3MNND

A ruthenium antitumour agent forms specific histone protein adducts in the nucleosome core
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title A ruthenium antimetastasis agent forms specific histone protein adducts in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mnnD00
3AN2A 5AV5A 4KUDC 4DRBA 5JRGB 3UT9A 1TAFA 2HIOD 3LZ0B 5C3IB 3X1VB 4LD9D 3UTAD 1R4VA 3LELC 1P3GB 3VH6A 3X1UA 5B32A 2AROB 5G49B 3AZEC 3REJD 3W99A 2NZDA 3AYWC 3REIA 1U35B 5AY8A 3AFAB 1ZLAA 1TZYD 4ZBJB 4J8VC 4QLCC 2NQBD 1P34B 4WU8B 3B0DC 4R8PC 5GXQA 4Z2MG 2YFWA 4XUJC 1AOID 3REIB 3B6FA 4H9OA 1ID3B 5DNMD 1P3AD 2YFVA 3AZLC 4WU9C 5AVBA 5B1LD 5CPKB 4H9QA 3A6NB 3MGSD 5B1MA 3C1BB 3MNND 4WNNA 2HUEC 5F99B 4H9OB 5FUGB 4CAYB 5GT3A 5CP6C 3UTBD 3AZIA 5B40B 1EQZD 4UUZA 1P3KB 1P3PC 4M6BA 4X23A 3AZFB 4ZUXA 3REKC 4J8VA 4QLCA 1HQ3C 3UTAC 2PYOB 3KUYD 5B31A 4JJNB 2BYKA 3LZ1D 4YS3A 1M1AA 3WTPA 1HTAA 3VH5T 2RVQD 4HGAC 3REJC 3AV2A 3AFAD 4XZQB 5B33B 2CV5D 5B2ID 5GSUA 5GT0D 3X1TB 1P3OB 3AZLA 3WAAA 1WWSA 5CPJA 5BS7A 4WU8D 1M19C 1TZYC 5B31B 2FJ7A 1KX3B 4KUDD 3WA9B 2NQBC 3AZMC 5CPIA 5B0ZB 5BNXA 4H9PA 5AV6C 3AZHD 3MGPA 5CPJB 5DNMC 1P3AC 3B6GD 4H9SC 3AYWD 5B1LC 5CPIB 3W97B 3MGSC 1KX5D 2HIOA 5F99D 3MGRC 3RELD 3NQUA 4LD9A 3NQJB 5JA4A 3X1SC 4J8UB 3KXBD 4KGCA 4YM6B 3MGQD 4NE6A 4H9RB 3MVDD 5B40D 3REJA 1P3FB 4R8PD 5JRGC 3UTBC 3AZJB 1JFIA 3LZ0C 5C3IC 4XUJD 3X1VC 5DNNB 1TZYA 2AROC 4KGCB 4WU9D 1P3ID 3KUYC 4Z5TD 5B33D 4J8XB 3AZGD 1U35C 3R45B 1ULYA 1AOIA 1JFIB 3AFAC 4J8WB 2CV5C 5GT0C 5B2IC 3AV1D 5DNMA 1P3AA 4ZBJC 1P3BA 4WU8C 3W96D 4Z66D 5CP6D 3TU4B 3LJAB 4EO5B 1KX4A 3MGSA 3WKJD 5AVCB 1P3PD 3MNNA 5BNVA 5AV9B 5AV8D 3REKD 3AZHC 1HQ3D 1M18D 5B0YB 1P3BB 3AZNA 5CPKC 3UTBA 2F8NB 1P3LB 3B6GC 3C1BC 1EQZA 3AN2B 3B0CW 5AV5B 4NE5A 5B2JD 3O62D 5E5AA 3VH6T 3AZKD 1KX5C 5F99C 3RELC 3UT9B 1TAFB 4E45A 1P3MD 1M19D 3KXBC 3LZ1A 3V9RA 3MGQC 3MVDC 5B40C 3X1UB 5B32B 4G91C 3AZMD 5DNND 1P3KC 3W98D 2F8NG 3W99B 2CV5A 5B24D 5GT0A 2NZDB 4G92B 1S32D 2JSSA 2IO5B 5AV6D 2PYOC 1F66A 3REHD 1BH9A 4JJNC 1B67A 5AY8B 3C1CD 1ZLAB 4KUDA 1P3IC 5BO0A 4Z5TC 3KWQD 4XZQC 5B33C 1BFMA 5B32G 3AZGC 3MGRD 3X1TC 5GXQB 2F8NK 2YFWB 3AZHA 4H9NA 3LELA 3X1SD 1BH8A 3AV1C 3LJAD 1F66B 3B6FB 1N1JA 2CWEA 3AZEA 2YFVB 3W96C 4Z66C 3AYWA 3B0BA 5JRGD 1WWIA 5AVBB 1KX5A 3LZ0D 3RELA 3X1VD 3WKJC 4H9QB 5B1MB 1P3GD 3KXBA 2AROD 3LELB 3MGQA 4WNNB 5AV8C 3MVDA 1M18C 1H3OA 2LY8A 1N1JB 4R8PA 1F1EA 5GT3B 3W97C 1U35D 4XUJA 3AZIB 5B2JC 3O62C 4UUZB 3AZKC 4X23B 5B32D 4WU9A 1P34D 1P3IA 1P3MC 4Z5TA 4ZUXB 4J8VB 4QLCB 3W99D 3B0DB 2NZDD 2BYKB 4YS3B 3AZGA 1M1AB 5DNNC 3WTPB 3REID 3W98C 3AV2B 5B24C 1ID3D 3AV1A 1S32C 5GSUB 3REHC 3AZLB 3WAAB 3W96A 5CP6A 3C1CC 5CPKD 3A6ND 4WV4B 1A7WA 3C1BD 3WKJA 1P3PA 2FJ7B 3KWQC 4J8WC 5B31G 5BNXB 4H9PB 5AV8A 3REKA 3UTAA 1HQ3A 1KU5A 3LJAC 4EO5C 3MGPB 1P3KD 5AVCC 3O62A 3AZKA 3AZFD 2F8NH 5AV9C 2PYOD 4NFTA 5CHLB 2HIOB 1P3GC 1P3MA 3NQUB 4JJND 1M19A 4LD9B 5JA4B 4DRAA 2NQBA 4CSRA 3AZMA 5AV5C 3AZID 4XZQD 3REJB 3W98A 1P3OD 5B24A 3X1TD 5KDMA 1S32A 5AV6A 4WZSB 1Q9CA 3C1CA 4KHAA 5B31D 3X1UC 5B32C 1KX3D 1TZYB 3WA9D 1P34C 4AWLB 5B0ZD 4H9SA 3KWQA 5B1LA 3W99C 2NQBB 2NZDC 4G92C 3MGRA 2IO5C 2BYMA 3REIC 5KDMB 3X1SA 5CPJD 1P3LA 1ID3C 1AOIB 1ZLAC 4KHAB 5DNMB 1P3AB 5JRGA 3A6NC 5CPID 3W97D 3LZ0A 3X1VA 1KX4B 3MGSB 4J8UD 4YM6D 2AROA 5G49A 4E44A 3B6FC 3MNNB 3WTPE 1P3FD 5BNVB 3KUYA 3VH5W 5AVBC 3AZJD 3AZNB 4NE3A 1U35A 3UTBB 5B1MC 1EQZB 3AFAA 3AZFC 5B2IA 5E5AB 4KGCD 1P34A 4WU8A 2L5AA 3KUYB 5GT3C 4J8XD 3LZ1B 3V9RB 3AZIC 4J8WD 1P3OC 1ID3A 4X23C 2CV5B 5GT0B 5B2IB 4ZUXC 3TU4D 5CPKA 1BH9B 5B31C 3A6NA 4YS3C 1KX3C 3B6GA 3C1BA 3WA9C 1M1AC 5AVCD 3WTPC 5B0ZC 4KUDB 5BO0B 3AV2C 5F99A 5AV9D 5GSUC 3WAAC 5B0YD 5FUGA 4CAYA 5BT1C 3AZHB 5CPJC 1P3BD 5BS7C 4H9NB 2F8ND 1P3LD 1BH8B 5B40A 3AN2D 1KX4D 1P3KA 5AV5D 2FJ7C 3B6GB 3AZEB 5CPIC 3AZFA 3AYWB 3UT9D 2PYOA 1KX5B 3RELB 4J8UC 4JJNA 4YM6C 3MGPC 3AZND 3X1UD 3KXBB 1P3FC 3MGQB 3MVDB 4G91B 4XZQA 1H3OB 5B33A 3AZJC 1P3OA 3X1TA 5E5AD 4R8PB 3B0CT 2HIOC 3VH5A 4XUJB 4LD9C 5AY8D 1ZLAD 4KGCC 1KX3A 3WA9A 5B0ZA 4Z66A 4WU9B 1P3IB 4Z5TB 4J8XC 5GXQD 3AZGB 1F66D 3B6FD 3AV1B 2HUEB 4AWLC 1M18A 3TU4C 5AVBD 3W97A 3W96B 4Z66B 3VH6W 5CP6B 3KSYA 3NQJA 5B1MD 5B2JA 3WKJB 4J8UA 1P3PB 1AOIC 4YM6A 3LELD 4H9RA 1P3FA 5B0YC 1P3BC 5AV8B 3REKB 3UTAB 1HQ3B 3AZED 1M18B 3AZJA 1B6WA 5GT3D 1P3LC 3AN2C 1KX4C 5DNNA 4HGAB 5B2JB 3O62B 3UT9C 4X23D 3MNNC 3AZKB 4ZUXD 3REHA 4J8VD 4QLCD 1P3MB 3AZNC 4YS3D 4J8XA 1M19B 1M1AD 3WTPD 3R45A 1EQZC 4Z2MH 4J8WA 3AV2D 4CSRB 3AZMB 5E5AC 3W98B 5GSUD 5B24B 3AZLD 1S32B 3WAAD 5AV6B 5BT1D 5AY8C 3TU4A 3LJAA 3REHB 3LZ1C 3C1CB 5AVCA 2FJ7D 2RVQC 3KWQB 5B1LB 5GXQC 5AV9A 3MGRB 1P3GA 5B0YA 2BYMB 1F66C 3X1SB 2F8NA 3MGPD
chains in the Genus database with same CATH superfamily
3AN2A 5AV5A 4KUDC 4DRBA 2XD1A 5JRGB 3UT9A 1TAFA 2HIOD 3LZ0B 5C3IB 3X1VB 4LD9D 3UTAD 1R4VA 3LELC 1P3GB 3VH6A 3X1UA 5B32A 2AROB 5G49B 2UWXA 3AZEC 3REJD 3W99A 2NZDA 3AYWC 2ZY2A 3REIA 1U35B 5AY8A 3AFAB 1ZLAA 1TZYD 4ZBJB 4J8VC 4QLCC 2NQBD 1P34B 4WU8B 3B0DC 4R8PC 5GXQA 4Z2MG 2YFWA 4XUJC 2Y2PA 1AOID 3REIB 3B6FA 4H9OA 1ID3B 5DNMD 1P3AD 2YFVA 3AZLC 2RIQA 4WU9C 5AVBA 5B1LD 5CPKB 4H9QA 3A6NB 3MGSD 2JCHA 5B1MA 3C1BB 2Y2MA 3MNND 4WNNA 2HUEC 5F99B 2Y2LA 4H9OB 5FUGB 4CAYB 5GT3A 5CP6C 3UTBD 3AZIA 5B40B 1EQZD 4UUZA 1P3KB 1P3PC 4M6BA 4X23A 3AZFB 4ZUXA 3REKC 4J8VA 4QLCA 1HQ3C 3UTAC 2PYOB 3KUYD 5B31A 2ZM5A 2BYKA 3LZ1D 4JJNB 4YS3A 1M1AA 3WTPA 1HTAA 3VH5T 2RVQD 4HGAC 3REJC 3AV2A 3AFAD 4XZQB 5B33B 2CV5D 5B2ID 5GSUA 5GT0D 3X1TB 1P3OB 3AZLA 3WAAA 1WWSA 5CPJA 5BS7A 4WU8D 1M19C 1TZYC 2VQRA 5B31B 2FJ7A 1KX3B 4KUDD 3WA9B 2NQBC 3AZMC 5CPIA 5B0ZB 5BNXA 3H0MC 4H9PA 5AV6C 3AZHD 3MGPA 5CPJB 5DNMC 1P3AC 3B6GD 1T3UA 4H9SC 3AYWD 5B1LC 5CPIB 3W97B 3MGSC 1KX5D 2HIOA 5F99D 3MGRC 3RELD 3NQUA 4LD9A 3NQJB 5JA4A 3X1SC 3P5JB 4J8UB 3KXBD 4KGCA 4YM6B 3MGQD 4NE6A 4H9RB 3MVDD 5B40D 3REJA 1P3FB 4R8PD 5JRGC 3UTBC 3AZJB 1JFIA 3LZ0C 5C3IC 4XUJD 3X1VC 5DNNB 1TZYA 2AROC 4KGCB 4WU9D 1P3ID 3KUYC 4Z5TD 5B33D 2Y2GA 4J8XB 3AZGD 1U35C 3R45B 1ULYA 1AOIA 1JFIB 2Y2QA 3AFAC 4J8WB 2CV5C 5GT0C 5B2IC 3AV1D 5DNMA 1P3AA 4ZBJC 1P3BA 4WU8C 3W96D 4Z66D 5CP6D 3TU4B 3LJAB 4EO5B 1KX4A 3MGSA 3WKJD 5AVCB 1P3PD 3F6TA 3MNNA 5BNVA 5AV9B 1W2EA 5AV8D 3REKD 3AZHC 1HQ3D 1M18D 5B0YB 1P3BB 3AZNA 5CPKC 3UTBA 2F8NB 1P3LB 3B6GC 3C1BC 1EQZA 3AN2B 3B0CW 5AV5B 4NE5A 5B2JD 3O62D 5E5AA 3VH6T 3AZKD 1KX5C 5F99C 3RELC 3UT9B 1TAFB 4E45A 1P3MD 1M19D 3KXBC 3LZ1A 3V9RA 3MGQC 3MVDC 5B40C 3X1UB 5B32B 4G91C 3AZMD 5DNND 1P3KC 2XD5A 3W98D 2F8NG 3W99B 2CV5A 5B24D 5GT0A 2NZDB 4G92B 1S32D 2JSSA 2IO5B 5AV6D 2Y2OA 2PYOC 1F66A 3REHD 1BH9A 3FDDA 4JJNC 1B67A 5AY8B 3C1CD 1ZLAB 4KUDA 2F2AC 1P3IC 5BO0A 4Z5TC 3KWQD 4XZQC 5B33C 1BFMA 5B32G 3AZGC 3MGRD 3X1TC 2ZY4A 5GXQB 2F8NK 2YFWB 3AZHA 4H9NA 3LELA 3X1SD 1BH8A 3AV1C 3LJAD 1F66B 3B6FB 1N1JA 2CWEA 3AZEA 2YFVB 3W96C 4Z66C 3AYWA 3B0BA 5JRGD 1WWIA 5AVBB 1KX5A 3LZ0D 3RELA 3H0LC 3X1VD 3WKJC 4H9QB 5B1MB 1P3GD 3KXBA 2AROD 3LELB 3MGQA 4WNNB 5AV8C 3MVDA 1M18C 1H3OA 2LY8A 1N1JB 4R8PA 1F1EA 5GT3B 3W97C 2DF4C 1U35D 4XUJA 3AZIB 5B2JC 3O62C 4UUZB 3AZKC 4X23B 5B32D 4WJ3C 4WU9A 1P34D 1P3IA 1P3MC 4Z5TA 4ZUXB 4J8VB 4QLCB 3W99D 3EPJA 3B0DB 2NZDD 2BYKB 4YS3B 3AZGA 3H0RC 1M1AB 5DNNC 3WTPB 3REID 3W98C 3AV2B 5B24C 1ID3D 3AV1A 1S32C 2G5HC 5GSUB 3EPLA 3REHC 3AZLB 3WAAB 3W96A 5CP6A 3A1KA 3C1CC 5CPKD 3A6ND 4WV4B 1A7WA 3C1BD 2W8SA 3WKJA 1P3PA 1Z2CB 2FJ7B 3KWQC 4J8WC 5B31G 5BNXB 4H9PB 5AV8A 3REKA 3UTAA 1HQ3A 1KU5A 3LJAC 4EO5C 3MGPB 1P3KD 5AVCC 3O62A 3AZKA 3AZFD 2F8NH 5AV9C 2PYOD 4NFTA 5CHLB 4DQYB 2HIOB 1P3GC 1P3MA 3NQUB 4JJND 1M19A 4LD9B 2BG1A 5JA4B 4DRAA 2NQBA 4CSRA 3AZMA 5AV5C 3AZID 2Y2JA 4XZQD 3REJB 3W98A 1P3OD 5B24A 3X1TD 5KDMA 1S32A 5AV6A 4WZSB 4UPKA 1PZRA 1Q9CA 3C1CA 4KHAA 5B31D 3X1UC 5B32C 1KX3D 1TZYB 3WA9D 1P34C 4AWLB 5B0ZD 4H9SA 3KWQA 5B1LA 3W99C 2NQBB 2NZDC 4G92C 3MGRA 2IO5C 2BYMA 3REIC 5KDMB 3X1SA 5CPJD 1P3LA 1ID3C 1AOIB 1ZLAC 4KHAB 5DNMB 1P3AB 5JRGA 3A6NC 5CPID 3W97D 3LZ0A 3X1VA 1KX4B 3MGSB 4J8UD 4YM6D 2AROA 5G49A 4E44A 3B6FC 3MNNB 3WTPE 1P3FD 2ZY5A 5BNVB 3KUYA 3VH5W 5AVBC 3AZJD 3AZNB 4NE3A 1U35A 3UTBB 5B1MC 1EQZB 2FFFB 3AFAA 3AZFC 5B2IA 5E5AB 4KGCD 1P34A 4WU8A 3EPKA 2L5AA 3KUYB 5GT3C 4J8XD 3LZ1B 3V9RB 3AZIC 4J8WD 1P3OC 1ID3A 4X23C 2CV5B 5GT0B 5B2IB 4ZUXC 2DQNC 3TU4D 5CPKA 1BH9B 5B31C 3A6NA 4YS3C 1KX3C 3B6GA 3C1BA 3WA9C 1M1AC 5AVCD 3WTPC 5B0ZC 4KUDB 5BO0B 3AV2C 5F99A 5AV9D 3AL0C 5GSUC 2JE5A 3WAAC 5FUGA 4CAYA 5BT1C 5B0YD 3AZHB 5CPJC 5BS7C 4H9NB 1P3BD 2F8ND 3IP4C 1P3LD 1BH8B 5B40A 2J8PA 3AN2D 1KX4D 1P3KA 5AV5D 2FJ7C 3B6GB 3AZEB 5CPIC 3AZFA 3AYWB 3UT9D 2PYOA 1KX5B 3RELB 4J8UC 4JJNA 4YM6C 3MGPC 3AZND 3X1UD 3KXBB 1P3FC 3MGQB 3MVDB 4G91B 2Y2NA 4XZQA 1H3OB 5B33A 3AZJC 1P3OA 2ZY3A 5E5AD 3X1TA 4R8PB 3B0CT 2HIOC 3VH5A 4XUJB 4LD9C 5AY8D 1ZLAD 2G5IC 4KGCC 1KX3A 3WA9A 5B0ZA 4Z66A 4WU9B 1P3IB 4Z5TB 4J8XC 5GXQD 3AZGB 2Y2IA 1F66D 3A1IA 3B6FD 3AV1B 2HUEB 4AWLC 1M18A 3TU4C 5AVBD 2Y2HA 2Y2KA 3W97A 3W96B 4Z66B 3VH6W 5CP6B 3EG5B 3KSYA 3NQJA 5B1MD 5B2JA 3WKJB 4J8UA 1P3PB 1AOIC 4YM6A 3LELD 4H9RA 1P3FA 5B0YC 1P3BC 5AV8B 3REKB 3UTAB 1HQ3B 3AZED 1M18B 3AZJA 1B6WA 5GT3D 1P3LC 3KFUG 3AN2C 1KX4C 5DNNA 4HGAB 5B2JB 3O62B 3UT9C 4X23D 3MNNC 3AZKB 4ZUXD 3REHA 4J8VD 4QLCD 1P3MB 3AZNC 4YS3D 4J8XA 1M19B 1M1AD 3WTPD 3R45A 1EQZC 4Z2MH 4J8WA 3AV2D 4CSRB 3AZMB 5E5AC 3W98B 3EPHA 5GSUD 5B24B 3AZLD 1S32B 3WAAD 5AV6B 5BT1D 5AY8C 3TU4A 3LJAA 3REHB 3LZ1C 3C1CB 5AVCA 2FJ7D 2RVQC 3KWQB 5B1LB 5GXQC 5AV9A 3MGRB 1P3GA 5B0YA 2BYMB 1F66C 3X1SB 2F8NA 3MGPD
chains in the Genus database with same CATH topology
3AN2A 5AV5A 4KUDC 4DRBA 2XD1A 5JRGB 3UT9A 1TAFA 2HIOD 3LZ0B 5C3IB 3X1VB 4LD9D 3UTAD 1R4VA 3LELC 1P3GB 3VH6A 3X1UA 5B32A 2AROB 5G49B 2UWXA 3AZEC 3REJD 3W99A 2NZDA 3AYWC 2ZY2A 3REIA 1U35B 5AY8A 3AFAB 1ZLAA 1TZYD 4ZBJB 4J8VC 4QLCC 2NQBD 1P34B 4WU8B 3B0DC 4R8PC 5GXQA 4Z2MG 2YFWA 4XUJC 2Y2PA 1AOID 3REIB 3B6FA 4H9OA 1ID3B 5DNMD 1P3AD 2YFVA 3AZLC 2RIQA 4WU9C 5AVBA 5B1LD 5CPKB 4H9QA 3A6NB 3MGSD 2JCHA 5B1MA 3C1BB 2Y2MA 3MNND 4WNNA 2HUEC 5F99B 2Y2LA 4H9OB 5FUGB 4CAYB 5GT3A 5CP6C 3UTBD 3AZIA 5B40B 1EQZD 4UUZA 1P3KB 1P3PC 4M6BA 4X23A 3AZFB 4ZUXA 3REKC 4J8VA 4QLCA 1HQ3C 3UTAC 2PYOB 3KUYD 5B31A 2ZM5A 2BYKA 3LZ1D 4JJNB 4YS3A 1M1AA 3WTPA 1HTAA 3VH5T 2RVQD 4HGAC 3REJC 3AV2A 3AFAD 4XZQB 5B33B 2CV5D 5B2ID 5GSUA 5GT0D 3X1TB 1P3OB 3AZLA 3WAAA 1WWSA 5CPJA 5BS7A 4WU8D 1M19C 1TZYC 2VQRA 5B31B 2FJ7A 1KX3B 4KUDD 3WA9B 2NQBC 3AZMC 5CPIA 5B0ZB 5BNXA 3H0MC 4H9PA 5AV6C 3AZHD 3MGPA 5CPJB 5DNMC 1P3AC 3B6GD 1T3UA 4H9SC 3AYWD 5B1LC 5CPIB 3W97B 3MGSC 1KX5D 2HIOA 5F99D 3MGRC 3RELD 3NQUA 4LD9A 3NQJB 5JA4A 3X1SC 3P5JB 4J8UB 3KXBD 4KGCA 4YM6B 3MGQD 4NE6A 4H9RB 3MVDD 5B40D 3REJA 1P3FB 4R8PD 5JRGC 3UTBC 3AZJB 1JFIA 3LZ0C 5C3IC 4XUJD 3X1VC 5DNNB 1TZYA 2AROC 4KGCB 4WU9D 1P3ID 3KUYC 4Z5TD 5B33D 2Y2GA 4J8XB 3AZGD 1U35C 3R45B 1ULYA 1AOIA 1JFIB 2Y2QA 3AFAC 4J8WB 2CV5C 5GT0C 5B2IC 3AV1D 5DNMA 1P3AA 4ZBJC 1P3BA 4WU8C 3W96D 4Z66D 5CP6D 3TU4B 3LJAB 4EO5B 1KX4A 3MGSA 3WKJD 5AVCB 1P3PD 3F6TA 3MNNA 5BNVA 5AV9B 1W2EA 5AV8D 3REKD 3AZHC 1HQ3D 1M18D 5B0YB 1P3BB 3AZNA 5CPKC 3UTBA 2F8NB 1P3LB 3B6GC 3C1BC 1EQZA 3AN2B 3B0CW 5AV5B 4NE5A 5B2JD 3O62D 5E5AA 3VH6T 3AZKD 1KX5C 5F99C 3RELC 3UT9B 1TAFB 4E45A 1P3MD 1M19D 3KXBC 3LZ1A 3V9RA 3MGQC 3MVDC 5B40C 3X1UB 5B32B 4G91C 3AZMD 5DNND 1P3KC 2XD5A 3W98D 2F8NG 3W99B 2CV5A 5B24D 5GT0A 2NZDB 4G92B 1S32D 2JSSA 2IO5B 5AV6D 2Y2OA 2PYOC 1F66A 3REHD 1BH9A 3FDDA 4JJNC 1B67A 5AY8B 3C1CD 1ZLAB 4KUDA 2F2AC 1P3IC 5BO0A 4Z5TC 3KWQD 4XZQC 5B33C 1BFMA 5B32G 3AZGC 3MGRD 3X1TC 2ZY4A 5GXQB 2F8NK 2YFWB 3AZHA 4H9NA 3LELA 3X1SD 1BH8A 3AV1C 3LJAD 1F66B 3B6FB 1N1JA 2CWEA 3AZEA 2YFVB 3W96C 4Z66C 3AYWA 3B0BA 5JRGD 1WWIA 5AVBB 1KX5A 3LZ0D 3RELA 3H0LC 3X1VD 3WKJC 4H9QB 5B1MB 1P3GD 3KXBA 2AROD 3LELB 3MGQA 4WNNB 5AV8C 3MVDA 1M18C 1H3OA 2LY8A 1N1JB 4R8PA 1F1EA 5GT3B 3W97C 2DF4C 1U35D 4XUJA 3AZIB 5B2JC 3O62C 4UUZB 3AZKC 4X23B 5B32D 4WJ3C 4WU9A 1P34D 1P3IA 1P3MC 4Z5TA 4ZUXB 4J8VB 4QLCB 3W99D 3EPJA 3B0DB 2NZDD 2BYKB 4YS3B 3AZGA 3H0RC 1M1AB 5DNNC 3WTPB 3REID 3W98C 3AV2B 5B24C 1ID3D 3AV1A 1S32C 2G5HC 5GSUB 3EPLA 3REHC 3AZLB 3WAAB 3W96A 5CP6A 3A1KA 3C1CC 5CPKD 3A6ND 4WV4B 1A7WA 3C1BD 2W8SA 3WKJA 1P3PA 1Z2CB 2FJ7B 3KWQC 4J8WC 5B31G 5BNXB 4H9PB 5AV8A 3REKA 3UTAA 1HQ3A 1KU5A 3LJAC 4EO5C 3MGPB 1P3KD 5AVCC 3O62A 3AZKA 3AZFD 2F8NH 5AV9C 2PYOD 4NFTA 5CHLB 4DQYB 2HIOB 1P3GC 1P3MA 3NQUB 4JJND 1M19A 4LD9B 2BG1A 5JA4B 4DRAA 2NQBA 4CSRA 3AZMA 5AV5C 3AZID 2Y2JA 4XZQD 3REJB 3W98A 1P3OD 5B24A 3X1TD 5KDMA 1S32A 5AV6A 4WZSB 4UPKA 1PZRA 1Q9CA 3C1CA 4KHAA 5B31D 3X1UC 5B32C 1KX3D 1TZYB 3WA9D 1P34C 4AWLB 5B0ZD 4H9SA 3KWQA 5B1LA 3W99C 2NQBB 2NZDC 4G92C 3MGRA 2IO5C 2BYMA 3REIC 5KDMB 3X1SA 5CPJD 1P3LA 1ID3C 1AOIB 1ZLAC 4KHAB 5DNMB 1P3AB 5JRGA 3A6NC 5CPID 3W97D 3LZ0A 3X1VA 1KX4B 3MGSB 4J8UD 4YM6D 2AROA 5G49A 4E44A 3B6FC 3MNNB 3WTPE 1P3FD 2ZY5A 5BNVB 3KUYA 3VH5W 5AVBC 3AZJD 3AZNB 4NE3A 1U35A 3UTBB 5B1MC 1EQZB 2FFFB 3AFAA 3AZFC 5B2IA 5E5AB 4KGCD 1P34A 4WU8A 3EPKA 2L5AA 3KUYB 5GT3C 4J8XD 3LZ1B 3V9RB 3AZIC 4J8WD 1P3OC 1ID3A 4X23C 2CV5B 5GT0B 5B2IB 4ZUXC 2DQNC 3TU4D 5CPKA 1BH9B 5B31C 3A6NA 4YS3C 1KX3C 3B6GA 3C1BA 3WA9C 1M1AC 5AVCD 3WTPC 5B0ZC 4KUDB 5BO0B 3AV2C 5F99A 5AV9D 3AL0C 5GSUC 2JE5A 3WAAC 5FUGA 4CAYA 5BT1C 5B0YD 3AZHB 5CPJC 5BS7C 4H9NB 1P3BD 2F8ND 3IP4C 1P3LD 1BH8B 5B40A 2J8PA 3AN2D 1KX4D 1P3KA 5AV5D 2FJ7C 3B6GB 3AZEB 5CPIC 3AZFA 3AYWB 3UT9D 2PYOA 1KX5B 3RELB 4J8UC 4JJNA 4YM6C 3MGPC 3AZND 3X1UD 3KXBB 1P3FC 3MGQB 3MVDB 4G91B 2Y2NA 4XZQA 1H3OB 5B33A 3AZJC 1P3OA 2ZY3A 5E5AD 3X1TA 4R8PB 3B0CT 2HIOC 3VH5A 4XUJB 4LD9C 5AY8D 1ZLAD 2G5IC 4KGCC 1KX3A 3WA9A 5B0ZA 4Z66A 4WU9B 1P3IB 4Z5TB 4J8XC 5GXQD 3AZGB 2Y2IA 1F66D 3A1IA 3B6FD 3AV1B 2HUEB 4AWLC 1M18A 3TU4C 5AVBD 2Y2HA 2Y2KA 3W97A 3W96B 4Z66B 3VH6W 5CP6B 3EG5B 3KSYA 3NQJA 5B1MD 5B2JA 3WKJB 4J8UA 1P3PB 1AOIC 4YM6A 3LELD 4H9RA 1P3FA 5B0YC 1P3BC 5AV8B 3REKB 3UTAB 1HQ3B 3AZED 1M18B 3AZJA 1B6WA 5GT3D 1P3LC 3KFUG 3AN2C 1KX4C 5DNNA 4HGAB 5B2JB 3O62B 3UT9C 4X23D 3MNNC 3AZKB 4ZUXD 3REHA 4J8VD 4QLCD 1P3MB 3AZNC 4YS3D 4J8XA 1M19B 1M1AD 3WTPD 3R45A 1EQZC 4Z2MH 4J8WA 3AV2D 4CSRB 3AZMB 5E5AC 3W98B 3EPHA 5GSUD 5B24B 3AZLD 1S32B 3WAAD 5AV6B 5BT1D 5AY8C 3TU4A 3LJAA 3REHB 3LZ1C 3C1CB 5AVCA 2FJ7D 2RVQC 3KWQB 5B1LB 5GXQC 5AV9A 3MGRB 1P3GA 5B0YA 2BYMB 1F66C 3X1SB 2F8NA 3MGPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN2 A;  5AV5 A;  4KUD C;  4DRB A;  5JRG B;  3UT9 A;  1TAF A;  2HIO D;  3LZ0 B;  5C3I B;  3X1V B;  4LD9 D;  3UTA D;  1R4V A;  3LEL C;  1P3G B;  3VH6 A;  3X1U A;  5B32 A;  2ARO B;  5G49 B;  3AZE C;  3REJ D;  3W99 A;  2NZD A;  3AYW C;  3REI A;  1U35 B;  5AY8 A;  3AFA B;  1ZLA A;  1TZY D;  4ZBJ B;  4J8V C;  4QLC C;  2NQB D;  1P34 B;  4WU8 B;  3B0D C;  4R8P C;  5GXQ A;  4Z2M G;  2YFW A;  4XUJ C;  1AOI D;  3REI B;  3B6F A;  4H9O A;  1ID3 B;  5DNM D;  1P3A D;  2YFV A;  3AZL C;  4WU9 C;  5AVB A;  5B1L D;  5CPK B;  4H9Q A;  3A6N B;  3MGS D;  5B1M A;  3C1B B;  3MNN D;  4WNN A;  2HUE C;  5F99 B;  4H9O B;  5FUG B;  4CAY B;  5GT3 A;  5CP6 C;  3UTB D;  3AZI A;  5B40 B;  1EQZ D;  4UUZ A;  1P3K B;  1P3P C;  4M6B A;  4X23 A;  3AZF B;  4ZUX A;  3REK C;  4J8V A;  4QLC A;  1HQ3 C;  3UTA C;  2PYO B;  3KUY D;  5B31 A;  4JJN B;  2BYK A;  3LZ1 D;  4YS3 A;  1M1A A;  3WTP A;  1HTA A;  3VH5 T;  2RVQ D;  4HGA C;  3REJ C;  3AV2 A;  3AFA D;  4XZQ B;  5B33 B;  2CV5 D;  5B2I D;  5GSU A;  5GT0 D;  3X1T B;  1P3O B;  3AZL A;  3WAA A;  1WWS A;  5CPJ A;  5BS7 A;  4WU8 D;  1M19 C;  1TZY C;  5B31 B;  2FJ7 A;  1KX3 B;  4KUD D;  3WA9 B;  2NQB C;  3AZM C;  5CPI A;  5B0Z B;  5BNX A;  4H9P A;  5AV6 C;  3AZH D;  3MGP A;  5CPJ B;  5DNM C;  1P3A C;  3B6G D;  4H9S C;  3AYW D;  5B1L C;  5CPI B;  3W97 B;  3MGS C;  1KX5 D;  2HIO A;  5F99 D;  3MGR C;  3REL D;  3NQU A;  4LD9 A;  3NQJ B;  5JA4 A;  3X1S C;  4J8U B;  3KXB D;  4KGC A;  4YM6 B;  3MGQ D;  4NE6 A;  4H9R B;  3MVD D;  5B40 D;  3REJ A;  1P3F B;  4R8P D;  5JRG C;  3UTB C;  3AZJ B;  1JFI A;  3LZ0 C;  5C3I C;  4XUJ D;  3X1V C;  5DNN B;  1TZY A;  2ARO C;  4KGC B;  4WU9 D;  1P3I D;  3KUY C;  4Z5T D;  5B33 D;  4J8X B;  3AZG D;  1U35 C;  3R45 B;  1ULY A;  1AOI A;  1JFI B;  3AFA C;  4J8W B;  2CV5 C;  5GT0 C;  5B2I C;  3AV1 D;  5DNM A;  1P3A A;  4ZBJ C;  1P3B A;  4WU8 C;  3W96 D;  4Z66 D;  5CP6 D;  3TU4 B;  3LJA B;  4EO5 B;  1KX4 A;  3MGS A;  3WKJ D;  5AVC B;  1P3P D;  3MNN A;  5BNV A;  5AV9 B;  5AV8 D;  3REK D;  3AZH C;  1HQ3 D;  1M18 D;  5B0Y B;  1P3B B;  3AZN A;  5CPK C;  3UTB A;  2F8N B;  1P3L B;  3B6G C;  3C1B C;  1EQZ A;  3AN2 B;  3B0C W;  5AV5 B;  4NE5 A;  5B2J D;  3O62 D;  5E5A A;  3VH6 T;  3AZK D;  1KX5 C;  5F99 C;  3REL C;  3UT9 B;  1TAF B;  4E45 A;  1P3M D;  1M19 D;  3KXB C;  3LZ1 A;  3V9R A;  3MGQ C;  3MVD C;  5B40 C;  3X1U B;  5B32 B;  4G91 C;  3AZM D;  5DNN D;  1P3K C;  3W98 D;  2F8N G;  3W99 B;  2CV5 A;  5B24 D;  5GT0 A;  2NZD B;  4G92 B;  1S32 D;  2JSS A;  2IO5 B;  5AV6 D;  2PYO C;  1F66 A;  3REH D;  1BH9 A;  4JJN C;  1B67 A;  5AY8 B;  3C1C D;  1ZLA B;  4KUD A;  1P3I C;  5BO0 A;  4Z5T C;  3KWQ D;  4XZQ C;  5B33 C;  1BFM A;  5B32 G;  3AZG C;  3MGR D;  3X1T C;  5GXQ B;  2F8N K;  2YFW B;  3AZH A;  4H9N A;  3LEL A;  3X1S D;  1BH8 A;  3AV1 C;  3LJA D;  1F66 B;  3B6F B;  1N1J A;  2CWE A;  3AZE A;  2YFV B;  3W96 C;  4Z66 C;  3AYW A;  3B0B A;  5JRG D;  1WWI A;  5AVB B;  1KX5 A;  3LZ0 D;  3REL A;  3X1V D;  3WKJ C;  4H9Q B;  5B1M B;  1P3G D;  3KXB A;  2ARO D;  3LEL B;  3MGQ A;  4WNN B;  5AV8 C;  3MVD A;  1M18 C;  1H3O A;  2LY8 A;  1N1J B;  4R8P A;  1F1E A;  5GT3 B;  3W97 C;  1U35 D;  4XUJ A;  3AZI B;  5B2J C;  3O62 C;  4UUZ B;  3AZK C;  4X23 B;  5B32 D;  4WU9 A;  1P34 D;  1P3I A;  1P3M C;  4Z5T A;  4ZUX B;  4J8V B;  4QLC B;  3W99 D;  3B0D B;  2NZD D;  2BYK B;  4YS3 B;  3AZG A;  1M1A B;  5DNN C;  3WTP B;  3REI D;  3W98 C;  3AV2 B;  5B24 C;  1ID3 D;  3AV1 A;  1S32 C;  5GSU B;  3REH C;  3AZL B;  3WAA B;  3W96 A;  5CP6 A;  3C1C C;  5CPK D;  3A6N D;  4WV4 B;  1A7W A;  3C1B D;  3WKJ A;  1P3P A;  2FJ7 B;  3KWQ C;  4J8W C;  5B31 G;  5BNX B;  4H9P B;  5AV8 A;  3REK A;  3UTA A;  1HQ3 A;  1KU5 A;  3LJA C;  4EO5 C;  3MGP B;  1P3K D;  5AVC C;  3O62 A;  3AZK A;  3AZF D;  2F8N H;  5AV9 C;  2PYO D;  4NFT A;  5CHL B;  2HIO B;  1P3G C;  1P3M A;  3NQU B;  4JJN D;  1M19 A;  4LD9 B;  5JA4 B;  4DRA A;  2NQB A;  4CSR A;  3AZM A;  5AV5 C;  3AZI D;  4XZQ D;  3REJ B;  3W98 A;  1P3O D;  5B24 A;  3X1T D;  5KDM A;  1S32 A;  5AV6 A;  4WZS B;  1Q9C A;  3C1C A;  4KHA A;  5B31 D;  3X1U C;  5B32 C;  1KX3 D;  1TZY B;  3WA9 D;  1P34 C;  4AWL B;  5B0Z D;  4H9S A;  3KWQ A;  5B1L A;  3W99 C;  2NQB B;  2NZD C;  4G92 C;  3MGR A;  2IO5 C;  2BYM A;  3REI C;  5KDM B;  3X1S A;  5CPJ D;  1P3L A;  1ID3 C;  1AOI B;  1ZLA C;  4KHA B;  5DNM B;  1P3A B;  5JRG A;  3A6N C;  5CPI D;  3W97 D;  3LZ0 A;  3X1V A;  1KX4 B;  3MGS B;  4J8U D;  4YM6 D;  2ARO A;  5G49 A;  4E44 A;  3B6F C;  3MNN B;  3WTP E;  1P3F D;  5BNV B;  3KUY A;  3VH5 W;  5AVB C;  3AZJ D;  3AZN B;  4NE3 A;  1U35 A;  3UTB B;  5B1M C;  1EQZ B;  3AFA A;  3AZF C;  5B2I A;  5E5A B;  4KGC D;  1P34 A;  4WU8 A;  2L5A A;  3KUY B;  5GT3 C;  4J8X D;  3LZ1 B;  3V9R B;  3AZI C;  4J8W D;  1P3O C;  1ID3 A;  4X23 C;  2CV5 B;  5GT0 B;  5B2I B;  4ZUX C;  3TU4 D;  5CPK A;  1BH9 B;  5B31 C;  3A6N A;  4YS3 C;  1KX3 C;  3B6G A;  3C1B A;  3WA9 C;  1M1A C;  5AVC D;  3WTP C;  5B0Z C;  4KUD B;  5BO0 B;  3AV2 C;  5F99 A;  5AV9 D;  5GSU C;  3WAA C;  5B0Y D;  5FUG A;  4CAY A;  5BT1 C;  3AZH B;  5CPJ C;  1P3B D;  5BS7 C;  4H9N B;  2F8N D;  1P3L D;  1BH8 B;  5B40 A;  3AN2 D;  1KX4 D;  1P3K A;  5AV5 D;  2FJ7 C;  3B6G B;  3AZE B;  5CPI C;  3AZF A;  3AYW B;  3UT9 D;  2PYO A;  1KX5 B;  3REL B;  4J8U C;  4JJN A;  4YM6 C;  3MGP C;  3AZN D;  3X1U D;  3KXB B;  1P3F C;  3MGQ B;  3MVD B;  4G91 B;  4XZQ A;  1H3O B;  5B33 A;  3AZJ C;  1P3O A;  3X1T A;  5E5A D;  4R8P B;  3B0C T;  2HIO C;  3VH5 A;  4XUJ B;  4LD9 C;  5AY8 D;  1ZLA D;  4KGC C;  1KX3 A;  3WA9 A;  5B0Z A;  4Z66 A;  4WU9 B;  1P3I B;  4Z5T B;  4J8X C;  5GXQ D;  3AZG B;  1F66 D;  3B6F D;  3AV1 B;  2HUE B;  4AWL C;  1M18 A;  3TU4 C;  5AVB D;  3W97 A;  3W96 B;  4Z66 B;  3VH6 W;  5CP6 B;  3KSY A;  3NQJ A;  5B1M D;  5B2J A;  3WKJ B;  4J8U A;  1P3P B;  1AOI C;  4YM6 A;  3LEL D;  4H9R A;  1P3F A;  5B0Y C;  1P3B C;  5AV8 B;  3REK B;  3UTA B;  1HQ3 B;  3AZE D;  1M18 B;  3AZJ A;  1B6W A;  5GT3 D;  1P3L C;  3AN2 C;  1KX4 C;  5DNN A;  4HGA B;  5B2J B;  3O62 B;  3UT9 C;  4X23 D;  3MNN C;  3AZK B;  4ZUX D;  3REH A;  4J8V D;  4QLC D;  1P3M B;  3AZN C;  4YS3 D;  4J8X A;  1M19 B;  1M1A D;  3WTP D;  3R45 A;  1EQZ C;  4Z2M H;  4J8W A;  3AV2 D;  4CSR B;  3AZM B;  5E5A C;  3W98 B;  5GSU D;  5B24 B;  3AZL D;  1S32 B;  3WAA D;  5AV6 B;  5BT1 D;  5AY8 C;  3TU4 A;  3LJA A;  3REH B;  3LZ1 C;  3C1C B;  5AVC A;  2FJ7 D;  2RVQ C;  3KWQ B;  5B1L B;  5GXQ C;  5AV9 A;  3MGR B;  1P3G A;  5B0Y A;  2BYM B;  1F66 C;  3X1S B;  2F8N A;  3MGP D; 
#chains in the Genus database with same CATH topology
 3AN2 A;  5AV5 A;  4KUD C;  4DRB A;  2XD1 A;  5JRG B;  3UT9 A;  1TAF A;  2HIO D;  3LZ0 B;  5C3I B;  3X1V B;  4LD9 D;  3UTA D;  1R4V A;  3LEL C;  1P3G B;  3VH6 A;  3X1U A;  5B32 A;  2ARO B;  5G49 B;  2UWX A;  3AZE C;  3REJ D;  3W99 A;  2NZD A;  3AYW C;  2ZY2 A;  3REI A;  1U35 B;  5AY8 A;  3AFA B;  1ZLA A;  1TZY D;  4ZBJ B;  4J8V C;  4QLC C;  2NQB D;  1P34 B;  4WU8 B;  3B0D C;  4R8P C;  5GXQ A;  4Z2M G;  2YFW A;  4XUJ C;  2Y2P A;  1AOI D;  3REI B;  3B6F A;  4H9O A;  1ID3 B;  5DNM D;  1P3A D;  2YFV A;  3AZL C;  2RIQ A;  4WU9 C;  5AVB A;  5B1L D;  5CPK B;  4H9Q A;  3A6N B;  3MGS D;  2JCH A;  5B1M A;  3C1B B;  2Y2M A;  3MNN D;  4WNN A;  2HUE C;  5F99 B;  2Y2L A;  4H9O B;  5FUG B;  4CAY B;  5GT3 A;  5CP6 C;  3UTB D;  3AZI A;  5B40 B;  1EQZ D;  4UUZ A;  1P3K B;  1P3P C;  4M6B A;  4X23 A;  3AZF B;  4ZUX A;  3REK C;  4J8V A;  4QLC A;  1HQ3 C;  3UTA C;  2PYO B;  3KUY D;  5B31 A;  2ZM5 A;  2BYK A;  3LZ1 D;  4JJN B;  4YS3 A;  1M1A A;  3WTP A;  1HTA A;  3VH5 T;  2RVQ D;  4HGA C;  3REJ C;  3AV2 A;  3AFA D;  4XZQ B;  5B33 B;  2CV5 D;  5B2I D;  5GSU A;  5GT0 D;  3X1T B;  1P3O B;  3AZL A;  3WAA A;  1WWS A;  5CPJ A;  5BS7 A;  4WU8 D;  1M19 C;  1TZY C;  2VQR A;  5B31 B;  2FJ7 A;  1KX3 B;  4KUD D;  3WA9 B;  2NQB C;  3AZM C;  5CPI A;  5B0Z B;  5BNX A;  3H0M C;  4H9P A;  5AV6 C;  3AZH D;  3MGP A;  5CPJ B;  5DNM C;  1P3A C;  3B6G D;  1T3U A;  4H9S C;  3AYW D;  5B1L C;  5CPI B;  3W97 B;  3MGS C;  1KX5 D;  2HIO A;  5F99 D;  3MGR C;  3REL D;  3NQU A;  4LD9 A;  3NQJ B;  5JA4 A;  3X1S C;  3P5J B;  4J8U B;  3KXB D;  4KGC A;  4YM6 B;  3MGQ D;  4NE6 A;  4H9R B;  3MVD D;  5B40 D;  3REJ A;  1P3F B;  4R8P D;  5JRG C;  3UTB C;  3AZJ B;  1JFI A;  3LZ0 C;  5C3I C;  4XUJ D;  3X1V C;  5DNN B;  1TZY A;  2ARO C;  4KGC B;  4WU9 D;  1P3I D;  3KUY C;  4Z5T D;  5B33 D;  2Y2G A;  4J8X B;  3AZG D;  1U35 C;  3R45 B;  1ULY A;  1AOI A;  1JFI B;  2Y2Q A;  3AFA C;  4J8W B;  2CV5 C;  5GT0 C;  5B2I C;  3AV1 D;  5DNM A;  1P3A A;  4ZBJ C;  1P3B A;  4WU8 C;  3W96 D;  4Z66 D;  5CP6 D;  3TU4 B;  3LJA B;  4EO5 B;  1KX4 A;  3MGS A;  3WKJ D;  5AVC B;  1P3P D;  3F6T A;  3MNN A;  5BNV A;  5AV9 B;  1W2E A;  5AV8 D;  3REK D;  3AZH C;  1HQ3 D;  1M18 D;  5B0Y B;  1P3B B;  3AZN A;  5CPK C;  3UTB A;  2F8N B;  1P3L B;  3B6G C;  3C1B C;  1EQZ A;  3AN2 B;  3B0C W;  5AV5 B;  4NE5 A;  5B2J D;  3O62 D;  5E5A A;  3VH6 T;  3AZK D;  1KX5 C;  5F99 C;  3REL C;  3UT9 B;  1TAF B;  4E45 A;  1P3M D;  1M19 D;  3KXB C;  3LZ1 A;  3V9R A;  3MGQ C;  3MVD C;  5B40 C;  3X1U B;  5B32 B;  4G91 C;  3AZM D;  5DNN D;  1P3K C;  2XD5 A;  3W98 D;  2F8N G;  3W99 B;  2CV5 A;  5B24 D;  5GT0 A;  2NZD B;  4G92 B;  1S32 D;  2JSS A;  2IO5 B;  5AV6 D;  2Y2O A;  2PYO C;  1F66 A;  3REH D;  1BH9 A;  3FDD A;  4JJN C;  1B67 A;  5AY8 B;  3C1C D;  1ZLA B;  4KUD A;  2F2A C;  1P3I C;  5BO0 A;  4Z5T C;  3KWQ D;  4XZQ C;  5B33 C;  1BFM A;  5B32 G;  3AZG C;  3MGR D;  3X1T C;  2ZY4 A;  5GXQ B;  2F8N K;  2YFW B;  3AZH A;  4H9N A;  3LEL A;  3X1S D;  1BH8 A;  3AV1 C;  3LJA D;  1F66 B;  3B6F B;  1N1J A;  2CWE A;  3AZE A;  2YFV B;  3W96 C;  4Z66 C;  3AYW A;  3B0B A;  5JRG D;  1WWI A;  5AVB B;  1KX5 A;  3LZ0 D;  3REL A;  3H0L C;  3X1V D;  3WKJ C;  4H9Q B;  5B1M B;  1P3G D;  3KXB A;  2ARO D;  3LEL B;  3MGQ A;  4WNN B;  5AV8 C;  3MVD A;  1M18 C;  1H3O A;  2LY8 A;  1N1J B;  4R8P A;  1F1E A;  5GT3 B;  3W97 C;  2DF4 C;  1U35 D;  4XUJ A;  3AZI B;  5B2J C;  3O62 C;  4UUZ B;  3AZK C;  4X23 B;  5B32 D;  4WJ3 C;  4WU9 A;  1P34 D;  1P3I A;  1P3M C;  4Z5T A;  4ZUX B;  4J8V B;  4QLC B;  3W99 D;  3EPJ A;  3B0D B;  2NZD D;  2BYK B;  4YS3 B;  3AZG A;  3H0R C;  1M1A B;  5DNN C;  3WTP B;  3REI D;  3W98 C;  3AV2 B;  5B24 C;  1ID3 D;  3AV1 A;  1S32 C;  2G5H C;  5GSU B;  3EPL A;  3REH C;  3AZL B;  3WAA B;  3W96 A;  5CP6 A;  3A1K A;  3C1C C;  5CPK D;  3A6N D;  4WV4 B;  1A7W A;  3C1B D;  2W8S A;  3WKJ A;  1P3P A;  1Z2C B;  2FJ7 B;  3KWQ C;  4J8W C;  5B31 G;  5BNX B;  4H9P B;  5AV8 A;  3REK A;  3UTA A;  1HQ3 A;  1KU5 A;  3LJA C;  4EO5 C;  3MGP B;  1P3K D;  5AVC C;  3O62 A;  3AZK A;  3AZF D;  2F8N H;  5AV9 C;  2PYO D;  4NFT A;  5CHL B;  4DQY B;  2HIO B;  1P3G C;  1P3M A;  3NQU B;  4JJN D;  1M19 A;  4LD9 B;  2BG1 A;  5JA4 B;  4DRA A;  2NQB A;  4CSR A;  3AZM A;  5AV5 C;  3AZI D;  2Y2J A;  4XZQ D;  3REJ B;  3W98 A;  1P3O D;  5B24 A;  3X1T D;  5KDM A;  1S32 A;  5AV6 A;  4WZS B;  4UPK A;  1PZR A;  1Q9C A;  3C1C A;  4KHA A;  5B31 D;  3X1U C;  5B32 C;  1KX3 D;  1TZY B;  3WA9 D;  1P34 C;  4AWL B;  5B0Z D;  4H9S A;  3KWQ A;  5B1L A;  3W99 C;  2NQB B;  2NZD C;  4G92 C;  3MGR A;  2IO5 C;  2BYM A;  3REI C;  5KDM B;  3X1S A;  5CPJ D;  1P3L A;  1ID3 C;  1AOI B;  1ZLA C;  4KHA B;  5DNM B;  1P3A B;  5JRG A;  3A6N C;  5CPI D;  3W97 D;  3LZ0 A;  3X1V A;  1KX4 B;  3MGS B;  4J8U D;  4YM6 D;  2ARO A;  5G49 A;  4E44 A;  3B6F C;  3MNN B;  3WTP E;  1P3F D;  2ZY5 A;  5BNV B;  3KUY A;  3VH5 W;  5AVB C;  3AZJ D;  3AZN B;  4NE3 A;  1U35 A;  3UTB B;  5B1M C;  1EQZ B;  2FFF B;  3AFA A;  3AZF C;  5B2I A;  5E5A B;  4KGC D;  1P34 A;  4WU8 A;  3EPK A;  2L5A A;  3KUY B;  5GT3 C;  4J8X D;  3LZ1 B;  3V9R B;  3AZI C;  4J8W D;  1P3O C;  1ID3 A;  4X23 C;  2CV5 B;  5GT0 B;  5B2I B;  4ZUX C;  2DQN C;  3TU4 D;  5CPK A;  1BH9 B;  5B31 C;  3A6N A;  4YS3 C;  1KX3 C;  3B6G A;  3C1B A;  3WA9 C;  1M1A C;  5AVC D;  3WTP C;  5B0Z C;  4KUD B;  5BO0 B;  3AV2 C;  5F99 A;  5AV9 D;  3AL0 C;  5GSU C;  2JE5 A;  3WAA C;  5FUG A;  4CAY A;  5BT1 C;  5B0Y D;  3AZH B;  5CPJ C;  5BS7 C;  4H9N B;  1P3B D;  2F8N D;  3IP4 C;  1P3L D;  1BH8 B;  5B40 A;  2J8P A;  3AN2 D;  1KX4 D;  1P3K A;  5AV5 D;  2FJ7 C;  3B6G B;  3AZE B;  5CPI C;  3AZF A;  3AYW B;  3UT9 D;  2PYO A;  1KX5 B;  3REL B;  4J8U C;  4JJN A;  4YM6 C;  3MGP C;  3AZN D;  3X1U D;  3KXB B;  1P3F C;  3MGQ B;  3MVD B;  4G91 B;  2Y2N A;  4XZQ A;  1H3O B;  5B33 A;  3AZJ C;  1P3O A;  2ZY3 A;  5E5A D;  3X1T A;  4R8P B;  3B0C T;  2HIO C;  3VH5 A;  4XUJ B;  4LD9 C;  5AY8 D;  1ZLA D;  2G5I C;  4KGC C;  1KX3 A;  3WA9 A;  5B0Z A;  4Z66 A;  4WU9 B;  1P3I B;  4Z5T B;  4J8X C;  5GXQ D;  3AZG B;  2Y2I A;  1F66 D;  3A1I A;  3B6F D;  3AV1 B;  2HUE B;  4AWL C;  1M18 A;  3TU4 C;  5AVB D;  2Y2H A;  2Y2K A;  3W97 A;  3W96 B;  4Z66 B;  3VH6 W;  5CP6 B;  3EG5 B;  3KSY A;  3NQJ A;  5B1M D;  5B2J A;  3WKJ B;  4J8U A;  1P3P B;  1AOI C;  4YM6 A;  3LEL D;  4H9R A;  1P3F A;  5B0Y C;  1P3B C;  5AV8 B;  3REK B;  3UTA B;  1HQ3 B;  3AZE D;  1M18 B;  3AZJ A;  1B6W A;  5GT3 D;  1P3L C;  3KFU G;  3AN2 C;  1KX4 C;  5DNN A;  4HGA B;  5B2J B;  3O62 B;  3UT9 C;  4X23 D;  3MNN C;  3AZK B;  4ZUX D;  3REH A;  4J8V D;  4QLC D;  1P3M B;  3AZN C;  4YS3 D;  4J8X A;  1M19 B;  1M1A D;  3WTP D;  3R45 A;  1EQZ C;  4Z2M H;  4J8W A;  3AV2 D;  4CSR B;  3AZM B;  5E5A C;  3W98 B;  3EPH A;  5GSU D;  5B24 B;  3AZL D;  1S32 B;  3WAA D;  5AV6 B;  5BT1 D;  5AY8 C;  3TU4 A;  3LJA A;  3REH B;  3LZ1 C;  3C1C B;  5AVC A;  2FJ7 D;  2RVQ C;  3KWQ B;  5B1L B;  5GXQ C;  5AV9 A;  3MGR B;  1P3G A;  5B0Y A;  2BYM B;  1F66 C;  3X1S B;  2F8N A;  3MGP D; 
#chains in the Genus database with same CATH homology
 3AN2 A;  5AV5 A;  4KUD C;  4DRB A;  2XD1 A;  5JRG B;  3UT9 A;  1TAF A;  2HIO D;  3LZ0 B;  5C3I B;  3X1V B;  4LD9 D;  3UTA D;  1R4V A;  3LEL C;  1P3G B;  3VH6 A;  3X1U A;  5B32 A;  2ARO B;  5G49 B;  2UWX A;  3AZE C;  3REJ D;  3W99 A;  2NZD A;  3AYW C;  2ZY2 A;  3REI A;  1U35 B;  5AY8 A;  3AFA B;  1ZLA A;  1TZY D;  4ZBJ B;  4J8V C;  4QLC C;  2NQB D;  1P34 B;  4WU8 B;  3B0D C;  4R8P C;  5GXQ A;  4Z2M G;  2YFW A;  4XUJ C;  2Y2P A;  1AOI D;  3REI B;  3B6F A;  4H9O A;  1ID3 B;  5DNM D;  1P3A D;  2YFV A;  3AZL C;  2RIQ A;  4WU9 C;  5AVB A;  5B1L D;  5CPK B;  4H9Q A;  3A6N B;  3MGS D;  2JCH A;  5B1M A;  3C1B B;  2Y2M A;  3MNN D;  4WNN A;  2HUE C;  5F99 B;  2Y2L A;  4H9O B;  5FUG B;  4CAY B;  5GT3 A;  5CP6 C;  3UTB D;  3AZI A;  5B40 B;  1EQZ D;  4UUZ A;  1P3K B;  1P3P C;  4M6B A;  4X23 A;  3AZF B;  4ZUX A;  3REK C;  4J8V A;  4QLC A;  1HQ3 C;  3UTA C;  2PYO B;  3KUY D;  5B31 A;  2ZM5 A;  2BYK A;  3LZ1 D;  4JJN B;  4YS3 A;  1M1A A;  3WTP A;  1HTA A;  3VH5 T;  2RVQ D;  4HGA C;  3REJ C;  3AV2 A;  3AFA D;  4XZQ B;  5B33 B;  2CV5 D;  5B2I D;  5GSU A;  5GT0 D;  3X1T B;  1P3O B;  3AZL A;  3WAA A;  1WWS A;  5CPJ A;  5BS7 A;  4WU8 D;  1M19 C;  1TZY C;  2VQR A;  5B31 B;  2FJ7 A;  1KX3 B;  4KUD D;  3WA9 B;  2NQB C;  3AZM C;  5CPI A;  5B0Z B;  5BNX A;  3H0M C;  4H9P A;  5AV6 C;  3AZH D;  3MGP A;  5CPJ B;  5DNM C;  1P3A C;  3B6G D;  1T3U A;  4H9S C;  3AYW D;  5B1L C;  5CPI B;  3W97 B;  3MGS C;  1KX5 D;  2HIO A;  5F99 D;  3MGR C;  3REL D;  3NQU A;  4LD9 A;  3NQJ B;  5JA4 A;  3X1S C;  3P5J B;  4J8U B;  3KXB D;  4KGC A;  4YM6 B;  3MGQ D;  4NE6 A;  4H9R B;  3MVD D;  5B40 D;  3REJ A;  1P3F B;  4R8P D;  5JRG C;  3UTB C;  3AZJ B;  1JFI A;  3LZ0 C;  5C3I C;  4XUJ D;  3X1V C;  5DNN B;  1TZY A;  2ARO C;  4KGC B;  4WU9 D;  1P3I D;  3KUY C;  4Z5T D;  5B33 D;  2Y2G A;  4J8X B;  3AZG D;  1U35 C;  3R45 B;  1ULY A;  1AOI A;  1JFI B;  2Y2Q A;  3AFA C;  4J8W B;  2CV5 C;  5GT0 C;  5B2I C;  3AV1 D;  5DNM A;  1P3A A;  4ZBJ C;  1P3B A;  4WU8 C;  3W96 D;  4Z66 D;  5CP6 D;  3TU4 B;  3LJA B;  4EO5 B;  1KX4 A;  3MGS A;  3WKJ D;  5AVC B;  1P3P D;  3F6T A;  3MNN A;  5BNV A;  5AV9 B;  1W2E A;  5AV8 D;  3REK D;  3AZH C;  1HQ3 D;  1M18 D;  5B0Y B;  1P3B B;  3AZN A;  5CPK C;  3UTB A;  2F8N B;  1P3L B;  3B6G C;  3C1B C;  1EQZ A;  3AN2 B;  3B0C W;  5AV5 B;  4NE5 A;  5B2J D;  3O62 D;  5E5A A;  3VH6 T;  3AZK D;  1KX5 C;  5F99 C;  3REL C;  3UT9 B;  1TAF B;  4E45 A;  1P3M D;  1M19 D;  3KXB C;  3LZ1 A;  3V9R A;  3MGQ C;  3MVD C;  5B40 C;  3X1U B;  5B32 B;  4G91 C;  3AZM D;  5DNN D;  1P3K C;  2XD5 A;  3W98 D;  2F8N G;  3W99 B;  2CV5 A;  5B24 D;  5GT0 A;  2NZD B;  4G92 B;  1S32 D;  2JSS A;  2IO5 B;  5AV6 D;  2Y2O A;  2PYO C;  1F66 A;  3REH D;  1BH9 A;  3FDD A;  4JJN C;  1B67 A;  5AY8 B;  3C1C D;  1ZLA B;  4KUD A;  2F2A C;  1P3I C;  5BO0 A;  4Z5T C;  3KWQ D;  4XZQ C;  5B33 C;  1BFM A;  5B32 G;  3AZG C;  3MGR D;  3X1T C;  2ZY4 A;  5GXQ B;  2F8N K;  2YFW B;  3AZH A;  4H9N A;  3LEL A;  3X1S D;  1BH8 A;  3AV1 C;  3LJA D;  1F66 B;  3B6F B;  1N1J A;  2CWE A;  3AZE A;  2YFV B;  3W96 C;  4Z66 C;  3AYW A;  3B0B A;  5JRG D;  1WWI A;  5AVB B;  1KX5 A;  3LZ0 D;  3REL A;  3H0L C;  3X1V D;  3WKJ C;  4H9Q B;  5B1M B;  1P3G D;  3KXB A;  2ARO D;  3LEL B;  3MGQ A;  4WNN B;  5AV8 C;  3MVD A;  1M18 C;  1H3O A;  2LY8 A;  1N1J B;  4R8P A;  1F1E A;  5GT3 B;  3W97 C;  2DF4 C;  1U35 D;  4XUJ A;  3AZI B;  5B2J C;  3O62 C;  4UUZ B;  3AZK C;  4X23 B;  5B32 D;  4WJ3 C;  4WU9 A;  1P34 D;  1P3I A;  1P3M C;  4Z5T A;  4ZUX B;  4J8V B;  4QLC B;  3W99 D;  3EPJ A;  3B0D B;  2NZD D;  2BYK B;  4YS3 B;  3AZG A;  3H0R C;  1M1A B;  5DNN C;  3WTP B;  3REI D;  3W98 C;  3AV2 B;  5B24 C;  1ID3 D;  3AV1 A;  1S32 C;  2G5H C;  5GSU B;  3EPL A;  3REH C;  3AZL B;  3WAA B;  3W96 A;  5CP6 A;  3A1K A;  3C1C C;  5CPK D;  3A6N D;  4WV4 B;  1A7W A;  3C1B D;  2W8S A;  3WKJ A;  1P3P A;  1Z2C B;  2FJ7 B;  3KWQ C;  4J8W C;  5B31 G;  5BNX B;  4H9P B;  5AV8 A;  3REK A;  3UTA A;  1HQ3 A;  1KU5 A;  3LJA C;  4EO5 C;  3MGP B;  1P3K D;  5AVC C;  3O62 A;  3AZK A;  3AZF D;  2F8N H;  5AV9 C;  2PYO D;  4NFT A;  5CHL B;  4DQY B;  2HIO B;  1P3G C;  1P3M A;  3NQU B;  4JJN D;  1M19 A;  4LD9 B;  2BG1 A;  5JA4 B;  4DRA A;  2NQB A;  4CSR A;  3AZM A;  5AV5 C;  3AZI D;  2Y2J A;  4XZQ D;  3REJ B;  3W98 A;  1P3O D;  5B24 A;  3X1T D;  5KDM A;  1S32 A;  5AV6 A;  4WZS B;  4UPK A;  1PZR A;  1Q9C A;  3C1C A;  4KHA A;  5B31 D;  3X1U C;  5B32 C;  1KX3 D;  1TZY B;  3WA9 D;  1P34 C;  4AWL B;  5B0Z D;  4H9S A;  3KWQ A;  5B1L A;  3W99 C;  2NQB B;  2NZD C;  4G92 C;  3MGR A;  2IO5 C;  2BYM A;  3REI C;  5KDM B;  3X1S A;  5CPJ D;  1P3L A;  1ID3 C;  1AOI B;  1ZLA C;  4KHA B;  5DNM B;  1P3A B;  5JRG A;  3A6N C;  5CPI D;  3W97 D;  3LZ0 A;  3X1V A;  1KX4 B;  3MGS B;  4J8U D;  4YM6 D;  2ARO A;  5G49 A;  4E44 A;  3B6F C;  3MNN B;  3WTP E;  1P3F D;  2ZY5 A;  5BNV B;  3KUY A;  3VH5 W;  5AVB C;  3AZJ D;  3AZN B;  4NE3 A;  1U35 A;  3UTB B;  5B1M C;  1EQZ B;  2FFF B;  3AFA A;  3AZF C;  5B2I A;  5E5A B;  4KGC D;  1P34 A;  4WU8 A;  3EPK A;  2L5A A;  3KUY B;  5GT3 C;  4J8X D;  3LZ1 B;  3V9R B;  3AZI C;  4J8W D;  1P3O C;  1ID3 A;  4X23 C;  2CV5 B;  5GT0 B;  5B2I B;  4ZUX C;  2DQN C;  3TU4 D;  5CPK A;  1BH9 B;  5B31 C;  3A6N A;  4YS3 C;  1KX3 C;  3B6G A;  3C1B A;  3WA9 C;  1M1A C;  5AVC D;  3WTP C;  5B0Z C;  4KUD B;  5BO0 B;  3AV2 C;  5F99 A;  5AV9 D;  3AL0 C;  5GSU C;  2JE5 A;  3WAA C;  5FUG A;  4CAY A;  5BT1 C;  5B0Y D;  3AZH B;  5CPJ C;  5BS7 C;  4H9N B;  1P3B D;  2F8N D;  3IP4 C;  1P3L D;  1BH8 B;  5B40 A;  2J8P A;  3AN2 D;  1KX4 D;  1P3K A;  5AV5 D;  2FJ7 C;  3B6G B;  3AZE B;  5CPI C;  3AZF A;  3AYW B;  3UT9 D;  2PYO A;  1KX5 B;  3REL B;  4J8U C;  4JJN A;  4YM6 C;  3MGP C;  3AZN D;  3X1U D;  3KXB B;  1P3F C;  3MGQ B;  3MVD B;  4G91 B;  2Y2N A;  4XZQ A;  1H3O B;  5B33 A;  3AZJ C;  1P3O A;  2ZY3 A;  5E5A D;  3X1T A;  4R8P B;  3B0C T;  2HIO C;  3VH5 A;  4XUJ B;  4LD9 C;  5AY8 D;  1ZLA D;  2G5I C;  4KGC C;  1KX3 A;  3WA9 A;  5B0Z A;  4Z66 A;  4WU9 B;  1P3I B;  4Z5T B;  4J8X C;  5GXQ D;  3AZG B;  2Y2I A;  1F66 D;  3A1I A;  3B6F D;  3AV1 B;  2HUE B;  4AWL C;  1M18 A;  3TU4 C;  5AVB D;  2Y2H A;  2Y2K A;  3W97 A;  3W96 B;  4Z66 B;  3VH6 W;  5CP6 B;  3EG5 B;  3KSY A;  3NQJ A;  5B1M D;  5B2J A;  3WKJ B;  4J8U A;  1P3P B;  1AOI C;  4YM6 A;  3LEL D;  4H9R A;  1P3F A;  5B0Y C;  1P3B C;  5AV8 B;  3REK B;  3UTA B;  1HQ3 B;  3AZE D;  1M18 B;  3AZJ A;  1B6W A;  5GT3 D;  1P3L C;  3KFU G;  3AN2 C;  1KX4 C;  5DNN A;  4HGA B;  5B2J B;  3O62 B;  3UT9 C;  4X23 D;  3MNN C;  3AZK B;  4ZUX D;  3REH A;  4J8V D;  4QLC D;  1P3M B;  3AZN C;  4YS3 D;  4J8X A;  1M19 B;  1M1A D;  3WTP D;  3R45 A;  1EQZ C;  4Z2M H;  4J8W A;  3AV2 D;  4CSR B;  3AZM B;  5E5A C;  3W98 B;  3EPH A;  5GSU D;  5B24 B;  3AZL D;  1S32 B;  3WAA D;  5AV6 B;  5BT1 D;  5AY8 C;  3TU4 A;  3LJA A;  3REH B;  3LZ1 C;  3C1C B;  5AVC A;  2FJ7 D;  2RVQ C;  3KWQ B;  5B1L B;  5GXQ C;  5AV9 A;  3MGR B;  1P3G A;  5B0Y A;  2BYM B;  1F66 C;  3X1S B;  2F8N A;  3MGP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...