3LJAB 4J8UB 3WA9B 1TZYB 2G5IC 3AZGD 5CPKB 1P3OC 1KX5D 3VH5T 3AYWC 3MNNC 2Y2PA 1BH8B 2IO5C 1ZLAB 1P3FB 4CSRB 4J8XB 4E45A 3TU4A 4QLCB 5B31B 3A1IA 2NZDD 2Y2QA 5AV8A 4AWLC 3B0CW 5AY8A 3LZ1A 3UT9A 5JRGB 2YFWA 3TU4C 5GSUC 5BNXB 3KXBD 3REKB 2CV5D 5AY8C 3AZGA 3KUYD 3LZ1C 1P3BB 1KX5A 3UT9C 4WU8B 4LD9D 2JSSA 1P3AB 3AL0C 2NQBD 5B2JB 4KHAB 5C3IC 5BO0A
chains in the Genus database with same CATH topology
4XZQD 5GT0D 2ZY4A 3AZGC 5DNNB 2NZDA 1KX5C 4HGAC 5KDMA 3B6FD 3RELD 2RIQA 5DNMB 5CPJB 2L5AA 2NZDC 3WAAD 3KXBA 2CV5A 1P3OB 3KUYA 1P3GA 5GT3D 3EPJA 5BNVA 3AYWB 1F66D 5B0YA 3REHD 2Y2OA 4WZSB 2NQBA 4XUJD 3KXBC 2CV5C 4XZQA 5GT0A 2F8NH 4WJ3C 3AZMD 3KUYC 4AWLB 3EG5B 4LD9C 3B6FA 4WU9D 3RELA 2HUEC 2NQBC 3TU4B 4XZQC 5GT0C 3REJA 5AV8B 1KX4D 2Y2GA 3WAAA 5AY8B 3LZ1B 3UT9B 3B6FC 3LZ0D 3RELC 1F66A 2BYKA 3REHA 1S32D 3W98D 1HQ3A 2YFWB 1P3PD 1N1JA 5C3IB 3WAAC 3AZFA 3C1CD 2VQRA 5JA4A 3AZGB 3AZMA 3AZJD 1M1AD 1KX5B 5GT3C 3H0MC 5AV9D 4HGAB 1F66C 2ZY5A 3REHC 3H0RC 1P3MD 3W96D 3NQJB 5BO0B 4XUJC 1P3LD 2AROD 3KWQB 3AZMC 1P3IA 1KX4A 4X23D 5F99D 3X1TD 5KDMB 1H3OA 4WU9C 3MGSD 1S32A 3W98A 3B0DC 4YS3D 1P3PA 1P3IC 2XD5A 5CP6D 3KXBB 3B0CT 3NQJA 4R8PD 2CV5B 1KX4C 3C1CA 4KUDA 3AZJA 4ZUXD 1P3GB 4DRAA 1M1AA 2F8ND 5BNVB 3WTPE 5B0YB 1S32C 4H9RA 3W98C 1P3PC 2BYMA 1PZRA 2HUEB 2NQBB 1P3MA 3W96A 1P3LA 4XZQB 5GT0B 3C1CC 3F6TA 3H0LC 4JJND 3AZKD 2AROA 3MNNA 3AZJC 5FUGA 1M1AC 4X23A 5F99A 5AV9C 3B6FB 3RELB 3MGSA 5AVCD 3X1UD 1P3MC 3W96C 1P3LC 4YS3A 2FFFB 2AROC 5B33D 3REJB 4X23C 5F99C 2XD1A 3B0BA 3X1TC 1KU5A 1WWIA 3AV1B 4ZUXA 2F8NA 2Y2KA 1F66B 2BYKB 5GSUA 5B1MD 3MGSC 3REHB 1HTAA 1HQ3B 1U35D 4YS3C 1N1JB 5CP6C 4YM6D 3AZFB 4R8PC 5B32D 3AZKA 3AZMB 2HIOD 3X1VD 4ZUXC 1P34D 5BS7A 5E5AD 5AVCA 3X1UA 4JJNC 3AZKC 1P3IB 1KX4B 2W8SA 5AV6D 1H3OB 3WTPD 5BS7C 5B1MA 1S32B 5AVCC 3X1UC 3W98B 4NE6A 3W99D 5B40B 1P3PB 3AFAD 5B33C 4YM6A 3C1CB 2JE5A 5B32A 3AZID 4KUDB 3AZJB 2HIOA 3X1VA 1M1AB 3VH6W 5B1LD 1P34A 3UTAD 5B1MC 4H9RB 3NQUA 1U35C 2BYMB 5E5AA 1P3MB 3R45A 1AOID 3W96B 1P3LB 2YFVA 4YM6C 5B32C 2AROB 3MNNB 5FUGB 2HIOC 3X1VC 2IO5B 3AZND 2ZM5A 1M18D 4X23B 5F99B 1Q9CA 1P34C 5AVBD 5AV6A 3MGQD 3WTPA 2ZY3A 5E5AC 3MGSB 1TAFA 2G5HC 2DQNC 4YS3B 3W99A 3AFAA 2Y2MA 3LJAD 1W2EA 1TZYD 5CPKD 4LD9A 3AZIA 2RVQD 5AV6C 4ZUXB 2F8NB 3AZED 5AV5D 3WTPC 5B1LA 3A6ND 5GSUB 3UTAA 1P3FD 4Z66D 3EPLA 4J8XD 3W99C 3AFAC 4QLCD 5B31D 1AOIA 5GT3A 3AZKB 3KSYA 3O62D 3AZIC 1M18A 3W97D 5BT1D 5B1LC 3FDDA 5AVBA 3UTAC 3AV2D 4XUJA 5JRGD 3MGQA 5AVCB 3X1UB 1AOIC 2BG1A 3AZHD 3LELD 3AZNC 1M18C 4WV4B 2CWEA 4WU9A 5AVBC 4DRBA 1ID3D 3AZEA 1KX3D 3MGQC 5AV5A 3A6NA 3IP4C 4CAYA 1EQZD 2NZDB 4Z66A 5B2JD 3LJAC 1TZYC 2DF4C 4YM6B 3UTBD 5CPKC 2F8NG 3LZ0A 3V9RA 3O62A 2HIOB 2RVQC 3AZLB 3X1VB 3AZEC 3W97A 5AV5C 4J8VD 5G49A 4H9OA 3A6NC 1P34B 2Y2HA 3AV2A 3NQUB 1P3FC 3EPHA 1JFIA 4Z66C 5E5AB 5JRGA 4J8XC 1P3KD 2PYOD 3R45B 4QLCC 3KUYB 2YFVB 3AZHA 5B2ID 5AV9A 3O62C 3LZ0C 3VH6A 3LELA 4LD9B 4NFTA 3W97C 5BT1C 3REID 1M19D 5AV6B 3AV2C 1ID3A 2F8NK 4J8WD 1KX3A 3WTPB 5JRGC 1TAFB 1EQZA 3W99B 5B2JA 3AFAB 3AZHC 1A7WA 3LELC 3X1TA 3UTBA 3AZIB 3VH5A 1ID3C 3MGRD 1KX3C 5B1LB 4J8VA 4UUZA 3UTAB 1EQZC 3B6GD 5CP6A 5B24D 1P3KA 5B2JC 4Z5TD 4R8PA 3WAAB 5B32G 2PYOA 1AOIB 3UTBC 5GT3B 5AV8D 4H9PA 5B2IA 1M18B 3X1SD 4J8VC 5AVBB 3REIA 3P5JB 1M19A 2Y2LA 4XUJB 3MGQB 4J8WA 1P3KC 1R4VA 5JA4B 2PYOC 4JJNA 5B2IC 4WU9B 3REIC 1M19C 4KGCD 3AZEB 4H9SA 3MGRA 3WKJD 3B0DB 5AV5B 4J8WC 3A6NB 4CAYB 2LY8A 5B33A 4Z66B 3B6GA 5B24A 4Z5TA 3AN2D 3KWQD 3MVDD 3MGPD 3LZ0B 3V9RB 3O62B 4DQYB 4H9SC 3MGRC 1U35A 3W97B 5G49B 1ULYA 4H9OB 3X1SA 3AV2B 2FJ7D 1JFIB 3B6GC 5B24C 4Z5TC 2UWXA 5B0ZD 5CPID 3AZHB 2JCHA 5AV9B 5AV8C 3LELB 4G91C 3X1SC 1P3GD 1ID3B 1Z2CB 4KGCA 5B0YD 1KX3B 3WKJA 5GXQD 1BH9A 1EQZB 4ZBJC 3AN2A 3X1TB 3UTBB 3VH5W 3KWQA 3MVDA 3MGPA 2Y2NA 3C1BD 4KGCC 3WKJC 4J8VB 4UUZB 4J8UD 3A1KA 2FJ7A 1T3UA 5B31G 5CP6B 1P3KB 3WA9D 4M6BA 4R8PB 2PYOB 4EO5C 3AN2C 4NE3A 5B0ZA 3KWQC 3REJD 3MVDC 3MGPC 5CPIA 4H9PB 5B2IB 3AV1D 3REIB 1M19B 2FJ7C 4J8WB 1HQ3D 5GXQA 4JJNB 5CPIC 5B0ZC 3AZNA 4H9QA 3AZFD 4H9NA 2Y2IA 4NE5A 1B6WA 4WNNA 1P3GC 3C1BA 3MGRB 5B0YC 5GXQC 3LJAA 4J8UA 3REKD 5B33B 3B6GB 3WA9A 1TZYA 2J8PA 5B24B 4Z5TB 5CPKA 1P3BD 1P3ID 4WU8D 4Z2MH 1BH8A 3C1BC 5B1MB 4G91B 4G92C 1U35B 4CSRA 2F2AC 1P3AD 3X1SB 1P3FA 3AV1A 4J8XA 3AZLD 1ZLAD 4J8UC 4UPKA 4QLCA 5B31A 3WA9C 5DNND 5B32B 5B40D 3REJC 4ZBJB 4KUDD 3AV1C 5DNMD 4KGCB 5CHLB 4E44A 5CPJD 3WKJB 5B31C 1HQ3C 5BNXA 1BH9B 3REKA 1P3OD 1P3BA 4EO5B 3AZFC 3AN2B 3AYWD 3MNND 3MVDB 4WU8A 3MGPB 1BFMA 1P3AA 1B67A 3AZLA 4KHAA 1ZLAA 3REKC 2FJ7B 1F1EA 5DNNA 1P3BC 5B40A 5B0ZB 5CPIB 3EPKA 4WU8C 1P3AC 3AZLC 1ZLAC 5DNMA 4Z2MG 5GSUD 3TU4D 5CPJA 5GXQB 3KFUG 5DNNC 5B40C 5AY8D 3VH6T 3AZNB 4H9QB 3LZ1D 1P3OA 2Y2JA 4H9NB 3UT9D 1WWSA 4WNNB 2ZY2A 3AYWA 4KUDC 3C1BB 5DNMC 4G92B 5CPJC 3LJAB 4J8UB 3WA9B 1TZYB 2G5IC 3AZGD 5CPKB 1P3OC 1KX5D 3VH5T 3AYWC 3MNNC 2Y2PA 1BH8B 2IO5C 1ZLAB 1P3FB 4CSRB 4J8XB 4E45A 3TU4A 4QLCB 5B31B 3A1IA 2NZDD 2Y2QA 5AV8A 4AWLC 3B0CW 5AY8A 3LZ1A 3UT9A 5JRGB 2YFWA 3TU4C 5GSUC 5BNXB 3KXBD 3REKB 2CV5D 5AY8C 3AZGA 3KUYD 3LZ1C 1P3BB 1KX5A 3UT9C 4WU8B 4LD9D 2JSSA 1P3AB 3AL0C 2NQBD 5B2JB 4KHAB 5C3IC 5BO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ D;  5GT0 D;  3AZG C;  5DNN B;  2NZD A;  1KX5 C;  4HGA C;  5KDM A;  3B6F D;  3REL D;  5DNM B;  5CPJ B;  2L5A A;  2NZD C;  3WAA D;  3KXB A;  2CV5 A;  1P3O B;  3KUY A;  1P3G A;  5GT3 D;  5BNV A;  3AYW B;  1F66 D;  5B0Y A;  3REH D;  4WZS B;  2NQB A;  4XUJ D;  3KXB C;  2CV5 C;  4XZQ A;  5GT0 A;  2F8N H;  3AZM D;  3KUY C;  4AWL B;  4LD9 C;  3B6F A;  4WU9 D;  3REL A;  2HUE C;  2NQB C;  3TU4 B;  4XZQ C;  5GT0 C;  3REJ A;  5AV8 B;  1KX4 D;  3WAA A;  5AY8 B;  3LZ1 B;  3UT9 B;  3B6F C;  3LZ0 D;  3REL C;  1F66 A;  2BYK A;  3REH A;  1S32 D;  3W98 D;  1HQ3 A;  2YFW B;  1P3P D;  1N1J A;  5C3I B;  3WAA C;  3AZF A;  3C1C D;  5JA4 A;  3AZG B;  3AZM A;  3AZJ D;  1M1A D;  1KX5 B;  5GT3 C;  5AV9 D;  4HGA B;  1F66 C;  3REH C;  1P3M D;  3W96 D;  3NQJ B;  5BO0 B;  4XUJ C;  1P3L D;  2ARO D;  3KWQ B;  3AZM C;  1P3I A;  1KX4 A;  4X23 D;  5F99 D;  3X1T D;  5KDM B;  1H3O A;  4WU9 C;  3MGS D;  1S32 A;  3W98 A;  3B0D C;  4YS3 D;  1P3P A;  1P3I C;  5CP6 D;  3KXB B;  3B0C T;  3NQJ A;  4R8P D;  2CV5 B;  1KX4 C;  3C1C A;  4KUD A;  3AZJ A;  4ZUX D;  1P3G B;  4DRA A;  1M1A A;  2F8N D;  5BNV B;  3WTP E;  5B0Y B;  1S32 C;  4H9R A;  3W98 C;  1P3P C;  2BYM A;  2HUE B;  2NQB B;  1P3M A;  3W96 A;  1P3L A;  4XZQ B;  5GT0 B;  3C1C C;  4JJN D;  3AZK D;  2ARO A;  3MNN A;  3AZJ C;  5FUG A;  1M1A C;  4X23 A;  5F99 A;  5AV9 C;  3B6F B;  3REL B;  3MGS A;  5AVC D;  3X1U D;  1P3M C;  3W96 C;  1P3L C;  4YS3 A;  2ARO C;  5B33 D;  3REJ B;  4X23 C;  5F99 C;  3B0B A;  3X1T C;  1KU5 A;  1WWI A;  3AV1 B;  4ZUX A;  2F8N A;  1F66 B;  2BYK B;  5GSU A;  5B1M D;  3MGS C;  3REH B;  1HTA A;  1HQ3 B;  1U35 D;  4YS3 C;  1N1J B;  5CP6 C;  4YM6 D;  3AZF B;  4R8P C;  5B32 D;  3AZK A;  3AZM B;  2HIO D;  3X1V D;  4ZUX C;  1P34 D;  5BS7 A;  5E5A D;  5AVC A;  3X1U A;  4JJN C;  3AZK C;  1P3I B;  1KX4 B;  5AV6 D;  1H3O B;  3WTP D;  5BS7 C;  5B1M A;  1S32 B;  5AVC C;  3X1U C;  3W98 B;  4NE6 A;  3W99 D;  5B40 B;  1P3P B;  3AFA D;  5B33 C;  4YM6 A;  3C1C B;  5B32 A;  3AZI D;  4KUD B;  3AZJ B;  2HIO A;  3X1V A;  1M1A B;  3VH6 W;  5B1L D;  1P34 A;  3UTA D;  5B1M C;  4H9R B;  3NQU A;  1U35 C;  2BYM B;  5E5A A;  1P3M B;  3R45 A;  1AOI D;  3W96 B;  1P3L B;  2YFV A;  4YM6 C;  5B32 C;  2ARO B;  3MNN B;  5FUG B;  2HIO C;  3X1V C;  2IO5 B;  3AZN D;  1M18 D;  4LD9 A;  4X23 B;  5F99 B;  1Q9C A;  1P34 C;  5AVB D;  5AV6 A;  3MGQ D;  3WTP A;  5E5A C;  3MGS B;  1TAF A;  4YS3 B;  3W99 A;  3AFA A;  3LJA D;  1TZY D;  5CPK D;  3AZI A;  2RVQ D;  5AV6 C;  4ZUX B;  2F8N B;  3AZE D;  5AV5 D;  3WTP C;  5B1L A;  3A6N D;  5GSU B;  3UTA A;  1P3F D;  4Z66 D;  4J8X D;  3W99 C;  3AFA C;  4QLC D;  5B31 D;  1AOI A;  5GT3 A;  3AZK B;  3KSY A;  3O62 D;  3AZI C;  1M18 A;  3W97 D;  5BT1 D;  5B1L C;  5AVB A;  3UTA C;  3AV2 D;  4XUJ A;  5JRG D;  3MGQ A;  5AVC B;  3X1U B;  1AOI C;  3AZH D;  3LEL D;  3AZN C;  1M18 C;  4WV4 B;  2CWE A;  4WU9 A;  5AVB C;  4DRB A;  1ID3 D;  3AZE A;  1KX3 D;  3MGQ C;  5AV5 A;  3A6N A;  4CAY A;  1EQZ D;  2NZD B;  4Z66 A;  5B2J D;  3LJA C;  1TZY C;  4YM6 B;  3UTB D;  5CPK C;  2F8N G;  3LZ0 A;  3V9R A;  3O62 A;  2HIO B;  2RVQ C;  3AZL B;  3X1V B;  3AZE C;  3W97 A;  5AV5 C;  4J8V D;  5G49 A;  4H9O A;  3A6N C;  1P34 B;  3AV2 A;  3NQU B;  1P3F C;  1JFI A;  4Z66 C;  5E5A B;  5JRG A;  4J8X C;  1P3K D;  2PYO D;  3R45 B;  4QLC C;  3KUY B;  2YFV B;  3AZH A;  5B2I D;  5AV9 A;  3O62 C;  3LZ0 C;  3VH6 A;  3LEL A;  4LD9 B;  4NFT A;  3W97 C;  5BT1 C;  3REI D;  1M19 D;  5AV6 B;  3AV2 C;  1ID3 A;  2F8N K;  4J8W D;  1KX3 A;  3WTP B;  5JRG C;  1TAF B;  1EQZ A;  3W99 B;  5B2J A;  3AFA B;  3AZH C;  1A7W A;  3LEL C;  3X1T A;  3UTB A;  3AZI B;  3VH5 A;  1ID3 C;  3MGR D;  1KX3 C;  5B1L B;  4J8V A;  4UUZ A;  3UTA B;  1EQZ C;  3B6G D;  5CP6 A;  5B24 D;  1P3K A;  5B2J C;  4Z5T D;  4R8P A;  3WAA B;  5B32 G;  2PYO A;  1AOI B;  3UTB C;  5GT3 B;  5AV8 D;  4H9P A;  5B2I A;  1M18 B;  3X1S D;  4J8V C;  5AVB B;  3REI A;  1M19 A;  4XUJ B;  3MGQ B;  4J8W A;  1P3K C;  1R4V A;  5JA4 B;  2PYO C;  4JJN A;  5B2I C;  4WU9 B;  3REI C;  1M19 C;  4KGC D;  3AZE B;  4H9S A;  3MGR A;  3WKJ D;  3B0D B;  5AV5 B;  4J8W C;  3A6N B;  4CAY B;  2LY8 A;  5B33 A;  4Z66 B;  3B6G A;  5B24 A;  4Z5T A;  3AN2 D;  3KWQ D;  3MVD D;  3MGP D;  3LZ0 B;  3V9R B;  3O62 B;  4H9S C;  3MGR C;  1U35 A;  3W97 B;  5G49 B;  1ULY A;  4H9O B;  3X1S A;  3AV2 B;  2FJ7 D;  1JFI B;  3B6G C;  5B24 C;  4Z5T C;  5B0Z D;  5CPI D;  3AZH B;  5AV9 B;  5AV8 C;  3LEL B;  4G91 C;  3X1S C;  1P3G D;  1ID3 B;  4KGC A;  5B0Y D;  1KX3 B;  3WKJ A;  5GXQ D;  1BH9 A;  1EQZ B;  4ZBJ C;  3AN2 A;  3X1T B;  3UTB B;  3VH5 W;  3KWQ A;  3MVD A;  3MGP A;  3C1B D;  4KGC C;  3WKJ C;  4J8V B;  4UUZ B;  4J8U D;  2FJ7 A;  5B31 G;  5CP6 B;  1P3K B;  3WA9 D;  4M6B A;  4R8P B;  2PYO B;  4EO5 C;  3AN2 C;  4NE3 A;  5B0Z A;  3KWQ C;  3REJ D;  3MVD C;  3MGP C;  5CPI A;  4H9P B;  5B2I B;  3AV1 D;  3REI B;  1M19 B;  2FJ7 C;  4J8W B;  1HQ3 D;  5GXQ A;  4JJN B;  5CPI C;  5B0Z C;  3AZN A;  4H9Q A;  3AZF D;  4H9N A;  4NE5 A;  1B6W A;  4WNN A;  1P3G C;  3C1B A;  3MGR B;  5B0Y C;  5GXQ C;  3LJA A;  4J8U A;  3REK D;  5B33 B;  3B6G B;  3WA9 A;  1TZY A;  5B24 B;  5CPK A;  4Z5T B;  1P3B D;  1P3I D;  4WU8 D;  4Z2M H;  1BH8 A;  3C1B C;  5B1M B;  4G91 B;  4G92 C;  1U35 B;  4CSR A;  1P3A D;  1P3F A;  3X1S B;  3AV1 A;  4J8X A;  3AZL D;  1ZLA D;  4J8U C;  4QLC A;  5B31 A;  3WA9 C;  5DNN D;  5B32 B;  5B40 D;  3REJ C;  4ZBJ B;  4KUD D;  3AV1 C;  5DNM D;  4KGC B;  5CHL B;  4E44 A;  5CPJ D;  3WKJ B;  5B31 C;  1HQ3 C;  5BNX A;  1BH9 B;  3REK A;  1P3O D;  1P3B A;  4EO5 B;  3AZF C;  3AN2 B;  3AYW D;  3MNN D;  3MVD B;  4WU8 A;  3MGP B;  1BFM A;  1P3A A;  1B67 A;  3AZL A;  4KHA A;  1ZLA A;  3REK C;  2FJ7 B;  1F1E A;  5DNN A;  1P3B C;  5B40 A;  5B0Z B;  5CPI B;  4WU8 C;  1P3A C;  3AZL C;  1ZLA C;  5DNM A;  4Z2M G;  5GSU D;  3TU4 D;  5CPJ A;  5GXQ B;  5DNN C;  5B40 C;  5AY8 D;  3VH6 T;  3AZN B;  4H9Q B;  3LZ1 D;  1P3O A;  4H9N B;  3UT9 D;  1WWS A;  4WNN B;  3AYW A;  4KUD C;  3C1B B;  5DNM C;  4G92 B;  5CPJ C;  3LJA B;  4J8U B;  3WA9 B;  1TZY B;  5CPK B;  3AZG D;  1P3O C;  1KX5 D;  3VH5 T;  3AYW C;  3MNN C;  1BH8 B;  2IO5 C;  1ZLA B;  1P3F B;  4CSR B;  4J8X B;  4E45 A;  3TU4 A;  4QLC B;  5B31 B;  2NZD D;  5AV8 A;  4AWL C;  3B0C W;  5AY8 A;  3LZ1 A;  3UT9 A;  5JRG B;  2YFW A;  3TU4 C;  5GSU C;  5BNX B;  3KXB D;  3REK B;  2CV5 D;  5AY8 C;  3AZG A;  3KUY D;  3LZ1 C;  1P3B B;  1KX5 A;  3UT9 C;  4WU8 B;  4LD9 D;  2JSS A;  1P3A B;  2NQB D;  5B2J B;  4KHA B;  5C3I C;  5BO0 A; 
#chains in the Genus database with same CATH topology
 4XZQ D;  5GT0 D;  2ZY4 A;  3AZG C;  5DNN B;  2NZD A;  1KX5 C;  4HGA C;  5KDM A;  3B6F D;  3REL D;  2RIQ A;  5DNM B;  5CPJ B;  2L5A A;  2NZD C;  3WAA D;  3KXB A;  2CV5 A;  1P3O B;  3KUY A;  1P3G A;  5GT3 D;  3EPJ A;  5BNV A;  3AYW B;  1F66 D;  5B0Y A;  3REH D;  2Y2O A;  4WZS B;  2NQB A;  4XUJ D;  3KXB C;  2CV5 C;  4XZQ A;  5GT0 A;  2F8N H;  4WJ3 C;  3AZM D;  3KUY C;  4AWL B;  3EG5 B;  4LD9 C;  3B6F A;  4WU9 D;  3REL A;  2HUE C;  2NQB C;  3TU4 B;  4XZQ C;  5GT0 C;  3REJ A;  5AV8 B;  1KX4 D;  2Y2G A;  3WAA A;  5AY8 B;  3LZ1 B;  3UT9 B;  3B6F C;  3LZ0 D;  3REL C;  1F66 A;  2BYK A;  3REH A;  1S32 D;  3W98 D;  1HQ3 A;  2YFW B;  1P3P D;  1N1J A;  5C3I B;  3WAA C;  3AZF A;  3C1C D;  2VQR A;  5JA4 A;  3AZG B;  3AZM A;  3AZJ D;  1M1A D;  1KX5 B;  5GT3 C;  3H0M C;  5AV9 D;  4HGA B;  1F66 C;  2ZY5 A;  3REH C;  3H0R C;  1P3M D;  3W96 D;  3NQJ B;  5BO0 B;  4XUJ C;  1P3L D;  2ARO D;  3KWQ B;  3AZM C;  1P3I A;  1KX4 A;  4X23 D;  5F99 D;  3X1T D;  5KDM B;  1H3O A;  4WU9 C;  3MGS D;  1S32 A;  3W98 A;  3B0D C;  4YS3 D;  1P3P A;  1P3I C;  2XD5 A;  5CP6 D;  3KXB B;  3B0C T;  3NQJ A;  4R8P D;  2CV5 B;  1KX4 C;  3C1C A;  4KUD A;  3AZJ A;  4ZUX D;  1P3G B;  4DRA A;  1M1A A;  2F8N D;  5BNV B;  3WTP E;  5B0Y B;  1S32 C;  4H9R A;  3W98 C;  1P3P C;  2BYM A;  1PZR A;  2HUE B;  2NQB B;  1P3M A;  3W96 A;  1P3L A;  4XZQ B;  5GT0 B;  3C1C C;  3F6T A;  3H0L C;  4JJN D;  3AZK D;  2ARO A;  3MNN A;  3AZJ C;  5FUG A;  1M1A C;  4X23 A;  5F99 A;  5AV9 C;  3B6F B;  3REL B;  3MGS A;  5AVC D;  3X1U D;  1P3M C;  3W96 C;  1P3L C;  4YS3 A;  2FFF B;  2ARO C;  5B33 D;  3REJ B;  4X23 C;  5F99 C;  2XD1 A;  3B0B A;  3X1T C;  1KU5 A;  1WWI A;  3AV1 B;  4ZUX A;  2F8N A;  2Y2K A;  1F66 B;  2BYK B;  5GSU A;  5B1M D;  3MGS C;  3REH B;  1HTA A;  1HQ3 B;  1U35 D;  4YS3 C;  1N1J B;  5CP6 C;  4YM6 D;  3AZF B;  4R8P C;  5B32 D;  3AZK A;  3AZM B;  2HIO D;  3X1V D;  4ZUX C;  1P34 D;  5BS7 A;  5E5A D;  5AVC A;  3X1U A;  4JJN C;  3AZK C;  1P3I B;  1KX4 B;  2W8S A;  5AV6 D;  1H3O B;  3WTP D;  5BS7 C;  5B1M A;  1S32 B;  5AVC C;  3X1U C;  3W98 B;  4NE6 A;  3W99 D;  5B40 B;  1P3P B;  3AFA D;  5B33 C;  4YM6 A;  3C1C B;  2JE5 A;  5B32 A;  3AZI D;  4KUD B;  3AZJ B;  2HIO A;  3X1V A;  1M1A B;  3VH6 W;  5B1L D;  1P34 A;  3UTA D;  5B1M C;  4H9R B;  3NQU A;  1U35 C;  2BYM B;  5E5A A;  1P3M B;  3R45 A;  1AOI D;  3W96 B;  1P3L B;  2YFV A;  4YM6 C;  5B32 C;  2ARO B;  3MNN B;  5FUG B;  2HIO C;  3X1V C;  2IO5 B;  3AZN D;  2ZM5 A;  1M18 D;  4X23 B;  5F99 B;  1Q9C A;  1P34 C;  5AVB D;  5AV6 A;  3MGQ D;  3WTP A;  2ZY3 A;  5E5A C;  3MGS B;  1TAF A;  2G5H C;  2DQN C;  4YS3 B;  3W99 A;  3AFA A;  2Y2M A;  3LJA D;  1W2E A;  1TZY D;  5CPK D;  4LD9 A;  3AZI A;  2RVQ D;  5AV6 C;  4ZUX B;  2F8N B;  3AZE D;  5AV5 D;  3WTP C;  5B1L A;  3A6N D;  5GSU B;  3UTA A;  1P3F D;  4Z66 D;  3EPL A;  4J8X D;  3W99 C;  3AFA C;  4QLC D;  5B31 D;  1AOI A;  5GT3 A;  3AZK B;  3KSY A;  3O62 D;  3AZI C;  1M18 A;  3W97 D;  5BT1 D;  5B1L C;  3FDD A;  5AVB A;  3UTA C;  3AV2 D;  4XUJ A;  5JRG D;  3MGQ A;  5AVC B;  3X1U B;  1AOI C;  2BG1 A;  3AZH D;  3LEL D;  3AZN C;  1M18 C;  4WV4 B;  2CWE A;  4WU9 A;  5AVB C;  4DRB A;  1ID3 D;  3AZE A;  1KX3 D;  3MGQ C;  5AV5 A;  3A6N A;  3IP4 C;  4CAY A;  1EQZ D;  2NZD B;  4Z66 A;  5B2J D;  3LJA C;  1TZY C;  2DF4 C;  4YM6 B;  3UTB D;  5CPK C;  2F8N G;  3LZ0 A;  3V9R A;  3O62 A;  2HIO B;  2RVQ C;  3AZL B;  3X1V B;  3AZE C;  3W97 A;  5AV5 C;  4J8V D;  5G49 A;  4H9O A;  3A6N C;  1P34 B;  2Y2H A;  3AV2 A;  3NQU B;  1P3F C;  3EPH A;  1JFI A;  4Z66 C;  5E5A B;  5JRG A;  4J8X C;  1P3K D;  2PYO D;  3R45 B;  4QLC C;  3KUY B;  2YFV B;  3AZH A;  5B2I D;  5AV9 A;  3O62 C;  3LZ0 C;  3VH6 A;  3LEL A;  4LD9 B;  4NFT A;  3W97 C;  5BT1 C;  3REI D;  1M19 D;  5AV6 B;  3AV2 C;  1ID3 A;  2F8N K;  4J8W D;  1KX3 A;  3WTP B;  5JRG C;  1TAF B;  1EQZ A;  3W99 B;  5B2J A;  3AFA B;  3AZH C;  1A7W A;  3LEL C;  3X1T A;  3UTB A;  3AZI B;  3VH5 A;  1ID3 C;  3MGR D;  1KX3 C;  5B1L B;  4J8V A;  4UUZ A;  3UTA B;  1EQZ C;  3B6G D;  5CP6 A;  5B24 D;  1P3K A;  5B2J C;  4Z5T D;  4R8P A;  3WAA B;  5B32 G;  2PYO A;  1AOI B;  3UTB C;  5GT3 B;  5AV8 D;  4H9P A;  5B2I A;  1M18 B;  3X1S D;  4J8V C;  5AVB B;  3REI A;  3P5J B;  1M19 A;  2Y2L A;  4XUJ B;  3MGQ B;  4J8W A;  1P3K C;  1R4V A;  5JA4 B;  2PYO C;  4JJN A;  5B2I C;  4WU9 B;  3REI C;  1M19 C;  4KGC D;  3AZE B;  4H9S A;  3MGR A;  3WKJ D;  3B0D B;  5AV5 B;  4J8W C;  3A6N B;  4CAY B;  2LY8 A;  5B33 A;  4Z66 B;  3B6G A;  5B24 A;  4Z5T A;  3AN2 D;  3KWQ D;  3MVD D;  3MGP D;  3LZ0 B;  3V9R B;  3O62 B;  4DQY B;  4H9S C;  3MGR C;  1U35 A;  3W97 B;  5G49 B;  1ULY A;  4H9O B;  3X1S A;  3AV2 B;  2FJ7 D;  1JFI B;  3B6G C;  5B24 C;  4Z5T C;  2UWX A;  5B0Z D;  5CPI D;  3AZH B;  2JCH A;  5AV9 B;  5AV8 C;  3LEL B;  4G91 C;  3X1S C;  1P3G D;  1ID3 B;  1Z2C B;  4KGC A;  5B0Y D;  1KX3 B;  3WKJ A;  5GXQ D;  1BH9 A;  1EQZ B;  4ZBJ C;  3AN2 A;  3X1T B;  3UTB B;  3VH5 W;  3KWQ A;  3MVD A;  3MGP A;  2Y2N A;  3C1B D;  4KGC C;  3WKJ C;  4J8V B;  4UUZ B;  4J8U D;  3A1K A;  2FJ7 A;  1T3U A;  5B31 G;  5CP6 B;  1P3K B;  3WA9 D;  4M6B A;  4R8P B;  2PYO B;  4EO5 C;  3AN2 C;  4NE3 A;  5B0Z A;  3KWQ C;  3REJ D;  3MVD C;  3MGP C;  5CPI A;  4H9P B;  5B2I B;  3AV1 D;  3REI B;  1M19 B;  2FJ7 C;  4J8W B;  1HQ3 D;  5GXQ A;  4JJN B;  5CPI C;  5B0Z C;  3AZN A;  4H9Q A;  3AZF D;  4H9N A;  2Y2I A;  4NE5 A;  1B6W A;  4WNN A;  1P3G C;  3C1B A;  3MGR B;  5B0Y C;  5GXQ C;  3LJA A;  4J8U A;  3REK D;  5B33 B;  3B6G B;  3WA9 A;  1TZY A;  2J8P A;  5B24 B;  4Z5T B;  5CPK A;  1P3B D;  1P3I D;  4WU8 D;  4Z2M H;  1BH8 A;  3C1B C;  5B1M B;  4G91 B;  4G92 C;  1U35 B;  4CSR A;  2F2A C;  1P3A D;  3X1S B;  1P3F A;  3AV1 A;  4J8X A;  3AZL D;  1ZLA D;  4J8U C;  4UPK A;  4QLC A;  5B31 A;  3WA9 C;  5DNN D;  5B32 B;  5B40 D;  3REJ C;  4ZBJ B;  4KUD D;  3AV1 C;  5DNM D;  4KGC B;  5CHL B;  4E44 A;  5CPJ D;  3WKJ B;  5B31 C;  1HQ3 C;  5BNX A;  1BH9 B;  3REK A;  1P3O D;  1P3B A;  4EO5 B;  3AZF C;  3AN2 B;  3AYW D;  3MNN D;  3MVD B;  4WU8 A;  3MGP B;  1BFM A;  1P3A A;  1B67 A;  3AZL A;  4KHA A;  1ZLA A;  3REK C;  2FJ7 B;  1F1E A;  5DNN A;  1P3B C;  5B40 A;  5B0Z B;  5CPI B;  3EPK A;  4WU8 C;  1P3A C;  3AZL C;  1ZLA C;  5DNM A;  4Z2M G;  5GSU D;  3TU4 D;  5CPJ A;  5GXQ B;  3KFU G;  5DNN C;  5B40 C;  5AY8 D;  3VH6 T;  3AZN B;  4H9Q B;  3LZ1 D;  1P3O A;  2Y2J A;  4H9N B;  3UT9 D;  1WWS A;  4WNN B;  2ZY2 A;  3AYW A;  4KUD C;  3C1B B;  5DNM C;  4G92 B;  5CPJ C;  3LJA B;  4J8U B;  3WA9 B;  1TZY B;  2G5I C;  3AZG D;  5CPK B;  1P3O C;  1KX5 D;  3VH5 T;  3AYW C;  3MNN C;  2Y2P A;  1BH8 B;  2IO5 C;  1ZLA B;  1P3F B;  4CSR B;  4J8X B;  4E45 A;  3TU4 A;  4QLC B;  5B31 B;  3A1I A;  2NZD D;  2Y2Q A;  5AV8 A;  4AWL C;  3B0C W;  5AY8 A;  3LZ1 A;  3UT9 A;  5JRG B;  2YFW A;  3TU4 C;  5GSU C;  5BNX B;  3KXB D;  3REK B;  2CV5 D;  5AY8 C;  3AZG A;  3KUY D;  3LZ1 C;  1P3B B;  1KX5 A;  3UT9 C;  4WU8 B;  4LD9 D;  2JSS A;  1P3A B;  3AL0 C;  2NQB D;  5B2J B;  4KHA B;  5C3I C;  5BO0 A; 
#chains in the Genus database with same CATH homology
 4XZQ D;  5GT0 D;  2ZY4 A;  3AZG C;  5DNN B;  2NZD A;  1KX5 C;  4HGA C;  5KDM A;  3B6F D;  3REL D;  2RIQ A;  5DNM B;  5CPJ B;  2L5A A;  2NZD C;  3WAA D;  3KXB A;  2CV5 A;  1P3O B;  3KUY A;  1P3G A;  5GT3 D;  3EPJ A;  5BNV A;  3AYW B;  1F66 D;  5B0Y A;  3REH D;  2Y2O A;  4WZS B;  2NQB A;  4XUJ D;  3KXB C;  2CV5 C;  4XZQ A;  5GT0 A;  2F8N H;  4WJ3 C;  3AZM D;  3KUY C;  4AWL B;  3EG5 B;  4LD9 C;  3B6F A;  4WU9 D;  3REL A;  2HUE C;  2NQB C;  3TU4 B;  4XZQ C;  5GT0 C;  3REJ A;  5AV8 B;  1KX4 D;  2Y2G A;  3WAA A;  5AY8 B;  3LZ1 B;  3UT9 B;  3B6F C;  3LZ0 D;  3REL C;  1F66 A;  2BYK A;  3REH A;  1S32 D;  3W98 D;  1HQ3 A;  2YFW B;  1P3P D;  1N1J A;  5C3I B;  3WAA C;  3AZF A;  3C1C D;  2VQR A;  5JA4 A;  3AZG B;  3AZM A;  3AZJ D;  1M1A D;  1KX5 B;  5GT3 C;  3H0M C;  5AV9 D;  4HGA B;  1F66 C;  2ZY5 A;  3REH C;  3H0R C;  1P3M D;  3W96 D;  3NQJ B;  5BO0 B;  4XUJ C;  1P3L D;  2ARO D;  3KWQ B;  3AZM C;  1P3I A;  1KX4 A;  4X23 D;  5F99 D;  3X1T D;  5KDM B;  1H3O A;  4WU9 C;  3MGS D;  1S32 A;  3W98 A;  3B0D C;  4YS3 D;  1P3P A;  1P3I C;  2XD5 A;  5CP6 D;  3KXB B;  3B0C T;  3NQJ A;  4R8P D;  2CV5 B;  1KX4 C;  3C1C A;  4KUD A;  3AZJ A;  4ZUX D;  1P3G B;  4DRA A;  1M1A A;  2F8N D;  5BNV B;  3WTP E;  5B0Y B;  1S32 C;  4H9R A;  3W98 C;  1P3P C;  2BYM A;  1PZR A;  2HUE B;  2NQB B;  1P3M A;  3W96 A;  1P3L A;  4XZQ B;  5GT0 B;  3C1C C;  3F6T A;  3H0L C;  4JJN D;  3AZK D;  2ARO A;  3MNN A;  3AZJ C;  5FUG A;  1M1A C;  4X23 A;  5F99 A;  5AV9 C;  3B6F B;  3REL B;  3MGS A;  5AVC D;  3X1U D;  1P3M C;  3W96 C;  1P3L C;  4YS3 A;  2FFF B;  2ARO C;  5B33 D;  3REJ B;  4X23 C;  5F99 C;  2XD1 A;  3B0B A;  3X1T C;  1KU5 A;  1WWI A;  3AV1 B;  4ZUX A;  2F8N A;  2Y2K A;  1F66 B;  2BYK B;  5GSU A;  5B1M D;  3MGS C;  3REH B;  1HTA A;  1HQ3 B;  1U35 D;  4YS3 C;  1N1J B;  5CP6 C;  4YM6 D;  3AZF B;  4R8P C;  5B32 D;  3AZK A;  3AZM B;  2HIO D;  3X1V D;  4ZUX C;  1P34 D;  5BS7 A;  5E5A D;  5AVC A;  3X1U A;  4JJN C;  3AZK C;  1P3I B;  1KX4 B;  2W8S A;  5AV6 D;  1H3O B;  3WTP D;  5BS7 C;  5B1M A;  1S32 B;  5AVC C;  3X1U C;  3W98 B;  4NE6 A;  3W99 D;  5B40 B;  1P3P B;  3AFA D;  5B33 C;  4YM6 A;  3C1C B;  2JE5 A;  5B32 A;  3AZI D;  4KUD B;  3AZJ B;  2HIO A;  3X1V A;  1M1A B;  3VH6 W;  5B1L D;  1P34 A;  3UTA D;  5B1M C;  4H9R B;  3NQU A;  1U35 C;  2BYM B;  5E5A A;  1P3M B;  3R45 A;  1AOI D;  3W96 B;  1P3L B;  2YFV A;  4YM6 C;  5B32 C;  2ARO B;  3MNN B;  5FUG B;  2HIO C;  3X1V C;  2IO5 B;  3AZN D;  2ZM5 A;  1M18 D;  4X23 B;  5F99 B;  1Q9C A;  1P34 C;  5AVB D;  5AV6 A;  3MGQ D;  3WTP A;  2ZY3 A;  5E5A C;  3MGS B;  1TAF A;  2G5H C;  2DQN C;  4YS3 B;  3W99 A;  3AFA A;  2Y2M A;  3LJA D;  1W2E A;  1TZY D;  5CPK D;  4LD9 A;  3AZI A;  2RVQ D;  5AV6 C;  4ZUX B;  2F8N B;  3AZE D;  5AV5 D;  3WTP C;  5B1L A;  3A6N D;  5GSU B;  3UTA A;  1P3F D;  4Z66 D;  3EPL A;  4J8X D;  3W99 C;  3AFA C;  4QLC D;  5B31 D;  1AOI A;  5GT3 A;  3AZK B;  3KSY A;  3O62 D;  3AZI C;  1M18 A;  3W97 D;  5BT1 D;  5B1L C;  3FDD A;  5AVB A;  3UTA C;  3AV2 D;  4XUJ A;  5JRG D;  3MGQ A;  5AVC B;  3X1U B;  1AOI C;  2BG1 A;  3AZH D;  3LEL D;  3AZN C;  1M18 C;  4WV4 B;  2CWE A;  4WU9 A;  5AVB C;  4DRB A;  1ID3 D;  3AZE A;  1KX3 D;  3MGQ C;  5AV5 A;  3A6N A;  3IP4 C;  4CAY A;  1EQZ D;  2NZD B;  4Z66 A;  5B2J D;  3LJA C;  1TZY C;  2DF4 C;  4YM6 B;  3UTB D;  5CPK C;  2F8N G;  3LZ0 A;  3V9R A;  3O62 A;  2HIO B;  2RVQ C;  3AZL B;  3X1V B;  3AZE C;  3W97 A;  5AV5 C;  4J8V D;  5G49 A;  4H9O A;  3A6N C;  1P34 B;  2Y2H A;  3AV2 A;  3NQU B;  1P3F C;  3EPH A;  1JFI A;  4Z66 C;  5E5A B;  5JRG A;  4J8X C;  1P3K D;  2PYO D;  3R45 B;  4QLC C;  3KUY B;  2YFV B;  3AZH A;  5B2I D;  5AV9 A;  3O62 C;  3LZ0 C;  3VH6 A;  3LEL A;  4LD9 B;  4NFT A;  3W97 C;  5BT1 C;  3REI D;  1M19 D;  5AV6 B;  3AV2 C;  1ID3 A;  2F8N K;  4J8W D;  1KX3 A;  3WTP B;  5JRG C;  1TAF B;  1EQZ A;  3W99 B;  5B2J A;  3AFA B;  3AZH C;  1A7W A;  3LEL C;  3X1T A;  3UTB A;  3AZI B;  3VH5 A;  1ID3 C;  3MGR D;  1KX3 C;  5B1L B;  4J8V A;  4UUZ A;  3UTA B;  1EQZ C;  3B6G D;  5CP6 A;  5B24 D;  1P3K A;  5B2J C;  4Z5T D;  4R8P A;  3WAA B;  5B32 G;  2PYO A;  1AOI B;  3UTB C;  5GT3 B;  5AV8 D;  4H9P A;  5B2I A;  1M18 B;  3X1S D;  4J8V C;  5AVB B;  3REI A;  3P5J B;  1M19 A;  2Y2L A;  4XUJ B;  3MGQ B;  4J8W A;  1P3K C;  1R4V A;  5JA4 B;  2PYO C;  4JJN A;  5B2I C;  4WU9 B;  3REI C;  1M19 C;  4KGC D;  3AZE B;  4H9S A;  3MGR A;  3WKJ D;  3B0D B;  5AV5 B;  4J8W C;  3A6N B;  4CAY B;  2LY8 A;  5B33 A;  4Z66 B;  3B6G A;  5B24 A;  4Z5T A;  3AN2 D;  3KWQ D;  3MVD D;  3MGP D;  3LZ0 B;  3V9R B;  3O62 B;  4DQY B;  4H9S C;  3MGR C;  1U35 A;  3W97 B;  5G49 B;  1ULY A;  4H9O B;  3X1S A;  3AV2 B;  2FJ7 D;  1JFI B;  3B6G C;  5B24 C;  4Z5T C;  2UWX A;  5B0Z D;  5CPI D;  3AZH B;  2JCH A;  5AV9 B;  5AV8 C;  3LEL B;  4G91 C;  3X1S C;  1P3G D;  1ID3 B;  1Z2C B;  4KGC A;  5B0Y D;  1KX3 B;  3WKJ A;  5GXQ D;  1BH9 A;  1EQZ B;  4ZBJ C;  3AN2 A;  3X1T B;  3UTB B;  3VH5 W;  3KWQ A;  3MVD A;  3MGP A;  2Y2N A;  3C1B D;  4KGC C;  3WKJ C;  4J8V B;  4UUZ B;  4J8U D;  3A1K A;  2FJ7 A;  1T3U A;  5B31 G;  5CP6 B;  1P3K B;  3WA9 D;  4M6B A;  4R8P B;  2PYO B;  4EO5 C;  3AN2 C;  4NE3 A;  5B0Z A;  3KWQ C;  3REJ D;  3MVD C;  3MGP C;  5CPI A;  4H9P B;  5B2I B;  3AV1 D;  3REI B;  1M19 B;  2FJ7 C;  4J8W B;  1HQ3 D;  5GXQ A;  4JJN B;  5CPI C;  5B0Z C;  3AZN A;  4H9Q A;  3AZF D;  4H9N A;  2Y2I A;  4NE5 A;  1B6W A;  4WNN A;  1P3G C;  3C1B A;  3MGR B;  5B0Y C;  5GXQ C;  3LJA A;  4J8U A;  3REK D;  5B33 B;  3B6G B;  3WA9 A;  1TZY A;  2J8P A;  5B24 B;  4Z5T B;  5CPK A;  1P3B D;  1P3I D;  4WU8 D;  4Z2M H;  1BH8 A;  3C1B C;  5B1M B;  4G91 B;  4G92 C;  1U35 B;  4CSR A;  2F2A C;  1P3A D;  3X1S B;  1P3F A;  3AV1 A;  4J8X A;  3AZL D;  1ZLA D;  4J8U C;  4UPK A;  4QLC A;  5B31 A;  3WA9 C;  5DNN D;  5B32 B;  5B40 D;  3REJ C;  4ZBJ B;  4KUD D;  3AV1 C;  5DNM D;  4KGC B;  5CHL B;  4E44 A;  5CPJ D;  3WKJ B;  5B31 C;  1HQ3 C;  5BNX A;  1BH9 B;  3REK A;  1P3O D;  1P3B A;  4EO5 B;  3AZF C;  3AN2 B;  3AYW D;  3MNN D;  3MVD B;  4WU8 A;  3MGP B;  1BFM A;  1P3A A;  1B67 A;  3AZL A;  4KHA A;  1ZLA A;  3REK C;  2FJ7 B;  1F1E A;  5DNN A;  1P3B C;  5B40 A;  5B0Z B;  5CPI B;  3EPK A;  4WU8 C;  1P3A C;  3AZL C;  1ZLA C;  5DNM A;  4Z2M G;  5GSU D;  3TU4 D;  5CPJ A;  5GXQ B;  3KFU G;  5DNN C;  5B40 C;  5AY8 D;  3VH6 T;  3AZN B;  4H9Q B;  3LZ1 D;  1P3O A;  2Y2J A;  4H9N B;  3UT9 D;  1WWS A;  4WNN B;  2ZY2 A;  3AYW A;  4KUD C;  3C1B B;  5DNM C;  4G92 B;  5CPJ C;  3LJA B;  4J8U B;  3WA9 B;  1TZY B;  2G5I C;  3AZG D;  5CPK B;  1P3O C;  1KX5 D;  3VH5 T;  3AYW C;  3MNN C;  2Y2P A;  1BH8 B;  2IO5 C;  1ZLA B;  1P3F B;  4CSR B;  4J8X B;  4E45 A;  3TU4 A;  4QLC B;  5B31 B;  3A1I A;  2NZD D;  2Y2Q A;  5AV8 A;  4AWL C;  3B0C W;  5AY8 A;  3LZ1 A;  3UT9 A;  5JRG B;  2YFW A;  3TU4 C;  5GSU C;  5BNX B;  3KXB D;  3REK B;  2CV5 D;  5AY8 C;  3AZG A;  3KUY D;  3LZ1 C;  1P3B B;  1KX5 A;  3UT9 C;  4WU8 B;  4LD9 D;  2JSS A;  1P3A B;  3AL0 C;  2NQB D;  5B2J B;  4KHA B;  5C3I C;  5BO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...