3MNND

A ruthenium antitumour agent forms specific histone protein adducts in the nucleosome core
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title A ruthenium antimetastasis agent forms specific histone protein adducts in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mnnD00
5AV6D 1S32D 4R8PA 4WU8B 3MGQC 5B2IB 3MGRA 3W97A 2NQBB 5AV6A 1N1JB 4H9NB 3TU4B 1KX5C 1EQZC 4XZQB 3REKC 1P3IB 1P3GD 3REJD 3AZLD 5GSUB 1P3GA 3REJA 3MGPD 3AV2B 1TZYC 1M18B 1M19C 3AZLA 3MGSC 5DNMC 3NQUA 5B2JC 5AV5A 3MGPA 3AZKD 1P3PA 5JRGD 5B40D 4WU8C 5B2IC 5CPJD 3AZKA 3TU4C 2BYKA 5B40A 2YFWB 5CPJA 4XZQC 5B32G 5B32B 3AZNB 3X1VD 1P3IC 1P3LD 3AV1B 3AN2B 1P3MB 4Z2MG 3C1CB 5CPID 3R45B 4X23B 3LZ0C 4J8VB 3X1VA 3MVDD 3AV2C 1P3OB 4Z5TB 5CPIA 1P3PB 4NE3A 3AZFA 3WAAD 2CV5B 2F8NH 3MVDA 4KUDB 5GT0A 2JSSA 5CPKD 3AZHA 5BT1D 1KX4A 2YFVA 4YM6D 5F99D 3A6ND 5CPKA 5AY8B 3AZIB 5B0ZB 4XUJB 5B0YB 4YM6A 5F99A 3A6NA 1BH8A 3UTAD 5BO0B 4Z66D 5B32C 1BH9A 3REJC 3AZNC 1P3GC 3AV1C 4J8WD 2CWEA 1P3MC 5AV8B 4WU9D 5AV5C 3C1CC 3AZFB 1P3AD 4X23C 3NQJA 4Z66A 4J8VC 4NFTA 4J8WA 4WZSB 1P3OC 4WU9A 4KHAB 3AZHB 4M6BA 3KXBA 5AV9D 1P3AA 1P3PC 1KX4B 1P34D 4KUDC 4AWLC 3AZKC 5AV9A 5JA4B 2HIOD 3X1SA 3W98B 3LJAB 4ZUXB 5B1LD 5AY8C 5C3IC 4DRAA 1ID3B 2NZDB 3AZIC 2HIOA 5BNVA 3RELB 3AZED 5B0YC 1H3OA 2HUEB 5B1LA 5B24A 3X1VC 3LZ1B 2F8NK 1M1AD 3AZMB 1P3FB 5AV8C 3AZEA 3AZFC 5B1MD 3WTPD 5GT0C 3AZGD 1WWIA 1M1AA 3VH5A 3O62B 3AZHC 1BFMA 5B1MA 4Z2MH 2PYOD 3WTPA 3AZGA 1KX4C 3AYWB 1AOIA 5BS7C 5CPKC 5B33D 4H9RA 5BT1C 3MGQB 1A7WA 3X1TA 1P3KB 5B33A 4ZUXC 5B24B 4JJND 2NZDC 2BYMA 3AZJD 3RELC 2HUEC 4JJNA 3UTBB 3LZ1C 4J8UB 5CP6D 3AZJA 2F8NB 3AZMC 1P3FC 3KXBC 1P3AC 3MNNB 3X1UB 5CP6A 1KX3D 4H9OB 3AYWC 3O62C 3UT9D 3X1SC 1KX3A 3UT9A 2HIOC 1JFIA 3B6GB 3WKJD 1P3KC 5GT3B 4HGAB 3W99D 5B24C 1S32A 3REHB 5E5AB 3AZEC 3WKJA 5GSUD 3W99A 3UTBC 4J8UC 4G91B 4YS3D 3LZ0B 5GXQD 3MNNC 4QLCD 4LD9D 3X1UC 1P3BD 3B0BA 3WTPC 3LELD 3AZGC 3MGRD 1AOIC 4YS3A 4QLCA 4LD9A 3W96D 1P3BA 4R8PB 3LELA 3MGRB 4J8XD 3X1TC 3W97B 5AV6B 1F1EA 5G49A 3VH6A 4J8XA 3B6GC 3KUYD 4JJNC 5GT3C 4HGAC 5JRGA 5E5AC 3REHC 3KUYA 1P3GB 3REJB 3AZLB 3NQUB 5AV5B 4G91C 1TAFA 3MGPB 2CV5D 1P3LA 3WA9D 3B6FD 5BNXA 3UT9C 3KWQD 4R8PC 4AWLB 4NE5A 3MGRC 1ZLAD 3WA9A 3AZKB 3W97C 5AV6C 3WAAA 5DNND 2BYKB 3V9RA 1S32C 3KWQA 5B40B 5B0ZD 3WKJC 1ZLAA 5CPJB 2FJ7D 5C3IB 5DNNA 1F66D 5B31D 2FJ7A 3VH5W 4H9SA 3X1VB 5KDMA 1F66A 5B31A 3AFAD 5CPIB 3AZLC 4EO5B 4YS3C 4QLCC 3MVDB 3UTAA 5GT0B 3MGPC 3AFAA 1P3BC 3VH5T 4UUZA 3REID 2YFVB 2AROD 4J8XC 5CPKB 4H9QA 5AVCD 3REIA 4CSRA 5JRGC 1P34A 4YM6B 5B40C 2AROA 5F99B 3A6NB 1BH8B 5AVCA 5CPJC 1BH9B 4KGCD 3NQJB 4Z66B 1P3LC 4J8WB 4KGCA 4E45A 4WU9B 5CPIC 3KXBB 1P3AB 4EO5C 2RVQD 3MVDC 4H9QB 1HQ3D 5AVBD 3AYWD 5AV9B 3WAAC 3X1SB 1P34B 1HQ3A 5AVBA 2HIOB 2PYOA 5FUGA 5BNVB 1KX5D 1EQZD 4YM6C 1H3OB 5F99C 3A6NC 5B1LB 3REKD 1B6WA 1U35D 1KX5A 3AZEB 1EQZA 4WNNA 3UTAC 4Z66C 1M1AB 4J8WC 1TZYD 1M19D 1U35A 4WU9C 3MGSD 5DNMD 5B2JD 5B1MB 3WTPB 1ULYA 3AZGB 1AOIB 1TZYA 1M19A 4H9RB 3MGSA 5DNMA 5B2JA 5AV9C 1Q9CA 3C1BD 3X1TB 1P34C 5B33B 4WU8D 5AVCC 5B2ID 4H9PA 3C1BA 2NQBD 2BYMB 3TU4D 4JJNB 5B1LC 4XZQD 1P3ID 2NQBA 3AZJB 4KGCC 1N1JA 4H9NA 3TU4A 4G92B 2LY8A 1P3IA 5CP6B 2L5AA 1M1AC 3AV2D 1M18D 5GSUA 5B1MC 3B0DC 1KX3B 3AV2A 1M18A 3UT9B 5GXQA 1JFIB 2PYOC 5B33C 1S32B 3W96A 3WKJB 4ZBJC 3W99B 5B32D 3AZND 3AZJC 3AV1D 3AN2D 1U35C 1P3MD 5AV5D 3C1CD 4X23D 2YFWA 4G92C 4WV4B 5B32A 5CP6C 4J8VD 3AZNA 3AV1A 3AN2A 1P3MA 1P3OD 4Z5TD 4YS3B 3C1CA 5GXQB 4QLCB 3R45A 1P3PD 4X23A 1P3BB 4LD9B 3B0CW 3LELB 4J8VA 1KX3C 4KUDD 1P3OA 4Z5TA 3C1BC 5G49B 3W96B 2CV5A 4J8XB 4KUDA 3B6FA 3B0CT 5AY8D 2NQBC 3AZID 5JRGB 4XUJD 3KUYB 5B0YD 1HTAA 3W99C 5AY8A 3AZIA 5B0ZA 4XUJA 5GSUC 5AV8D 1TAFB 5B0YA 3AZFD 1P3LB 5BO0A 5GT0D 1M18C 5BNXB 5AV8A 3AZHD 4NE6A 5GXQC 4LD9C 3LELC 1KX4D 3WA9B 3B6FB 3WAAB 4KHAA 3V9RB 3KWQB 3W96C 1ZLAB 3W98D 5BS7A 3LJAD 5DNNB 4ZUXD 1ID3D 5JA4A 2NZDD 2FJ7B 3W98A 5CHLB 3RELD 3LJAA 3KUYC 5KDMB 4ZUXA 1F66B 5B31G 5B31B 3LZ1D 1ID3A 2NZDA 3AN2C 3AZMD 1P3FD 3RELA 3KXBD 4CAYA 3UTAB 3AFAB 3LZ1A 4Z5TC 4UUZB 3AZMA 1P3FA 2IO5B 3O62D 1R4VA 2CV5C 3X1SD 3WA9C 3B6FC 3O62A 4CSRB 3REIB 3KWQC 2AROB 1ZLAC 5AVCB 3MGQD 3AYWA 1P3KD 5DNNC 5B24D 5B0ZC 4XUJC 2FJ7C 3MGQA 4H9SC 3KSYA 4CAYB 1P3KA 1F66C 4KGCB 5B31C 3UTBD 4J8UD 2F8ND 3REKA 3MNND 4DRBA 3X1UD 3AFAC 3UTBA 4J8UA 1AOID 2F8NA 2IO5C 3B0DB 3MNNA 3X1UA 1HQ3B 5AVBB 3VH6W 3X1TD 4H9OA 3REIC 2PYOB 5FUGB 2AROC 3W98C 3LJAC 3B6GD 5GT3D 1ID3C 1KX5B 3VH6T 1EQZB 1KU5A 3REHD 5E5AD 4WNNB 4ZBJB 4WU8A 5B2IA 1B67A 3REKB 3B6GA 5GT3A 1U35B 3REHA 5E5AA 2F8NG 1WWSA 4XZQA 3LZ0D 1TZYB 1M19B 4E44A 3MGSB 5DNMB 5B2JB 2RVQC 3LZ0A 3WTPE 4R8PD 1HQ3C 5AVBC 4H9PB 3C1BB 3W97D
chains in the Genus database with same CATH superfamily
5AV6D 3FDDA 2ZY5A 3EPLA 1S32D 4R8PA 4WU8B 3MGQC 5B2IB 2Y2HA 3MGRA 3W97A 2NQBB 5AV6A 1N1JB 4H9NB 3TU4B 1KX5C 1EQZC 4XZQB 3REKC 1P3IB 1P3GD 2VQRA 3REJD 3AZLD 5GSUB 1P3GA 3REJA 3MGPD 3AV2B 1TZYC 3F6TA 1M18B 1M19C 3AZLA 3MGSC 5DNMC 3NQUA 5B2JC 5AV5A 3H0LC 3MGPA 2BG1A 3AZKD 1P3PA 5JRGD 5B40D 4WU8C 5B2IC 2Y2PA 5CPJD 3AZKA 3TU4C 2BYKA 5B40A 2YFWB 5CPJA 4DQYB 4XZQC 3AL0C 5B32G 5B32B 3AZNB 3X1VD 1P3IC 1P3LD 3AV1B 3AN2B 1P3MB 4Z2MG 3C1CB 5CPID 3R45B 4X23B 3LZ0C 4J8VB 3X1VA 3MVDD 3AV2C 1P3OB 4Z5TB 4UPKA 5CPIA 2ZY2A 4NE3A 3AZFA 1P3PB 3WAAD 2CV5B 2F8NH 3MVDA 4KUDB 5GT0A 2JSSA 5CPKD 3AZHA 5BT1D 1KX4A 2YFVA 4YM6D 5F99D 3A6ND 5CPKA 5AY8B 3AZIB 2RIQA 5B0ZB 4XUJB 5B0YB 4YM6A 5F99A 3A6NA 1BH8A 3UTAD 5BO0B 4Z66D 5B32C 1BH9A 3REJC 3AZNC 1P3GC 3AV1C 4J8WD 2CWEA 1P3MC 5AV8B 4WU9D 5AV5C 3C1CC 3AZFB 1P3AD 4X23C 3NQJA 4Z66A 4J8VC 4NFTA 4J8WA 4WZSB 1P3OC 4WU9A 4KHAB 3AZHB 4M6BA 3KXBA 5AV9D 1P3AA 1P3PC 1KX4B 2G5HC 1P34D 4AWLC 4KUDC 3AZKC 5AV9A 5JA4B 2HIOD 3X1SA 3W98B 3LJAB 4ZUXB 5B1LD 5AY8C 5C3IC 4DRAA 1ID3B 2NZDB 2ZY4A 3AZIC 2HIOA 5BNVA 3RELB 3AZED 5B0YC 1H3OA 2HUEB 3P5JB 5B1LA 5B24A 2JCHA 3X1VC 3LZ1B 2F8NK 1M1AD 3AZMB 1P3FB 5AV8C 3AZEA 3AZFC 5B1MD 2Y2GA 3WTPD 5GT0C 3AZGD 1WWIA 1M1AA 3VH5A 3O62B 3AZHC 1BFMA 5B1MA 4Z2MH 2PYOD 3WTPA 3AZGA 1KX4C 2FFFB 3AYWB 1AOIA 5BS7C 5CPKC 5B33D 4H9RA 5BT1C 3MGQB 1A7WA 3X1TA 1P3KB 5B33A 4ZUXC 5B24B 4JJND 2NZDC 2BYMA 3AZJD 3RELC 2HUEC 4JJNA 3UTBB 2JE5A 3LZ1C 4J8UB 5CP6D 3AZJA 2F8NB 3AZMC 1P3FC 3KXBC 1P3AC 3MNNB 3X1UB 5CP6A 1KX3D 4H9OB 3AYWC 3O62C 3UT9D 3X1SC 1KX3A 3UT9A 2HIOC 1JFIA 3B6GB 3WKJD 1P3KC 5GT3B 4HGAB 3W99D 5B24C 3EG5B 1S32A 3REHB 5E5AB 3AZEC 3WKJA 5GSUD 3W99A 3UTBC 4J8UC 4G91B 4YS3D 3LZ0B 5GXQD 3MNNC 4QLCD 4LD9D 3X1UC 1P3BD 3B0BA 3WTPC 3LELD 3AZGC 3MGRD 1AOIC 4YS3A 4QLCA 4LD9A 3W96D 1P3BA 4R8PB 3LELA 3MGRB 4J8XD 3X1TC 3W97B 5AV6B 1F1EA 5G49A 3H0RC 3VH6A 4J8XA 3B6GC 3KUYD 4JJNC 5GT3C 4HGAC 3KFUG 5JRGA 5E5AC 3REHC 3KUYA 1P3GB 3REJB 3AZLB 3NQUB 5AV5B 4G91C 1TAFA 3MGPB 2CV5D 1P3LA 3WA9D 3B6FD 5BNXA 3UT9C 3KWQD 4R8PC 4AWLB 4NE5A 3MGRC 1ZLAD 3WA9A 3AZKB 3W97C 5AV6C 3WAAA 5DNND 2BYKB 3V9RA 1S32C 3KWQA 5B40B 5B0ZD 3WKJC 1ZLAA 5CPJB 2FJ7D 5C3IB 5DNNA 1F66D 2XD5A 5B31D 2FJ7A 3VH5W 4H9SA 3X1VB 5KDMA 1F66A 5B31A 3AFAD 5CPIB 3AZLC 4EO5B 4YS3C 4QLCC 3MVDB 3UTAA 5GT0B 3MGPC 3AFAA 1P3BC 3VH5T 2Y2OA 4UUZA 3REID 2YFVB 2AROD 2Y2LA 4J8XC 4H9QA 5CPKB 5AVCD 3REIA 4CSRA 5JRGC 1P34A 4YM6B 5B40C 2AROA 5F99B 3A6NB 1BH8B 5AVCA 5CPJC 1BH9B 4KGCD 3NQJB 4Z66B 1P3LC 4J8WB 4KGCA 4E45A 4WU9B 5CPIC 3KXBB 1P3AB 4EO5C 2RVQD 3MVDC 1PZRA 4H9QB 1HQ3D 2ZY3A 5AVBD 3AYWD 5AV9B 3WAAC 3X1SB 1P34B 1HQ3A 5AVBA 2XD1A 2HIOB 2PYOA 5FUGA 5BNVB 1KX5D 1EQZD 4YM6C 1H3OB 5F99C 3A6NC 5B1LB 3REKD 1B6WA 1U35D 1KX5A 3AZEB 1EQZA 4WNNA 3UTAC 4Z66C 1M1AB 4J8WC 1TZYD 1M19D 1U35A 4WU9C 3MGSD 5DNMD 5B2JD 5B1MB 3IP4C 3WTPB 1ULYA 3AZGB 1AOIB 1TZYA 1M19A 4H9RB 3MGSA 5DNMA 5B2JA 3A1KA 1Q9CA 5AV9C 3C1BD 3X1TB 1P34C 5B33B 4WU8D 5AVCC 5B2ID 4H9PA 3C1BA 2NQBD 2BYMB 3EPJA 3TU4D 4JJNB 5B1LC 4XZQD 1P3ID 2NQBA 3AZJB 4KGCC 1N1JA 4H9NA 3TU4A 4WJ3C 4G92B 2LY8A 1P3IA 5CP6B 2L5AA 1M1AC 2G5IC 3AV2D 1M18D 2J8PA 2Y2NA 5GSUA 5B1MC 3B0DC 1KX3B 3AV2A 1M18A 3UT9B 2DQNC 5GXQA 1JFIB 2PYOC 5B33C 1S32B 3W96A 3WKJB 1W2EA 4ZBJC 3W99B 5B32D 3AZND 3AZJC 3AV1D 3AN2D 1U35C 1P3MD 5AV5D 3C1CD 4X23D 2YFWA 4G92C 4WV4B 5B32A 5CP6C 4J8VD 3AZNA 3AV1A 3AN2A 1P3MA 1P3OD 4Z5TD 2UWXA 4YS3B 3C1CA 5GXQB 4QLCB 3R45A 1P3PD 4X23A 1P3BB 4LD9B 2F2AC 3B0CW 3LELB 4J8VA 1KX3C 4KUDD 1P3OA 4Z5TA 3C1BC 5G49B 3W96B 2CV5A 4J8XB 4KUDA 3B6FA 3B0CT 5AY8D 2NQBC 2ZM5A 5JRGB 3AZID 2Y2QA 4XUJD 3EPKA 3KUYB 5B0YD 1HTAA 3W99C 5AY8A 3AZIA 5B0ZA 4XUJA 5GSUC 5AV8D 1TAFB 5B0YA 3AZFD 1P3LB 2W8SA 5BO0A 5GT0D 1M18C 5BNXB 5AV8A 3AZHD 4NE6A 5GXQC 4LD9C 3LELC 1KX4D 3WA9B 3B6FB 3WAAB 4KHAA 2Y2IA 3V9RB 3KWQB 3W96C 2Y2KA 1Z2CB 1ZLAB 3W98D 5BS7A 3LJAD 5DNNB 4ZUXD 1ID3D 5JA4A 2NZDD 3A1IA 2FJ7B 3W98A 5CHLB 3RELD 3LJAA 3KUYC 5KDMB 4ZUXA 1F66B 5B31G 5B31B 3LZ1D 1ID3A 2NZDA 3AN2C 3AZMD 1P3FD 3RELA 3KXBD 4CAYA 3UTAB 3AFAB 3LZ1A 4Z5TC 4UUZB 3AZMA 1P3FA 2IO5B 3O62D 1R4VA 2CV5C 3X1SD 3WA9C 1T3UA 3B6FC 3O62A 4CSRB 3REIB 3KWQC 2AROB 1ZLAC 5AVCB 3MGQD 3AYWA 1P3KD 5DNNC 5B24D 2DF4C 5B0ZC 3H0MC 4XUJC 2FJ7C 3MGQA 3EPHA 4H9SC 3KSYA 4CAYB 1P3KA 1F66C 4KGCB 5B31C 3UTBD 4J8UD 2F8ND 3REKA 3MNND 4DRBA 3X1UD 3AFAC 3UTBA 4J8UA 1AOID 2F8NA 2IO5C 3B0DB 3MNNA 3X1UA 1HQ3B 5AVBB 3VH6W 3X1TD 4H9OA 3REIC 2PYOB 5FUGB 2Y2MA 2AROC 3W98C 3LJAC 3B6GD 5GT3D 1ID3C 1KX5B 3VH6T 1EQZB 1KU5A 3REHD 5E5AD 4WNNB 4ZBJB 4WU8A 5B2IA 1B67A 3REKB 3B6GA 5GT3A 1U35B 3REHA 5E5AA 2F8NG 1WWSA 4XZQA 3LZ0D 1TZYB 1M19B 4E44A 3MGSB 5DNMB 5B2JB 2RVQC 3LZ0A 2Y2JA 3WTPE 4R8PD 1HQ3C 5AVBC 4H9PB 3C1BB 3W97D
chains in the Genus database with same CATH topology
5AV6D 3FDDA 2ZY5A 3EPLA 1S32D 4R8PA 4WU8B 3MGQC 5B2IB 2Y2HA 3MGRA 3W97A 2NQBB 5AV6A 1N1JB 4H9NB 3TU4B 1KX5C 1EQZC 4XZQB 3REKC 1P3IB 1P3GD 2VQRA 3REJD 3AZLD 5GSUB 1P3GA 3REJA 3MGPD 3AV2B 1TZYC 3F6TA 1M18B 1M19C 3AZLA 3MGSC 5DNMC 3NQUA 5B2JC 5AV5A 3H0LC 3MGPA 2BG1A 3AZKD 1P3PA 5JRGD 5B40D 4WU8C 5B2IC 2Y2PA 5CPJD 3AZKA 3TU4C 2BYKA 5B40A 2YFWB 5CPJA 4DQYB 4XZQC 3AL0C 5B32G 5B32B 3AZNB 3X1VD 1P3IC 1P3LD 3AV1B 3AN2B 1P3MB 4Z2MG 3C1CB 5CPID 3R45B 4X23B 3LZ0C 4J8VB 3X1VA 3MVDD 3AV2C 1P3OB 4Z5TB 4UPKA 5CPIA 2ZY2A 4NE3A 3AZFA 1P3PB 3WAAD 2CV5B 2F8NH 3MVDA 4KUDB 5GT0A 2JSSA 5CPKD 3AZHA 5BT1D 1KX4A 2YFVA 4YM6D 5F99D 3A6ND 5CPKA 5AY8B 3AZIB 2RIQA 5B0ZB 4XUJB 5B0YB 4YM6A 5F99A 3A6NA 1BH8A 3UTAD 5BO0B 4Z66D 5B32C 1BH9A 3REJC 3AZNC 1P3GC 3AV1C 4J8WD 2CWEA 1P3MC 5AV8B 4WU9D 5AV5C 3C1CC 3AZFB 1P3AD 4X23C 3NQJA 4Z66A 4J8VC 4NFTA 4J8WA 4WZSB 1P3OC 4WU9A 4KHAB 3AZHB 4M6BA 3KXBA 5AV9D 1P3AA 1P3PC 1KX4B 2G5HC 1P34D 4AWLC 4KUDC 3AZKC 5AV9A 5JA4B 2HIOD 3X1SA 3W98B 3LJAB 4ZUXB 5B1LD 5AY8C 5C3IC 4DRAA 1ID3B 2NZDB 2ZY4A 3AZIC 2HIOA 5BNVA 3RELB 3AZED 5B0YC 1H3OA 2HUEB 3P5JB 5B1LA 5B24A 2JCHA 3X1VC 3LZ1B 2F8NK 1M1AD 3AZMB 1P3FB 5AV8C 3AZEA 3AZFC 5B1MD 2Y2GA 3WTPD 5GT0C 3AZGD 1WWIA 1M1AA 3VH5A 3O62B 3AZHC 1BFMA 5B1MA 4Z2MH 2PYOD 3WTPA 3AZGA 1KX4C 2FFFB 3AYWB 1AOIA 5BS7C 5CPKC 5B33D 4H9RA 5BT1C 3MGQB 1A7WA 3X1TA 1P3KB 5B33A 4ZUXC 5B24B 4JJND 2NZDC 2BYMA 3AZJD 3RELC 2HUEC 4JJNA 3UTBB 2JE5A 3LZ1C 4J8UB 5CP6D 3AZJA 2F8NB 3AZMC 1P3FC 3KXBC 1P3AC 3MNNB 3X1UB 5CP6A 1KX3D 4H9OB 3AYWC 3O62C 3UT9D 3X1SC 1KX3A 3UT9A 2HIOC 1JFIA 3B6GB 3WKJD 1P3KC 5GT3B 4HGAB 3W99D 5B24C 3EG5B 1S32A 3REHB 5E5AB 3AZEC 3WKJA 5GSUD 3W99A 3UTBC 4J8UC 4G91B 4YS3D 3LZ0B 5GXQD 3MNNC 4QLCD 4LD9D 3X1UC 1P3BD 3B0BA 3WTPC 3LELD 3AZGC 3MGRD 1AOIC 4YS3A 4QLCA 4LD9A 3W96D 1P3BA 4R8PB 3LELA 3MGRB 4J8XD 3X1TC 3W97B 5AV6B 1F1EA 5G49A 3H0RC 3VH6A 4J8XA 3B6GC 3KUYD 4JJNC 5GT3C 4HGAC 3KFUG 5JRGA 5E5AC 3REHC 3KUYA 1P3GB 3REJB 3AZLB 3NQUB 5AV5B 4G91C 1TAFA 3MGPB 2CV5D 1P3LA 3WA9D 3B6FD 5BNXA 3UT9C 3KWQD 4R8PC 4AWLB 4NE5A 3MGRC 1ZLAD 3WA9A 3AZKB 3W97C 5AV6C 3WAAA 5DNND 2BYKB 3V9RA 1S32C 3KWQA 5B40B 5B0ZD 3WKJC 1ZLAA 5CPJB 2FJ7D 5C3IB 5DNNA 1F66D 2XD5A 5B31D 2FJ7A 3VH5W 4H9SA 3X1VB 5KDMA 1F66A 5B31A 3AFAD 5CPIB 3AZLC 4EO5B 4YS3C 4QLCC 3MVDB 3UTAA 5GT0B 3MGPC 3AFAA 1P3BC 3VH5T 2Y2OA 4UUZA 3REID 2YFVB 2AROD 2Y2LA 4J8XC 4H9QA 5CPKB 5AVCD 3REIA 4CSRA 5JRGC 1P34A 4YM6B 5B40C 2AROA 5F99B 3A6NB 1BH8B 5AVCA 5CPJC 1BH9B 4KGCD 3NQJB 4Z66B 1P3LC 4J8WB 4KGCA 4E45A 4WU9B 5CPIC 3KXBB 1P3AB 4EO5C 2RVQD 3MVDC 1PZRA 4H9QB 1HQ3D 2ZY3A 5AVBD 3AYWD 5AV9B 3WAAC 3X1SB 1P34B 1HQ3A 5AVBA 2XD1A 2HIOB 2PYOA 5FUGA 5BNVB 1KX5D 1EQZD 4YM6C 1H3OB 5F99C 3A6NC 5B1LB 3REKD 1B6WA 1U35D 1KX5A 3AZEB 1EQZA 4WNNA 3UTAC 4Z66C 1M1AB 4J8WC 1TZYD 1M19D 1U35A 4WU9C 3MGSD 5DNMD 5B2JD 5B1MB 3IP4C 3WTPB 1ULYA 3AZGB 1AOIB 1TZYA 1M19A 4H9RB 3MGSA 5DNMA 5B2JA 3A1KA 1Q9CA 5AV9C 3C1BD 3X1TB 1P34C 5B33B 4WU8D 5AVCC 5B2ID 4H9PA 3C1BA 2NQBD 2BYMB 3EPJA 3TU4D 4JJNB 5B1LC 4XZQD 1P3ID 2NQBA 3AZJB 4KGCC 1N1JA 4H9NA 3TU4A 4WJ3C 4G92B 2LY8A 1P3IA 5CP6B 2L5AA 1M1AC 2G5IC 3AV2D 1M18D 2J8PA 2Y2NA 5GSUA 5B1MC 3B0DC 1KX3B 3AV2A 1M18A 3UT9B 2DQNC 5GXQA 1JFIB 2PYOC 5B33C 1S32B 3W96A 3WKJB 1W2EA 4ZBJC 3W99B 5B32D 3AZND 3AZJC 3AV1D 3AN2D 1U35C 1P3MD 5AV5D 3C1CD 4X23D 2YFWA 4G92C 4WV4B 5B32A 5CP6C 4J8VD 3AZNA 3AV1A 3AN2A 1P3MA 1P3OD 4Z5TD 2UWXA 4YS3B 3C1CA 5GXQB 4QLCB 3R45A 1P3PD 4X23A 1P3BB 4LD9B 2F2AC 3B0CW 3LELB 4J8VA 1KX3C 4KUDD 1P3OA 4Z5TA 3C1BC 5G49B 3W96B 2CV5A 4J8XB 4KUDA 3B6FA 3B0CT 5AY8D 2NQBC 2ZM5A 5JRGB 3AZID 2Y2QA 4XUJD 3EPKA 3KUYB 5B0YD 1HTAA 3W99C 5AY8A 3AZIA 5B0ZA 4XUJA 5GSUC 5AV8D 1TAFB 5B0YA 3AZFD 1P3LB 2W8SA 5BO0A 5GT0D 1M18C 5BNXB 5AV8A 3AZHD 4NE6A 5GXQC 4LD9C 3LELC 1KX4D 3WA9B 3B6FB 3WAAB 4KHAA 2Y2IA 3V9RB 3KWQB 3W96C 2Y2KA 1Z2CB 1ZLAB 3W98D 5BS7A 3LJAD 5DNNB 4ZUXD 1ID3D 5JA4A 2NZDD 3A1IA 2FJ7B 3W98A 5CHLB 3RELD 3LJAA 3KUYC 5KDMB 4ZUXA 1F66B 5B31G 5B31B 3LZ1D 1ID3A 2NZDA 3AN2C 3AZMD 1P3FD 3RELA 3KXBD 4CAYA 3UTAB 3AFAB 3LZ1A 4Z5TC 4UUZB 3AZMA 1P3FA 2IO5B 3O62D 1R4VA 2CV5C 3X1SD 3WA9C 1T3UA 3B6FC 3O62A 4CSRB 3REIB 3KWQC 2AROB 1ZLAC 5AVCB 3MGQD 3AYWA 1P3KD 5DNNC 5B24D 2DF4C 5B0ZC 3H0MC 4XUJC 2FJ7C 3MGQA 3EPHA 4H9SC 3KSYA 4CAYB 1P3KA 1F66C 4KGCB 5B31C 3UTBD 4J8UD 2F8ND 3REKA 3MNND 4DRBA 3X1UD 3AFAC 3UTBA 4J8UA 1AOID 2F8NA 2IO5C 3B0DB 3MNNA 3X1UA 1HQ3B 5AVBB 3VH6W 3X1TD 4H9OA 3REIC 2PYOB 5FUGB 2Y2MA 2AROC 3W98C 3LJAC 3B6GD 5GT3D 1ID3C 1KX5B 3VH6T 1EQZB 1KU5A 3REHD 5E5AD 4WNNB 4ZBJB 4WU8A 5B2IA 1B67A 3REKB 3B6GA 5GT3A 1U35B 3REHA 5E5AA 2F8NG 1WWSA 4XZQA 3LZ0D 1TZYB 1M19B 4E44A 3MGSB 5DNMB 5B2JB 2RVQC 3LZ0A 2Y2JA 3WTPE 4R8PD 1HQ3C 5AVBC 4H9PB 3C1BB 3W97D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 D;  1S32 D;  4R8P A;  4WU8 B;  3MGQ C;  5B2I B;  3MGR A;  3W97 A;  2NQB B;  5AV6 A;  1N1J B;  4H9N B;  3TU4 B;  1KX5 C;  1EQZ C;  4XZQ B;  3REK C;  1P3I B;  1P3G D;  3REJ D;  3AZL D;  5GSU B;  1P3G A;  3REJ A;  3MGP D;  3AV2 B;  1TZY C;  1M18 B;  1M19 C;  3AZL A;  3MGS C;  5DNM C;  3NQU A;  5B2J C;  5AV5 A;  3MGP A;  3AZK D;  1P3P A;  5JRG D;  5B40 D;  4WU8 C;  5B2I C;  5CPJ D;  3AZK A;  3TU4 C;  2BYK A;  5B40 A;  2YFW B;  5CPJ A;  4XZQ C;  5B32 G;  5B32 B;  3AZN B;  3X1V D;  1P3I C;  1P3L D;  3AV1 B;  3AN2 B;  1P3M B;  4Z2M G;  3C1C B;  5CPI D;  3R45 B;  4X23 B;  3LZ0 C;  4J8V B;  3X1V A;  3MVD D;  3AV2 C;  1P3O B;  4Z5T B;  5CPI A;  1P3P B;  4NE3 A;  3AZF A;  3WAA D;  2CV5 B;  2F8N H;  3MVD A;  4KUD B;  5GT0 A;  2JSS A;  5CPK D;  3AZH A;  5BT1 D;  1KX4 A;  2YFV A;  4YM6 D;  5F99 D;  3A6N D;  5CPK A;  5AY8 B;  3AZI B;  5B0Z B;  4XUJ B;  5B0Y B;  4YM6 A;  5F99 A;  3A6N A;  1BH8 A;  3UTA D;  5BO0 B;  4Z66 D;  5B32 C;  1BH9 A;  3REJ C;  3AZN C;  1P3G C;  3AV1 C;  4J8W D;  2CWE A;  1P3M C;  5AV8 B;  4WU9 D;  5AV5 C;  3C1C C;  3AZF B;  1P3A D;  4X23 C;  3NQJ A;  4Z66 A;  4J8V C;  4NFT A;  4J8W A;  4WZS B;  1P3O C;  4WU9 A;  4KHA B;  3AZH B;  4M6B A;  3KXB A;  5AV9 D;  1P3A A;  1P3P C;  1KX4 B;  1P34 D;  4KUD C;  4AWL C;  3AZK C;  5AV9 A;  5JA4 B;  2HIO D;  3X1S A;  3W98 B;  3LJA B;  4ZUX B;  5B1L D;  5AY8 C;  5C3I C;  4DRA A;  1ID3 B;  2NZD B;  3AZI C;  2HIO A;  5BNV A;  3REL B;  3AZE D;  5B0Y C;  1H3O A;  2HUE B;  5B1L A;  5B24 A;  3X1V C;  3LZ1 B;  2F8N K;  1M1A D;  3AZM B;  1P3F B;  5AV8 C;  3AZE A;  3AZF C;  5B1M D;  3WTP D;  5GT0 C;  3AZG D;  1WWI A;  1M1A A;  3VH5 A;  3O62 B;  3AZH C;  1BFM A;  5B1M A;  4Z2M H;  2PYO D;  3WTP A;  3AZG A;  1KX4 C;  3AYW B;  1AOI A;  5BS7 C;  5CPK C;  5B33 D;  4H9R A;  5BT1 C;  3MGQ B;  1A7W A;  3X1T A;  1P3K B;  5B33 A;  4ZUX C;  5B24 B;  4JJN D;  2NZD C;  2BYM A;  3AZJ D;  3REL C;  2HUE C;  4JJN A;  3UTB B;  3LZ1 C;  4J8U B;  5CP6 D;  3AZJ A;  2F8N B;  3AZM C;  1P3F C;  3KXB C;  1P3A C;  3MNN B;  3X1U B;  5CP6 A;  1KX3 D;  4H9O B;  3AYW C;  3O62 C;  3UT9 D;  3X1S C;  1KX3 A;  3UT9 A;  2HIO C;  1JFI A;  3B6G B;  3WKJ D;  1P3K C;  5GT3 B;  4HGA B;  3W99 D;  5B24 C;  1S32 A;  3REH B;  5E5A B;  3AZE C;  3WKJ A;  5GSU D;  3W99 A;  3UTB C;  4J8U C;  4G91 B;  4YS3 D;  3LZ0 B;  5GXQ D;  3MNN C;  4QLC D;  4LD9 D;  3X1U C;  1P3B D;  3B0B A;  3WTP C;  3LEL D;  3AZG C;  3MGR D;  1AOI C;  4YS3 A;  4QLC A;  4LD9 A;  3W96 D;  1P3B A;  4R8P B;  3LEL A;  3MGR B;  4J8X D;  3X1T C;  3W97 B;  5AV6 B;  1F1E A;  5G49 A;  3VH6 A;  4J8X A;  3B6G C;  3KUY D;  4JJN C;  5GT3 C;  4HGA C;  5JRG A;  5E5A C;  3REH C;  3KUY A;  1P3G B;  3REJ B;  3AZL B;  3NQU B;  5AV5 B;  4G91 C;  1TAF A;  3MGP B;  2CV5 D;  1P3L A;  3WA9 D;  3B6F D;  5BNX A;  3UT9 C;  3KWQ D;  4R8P C;  4AWL B;  4NE5 A;  3MGR C;  1ZLA D;  3WA9 A;  3AZK B;  3W97 C;  5AV6 C;  3WAA A;  5DNN D;  2BYK B;  3V9R A;  1S32 C;  3KWQ A;  5B40 B;  5B0Z D;  3WKJ C;  1ZLA A;  5CPJ B;  2FJ7 D;  5C3I B;  5DNN A;  1F66 D;  5B31 D;  2FJ7 A;  3VH5 W;  4H9S A;  3X1V B;  5KDM A;  1F66 A;  5B31 A;  3AFA D;  5CPI B;  3AZL C;  4EO5 B;  4YS3 C;  4QLC C;  3MVD B;  3UTA A;  5GT0 B;  3MGP C;  3AFA A;  1P3B C;  3VH5 T;  4UUZ A;  3REI D;  2YFV B;  2ARO D;  4J8X C;  5CPK B;  4H9Q A;  5AVC D;  3REI A;  4CSR A;  5JRG C;  1P34 A;  4YM6 B;  5B40 C;  2ARO A;  5F99 B;  3A6N B;  1BH8 B;  5AVC A;  5CPJ C;  1BH9 B;  4KGC D;  3NQJ B;  4Z66 B;  1P3L C;  4J8W B;  4KGC A;  4E45 A;  4WU9 B;  5CPI C;  3KXB B;  1P3A B;  4EO5 C;  2RVQ D;  3MVD C;  4H9Q B;  1HQ3 D;  5AVB D;  3AYW D;  5AV9 B;  3WAA C;  3X1S B;  1P34 B;  1HQ3 A;  5AVB A;  2HIO B;  2PYO A;  5FUG A;  5BNV B;  1KX5 D;  1EQZ D;  4YM6 C;  1H3O B;  5F99 C;  3A6N C;  5B1L B;  3REK D;  1B6W A;  1U35 D;  1KX5 A;  3AZE B;  1EQZ A;  4WNN A;  3UTA C;  4Z66 C;  1M1A B;  4J8W C;  1TZY D;  1M19 D;  1U35 A;  4WU9 C;  3MGS D;  5DNM D;  5B2J D;  5B1M B;  3WTP B;  1ULY A;  3AZG B;  1AOI B;  1TZY A;  1M19 A;  4H9R B;  3MGS A;  5DNM A;  5B2J A;  5AV9 C;  1Q9C A;  3C1B D;  3X1T B;  1P34 C;  5B33 B;  4WU8 D;  5AVC C;  5B2I D;  4H9P A;  3C1B A;  2NQB D;  2BYM B;  3TU4 D;  4JJN B;  5B1L C;  4XZQ D;  1P3I D;  2NQB A;  3AZJ B;  4KGC C;  1N1J A;  4H9N A;  3TU4 A;  4G92 B;  2LY8 A;  1P3I A;  5CP6 B;  2L5A A;  1M1A C;  3AV2 D;  1M18 D;  5GSU A;  5B1M C;  3B0D C;  1KX3 B;  3AV2 A;  1M18 A;  3UT9 B;  5GXQ A;  1JFI B;  2PYO C;  5B33 C;  1S32 B;  3W96 A;  3WKJ B;  4ZBJ C;  3W99 B;  5B32 D;  3AZN D;  3AZJ C;  3AV1 D;  3AN2 D;  1U35 C;  1P3M D;  5AV5 D;  3C1C D;  4X23 D;  2YFW A;  4G92 C;  4WV4 B;  5B32 A;  5CP6 C;  4J8V D;  3AZN A;  3AV1 A;  3AN2 A;  1P3M A;  1P3O D;  4Z5T D;  4YS3 B;  3C1C A;  5GXQ B;  4QLC B;  3R45 A;  1P3P D;  4X23 A;  1P3B B;  4LD9 B;  3B0C W;  3LEL B;  4J8V A;  1KX3 C;  4KUD D;  1P3O A;  4Z5T A;  3C1B C;  5G49 B;  3W96 B;  2CV5 A;  4J8X B;  4KUD A;  3B6F A;  3B0C T;  5AY8 D;  2NQB C;  3AZI D;  5JRG B;  4XUJ D;  3KUY B;  5B0Y D;  1HTA A;  3W99 C;  5AY8 A;  3AZI A;  5B0Z A;  4XUJ A;  5GSU C;  5AV8 D;  1TAF B;  5B0Y A;  3AZF D;  1P3L B;  5BO0 A;  5GT0 D;  1M18 C;  5BNX B;  5AV8 A;  3AZH D;  4NE6 A;  5GXQ C;  4LD9 C;  3LEL C;  1KX4 D;  3WA9 B;  3B6F B;  3WAA B;  4KHA A;  3V9R B;  3KWQ B;  3W96 C;  1ZLA B;  3W98 D;  5BS7 A;  3LJA D;  5DNN B;  4ZUX D;  1ID3 D;  5JA4 A;  2NZD D;  2FJ7 B;  3W98 A;  5CHL B;  3REL D;  3LJA A;  3KUY C;  5KDM B;  4ZUX A;  1F66 B;  5B31 G;  5B31 B;  3LZ1 D;  1ID3 A;  2NZD A;  3AN2 C;  3AZM D;  1P3F D;  3REL A;  3KXB D;  4CAY A;  3UTA B;  3AFA B;  3LZ1 A;  4Z5T C;  4UUZ B;  3AZM A;  1P3F A;  2IO5 B;  3O62 D;  1R4V A;  2CV5 C;  3X1S D;  3WA9 C;  3B6F C;  3O62 A;  4CSR B;  3REI B;  3KWQ C;  2ARO B;  1ZLA C;  5AVC B;  3MGQ D;  3AYW A;  1P3K D;  5DNN C;  5B24 D;  5B0Z C;  4XUJ C;  2FJ7 C;  3MGQ A;  4H9S C;  3KSY A;  4CAY B;  1P3K A;  1F66 C;  4KGC B;  5B31 C;  3UTB D;  4J8U D;  2F8N D;  3REK A;  3MNN D;  4DRB A;  3X1U D;  3AFA C;  3UTB A;  4J8U A;  1AOI D;  2F8N A;  2IO5 C;  3B0D B;  3MNN A;  3X1U A;  1HQ3 B;  5AVB B;  3VH6 W;  3X1T D;  4H9O A;  3REI C;  2PYO B;  5FUG B;  2ARO C;  3W98 C;  3LJA C;  3B6G D;  5GT3 D;  1ID3 C;  1KX5 B;  3VH6 T;  1EQZ B;  1KU5 A;  3REH D;  5E5A D;  4WNN B;  4ZBJ B;  4WU8 A;  5B2I A;  1B67 A;  3REK B;  3B6G A;  5GT3 A;  1U35 B;  3REH A;  5E5A A;  2F8N G;  1WWS A;  4XZQ A;  3LZ0 D;  1TZY B;  1M19 B;  4E44 A;  3MGS B;  5DNM B;  5B2J B;  2RVQ C;  3LZ0 A;  3WTP E;  4R8P D;  1HQ3 C;  5AVB C;  4H9P B;  3C1B B;  3W97 D; 
#chains in the Genus database with same CATH topology
 5AV6 D;  3FDD A;  2ZY5 A;  3EPL A;  1S32 D;  4R8P A;  4WU8 B;  3MGQ C;  5B2I B;  2Y2H A;  3MGR A;  3W97 A;  2NQB B;  5AV6 A;  1N1J B;  4H9N B;  3TU4 B;  1KX5 C;  1EQZ C;  4XZQ B;  3REK C;  1P3I B;  1P3G D;  2VQR A;  3REJ D;  3AZL D;  5GSU B;  1P3G A;  3REJ A;  3MGP D;  3AV2 B;  1TZY C;  3F6T A;  1M18 B;  1M19 C;  3AZL A;  3MGS C;  5DNM C;  3NQU A;  5B2J C;  5AV5 A;  3H0L C;  3MGP A;  2BG1 A;  3AZK D;  1P3P A;  5JRG D;  5B40 D;  4WU8 C;  5B2I C;  2Y2P A;  5CPJ D;  3AZK A;  3TU4 C;  2BYK A;  5B40 A;  2YFW B;  5CPJ A;  4DQY B;  4XZQ C;  3AL0 C;  5B32 G;  5B32 B;  3AZN B;  3X1V D;  1P3I C;  1P3L D;  3AV1 B;  3AN2 B;  1P3M B;  4Z2M G;  3C1C B;  5CPI D;  3R45 B;  4X23 B;  3LZ0 C;  4J8V B;  3X1V A;  3MVD D;  3AV2 C;  1P3O B;  4Z5T B;  4UPK A;  5CPI A;  2ZY2 A;  4NE3 A;  3AZF A;  1P3P B;  3WAA D;  2CV5 B;  2F8N H;  3MVD A;  4KUD B;  5GT0 A;  2JSS A;  5CPK D;  3AZH A;  5BT1 D;  1KX4 A;  2YFV A;  4YM6 D;  5F99 D;  3A6N D;  5CPK A;  5AY8 B;  3AZI B;  2RIQ A;  5B0Z B;  4XUJ B;  5B0Y B;  4YM6 A;  5F99 A;  3A6N A;  1BH8 A;  3UTA D;  5BO0 B;  4Z66 D;  5B32 C;  1BH9 A;  3REJ C;  3AZN C;  1P3G C;  3AV1 C;  4J8W D;  2CWE A;  1P3M C;  5AV8 B;  4WU9 D;  5AV5 C;  3C1C C;  3AZF B;  1P3A D;  4X23 C;  3NQJ A;  4Z66 A;  4J8V C;  4NFT A;  4J8W A;  4WZS B;  1P3O C;  4WU9 A;  4KHA B;  3AZH B;  4M6B A;  3KXB A;  5AV9 D;  1P3A A;  1P3P C;  1KX4 B;  2G5H C;  1P34 D;  4AWL C;  4KUD C;  3AZK C;  5AV9 A;  5JA4 B;  2HIO D;  3X1S A;  3W98 B;  3LJA B;  4ZUX B;  5B1L D;  5AY8 C;  5C3I C;  4DRA A;  1ID3 B;  2NZD B;  2ZY4 A;  3AZI C;  2HIO A;  5BNV A;  3REL B;  3AZE D;  5B0Y C;  1H3O A;  2HUE B;  3P5J B;  5B1L A;  5B24 A;  2JCH A;  3X1V C;  3LZ1 B;  2F8N K;  1M1A D;  3AZM B;  1P3F B;  5AV8 C;  3AZE A;  3AZF C;  5B1M D;  2Y2G A;  3WTP D;  5GT0 C;  3AZG D;  1WWI A;  1M1A A;  3VH5 A;  3O62 B;  3AZH C;  1BFM A;  5B1M A;  4Z2M H;  2PYO D;  3WTP A;  3AZG A;  1KX4 C;  2FFF B;  3AYW B;  1AOI A;  5BS7 C;  5CPK C;  5B33 D;  4H9R A;  5BT1 C;  3MGQ B;  1A7W A;  3X1T A;  1P3K B;  5B33 A;  4ZUX C;  5B24 B;  4JJN D;  2NZD C;  2BYM A;  3AZJ D;  3REL C;  2HUE C;  4JJN A;  3UTB B;  2JE5 A;  3LZ1 C;  4J8U B;  5CP6 D;  3AZJ A;  2F8N B;  3AZM C;  1P3F C;  3KXB C;  1P3A C;  3MNN B;  3X1U B;  5CP6 A;  1KX3 D;  4H9O B;  3AYW C;  3O62 C;  3UT9 D;  3X1S C;  1KX3 A;  3UT9 A;  2HIO C;  1JFI A;  3B6G B;  3WKJ D;  1P3K C;  5GT3 B;  4HGA B;  3W99 D;  5B24 C;  3EG5 B;  1S32 A;  3REH B;  5E5A B;  3AZE C;  3WKJ A;  5GSU D;  3W99 A;  3UTB C;  4J8U C;  4G91 B;  4YS3 D;  3LZ0 B;  5GXQ D;  3MNN C;  4QLC D;  4LD9 D;  3X1U C;  1P3B D;  3B0B A;  3WTP C;  3LEL D;  3AZG C;  3MGR D;  1AOI C;  4YS3 A;  4QLC A;  4LD9 A;  3W96 D;  1P3B A;  4R8P B;  3LEL A;  3MGR B;  4J8X D;  3X1T C;  3W97 B;  5AV6 B;  1F1E A;  5G49 A;  3H0R C;  3VH6 A;  4J8X A;  3B6G C;  3KUY D;  4JJN C;  5GT3 C;  4HGA C;  3KFU G;  5JRG A;  5E5A C;  3REH C;  3KUY A;  1P3G B;  3REJ B;  3AZL B;  3NQU B;  5AV5 B;  4G91 C;  1TAF A;  3MGP B;  2CV5 D;  1P3L A;  3WA9 D;  3B6F D;  5BNX A;  3UT9 C;  3KWQ D;  4R8P C;  4AWL B;  4NE5 A;  3MGR C;  1ZLA D;  3WA9 A;  3AZK B;  3W97 C;  5AV6 C;  3WAA A;  5DNN D;  2BYK B;  3V9R A;  1S32 C;  3KWQ A;  5B40 B;  5B0Z D;  3WKJ C;  1ZLA A;  5CPJ B;  2FJ7 D;  5C3I B;  5DNN A;  1F66 D;  2XD5 A;  5B31 D;  2FJ7 A;  3VH5 W;  4H9S A;  3X1V B;  5KDM A;  1F66 A;  5B31 A;  3AFA D;  5CPI B;  3AZL C;  4EO5 B;  4YS3 C;  4QLC C;  3MVD B;  3UTA A;  5GT0 B;  3MGP C;  3AFA A;  1P3B C;  3VH5 T;  2Y2O A;  4UUZ A;  3REI D;  2YFV B;  2ARO D;  2Y2L A;  4J8X C;  4H9Q A;  5CPK B;  5AVC D;  3REI A;  4CSR A;  5JRG C;  1P34 A;  4YM6 B;  5B40 C;  2ARO A;  5F99 B;  3A6N B;  1BH8 B;  5AVC A;  5CPJ C;  1BH9 B;  4KGC D;  3NQJ B;  4Z66 B;  1P3L C;  4J8W B;  4KGC A;  4E45 A;  4WU9 B;  5CPI C;  3KXB B;  1P3A B;  4EO5 C;  2RVQ D;  3MVD C;  1PZR A;  4H9Q B;  1HQ3 D;  2ZY3 A;  5AVB D;  3AYW D;  5AV9 B;  3WAA C;  3X1S B;  1P34 B;  1HQ3 A;  5AVB A;  2XD1 A;  2HIO B;  2PYO A;  5FUG A;  5BNV B;  1KX5 D;  1EQZ D;  4YM6 C;  1H3O B;  5F99 C;  3A6N C;  5B1L B;  3REK D;  1B6W A;  1U35 D;  1KX5 A;  3AZE B;  1EQZ A;  4WNN A;  3UTA C;  4Z66 C;  1M1A B;  4J8W C;  1TZY D;  1M19 D;  1U35 A;  4WU9 C;  3MGS D;  5DNM D;  5B2J D;  5B1M B;  3IP4 C;  3WTP B;  1ULY A;  3AZG B;  1AOI B;  1TZY A;  1M19 A;  4H9R B;  3MGS A;  5DNM A;  5B2J A;  3A1K A;  1Q9C A;  5AV9 C;  3C1B D;  3X1T B;  1P34 C;  5B33 B;  4WU8 D;  5AVC C;  5B2I D;  4H9P A;  3C1B A;  2NQB D;  2BYM B;  3EPJ A;  3TU4 D;  4JJN B;  5B1L C;  4XZQ D;  1P3I D;  2NQB A;  3AZJ B;  4KGC C;  1N1J A;  4H9N A;  3TU4 A;  4WJ3 C;  4G92 B;  2LY8 A;  1P3I A;  5CP6 B;  2L5A A;  1M1A C;  2G5I C;  3AV2 D;  1M18 D;  2J8P A;  2Y2N A;  5GSU A;  5B1M C;  3B0D C;  1KX3 B;  3AV2 A;  1M18 A;  3UT9 B;  2DQN C;  5GXQ A;  1JFI B;  2PYO C;  5B33 C;  1S32 B;  3W96 A;  3WKJ B;  1W2E A;  4ZBJ C;  3W99 B;  5B32 D;  3AZN D;  3AZJ C;  3AV1 D;  3AN2 D;  1U35 C;  1P3M D;  5AV5 D;  3C1C D;  4X23 D;  2YFW A;  4G92 C;  4WV4 B;  5B32 A;  5CP6 C;  4J8V D;  3AZN A;  3AV1 A;  3AN2 A;  1P3M A;  1P3O D;  4Z5T D;  2UWX A;  4YS3 B;  3C1C A;  5GXQ B;  4QLC B;  3R45 A;  1P3P D;  4X23 A;  1P3B B;  4LD9 B;  2F2A C;  3B0C W;  3LEL B;  4J8V A;  1KX3 C;  4KUD D;  1P3O A;  4Z5T A;  3C1B C;  5G49 B;  3W96 B;  2CV5 A;  4J8X B;  4KUD A;  3B6F A;  3B0C T;  5AY8 D;  2NQB C;  2ZM5 A;  5JRG B;  3AZI D;  2Y2Q A;  4XUJ D;  3EPK A;  3KUY B;  5B0Y D;  1HTA A;  3W99 C;  5AY8 A;  3AZI A;  5B0Z A;  4XUJ A;  5GSU C;  5AV8 D;  1TAF B;  5B0Y A;  3AZF D;  1P3L B;  2W8S A;  5BO0 A;  5GT0 D;  1M18 C;  5BNX B;  5AV8 A;  3AZH D;  4NE6 A;  5GXQ C;  4LD9 C;  3LEL C;  1KX4 D;  3WA9 B;  3B6F B;  3WAA B;  4KHA A;  2Y2I A;  3V9R B;  3KWQ B;  3W96 C;  2Y2K A;  1Z2C B;  1ZLA B;  3W98 D;  5BS7 A;  3LJA D;  5DNN B;  4ZUX D;  1ID3 D;  5JA4 A;  2NZD D;  3A1I A;  2FJ7 B;  3W98 A;  5CHL B;  3REL D;  3LJA A;  3KUY C;  5KDM B;  4ZUX A;  1F66 B;  5B31 G;  5B31 B;  3LZ1 D;  1ID3 A;  2NZD A;  3AN2 C;  3AZM D;  1P3F D;  3REL A;  3KXB D;  4CAY A;  3UTA B;  3AFA B;  3LZ1 A;  4Z5T C;  4UUZ B;  3AZM A;  1P3F A;  2IO5 B;  3O62 D;  1R4V A;  2CV5 C;  3X1S D;  3WA9 C;  1T3U A;  3B6F C;  3O62 A;  4CSR B;  3REI B;  3KWQ C;  2ARO B;  1ZLA C;  5AVC B;  3MGQ D;  3AYW A;  1P3K D;  5DNN C;  5B24 D;  2DF4 C;  5B0Z C;  3H0M C;  4XUJ C;  2FJ7 C;  3MGQ A;  3EPH A;  4H9S C;  3KSY A;  4CAY B;  1P3K A;  1F66 C;  4KGC B;  5B31 C;  3UTB D;  4J8U D;  2F8N D;  3REK A;  3MNN D;  4DRB A;  3X1U D;  3AFA C;  3UTB A;  4J8U A;  1AOI D;  2F8N A;  2IO5 C;  3B0D B;  3MNN A;  3X1U A;  1HQ3 B;  5AVB B;  3VH6 W;  3X1T D;  4H9O A;  3REI C;  2PYO B;  5FUG B;  2Y2M A;  2ARO C;  3W98 C;  3LJA C;  3B6G D;  5GT3 D;  1ID3 C;  1KX5 B;  3VH6 T;  1EQZ B;  1KU5 A;  3REH D;  5E5A D;  4WNN B;  4ZBJ B;  4WU8 A;  5B2I A;  1B67 A;  3REK B;  3B6G A;  5GT3 A;  1U35 B;  3REH A;  5E5A A;  2F8N G;  1WWS A;  4XZQ A;  3LZ0 D;  1TZY B;  1M19 B;  4E44 A;  3MGS B;  5DNM B;  5B2J B;  2RVQ C;  3LZ0 A;  2Y2J A;  3WTP E;  4R8P D;  1HQ3 C;  5AVB C;  4H9P B;  3C1B B;  3W97 D; 
#chains in the Genus database with same CATH homology
 5AV6 D;  3FDD A;  2ZY5 A;  3EPL A;  1S32 D;  4R8P A;  4WU8 B;  3MGQ C;  5B2I B;  2Y2H A;  3MGR A;  3W97 A;  2NQB B;  5AV6 A;  1N1J B;  4H9N B;  3TU4 B;  1KX5 C;  1EQZ C;  4XZQ B;  3REK C;  1P3I B;  1P3G D;  2VQR A;  3REJ D;  3AZL D;  5GSU B;  1P3G A;  3REJ A;  3MGP D;  3AV2 B;  1TZY C;  3F6T A;  1M18 B;  1M19 C;  3AZL A;  3MGS C;  5DNM C;  3NQU A;  5B2J C;  5AV5 A;  3H0L C;  3MGP A;  2BG1 A;  3AZK D;  1P3P A;  5JRG D;  5B40 D;  4WU8 C;  5B2I C;  2Y2P A;  5CPJ D;  3AZK A;  3TU4 C;  2BYK A;  5B40 A;  2YFW B;  5CPJ A;  4DQY B;  4XZQ C;  3AL0 C;  5B32 G;  5B32 B;  3AZN B;  3X1V D;  1P3I C;  1P3L D;  3AV1 B;  3AN2 B;  1P3M B;  4Z2M G;  3C1C B;  5CPI D;  3R45 B;  4X23 B;  3LZ0 C;  4J8V B;  3X1V A;  3MVD D;  3AV2 C;  1P3O B;  4Z5T B;  4UPK A;  5CPI A;  2ZY2 A;  4NE3 A;  3AZF A;  1P3P B;  3WAA D;  2CV5 B;  2F8N H;  3MVD A;  4KUD B;  5GT0 A;  2JSS A;  5CPK D;  3AZH A;  5BT1 D;  1KX4 A;  2YFV A;  4YM6 D;  5F99 D;  3A6N D;  5CPK A;  5AY8 B;  3AZI B;  2RIQ A;  5B0Z B;  4XUJ B;  5B0Y B;  4YM6 A;  5F99 A;  3A6N A;  1BH8 A;  3UTA D;  5BO0 B;  4Z66 D;  5B32 C;  1BH9 A;  3REJ C;  3AZN C;  1P3G C;  3AV1 C;  4J8W D;  2CWE A;  1P3M C;  5AV8 B;  4WU9 D;  5AV5 C;  3C1C C;  3AZF B;  1P3A D;  4X23 C;  3NQJ A;  4Z66 A;  4J8V C;  4NFT A;  4J8W A;  4WZS B;  1P3O C;  4WU9 A;  4KHA B;  3AZH B;  4M6B A;  3KXB A;  5AV9 D;  1P3A A;  1P3P C;  1KX4 B;  2G5H C;  1P34 D;  4AWL C;  4KUD C;  3AZK C;  5AV9 A;  5JA4 B;  2HIO D;  3X1S A;  3W98 B;  3LJA B;  4ZUX B;  5B1L D;  5AY8 C;  5C3I C;  4DRA A;  1ID3 B;  2NZD B;  2ZY4 A;  3AZI C;  2HIO A;  5BNV A;  3REL B;  3AZE D;  5B0Y C;  1H3O A;  2HUE B;  3P5J B;  5B1L A;  5B24 A;  2JCH A;  3X1V C;  3LZ1 B;  2F8N K;  1M1A D;  3AZM B;  1P3F B;  5AV8 C;  3AZE A;  3AZF C;  5B1M D;  2Y2G A;  3WTP D;  5GT0 C;  3AZG D;  1WWI A;  1M1A A;  3VH5 A;  3O62 B;  3AZH C;  1BFM A;  5B1M A;  4Z2M H;  2PYO D;  3WTP A;  3AZG A;  1KX4 C;  2FFF B;  3AYW B;  1AOI A;  5BS7 C;  5CPK C;  5B33 D;  4H9R A;  5BT1 C;  3MGQ B;  1A7W A;  3X1T A;  1P3K B;  5B33 A;  4ZUX C;  5B24 B;  4JJN D;  2NZD C;  2BYM A;  3AZJ D;  3REL C;  2HUE C;  4JJN A;  3UTB B;  2JE5 A;  3LZ1 C;  4J8U B;  5CP6 D;  3AZJ A;  2F8N B;  3AZM C;  1P3F C;  3KXB C;  1P3A C;  3MNN B;  3X1U B;  5CP6 A;  1KX3 D;  4H9O B;  3AYW C;  3O62 C;  3UT9 D;  3X1S C;  1KX3 A;  3UT9 A;  2HIO C;  1JFI A;  3B6G B;  3WKJ D;  1P3K C;  5GT3 B;  4HGA B;  3W99 D;  5B24 C;  3EG5 B;  1S32 A;  3REH B;  5E5A B;  3AZE C;  3WKJ A;  5GSU D;  3W99 A;  3UTB C;  4J8U C;  4G91 B;  4YS3 D;  3LZ0 B;  5GXQ D;  3MNN C;  4QLC D;  4LD9 D;  3X1U C;  1P3B D;  3B0B A;  3WTP C;  3LEL D;  3AZG C;  3MGR D;  1AOI C;  4YS3 A;  4QLC A;  4LD9 A;  3W96 D;  1P3B A;  4R8P B;  3LEL A;  3MGR B;  4J8X D;  3X1T C;  3W97 B;  5AV6 B;  1F1E A;  5G49 A;  3H0R C;  3VH6 A;  4J8X A;  3B6G C;  3KUY D;  4JJN C;  5GT3 C;  4HGA C;  3KFU G;  5JRG A;  5E5A C;  3REH C;  3KUY A;  1P3G B;  3REJ B;  3AZL B;  3NQU B;  5AV5 B;  4G91 C;  1TAF A;  3MGP B;  2CV5 D;  1P3L A;  3WA9 D;  3B6F D;  5BNX A;  3UT9 C;  3KWQ D;  4R8P C;  4AWL B;  4NE5 A;  3MGR C;  1ZLA D;  3WA9 A;  3AZK B;  3W97 C;  5AV6 C;  3WAA A;  5DNN D;  2BYK B;  3V9R A;  1S32 C;  3KWQ A;  5B40 B;  5B0Z D;  3WKJ C;  1ZLA A;  5CPJ B;  2FJ7 D;  5C3I B;  5DNN A;  1F66 D;  2XD5 A;  5B31 D;  2FJ7 A;  3VH5 W;  4H9S A;  3X1V B;  5KDM A;  1F66 A;  5B31 A;  3AFA D;  5CPI B;  3AZL C;  4EO5 B;  4YS3 C;  4QLC C;  3MVD B;  3UTA A;  5GT0 B;  3MGP C;  3AFA A;  1P3B C;  3VH5 T;  2Y2O A;  4UUZ A;  3REI D;  2YFV B;  2ARO D;  2Y2L A;  4J8X C;  4H9Q A;  5CPK B;  5AVC D;  3REI A;  4CSR A;  5JRG C;  1P34 A;  4YM6 B;  5B40 C;  2ARO A;  5F99 B;  3A6N B;  1BH8 B;  5AVC A;  5CPJ C;  1BH9 B;  4KGC D;  3NQJ B;  4Z66 B;  1P3L C;  4J8W B;  4KGC A;  4E45 A;  4WU9 B;  5CPI C;  3KXB B;  1P3A B;  4EO5 C;  2RVQ D;  3MVD C;  1PZR A;  4H9Q B;  1HQ3 D;  2ZY3 A;  5AVB D;  3AYW D;  5AV9 B;  3WAA C;  3X1S B;  1P34 B;  1HQ3 A;  5AVB A;  2XD1 A;  2HIO B;  2PYO A;  5FUG A;  5BNV B;  1KX5 D;  1EQZ D;  4YM6 C;  1H3O B;  5F99 C;  3A6N C;  5B1L B;  3REK D;  1B6W A;  1U35 D;  1KX5 A;  3AZE B;  1EQZ A;  4WNN A;  3UTA C;  4Z66 C;  1M1A B;  4J8W C;  1TZY D;  1M19 D;  1U35 A;  4WU9 C;  3MGS D;  5DNM D;  5B2J D;  5B1M B;  3IP4 C;  3WTP B;  1ULY A;  3AZG B;  1AOI B;  1TZY A;  1M19 A;  4H9R B;  3MGS A;  5DNM A;  5B2J A;  3A1K A;  1Q9C A;  5AV9 C;  3C1B D;  3X1T B;  1P34 C;  5B33 B;  4WU8 D;  5AVC C;  5B2I D;  4H9P A;  3C1B A;  2NQB D;  2BYM B;  3EPJ A;  3TU4 D;  4JJN B;  5B1L C;  4XZQ D;  1P3I D;  2NQB A;  3AZJ B;  4KGC C;  1N1J A;  4H9N A;  3TU4 A;  4WJ3 C;  4G92 B;  2LY8 A;  1P3I A;  5CP6 B;  2L5A A;  1M1A C;  2G5I C;  3AV2 D;  1M18 D;  2J8P A;  2Y2N A;  5GSU A;  5B1M C;  3B0D C;  1KX3 B;  3AV2 A;  1M18 A;  3UT9 B;  2DQN C;  5GXQ A;  1JFI B;  2PYO C;  5B33 C;  1S32 B;  3W96 A;  3WKJ B;  1W2E A;  4ZBJ C;  3W99 B;  5B32 D;  3AZN D;  3AZJ C;  3AV1 D;  3AN2 D;  1U35 C;  1P3M D;  5AV5 D;  3C1C D;  4X23 D;  2YFW A;  4G92 C;  4WV4 B;  5B32 A;  5CP6 C;  4J8V D;  3AZN A;  3AV1 A;  3AN2 A;  1P3M A;  1P3O D;  4Z5T D;  2UWX A;  4YS3 B;  3C1C A;  5GXQ B;  4QLC B;  3R45 A;  1P3P D;  4X23 A;  1P3B B;  4LD9 B;  2F2A C;  3B0C W;  3LEL B;  4J8V A;  1KX3 C;  4KUD D;  1P3O A;  4Z5T A;  3C1B C;  5G49 B;  3W96 B;  2CV5 A;  4J8X B;  4KUD A;  3B6F A;  3B0C T;  5AY8 D;  2NQB C;  2ZM5 A;  5JRG B;  3AZI D;  2Y2Q A;  4XUJ D;  3EPK A;  3KUY B;  5B0Y D;  1HTA A;  3W99 C;  5AY8 A;  3AZI A;  5B0Z A;  4XUJ A;  5GSU C;  5AV8 D;  1TAF B;  5B0Y A;  3AZF D;  1P3L B;  2W8S A;  5BO0 A;  5GT0 D;  1M18 C;  5BNX B;  5AV8 A;  3AZH D;  4NE6 A;  5GXQ C;  4LD9 C;  3LEL C;  1KX4 D;  3WA9 B;  3B6F B;  3WAA B;  4KHA A;  2Y2I A;  3V9R B;  3KWQ B;  3W96 C;  2Y2K A;  1Z2C B;  1ZLA B;  3W98 D;  5BS7 A;  3LJA D;  5DNN B;  4ZUX D;  1ID3 D;  5JA4 A;  2NZD D;  3A1I A;  2FJ7 B;  3W98 A;  5CHL B;  3REL D;  3LJA A;  3KUY C;  5KDM B;  4ZUX A;  1F66 B;  5B31 G;  5B31 B;  3LZ1 D;  1ID3 A;  2NZD A;  3AN2 C;  3AZM D;  1P3F D;  3REL A;  3KXB D;  4CAY A;  3UTA B;  3AFA B;  3LZ1 A;  4Z5T C;  4UUZ B;  3AZM A;  1P3F A;  2IO5 B;  3O62 D;  1R4V A;  2CV5 C;  3X1S D;  3WA9 C;  1T3U A;  3B6F C;  3O62 A;  4CSR B;  3REI B;  3KWQ C;  2ARO B;  1ZLA C;  5AVC B;  3MGQ D;  3AYW A;  1P3K D;  5DNN C;  5B24 D;  2DF4 C;  5B0Z C;  3H0M C;  4XUJ C;  2FJ7 C;  3MGQ A;  3EPH A;  4H9S C;  3KSY A;  4CAY B;  1P3K A;  1F66 C;  4KGC B;  5B31 C;  3UTB D;  4J8U D;  2F8N D;  3REK A;  3MNN D;  4DRB A;  3X1U D;  3AFA C;  3UTB A;  4J8U A;  1AOI D;  2F8N A;  2IO5 C;  3B0D B;  3MNN A;  3X1U A;  1HQ3 B;  5AVB B;  3VH6 W;  3X1T D;  4H9O A;  3REI C;  2PYO B;  5FUG B;  2Y2M A;  2ARO C;  3W98 C;  3LJA C;  3B6G D;  5GT3 D;  1ID3 C;  1KX5 B;  3VH6 T;  1EQZ B;  1KU5 A;  3REH D;  5E5A D;  4WNN B;  4ZBJ B;  4WU8 A;  5B2I A;  1B67 A;  3REK B;  3B6G A;  5GT3 A;  1U35 B;  3REH A;  5E5A A;  2F8N G;  1WWS A;  4XZQ A;  3LZ0 D;  1TZY B;  1M19 B;  4E44 A;  3MGS B;  5DNM B;  5B2J B;  2RVQ C;  3LZ0 A;  2Y2J A;  3WTP E;  4R8P D;  1HQ3 C;  5AVB C;  4H9P B;  3C1B B;  3W97 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...