1EQZD

X-ray structure of the nucleosome core particle at 2.5 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
88
Chain Sequence
GAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 146 NUCLEOTIDES LONG DNA
publication title Asymmetries in the nucleosome core particle at 2.5 A resolution.
pubmed doi rcsb
total genus 28
structure length 88
sequence length 89
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1eqzD00
3MGRD 3WAAA 3AZHC 5BS7A 3W98C 3MGRB 3AV1D 3X1SD 1P3PA 5CP6A 3AZMB 1S32A 3KXBB 3AV1B 3X1SB 4WU8A 5AV6D 5G49A 5DNMD 3B6GD 1EQZC 5AV6B 4R8PA 5BS7C 1P3AA 5B33D 5DNMB 3MVDA 3AV2B 5B0ZC 3X1TD 4EO5B 3W97B 4H9OB 5B24A 3X1TB 3AZID 1M1AB 3B6GA 3MGRC 1M19A 3LJAB 3C1CD 3AZKD 3AN2A 3C1CB 4J8XA 3AV1C 3AZND 3X1SC 5AV8D 3MNNB 3AZEB 4KGCA 3AZNB 1F66D 5B2JB 4J8UD 5BNVB 5AV6C 3AZIA 3WKJD 3A6NB 5DNMC 1F66B 4J8UB 1M18A 3NQJA 5B33C 4H9SA 1P34B 5B1MD 4EO5C 2BYKA 5AV8A 3VH5T 3VH6A 5AY8A 3RELD 3X1TC 1M1AC 3AZFA 1P3BD 4J8WA 4XUJB 3AZIC 1P3OD 5F99D 3UTBA 1BH9B 3UT9D 4H9PB 3C1CC 3AZKC 1P3OB 5F99B 3UT9B 5B0YD 3AZNC 5DNNA 5AVBB 5AV8C 3VH6W 2FJ7B 3AZGA 5B0YB 1P3MB 1F66C 4J8UC 1ULYA 1ZLAD 4ZUXA 3X1UA 3WKJC 4XZQA 3B6FD 1BFMA 4X23D 1ZLAB 5B1LB 1KX3A 5JRGB 5B1MC 3O62D 1P3LD 3NQUA 2HIOA 3RELC 2PYOA 4CSRB 3AYWD 3O62B 1P3LB 1P3BC 3UTAA 1P3OC 5F99C 3REID 3UT9C 5CPIB 3B6FA 1TAFB 3REJA 3C1BD 3REIB 4M6BA 3W96D 5B0YC 3C1BB 2AROB 3W99B 2F8ND 4H9QB 3W96B 4Z5TA 2NQBA 1ZLAC 3AZJB 5B32D 3KUYD 5JRGC 2BYMB 5AVCA 5CPKA 4X23C 1P3KB 4JJND 1H3OB 1TZYA 4H9NB 1KX4B 3O62C 3B0CW 1P3LC 4JJNB 5E5AA 3AFAD 4YM6A 3AYWC 1ID3A 4LD9D 4Z66A 3MGQA 4WU9D 3REIC 2F8NG 4AWLB 3C1BC 4WU9B 3W99C 4J8VD 5B32G 3W96C 4J8VB 3AZJC 4Z2MG 3AZHA 1P3ID 4YS3D 1KX5D 1P3KC 3W98A 5B32C 3KUYC 3MGSD 1P3IB 1KX5B 1HQ3B 4DRBA 3WTPD 4JJNC 3MGSB 5JA4B 1N1JB 4NFTA 4KHAB 4NE3A 3WTPB 3AFAC 1EQZA 4G91C 4LD9C 4AWLC 3B0DB 4WU9C 5B2ID 4WZSB 3AZMD 1P3FD 2L5AA 3KXBD 5B2IB 4J8VC 5B0ZA 1P3FB 1A7WA 4NE5A 3MGRA 1P3IC 4YS3C 5BNXA 5B31D 1KX5C 1AOID 1HQ3C 1HTAA 3MGSC 3AV2D 2CV5D 5B31B 3X1SA 3AV1A 1AOIB 3W97D 3WTPC 1WWIA 2F8NK 2IO5C 3AZLD 2CV5B 1M1AD 5AV6A 3LJAD 5AV9B 3LZ1D 3B0DC 3AZLB 3V9RB 5DNMA 2YFVB 3LZ1B 5B33A 3TU4D 5B2IC 1F1EA 3AZMC 1P3FC 3MNND 3KXBC 3AZED 4H9OA 2NZDD 3TU4B 5B2JD 5B31G 3X1TA 4NE6A 1M1AA 2NZDB 5GT0D 3A6ND 4KUDD 5GT0B 3LELB 1P34D 3C1CA 5B31C 3AZKA 1AOIC 4KUDB 3AV2C 3AN2B 2CV5C 3AZNA 3W97C 4E44A 3AZLC 4XUJD 3A6NA 4KGCB 1F66A 4J8UA 1JFIB 5B40D 3LJAC 3LZ1C 3WKJA 5B40B 5CHLB 3TU4C 5AVBD 5B1MA 2FJ7D 2NZDC 3MNNC 3AZEC 4WV4B 5GT3D 5B2JC 1P3MD 3KSYA 3RELA 3WA9D 3REKD 2RVQD 5GT0C 3LELC 2JSSA 3A6NC 5GT3B 1P3BA 1P3OA 3WA9B 5B1LD 3REKB 5F99A 3UT9A 4KUDC 5JRGD 1P34C 3MGPD 5B0YA 2YFWA 3KWQD 5GXQD 3REHD 3MGPB 4XUJC 5CPID 3KWQB 1ZLAA 5B40C 5GXQB 4ZUXB 3REHB 5JRGA 4X23A 1KX3B 2AROD 5AV5B 5AVBC 3W99D 4G92B 2FJ7C 3R45A 3O62A 1P3LA 5GT3C 1P3MC 3AZJD 3WA9C 4UUZB 3REKC 2RVQC 3AYWA 1TAFA 1P3KD 5CPJD 3UTAB 5B1LC 3REIA 2F8NH 3C1BA 5CPJB 1KX4D 3W99A 1BH8B 4H9QA 3W96A 3MGPC 3KWQC 3AZJA 2F8NA 5GXQC 3REHC 2BYMA 5CPIC 1P3KA 5B32A 3KUYA 5AV5C 5KDMB 4DRAA 4H9NA 1P3GB 4ZBJB 2AROC 4JJNA 3X1VD 2HUEB 3AFAA 3X1VB 4LD9A 1ID3B 4QLCD 4Z66B 3MGQB 4WU9A 5CPJC 1U35B 1HQ3D 2CWEA 4QLCB 4WNNB 1KX4C 4J8VA 5FUGA 5BO0B 3VH5A 1P3IA 3AZHB 4YS3A 1KX5A 1HQ3A 3MGSA 5JA4A 1N1JA 5GSUD 3WTPA 4H9RB 4CAYA 3X1VC 5GSUB 3LZ0D 3WAAD 1U35C 3LZ0B 1EQZB 3WAAB 1KU5A 3VH5W 4QLCC 1P3PD 5B2IA 5C3IB 5CP6D 3AZMA 1P3FA 3KXBA 1S32D 4WU8D 1P3PB 5CP6B 5AV9D 1S32B 4WU8B 4R8PD 5G49B 3B0CT 1P3AD 5B31A 1AOIA 5BNXB 4R8PB 1P3AB 3MVDD 3AV2A 2CV5A 3W97A 5GSUC 5AV9A 3MVDB 5B24D 3AZLA 3V9RA 3LZ0C 3WAAC 2YFVA 3LELD 3LJAA 3LZ1A 1M19D 5B24B 5C3IC 3B6GB 1M19B 3AN2D 4J8XD 5B33B 3TU4A 1P3PC 5CP6C 2NZDA 3MNNA 1S32C 4J8XB 3AZEA 4KGCD 4WU8C 5B2JA 5BNVA 5AV9C 5GT0A 3LELA 1M18D 4R8PC 3AZIB 1P3AC 4KUDA 1P34A 3AZKB 2LY8A 3NQJB 1M18B 3MVDC 5AY8D 1JFIA 2BYKB 5AV8B 1Q9CA 5B24C 3AZFD 5AY8B 4J8WD 4XUJA 1BH9A 4HGAB 3UTBD 3B6GC 5B40A 4H9PA 1M19C 3AZFB 4J8WB 3WKJB 3UTBB 3AN2C 4J8XC 5AVBA 5DNND 5B1MB 2FJ7A 3AZGD 4KGCC 5GT3A 1P3MA 5DNNB 1R4VA 3RELB 4ZUXD 3REKA 3WA9A 3X1UD 3AZGB 3WTPE 4XZQD 1P3BB 1M18C 5B1LA 1KX3D 3X1UB 5AV5D 4H9SC 4XZQB 1B6WA 5AY8C 3MGPA 2HIOD 2PYOD 4CSRA 3KWQA 2YFWB 4HGAC 5GXQA 3REHA 3AZFC 3NQUB 4J8WC 3UTAD 2HIOB 2PYOB 5CPIA 3UTBC 3REJD 5AV5A 3B6FB 4X23B 3REJB 2AROA 5DNNC 4UUZA 4Z5TD 3AZGC 2NQBD 3R45B 4ZUXC 3X1UC 4Z5TB 3AYWB 4Z2MH 5BT1D 2NQBB 4XZQC 5AVCD 5CPKD 5CPJA 1KX3C 1P3GD 1BH8A 3B0BA 1H3OA 1TZYD 5AVCB 4G92C 5CPKB 1KX4A 1TZYB 5E5AD 2HIOC 2PYOC 4YM6D 1ID3D 2F8NB 4Z66D 3MGQD 5E5AB 3UTAC 1U35D 5KDMA 4YM6B 3VH6T 3B6FC 1WWSA 5B32B 3REJC 1P3GA 3KUYB 3X1VA 4Z5TC 1B67A 2NQBC 3AZHD 3W98D 1U35A 3AFAB 4G91B 5BT1C 4LD9B 4QLCA 4WNNA 5AVCC 5CPKC 3W98B 1P3GC 4ZBJC 5BO0A 1TZYC 4KHAA 2HUEC 5FUGB 5E5AC 4YM6C 1EQZD 1ID3C 4Z66C 3MGQC 4E45A 4YS3B 4H9RA 5B0ZD 5GSUA 2IO5B 5B0ZB 4CAYB 3LZ0A
chains in the Genus database with same CATH superfamily
3MGRD 3WAAA 3AZHC 5BS7A 3W98C 3MGRB 3AV1D 3X1SD 1P3PA 5CP6A 3AZMB 1S32A 3KXBB 3AV1B 3X1SB 4WU8A 5AV6D 5G49A 5DNMD 3EG5B 1EQZC 3B6GD 5AV6B 4R8PA 5BS7C 1P3AA 5B33D 5DNMB 3MVDA 3AV2B 5B0ZC 3X1TD 4EO5B 3W97B 4H9OB 5B24A 3X1TB 3AZID 1M1AB 3B6GA 3MGRC 1M19A 3LJAB 3C1CD 3AZKD 3AN2A 3C1CB 4J8XA 3AV1C 3AZND 2ZM5A 3X1SC 5AV8D 3MNNB 3AZEB 4KGCA 3AZNB 1F66D 5B2JB 4J8UD 5BNVB 5AV6C 3AZIA 3WKJD 3A6NB 5DNMC 1F66B 4J8UB 1M18A 3NQJA 2G5IC 5B33C 4H9SA 1P34B 5B1MD 4EO5C 2BYKA 5AV8A 3VH5T 3VH6A 5AY8A 3RELD 3X1TC 1M1AC 2FFFB 2Y2LA 3AZFA 1P3BD 4J8WA 4XUJB 3AZIC 1P3OD 5F99D 3UTBA 1BH9B 3UT9D 4H9PB 3C1CC 3FDDA 3AZKC 1P3OB 5F99B 3UT9B 2Y2NA 5B0YD 3AZNC 5DNNA 5AVBB 5AV8C 3VH6W 2FJ7B 3AZGA 5B0YB 1P3MB 1F66C 4J8UC 1ULYA 3H0LC 1ZLAD 4ZUXA 3X1UA 3WKJC 4XZQA 3B6FD 1BFMA 4X23D 1ZLAB 5B1LB 1KX3A 5JRGB 2Y2HA 5B1MC 2UWXA 3O62D 1P3LD 2ZY2A 3NQUA 2HIOA 3RELC 2PYOA 4CSRB 3AYWD 3O62B 1P3LB 1P3BC 3UTAA 1P3OC 5F99C 3REID 3UT9C 5CPIB 3B6FA 1TAFB 3REJA 3C1BD 3REIB 4M6BA 3W96D 5B0YC 3C1BB 2AROB 3W99B 2F8ND 4H9QB 3W96B 4Z5TA 2NQBA 1ZLAC 3AZJB 5B32D 2Y2KA 3KUYD 5JRGC 2BYMB 5AVCA 5CPKA 4X23C 1P3KB 4JJND 1H3OB 1TZYA 4H9NB 1KX4B 3O62C 3B0CW 1P3LC 3EPLA 4JJNB 5E5AA 3AFAD 4YM6A 3AYWC 1ID3A 4LD9D 4Z66A 3MGQA 2DQNC 4WU9D 3REIC 2F8NG 4AWLB 3C1BC 4WU9B 3EPJA 3W99C 4J8VD 5B32G 3W96C 2Y2OA 4J8VB 3AZJC 4Z2MG 3AZHA 1P3ID 4YS3D 1KX5D 1P3KC 3W98A 5B32C 3KUYC 3MGSD 1P3IB 3H0MC 1KX5B 1HQ3B 4DRBA 3WTPD 4JJNC 3MGSB 5JA4B 1N1JB 4NFTA 4KHAB 4NE3A 3WTPB 3AFAC 1EQZA 4G91C 4LD9C 4AWLC 3B0DB 4WU9C 5B2ID 4WZSB 3AZMD 1P3FD 2L5AA 3KXBD 5B2IB 4J8VC 5B0ZA 1P3FB 1A7WA 4NE5A 3MGRA 3KFUG 1P3IC 4YS3C 5BNXA 5B31D 1KX5C 1AOID 1HQ3C 2ZY4A 2XD1A 1HTAA 3MGSC 3AV2D 2CV5D 5B31B 3X1SA 3AV1A 1AOIB 3W97D 3WTPC 1WWIA 2F8NK 2IO5C 3AZLD 2CV5B 1M1AD 5AV6A 3LJAD 5AV9B 3LZ1D 3B0DC 3AZLB 3V9RB 5DNMA 2YFVB 3LZ1B 5B33A 3TU4D 2Y2MA 5B2IC 2ZY5A 1F1EA 2Y2GA 3AZMC 1P3FC 3MNND 3KXBC 3AZED 4H9OA 2NZDD 3TU4B 5B2JD 5B31G 3X1TA 4NE6A 1M1AA 2NZDB 5GT0D 3A6ND 2Y2PA 4KUDD 5GT0B 3LELB 1P34D 3C1CA 5B31C 3AZKA 1AOIC 2RIQA 2J8PA 4KUDB 3AV2C 3AN2B 2CV5C 3AZNA 3IP4C 3W97C 4E44A 3AZLC 4XUJD 3A6NA 4KGCB 1F66A 4J8UA 1JFIB 5B40D 3LJAC 3LZ1C 3WKJA 3P5JB 5B40B 5CHLB 3TU4C 5AVBD 5B1MA 2FJ7D 2NZDC 3MNNC 3AZEC 4WV4B 5GT3D 5B2JC 1P3MD 3KSYA 3RELA 3WA9D 3REKD 2RVQD 5GT0C 3LELC 2JSSA 3A6NC 5GT3B 1P3BA 2G5HC 1P3OA 3WA9B 5B1LD 3REKB 5F99A 3UT9A 4KUDC 5JRGD 1P34C 2Y2JA 3MGPD 5B0YA 2W8SA 2YFWA 3KWQD 5GXQD 3REHD 3MGPB 4XUJC 5CPID 3KWQB 1ZLAA 5B40C 5GXQB 4ZUXB 3REHB 5JRGA 4X23A 1KX3B 2AROD 5AV5B 5AVBC 3W99D 4G92B 2FJ7C 3R45A 3O62A 1P3LA 5GT3C 1P3MC 3AZJD 3WA9C 4UUZB 3REKC 2RVQC 3AYWA 1TAFA 1P3KD 5CPJD 3UTAB 5B1LC 3REIA 2F8NH 3C1BA 5CPJB 1KX4D 3W99A 1BH8B 4H9QA 3W96A 3MGPC 3KWQC 3AZJA 2F8NA 5GXQC 3REHC 2BYMA 5CPIC 1P3KA 1T3UA 5B32A 3KUYA 5AV5C 5KDMB 4DRAA 4H9NA 3F6TA 1P3GB 4ZBJB 2AROC 4JJNA 3X1VD 2HUEB 3AFAA 3X1VB 4LD9A 1ID3B 4QLCD 4Z66B 3MGQB 4WU9A 5CPJC 1U35B 1HQ3D 2CWEA 4QLCB 4WNNB 1KX4C 4J8VA 5FUGA 5BO0B 2Y2QA 3VH5A 1P3IA 3AZHB 4YS3A 1KX5A 1HQ3A 2F2AC 3MGSA 5JA4A 1N1JA 5GSUD 3WTPA 4H9RB 4CAYA 3X1VC 5GSUB 3LZ0D 3WAAD 2ZY3A 1U35C 3LZ0B 1EQZB 3WAAB 3AL0C 1KU5A 3VH5W 4QLCC 1P3PD 5B2IA 5C3IB 5CP6D 3AZMA 1P3FA 3KXBA 1S32D 4WU8D 1P3PB 5CP6B 5AV9D 1S32B 4WU8B 4R8PD 5G49B 3B0CT 1P3AD 4DQYB 5B31A 1AOIA 5BNXB 4R8PB 1P3AB 3MVDD 3AV2A 2CV5A 2Y2IA 1Z2CB 3W97A 5GSUC 5AV9A 3MVDB 5B24D 3AZLA 3V9RA 3LZ0C 3WAAC 2YFVA 3LELD 3LJAA 3LZ1A 1M19D 5B24B 5C3IC 3B6GB 1M19B 3AN2D 4J8XD 5B33B 3TU4A 1P3PC 5CP6C 2NZDA 3MNNA 1S32C 4J8XB 3AZEA 4KGCD 4WU8C 5B2JA 5BNVA 5AV9C 5GT0A 3LELA 1M18D 4R8PC 3AZIB 1W2EA 1P3AC 4KUDA 1P34A 3AZKB 2LY8A 3NQJB 1M18B 3MVDC 5AY8D 1JFIA 2BYKB 5AV8B 1Q9CA 5B24C 3AZFD 5AY8B 4J8WD 4XUJA 2VQRA 1BH9A 4HGAB 3UTBD 3B6GC 5B40A 4H9PA 1M19C 3AZFB 4J8WB 3WKJB 3A1KA 3UTBB 3AN2C 4J8XC 5AVBA 5DNND 5B1MB 2FJ7A 3AZGD 4KGCC 5GT3A 1P3MA 5DNNB 1R4VA 3RELB 4ZUXD 3REKA 3WA9A 3X1UD 3AZGB 3WTPE 3EPKA 4XZQD 1P3BB 4UPKA 5B1LA 2JE5A 1KX3D 1M18C 3X1UB 5AV5D 4WJ3C 4H9SC 4XZQB 1B6WA 5AY8C 3MGPA 2HIOD 2PYOD 4CSRA 3KWQA 2YFWB 4HGAC 5GXQA 3REHA 3AZFC 3NQUB 4J8WC 3UTAD 2HIOB 2PYOB 5CPIA 3UTBC 3REJD 5AV5A 3B6FB 4X23B 3REJB 2AROA 5DNNC 4UUZA 4Z5TD 3AZGC 2NQBD 3R45B 4ZUXC 3X1UC 4Z5TB 3AYWB 4Z2MH 5BT1D 2NQBB 4XZQC 5AVCD 5CPKD 5CPJA 1KX3C 1P3GD 1BH8A 3B0BA 1H3OA 1TZYD 5AVCB 4G92C 5CPKB 1KX4A 1PZRA 2XD5A 1TZYB 5E5AD 2HIOC 2PYOC 4YM6D 1ID3D 2F8NB 4Z66D 3MGQD 5E5AB 3UTAC 1U35D 5KDMA 4YM6B 3VH6T 3B6FC 1WWSA 5B32B 3REJC 1P3GA 3KUYB 3X1VA 4Z5TC 2BG1A 1B67A 2NQBC 3EPHA 3AZHD 3W98D 1U35A 3AFAB 4G91B 5BT1C 4LD9B 4QLCA 4WNNA 5AVCC 5CPKC 3W98B 1P3GC 4ZBJC 5BO0A 1TZYC 4KHAA 2HUEC 5FUGB 2JCHA 5E5AC 4YM6C 3A1IA 1EQZD 1ID3C 4Z66C 3MGQC 4E45A 4YS3B 4H9RA 2DF4C 5B0ZD 5GSUA 3H0RC 2IO5B 5B0ZB 4CAYB 3LZ0A
chains in the Genus database with same CATH topology
3MGRD 3WAAA 3AZHC 5BS7A 3W98C 3MGRB 3AV1D 3X1SD 1P3PA 5CP6A 3AZMB 1S32A 3KXBB 3AV1B 3X1SB 4WU8A 5AV6D 5G49A 5DNMD 3EG5B 1EQZC 3B6GD 5AV6B 4R8PA 5BS7C 1P3AA 5B33D 5DNMB 3MVDA 3AV2B 5B0ZC 3X1TD 4EO5B 3W97B 4H9OB 5B24A 3X1TB 3AZID 1M1AB 3B6GA 3MGRC 1M19A 3LJAB 3C1CD 3AZKD 3AN2A 3C1CB 4J8XA 3AV1C 3AZND 2ZM5A 3X1SC 5AV8D 3MNNB 3AZEB 4KGCA 3AZNB 1F66D 5B2JB 4J8UD 5BNVB 5AV6C 3AZIA 3WKJD 3A6NB 5DNMC 1F66B 4J8UB 1M18A 3NQJA 2G5IC 5B33C 4H9SA 1P34B 5B1MD 4EO5C 2BYKA 5AV8A 3VH5T 3VH6A 5AY8A 3RELD 3X1TC 1M1AC 2FFFB 2Y2LA 3AZFA 1P3BD 4J8WA 4XUJB 3AZIC 1P3OD 5F99D 3UTBA 1BH9B 3UT9D 4H9PB 3C1CC 3FDDA 3AZKC 1P3OB 5F99B 3UT9B 2Y2NA 5B0YD 3AZNC 5DNNA 5AVBB 5AV8C 3VH6W 2FJ7B 3AZGA 5B0YB 1P3MB 1F66C 4J8UC 1ULYA 3H0LC 1ZLAD 4ZUXA 3X1UA 3WKJC 4XZQA 3B6FD 1BFMA 4X23D 1ZLAB 5B1LB 1KX3A 5JRGB 2Y2HA 5B1MC 2UWXA 3O62D 1P3LD 2ZY2A 3NQUA 2HIOA 3RELC 2PYOA 4CSRB 3AYWD 3O62B 1P3LB 1P3BC 3UTAA 1P3OC 5F99C 3REID 3UT9C 5CPIB 3B6FA 1TAFB 3REJA 3C1BD 3REIB 4M6BA 3W96D 5B0YC 3C1BB 2AROB 3W99B 2F8ND 4H9QB 3W96B 4Z5TA 2NQBA 1ZLAC 3AZJB 5B32D 2Y2KA 3KUYD 5JRGC 2BYMB 5AVCA 5CPKA 4X23C 1P3KB 4JJND 1H3OB 1TZYA 4H9NB 1KX4B 3O62C 3B0CW 1P3LC 3EPLA 4JJNB 5E5AA 3AFAD 4YM6A 3AYWC 1ID3A 4LD9D 4Z66A 3MGQA 2DQNC 4WU9D 3REIC 2F8NG 4AWLB 3C1BC 4WU9B 3EPJA 3W99C 4J8VD 5B32G 3W96C 2Y2OA 4J8VB 3AZJC 4Z2MG 3AZHA 1P3ID 4YS3D 1KX5D 1P3KC 3W98A 5B32C 3KUYC 3MGSD 1P3IB 3H0MC 1KX5B 1HQ3B 4DRBA 3WTPD 4JJNC 3MGSB 5JA4B 1N1JB 4NFTA 4KHAB 4NE3A 3WTPB 3AFAC 1EQZA 4G91C 4LD9C 4AWLC 3B0DB 4WU9C 5B2ID 4WZSB 3AZMD 1P3FD 2L5AA 3KXBD 5B2IB 4J8VC 5B0ZA 1P3FB 1A7WA 4NE5A 3MGRA 3KFUG 1P3IC 4YS3C 5BNXA 5B31D 1KX5C 1AOID 1HQ3C 2ZY4A 2XD1A 1HTAA 3MGSC 3AV2D 2CV5D 5B31B 3X1SA 3AV1A 1AOIB 3W97D 3WTPC 1WWIA 2F8NK 2IO5C 3AZLD 2CV5B 1M1AD 5AV6A 3LJAD 5AV9B 3LZ1D 3B0DC 3AZLB 3V9RB 5DNMA 2YFVB 3LZ1B 5B33A 3TU4D 2Y2MA 5B2IC 2ZY5A 1F1EA 2Y2GA 3AZMC 1P3FC 3MNND 3KXBC 3AZED 4H9OA 2NZDD 3TU4B 5B2JD 5B31G 3X1TA 4NE6A 1M1AA 2NZDB 5GT0D 3A6ND 2Y2PA 4KUDD 5GT0B 3LELB 1P34D 3C1CA 5B31C 3AZKA 1AOIC 2RIQA 2J8PA 4KUDB 3AV2C 3AN2B 2CV5C 3AZNA 3IP4C 3W97C 4E44A 3AZLC 4XUJD 3A6NA 4KGCB 1F66A 4J8UA 1JFIB 5B40D 3LJAC 3LZ1C 3WKJA 3P5JB 5B40B 5CHLB 3TU4C 5AVBD 5B1MA 2FJ7D 2NZDC 3MNNC 3AZEC 4WV4B 5GT3D 5B2JC 1P3MD 3KSYA 3RELA 3WA9D 3REKD 2RVQD 5GT0C 3LELC 2JSSA 3A6NC 5GT3B 1P3BA 2G5HC 1P3OA 3WA9B 5B1LD 3REKB 5F99A 3UT9A 4KUDC 5JRGD 1P34C 2Y2JA 3MGPD 5B0YA 2W8SA 2YFWA 3KWQD 5GXQD 3REHD 3MGPB 4XUJC 5CPID 3KWQB 1ZLAA 5B40C 5GXQB 4ZUXB 3REHB 5JRGA 4X23A 1KX3B 2AROD 5AV5B 5AVBC 3W99D 4G92B 2FJ7C 3R45A 3O62A 1P3LA 5GT3C 1P3MC 3AZJD 3WA9C 4UUZB 3REKC 2RVQC 3AYWA 1TAFA 1P3KD 5CPJD 3UTAB 5B1LC 3REIA 2F8NH 3C1BA 5CPJB 1KX4D 3W99A 1BH8B 4H9QA 3W96A 3MGPC 3KWQC 3AZJA 2F8NA 5GXQC 3REHC 2BYMA 5CPIC 1P3KA 1T3UA 5B32A 3KUYA 5AV5C 5KDMB 4DRAA 4H9NA 3F6TA 1P3GB 4ZBJB 2AROC 4JJNA 3X1VD 2HUEB 3AFAA 3X1VB 4LD9A 1ID3B 4QLCD 4Z66B 3MGQB 4WU9A 5CPJC 1U35B 1HQ3D 2CWEA 4QLCB 4WNNB 1KX4C 4J8VA 5FUGA 5BO0B 2Y2QA 3VH5A 1P3IA 3AZHB 4YS3A 1KX5A 1HQ3A 2F2AC 3MGSA 5JA4A 1N1JA 5GSUD 3WTPA 4H9RB 4CAYA 3X1VC 5GSUB 3LZ0D 3WAAD 2ZY3A 1U35C 3LZ0B 1EQZB 3WAAB 3AL0C 1KU5A 3VH5W 4QLCC 1P3PD 5B2IA 5C3IB 5CP6D 3AZMA 1P3FA 3KXBA 1S32D 4WU8D 1P3PB 5CP6B 5AV9D 1S32B 4WU8B 4R8PD 5G49B 3B0CT 1P3AD 4DQYB 5B31A 1AOIA 5BNXB 4R8PB 1P3AB 3MVDD 3AV2A 2CV5A 2Y2IA 1Z2CB 3W97A 5GSUC 5AV9A 3MVDB 5B24D 3AZLA 3V9RA 3LZ0C 3WAAC 2YFVA 3LELD 3LJAA 3LZ1A 1M19D 5B24B 5C3IC 3B6GB 1M19B 3AN2D 4J8XD 5B33B 3TU4A 1P3PC 5CP6C 2NZDA 3MNNA 1S32C 4J8XB 3AZEA 4KGCD 4WU8C 5B2JA 5BNVA 5AV9C 5GT0A 3LELA 1M18D 4R8PC 3AZIB 1W2EA 1P3AC 4KUDA 1P34A 3AZKB 2LY8A 3NQJB 1M18B 3MVDC 5AY8D 1JFIA 2BYKB 5AV8B 1Q9CA 5B24C 3AZFD 5AY8B 4J8WD 4XUJA 2VQRA 1BH9A 4HGAB 3UTBD 3B6GC 5B40A 4H9PA 1M19C 3AZFB 4J8WB 3WKJB 3A1KA 3UTBB 3AN2C 4J8XC 5AVBA 5DNND 5B1MB 2FJ7A 3AZGD 4KGCC 5GT3A 1P3MA 5DNNB 1R4VA 3RELB 4ZUXD 3REKA 3WA9A 3X1UD 3AZGB 3WTPE 3EPKA 4XZQD 1P3BB 4UPKA 5B1LA 2JE5A 1KX3D 1M18C 3X1UB 5AV5D 4WJ3C 4H9SC 4XZQB 1B6WA 5AY8C 3MGPA 2HIOD 2PYOD 4CSRA 3KWQA 2YFWB 4HGAC 5GXQA 3REHA 3AZFC 3NQUB 4J8WC 3UTAD 2HIOB 2PYOB 5CPIA 3UTBC 3REJD 5AV5A 3B6FB 4X23B 3REJB 2AROA 5DNNC 4UUZA 4Z5TD 3AZGC 2NQBD 3R45B 4ZUXC 3X1UC 4Z5TB 3AYWB 4Z2MH 5BT1D 2NQBB 4XZQC 5AVCD 5CPKD 5CPJA 1KX3C 1P3GD 1BH8A 3B0BA 1H3OA 1TZYD 5AVCB 4G92C 5CPKB 1KX4A 1PZRA 2XD5A 1TZYB 5E5AD 2HIOC 2PYOC 4YM6D 1ID3D 2F8NB 4Z66D 3MGQD 5E5AB 3UTAC 1U35D 5KDMA 4YM6B 3VH6T 3B6FC 1WWSA 5B32B 3REJC 1P3GA 3KUYB 3X1VA 4Z5TC 2BG1A 1B67A 2NQBC 3EPHA 3AZHD 3W98D 1U35A 3AFAB 4G91B 5BT1C 4LD9B 4QLCA 4WNNA 5AVCC 5CPKC 3W98B 1P3GC 4ZBJC 5BO0A 1TZYC 4KHAA 2HUEC 5FUGB 2JCHA 5E5AC 4YM6C 3A1IA 1EQZD 1ID3C 4Z66C 3MGQC 4E45A 4YS3B 4H9RA 2DF4C 5B0ZD 5GSUA 3H0RC 2IO5B 5B0ZB 4CAYB 3LZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR D;  3WAA A;  3AZH C;  5BS7 A;  3W98 C;  3MGR B;  3AV1 D;  3X1S D;  1P3P A;  5CP6 A;  3AZM B;  1S32 A;  3KXB B;  3AV1 B;  3X1S B;  4WU8 A;  5AV6 D;  5G49 A;  5DNM D;  3B6G D;  1EQZ C;  5AV6 B;  4R8P A;  5BS7 C;  1P3A A;  5B33 D;  5DNM B;  3MVD A;  3AV2 B;  5B0Z C;  3X1T D;  4EO5 B;  3W97 B;  4H9O B;  5B24 A;  3X1T B;  3AZI D;  1M1A B;  3B6G A;  3MGR C;  1M19 A;  3LJA B;  3C1C D;  3AZK D;  3AN2 A;  3C1C B;  4J8X A;  3AV1 C;  3AZN D;  3X1S C;  5AV8 D;  3MNN B;  3AZE B;  4KGC A;  3AZN B;  1F66 D;  5B2J B;  4J8U D;  5BNV B;  5AV6 C;  3AZI A;  3WKJ D;  3A6N B;  5DNM C;  1F66 B;  4J8U B;  1M18 A;  3NQJ A;  5B33 C;  4H9S A;  1P34 B;  5B1M D;  4EO5 C;  2BYK A;  5AV8 A;  3VH5 T;  3VH6 A;  5AY8 A;  3REL D;  3X1T C;  1M1A C;  3AZF A;  1P3B D;  4J8W A;  4XUJ B;  3AZI C;  1P3O D;  5F99 D;  3UTB A;  1BH9 B;  3UT9 D;  4H9P B;  3C1C C;  3AZK C;  1P3O B;  5F99 B;  3UT9 B;  5B0Y D;  3AZN C;  5DNN A;  5AVB B;  5AV8 C;  3VH6 W;  2FJ7 B;  3AZG A;  5B0Y B;  1P3M B;  1F66 C;  4J8U C;  1ULY A;  1ZLA D;  4ZUX A;  3X1U A;  3WKJ C;  4XZQ A;  3B6F D;  1BFM A;  4X23 D;  1ZLA B;  5B1L B;  1KX3 A;  5JRG B;  5B1M C;  3O62 D;  1P3L D;  3NQU A;  2HIO A;  3REL C;  2PYO A;  4CSR B;  3AYW D;  3O62 B;  1P3L B;  1P3B C;  3UTA A;  1P3O C;  5F99 C;  3REI D;  3UT9 C;  5CPI B;  3B6F A;  1TAF B;  3REJ A;  3C1B D;  3REI B;  4M6B A;  3W96 D;  5B0Y C;  3C1B B;  2ARO B;  3W99 B;  2F8N D;  4H9Q B;  3W96 B;  4Z5T A;  2NQB A;  1ZLA C;  3AZJ B;  5B32 D;  3KUY D;  5JRG C;  2BYM B;  5AVC A;  5CPK A;  4X23 C;  1P3K B;  4JJN D;  1H3O B;  1TZY A;  4H9N B;  1KX4 B;  3O62 C;  3B0C W;  1P3L C;  4JJN B;  5E5A A;  3AFA D;  4YM6 A;  3AYW C;  1ID3 A;  4LD9 D;  4Z66 A;  3MGQ A;  4WU9 D;  3REI C;  2F8N G;  4AWL B;  3C1B C;  4WU9 B;  3W99 C;  4J8V D;  5B32 G;  3W96 C;  4J8V B;  3AZJ C;  4Z2M G;  3AZH A;  1P3I D;  4YS3 D;  1KX5 D;  1P3K C;  3W98 A;  5B32 C;  3KUY C;  3MGS D;  1P3I B;  1KX5 B;  1HQ3 B;  4DRB A;  3WTP D;  4JJN C;  3MGS B;  5JA4 B;  1N1J B;  4NFT A;  4KHA B;  4NE3 A;  3WTP B;  3AFA C;  1EQZ A;  4G91 C;  4LD9 C;  4AWL C;  3B0D B;  4WU9 C;  5B2I D;  4WZS B;  3AZM D;  1P3F D;  2L5A A;  3KXB D;  5B2I B;  4J8V C;  5B0Z A;  1P3F B;  1A7W A;  4NE5 A;  3MGR A;  1P3I C;  4YS3 C;  5BNX A;  5B31 D;  1KX5 C;  1AOI D;  1HQ3 C;  1HTA A;  3MGS C;  3AV2 D;  2CV5 D;  5B31 B;  3X1S A;  3AV1 A;  1AOI B;  3W97 D;  3WTP C;  1WWI A;  2F8N K;  2IO5 C;  3AZL D;  2CV5 B;  1M1A D;  5AV6 A;  3LJA D;  5AV9 B;  3LZ1 D;  3B0D C;  3AZL B;  3V9R B;  5DNM A;  2YFV B;  3LZ1 B;  5B33 A;  3TU4 D;  5B2I C;  1F1E A;  3AZM C;  1P3F C;  3MNN D;  3KXB C;  3AZE D;  4H9O A;  2NZD D;  3TU4 B;  5B2J D;  5B31 G;  3X1T A;  4NE6 A;  1M1A A;  2NZD B;  5GT0 D;  3A6N D;  4KUD D;  5GT0 B;  3LEL B;  1P34 D;  3C1C A;  5B31 C;  3AZK A;  1AOI C;  4KUD B;  3AV2 C;  3AN2 B;  2CV5 C;  3AZN A;  3W97 C;  4E44 A;  3AZL C;  4XUJ D;  3A6N A;  4KGC B;  1F66 A;  4J8U A;  1JFI B;  5B40 D;  3LJA C;  3LZ1 C;  3WKJ A;  5B40 B;  5CHL B;  3TU4 C;  5AVB D;  5B1M A;  2FJ7 D;  2NZD C;  3MNN C;  3AZE C;  4WV4 B;  5GT3 D;  5B2J C;  1P3M D;  3KSY A;  3REL A;  3WA9 D;  3REK D;  2RVQ D;  5GT0 C;  3LEL C;  2JSS A;  3A6N C;  5GT3 B;  1P3B A;  1P3O A;  3WA9 B;  5B1L D;  3REK B;  5F99 A;  3UT9 A;  4KUD C;  5JRG D;  1P34 C;  3MGP D;  5B0Y A;  2YFW A;  3KWQ D;  5GXQ D;  3REH D;  3MGP B;  4XUJ C;  5CPI D;  3KWQ B;  1ZLA A;  5B40 C;  5GXQ B;  4ZUX B;  3REH B;  5JRG A;  4X23 A;  1KX3 B;  2ARO D;  5AV5 B;  5AVB C;  3W99 D;  4G92 B;  2FJ7 C;  3R45 A;  3O62 A;  1P3L A;  5GT3 C;  1P3M C;  3AZJ D;  3WA9 C;  4UUZ B;  3REK C;  2RVQ C;  3AYW A;  1TAF A;  1P3K D;  5CPJ D;  3UTA B;  5B1L C;  3REI A;  2F8N H;  3C1B A;  5CPJ B;  1KX4 D;  3W99 A;  1BH8 B;  4H9Q A;  3W96 A;  3MGP C;  3KWQ C;  3AZJ A;  2F8N A;  5GXQ C;  3REH C;  2BYM A;  5CPI C;  1P3K A;  5B32 A;  3KUY A;  5AV5 C;  5KDM B;  4DRA A;  4H9N A;  1P3G B;  4ZBJ B;  2ARO C;  4JJN A;  3X1V D;  2HUE B;  3AFA A;  3X1V B;  4LD9 A;  1ID3 B;  4QLC D;  4Z66 B;  3MGQ B;  4WU9 A;  5CPJ C;  1U35 B;  1HQ3 D;  2CWE A;  4QLC B;  4WNN B;  1KX4 C;  4J8V A;  5FUG A;  5BO0 B;  3VH5 A;  1P3I A;  3AZH B;  4YS3 A;  1KX5 A;  1HQ3 A;  3MGS A;  5JA4 A;  1N1J A;  5GSU D;  3WTP A;  4H9R B;  4CAY A;  3X1V C;  5GSU B;  3LZ0 D;  3WAA D;  1U35 C;  3LZ0 B;  1EQZ B;  3WAA B;  1KU5 A;  3VH5 W;  4QLC C;  1P3P D;  5B2I A;  5C3I B;  5CP6 D;  3AZM A;  1P3F A;  3KXB A;  1S32 D;  4WU8 D;  1P3P B;  5CP6 B;  5AV9 D;  1S32 B;  4WU8 B;  4R8P D;  5G49 B;  3B0C T;  1P3A D;  5B31 A;  1AOI A;  5BNX B;  4R8P B;  1P3A B;  3MVD D;  3AV2 A;  2CV5 A;  3W97 A;  5GSU C;  5AV9 A;  3MVD B;  5B24 D;  3AZL A;  3V9R A;  3LZ0 C;  3WAA C;  2YFV A;  3LEL D;  3LJA A;  3LZ1 A;  1M19 D;  5B24 B;  5C3I C;  3B6G B;  1M19 B;  3AN2 D;  4J8X D;  5B33 B;  3TU4 A;  1P3P C;  5CP6 C;  2NZD A;  3MNN A;  1S32 C;  4J8X B;  3AZE A;  4KGC D;  4WU8 C;  5B2J A;  5BNV A;  5AV9 C;  5GT0 A;  3LEL A;  1M18 D;  4R8P C;  3AZI B;  1P3A C;  4KUD A;  1P34 A;  3AZK B;  2LY8 A;  3NQJ B;  1M18 B;  3MVD C;  5AY8 D;  1JFI A;  2BYK B;  5AV8 B;  1Q9C A;  5B24 C;  3AZF D;  5AY8 B;  4J8W D;  4XUJ A;  1BH9 A;  4HGA B;  3UTB D;  3B6G C;  5B40 A;  4H9P A;  1M19 C;  3AZF B;  4J8W B;  3WKJ B;  3UTB B;  3AN2 C;  4J8X C;  5AVB A;  5DNN D;  5B1M B;  2FJ7 A;  3AZG D;  4KGC C;  5GT3 A;  1P3M A;  5DNN B;  1R4V A;  3REL B;  4ZUX D;  3REK A;  3WA9 A;  3X1U D;  3AZG B;  3WTP E;  4XZQ D;  1P3B B;  1M18 C;  5B1L A;  1KX3 D;  3X1U B;  5AV5 D;  4H9S C;  4XZQ B;  1B6W A;  5AY8 C;  3MGP A;  2HIO D;  2PYO D;  4CSR A;  3KWQ A;  2YFW B;  4HGA C;  5GXQ A;  3REH A;  3AZF C;  3NQU B;  4J8W C;  3UTA D;  2HIO B;  2PYO B;  5CPI A;  3UTB C;  3REJ D;  5AV5 A;  3B6F B;  4X23 B;  3REJ B;  2ARO A;  5DNN C;  4UUZ A;  4Z5T D;  3AZG C;  2NQB D;  3R45 B;  4ZUX C;  3X1U C;  4Z5T B;  3AYW B;  4Z2M H;  5BT1 D;  2NQB B;  4XZQ C;  5AVC D;  5CPK D;  5CPJ A;  1KX3 C;  1P3G D;  1BH8 A;  3B0B A;  1H3O A;  1TZY D;  5AVC B;  4G92 C;  5CPK B;  1KX4 A;  1TZY B;  5E5A D;  2HIO C;  2PYO C;  4YM6 D;  1ID3 D;  2F8N B;  4Z66 D;  3MGQ D;  5E5A B;  3UTA C;  1U35 D;  5KDM A;  4YM6 B;  3VH6 T;  3B6F C;  1WWS A;  5B32 B;  3REJ C;  1P3G A;  3KUY B;  3X1V A;  4Z5T C;  1B67 A;  2NQB C;  3AZH D;  3W98 D;  1U35 A;  3AFA B;  4G91 B;  5BT1 C;  4LD9 B;  4QLC A;  4WNN A;  5AVC C;  5CPK C;  3W98 B;  1P3G C;  4ZBJ C;  5BO0 A;  1TZY C;  4KHA A;  2HUE C;  5FUG B;  5E5A C;  4YM6 C;  1EQZ D;  1ID3 C;  4Z66 C;  3MGQ C;  4E45 A;  4YS3 B;  4H9R A;  5B0Z D;  5GSU A;  2IO5 B;  5B0Z B;  4CAY B;  3LZ0 A; 
#chains in the Genus database with same CATH topology
 3MGR D;  3WAA A;  3AZH C;  5BS7 A;  3W98 C;  3MGR B;  3AV1 D;  3X1S D;  1P3P A;  5CP6 A;  3AZM B;  1S32 A;  3KXB B;  3AV1 B;  3X1S B;  4WU8 A;  5AV6 D;  5G49 A;  5DNM D;  3EG5 B;  1EQZ C;  3B6G D;  5AV6 B;  4R8P A;  5BS7 C;  1P3A A;  5B33 D;  5DNM B;  3MVD A;  3AV2 B;  5B0Z C;  3X1T D;  4EO5 B;  3W97 B;  4H9O B;  5B24 A;  3X1T B;  3AZI D;  1M1A B;  3B6G A;  3MGR C;  1M19 A;  3LJA B;  3C1C D;  3AZK D;  3AN2 A;  3C1C B;  4J8X A;  3AV1 C;  3AZN D;  2ZM5 A;  3X1S C;  5AV8 D;  3MNN B;  3AZE B;  4KGC A;  3AZN B;  1F66 D;  5B2J B;  4J8U D;  5BNV B;  5AV6 C;  3AZI A;  3WKJ D;  3A6N B;  5DNM C;  1F66 B;  4J8U B;  1M18 A;  3NQJ A;  2G5I C;  5B33 C;  4H9S A;  1P34 B;  5B1M D;  4EO5 C;  2BYK A;  5AV8 A;  3VH5 T;  3VH6 A;  5AY8 A;  3REL D;  3X1T C;  1M1A C;  2FFF B;  2Y2L A;  3AZF A;  1P3B D;  4J8W A;  4XUJ B;  3AZI C;  1P3O D;  5F99 D;  3UTB A;  1BH9 B;  3UT9 D;  4H9P B;  3C1C C;  3FDD A;  3AZK C;  1P3O B;  5F99 B;  3UT9 B;  2Y2N A;  5B0Y D;  3AZN C;  5DNN A;  5AVB B;  5AV8 C;  3VH6 W;  2FJ7 B;  3AZG A;  5B0Y B;  1P3M B;  1F66 C;  4J8U C;  1ULY A;  3H0L C;  1ZLA D;  4ZUX A;  3X1U A;  3WKJ C;  4XZQ A;  3B6F D;  1BFM A;  4X23 D;  1ZLA B;  5B1L B;  1KX3 A;  5JRG B;  2Y2H A;  5B1M C;  2UWX A;  3O62 D;  1P3L D;  2ZY2 A;  3NQU A;  2HIO A;  3REL C;  2PYO A;  4CSR B;  3AYW D;  3O62 B;  1P3L B;  1P3B C;  3UTA A;  1P3O C;  5F99 C;  3REI D;  3UT9 C;  5CPI B;  3B6F A;  1TAF B;  3REJ A;  3C1B D;  3REI B;  4M6B A;  3W96 D;  5B0Y C;  3C1B B;  2ARO B;  3W99 B;  2F8N D;  4H9Q B;  3W96 B;  4Z5T A;  2NQB A;  1ZLA C;  3AZJ B;  5B32 D;  2Y2K A;  3KUY D;  5JRG C;  2BYM B;  5AVC A;  5CPK A;  4X23 C;  1P3K B;  4JJN D;  1H3O B;  1TZY A;  4H9N B;  1KX4 B;  3O62 C;  3B0C W;  1P3L C;  3EPL A;  4JJN B;  5E5A A;  3AFA D;  4YM6 A;  3AYW C;  1ID3 A;  4LD9 D;  4Z66 A;  3MGQ A;  2DQN C;  4WU9 D;  3REI C;  2F8N G;  4AWL B;  3C1B C;  4WU9 B;  3EPJ A;  3W99 C;  4J8V D;  5B32 G;  3W96 C;  2Y2O A;  4J8V B;  3AZJ C;  4Z2M G;  3AZH A;  1P3I D;  4YS3 D;  1KX5 D;  1P3K C;  3W98 A;  5B32 C;  3KUY C;  3MGS D;  1P3I B;  3H0M C;  1KX5 B;  1HQ3 B;  4DRB A;  3WTP D;  4JJN C;  3MGS B;  5JA4 B;  1N1J B;  4NFT A;  4KHA B;  4NE3 A;  3WTP B;  3AFA C;  1EQZ A;  4G91 C;  4LD9 C;  4AWL C;  3B0D B;  4WU9 C;  5B2I D;  4WZS B;  3AZM D;  1P3F D;  2L5A A;  3KXB D;  5B2I B;  4J8V C;  5B0Z A;  1P3F B;  1A7W A;  4NE5 A;  3MGR A;  3KFU G;  1P3I C;  4YS3 C;  5BNX A;  5B31 D;  1KX5 C;  1AOI D;  1HQ3 C;  2ZY4 A;  2XD1 A;  1HTA A;  3MGS C;  3AV2 D;  2CV5 D;  5B31 B;  3X1S A;  3AV1 A;  1AOI B;  3W97 D;  3WTP C;  1WWI A;  2F8N K;  2IO5 C;  3AZL D;  2CV5 B;  1M1A D;  5AV6 A;  3LJA D;  5AV9 B;  3LZ1 D;  3B0D C;  3AZL B;  3V9R B;  5DNM A;  2YFV B;  3LZ1 B;  5B33 A;  3TU4 D;  2Y2M A;  5B2I C;  2ZY5 A;  1F1E A;  2Y2G A;  3AZM C;  1P3F C;  3MNN D;  3KXB C;  3AZE D;  4H9O A;  2NZD D;  3TU4 B;  5B2J D;  5B31 G;  3X1T A;  4NE6 A;  1M1A A;  2NZD B;  5GT0 D;  3A6N D;  2Y2P A;  4KUD D;  5GT0 B;  3LEL B;  1P34 D;  3C1C A;  5B31 C;  3AZK A;  1AOI C;  2RIQ A;  2J8P A;  4KUD B;  3AV2 C;  3AN2 B;  2CV5 C;  3AZN A;  3IP4 C;  3W97 C;  4E44 A;  3AZL C;  4XUJ D;  3A6N A;  4KGC B;  1F66 A;  4J8U A;  1JFI B;  5B40 D;  3LJA C;  3LZ1 C;  3WKJ A;  3P5J B;  5B40 B;  5CHL B;  3TU4 C;  5AVB D;  5B1M A;  2FJ7 D;  2NZD C;  3MNN C;  3AZE C;  4WV4 B;  5GT3 D;  5B2J C;  1P3M D;  3KSY A;  3REL A;  3WA9 D;  3REK D;  2RVQ D;  5GT0 C;  3LEL C;  2JSS A;  3A6N C;  5GT3 B;  1P3B A;  2G5H C;  1P3O A;  3WA9 B;  5B1L D;  3REK B;  5F99 A;  3UT9 A;  4KUD C;  5JRG D;  1P34 C;  2Y2J A;  3MGP D;  5B0Y A;  2W8S A;  2YFW A;  3KWQ D;  5GXQ D;  3REH D;  3MGP B;  4XUJ C;  5CPI D;  3KWQ B;  1ZLA A;  5B40 C;  5GXQ B;  4ZUX B;  3REH B;  5JRG A;  4X23 A;  1KX3 B;  2ARO D;  5AV5 B;  5AVB C;  3W99 D;  4G92 B;  2FJ7 C;  3R45 A;  3O62 A;  1P3L A;  5GT3 C;  1P3M C;  3AZJ D;  3WA9 C;  4UUZ B;  3REK C;  2RVQ C;  3AYW A;  1TAF A;  1P3K D;  5CPJ D;  3UTA B;  5B1L C;  3REI A;  2F8N H;  3C1B A;  5CPJ B;  1KX4 D;  3W99 A;  1BH8 B;  4H9Q A;  3W96 A;  3MGP C;  3KWQ C;  3AZJ A;  2F8N A;  5GXQ C;  3REH C;  2BYM A;  5CPI C;  1P3K A;  1T3U A;  5B32 A;  3KUY A;  5AV5 C;  5KDM B;  4DRA A;  4H9N A;  3F6T A;  1P3G B;  4ZBJ B;  2ARO C;  4JJN A;  3X1V D;  2HUE B;  3AFA A;  3X1V B;  4LD9 A;  1ID3 B;  4QLC D;  4Z66 B;  3MGQ B;  4WU9 A;  5CPJ C;  1U35 B;  1HQ3 D;  2CWE A;  4QLC B;  4WNN B;  1KX4 C;  4J8V A;  5FUG A;  5BO0 B;  2Y2Q A;  3VH5 A;  1P3I A;  3AZH B;  4YS3 A;  1KX5 A;  1HQ3 A;  2F2A C;  3MGS A;  5JA4 A;  1N1J A;  5GSU D;  3WTP A;  4H9R B;  4CAY A;  3X1V C;  5GSU B;  3LZ0 D;  3WAA D;  2ZY3 A;  1U35 C;  3LZ0 B;  1EQZ B;  3WAA B;  3AL0 C;  1KU5 A;  3VH5 W;  4QLC C;  1P3P D;  5B2I A;  5C3I B;  5CP6 D;  3AZM A;  1P3F A;  3KXB A;  1S32 D;  4WU8 D;  1P3P B;  5CP6 B;  5AV9 D;  1S32 B;  4WU8 B;  4R8P D;  5G49 B;  3B0C T;  1P3A D;  4DQY B;  5B31 A;  1AOI A;  5BNX B;  4R8P B;  1P3A B;  3MVD D;  3AV2 A;  2CV5 A;  2Y2I A;  1Z2C B;  3W97 A;  5GSU C;  5AV9 A;  3MVD B;  5B24 D;  3AZL A;  3V9R A;  3LZ0 C;  3WAA C;  2YFV A;  3LEL D;  3LJA A;  3LZ1 A;  1M19 D;  5B24 B;  5C3I C;  3B6G B;  1M19 B;  3AN2 D;  4J8X D;  5B33 B;  3TU4 A;  1P3P C;  5CP6 C;  2NZD A;  3MNN A;  1S32 C;  4J8X B;  3AZE A;  4KGC D;  4WU8 C;  5B2J A;  5BNV A;  5AV9 C;  5GT0 A;  3LEL A;  1M18 D;  4R8P C;  3AZI B;  1W2E A;  1P3A C;  4KUD A;  1P34 A;  3AZK B;  2LY8 A;  3NQJ B;  1M18 B;  3MVD C;  5AY8 D;  1JFI A;  2BYK B;  5AV8 B;  1Q9C A;  5B24 C;  3AZF D;  5AY8 B;  4J8W D;  4XUJ A;  2VQR A;  1BH9 A;  4HGA B;  3UTB D;  3B6G C;  5B40 A;  4H9P A;  1M19 C;  3AZF B;  4J8W B;  3WKJ B;  3A1K A;  3UTB B;  3AN2 C;  4J8X C;  5AVB A;  5DNN D;  5B1M B;  2FJ7 A;  3AZG D;  4KGC C;  5GT3 A;  1P3M A;  5DNN B;  1R4V A;  3REL B;  4ZUX D;  3REK A;  3WA9 A;  3X1U D;  3AZG B;  3WTP E;  3EPK A;  4XZQ D;  1P3B B;  4UPK A;  5B1L A;  2JE5 A;  1KX3 D;  1M18 C;  3X1U B;  5AV5 D;  4WJ3 C;  4H9S C;  4XZQ B;  1B6W A;  5AY8 C;  3MGP A;  2HIO D;  2PYO D;  4CSR A;  3KWQ A;  2YFW B;  4HGA C;  5GXQ A;  3REH A;  3AZF C;  3NQU B;  4J8W C;  3UTA D;  2HIO B;  2PYO B;  5CPI A;  3UTB C;  3REJ D;  5AV5 A;  3B6F B;  4X23 B;  3REJ B;  2ARO A;  5DNN C;  4UUZ A;  4Z5T D;  3AZG C;  2NQB D;  3R45 B;  4ZUX C;  3X1U C;  4Z5T B;  3AYW B;  4Z2M H;  5BT1 D;  2NQB B;  4XZQ C;  5AVC D;  5CPK D;  5CPJ A;  1KX3 C;  1P3G D;  1BH8 A;  3B0B A;  1H3O A;  1TZY D;  5AVC B;  4G92 C;  5CPK B;  1KX4 A;  1PZR A;  2XD5 A;  1TZY B;  5E5A D;  2HIO C;  2PYO C;  4YM6 D;  1ID3 D;  2F8N B;  4Z66 D;  3MGQ D;  5E5A B;  3UTA C;  1U35 D;  5KDM A;  4YM6 B;  3VH6 T;  3B6F C;  1WWS A;  5B32 B;  3REJ C;  1P3G A;  3KUY B;  3X1V A;  4Z5T C;  2BG1 A;  1B67 A;  2NQB C;  3EPH A;  3AZH D;  3W98 D;  1U35 A;  3AFA B;  4G91 B;  5BT1 C;  4LD9 B;  4QLC A;  4WNN A;  5AVC C;  5CPK C;  3W98 B;  1P3G C;  4ZBJ C;  5BO0 A;  1TZY C;  4KHA A;  2HUE C;  5FUG B;  2JCH A;  5E5A C;  4YM6 C;  3A1I A;  1EQZ D;  1ID3 C;  4Z66 C;  3MGQ C;  4E45 A;  4YS3 B;  4H9R A;  2DF4 C;  5B0Z D;  5GSU A;  3H0R C;  2IO5 B;  5B0Z B;  4CAY B;  3LZ0 A; 
#chains in the Genus database with same CATH homology
 3MGR D;  3WAA A;  3AZH C;  5BS7 A;  3W98 C;  3MGR B;  3AV1 D;  3X1S D;  1P3P A;  5CP6 A;  3AZM B;  1S32 A;  3KXB B;  3AV1 B;  3X1S B;  4WU8 A;  5AV6 D;  5G49 A;  5DNM D;  3EG5 B;  1EQZ C;  3B6G D;  5AV6 B;  4R8P A;  5BS7 C;  1P3A A;  5B33 D;  5DNM B;  3MVD A;  3AV2 B;  5B0Z C;  3X1T D;  4EO5 B;  3W97 B;  4H9O B;  5B24 A;  3X1T B;  3AZI D;  1M1A B;  3B6G A;  3MGR C;  1M19 A;  3LJA B;  3C1C D;  3AZK D;  3AN2 A;  3C1C B;  4J8X A;  3AV1 C;  3AZN D;  2ZM5 A;  3X1S C;  5AV8 D;  3MNN B;  3AZE B;  4KGC A;  3AZN B;  1F66 D;  5B2J B;  4J8U D;  5BNV B;  5AV6 C;  3AZI A;  3WKJ D;  3A6N B;  5DNM C;  1F66 B;  4J8U B;  1M18 A;  3NQJ A;  2G5I C;  5B33 C;  4H9S A;  1P34 B;  5B1M D;  4EO5 C;  2BYK A;  5AV8 A;  3VH5 T;  3VH6 A;  5AY8 A;  3REL D;  3X1T C;  1M1A C;  2FFF B;  2Y2L A;  3AZF A;  1P3B D;  4J8W A;  4XUJ B;  3AZI C;  1P3O D;  5F99 D;  3UTB A;  1BH9 B;  3UT9 D;  4H9P B;  3C1C C;  3FDD A;  3AZK C;  1P3O B;  5F99 B;  3UT9 B;  2Y2N A;  5B0Y D;  3AZN C;  5DNN A;  5AVB B;  5AV8 C;  3VH6 W;  2FJ7 B;  3AZG A;  5B0Y B;  1P3M B;  1F66 C;  4J8U C;  1ULY A;  3H0L C;  1ZLA D;  4ZUX A;  3X1U A;  3WKJ C;  4XZQ A;  3B6F D;  1BFM A;  4X23 D;  1ZLA B;  5B1L B;  1KX3 A;  5JRG B;  2Y2H A;  5B1M C;  2UWX A;  3O62 D;  1P3L D;  2ZY2 A;  3NQU A;  2HIO A;  3REL C;  2PYO A;  4CSR B;  3AYW D;  3O62 B;  1P3L B;  1P3B C;  3UTA A;  1P3O C;  5F99 C;  3REI D;  3UT9 C;  5CPI B;  3B6F A;  1TAF B;  3REJ A;  3C1B D;  3REI B;  4M6B A;  3W96 D;  5B0Y C;  3C1B B;  2ARO B;  3W99 B;  2F8N D;  4H9Q B;  3W96 B;  4Z5T A;  2NQB A;  1ZLA C;  3AZJ B;  5B32 D;  2Y2K A;  3KUY D;  5JRG C;  2BYM B;  5AVC A;  5CPK A;  4X23 C;  1P3K B;  4JJN D;  1H3O B;  1TZY A;  4H9N B;  1KX4 B;  3O62 C;  3B0C W;  1P3L C;  3EPL A;  4JJN B;  5E5A A;  3AFA D;  4YM6 A;  3AYW C;  1ID3 A;  4LD9 D;  4Z66 A;  3MGQ A;  2DQN C;  4WU9 D;  3REI C;  2F8N G;  4AWL B;  3C1B C;  4WU9 B;  3EPJ A;  3W99 C;  4J8V D;  5B32 G;  3W96 C;  2Y2O A;  4J8V B;  3AZJ C;  4Z2M G;  3AZH A;  1P3I D;  4YS3 D;  1KX5 D;  1P3K C;  3W98 A;  5B32 C;  3KUY C;  3MGS D;  1P3I B;  3H0M C;  1KX5 B;  1HQ3 B;  4DRB A;  3WTP D;  4JJN C;  3MGS B;  5JA4 B;  1N1J B;  4NFT A;  4KHA B;  4NE3 A;  3WTP B;  3AFA C;  1EQZ A;  4G91 C;  4LD9 C;  4AWL C;  3B0D B;  4WU9 C;  5B2I D;  4WZS B;  3AZM D;  1P3F D;  2L5A A;  3KXB D;  5B2I B;  4J8V C;  5B0Z A;  1P3F B;  1A7W A;  4NE5 A;  3MGR A;  3KFU G;  1P3I C;  4YS3 C;  5BNX A;  5B31 D;  1KX5 C;  1AOI D;  1HQ3 C;  2ZY4 A;  2XD1 A;  1HTA A;  3MGS C;  3AV2 D;  2CV5 D;  5B31 B;  3X1S A;  3AV1 A;  1AOI B;  3W97 D;  3WTP C;  1WWI A;  2F8N K;  2IO5 C;  3AZL D;  2CV5 B;  1M1A D;  5AV6 A;  3LJA D;  5AV9 B;  3LZ1 D;  3B0D C;  3AZL B;  3V9R B;  5DNM A;  2YFV B;  3LZ1 B;  5B33 A;  3TU4 D;  2Y2M A;  5B2I C;  2ZY5 A;  1F1E A;  2Y2G A;  3AZM C;  1P3F C;  3MNN D;  3KXB C;  3AZE D;  4H9O A;  2NZD D;  3TU4 B;  5B2J D;  5B31 G;  3X1T A;  4NE6 A;  1M1A A;  2NZD B;  5GT0 D;  3A6N D;  2Y2P A;  4KUD D;  5GT0 B;  3LEL B;  1P34 D;  3C1C A;  5B31 C;  3AZK A;  1AOI C;  2RIQ A;  2J8P A;  4KUD B;  3AV2 C;  3AN2 B;  2CV5 C;  3AZN A;  3IP4 C;  3W97 C;  4E44 A;  3AZL C;  4XUJ D;  3A6N A;  4KGC B;  1F66 A;  4J8U A;  1JFI B;  5B40 D;  3LJA C;  3LZ1 C;  3WKJ A;  3P5J B;  5B40 B;  5CHL B;  3TU4 C;  5AVB D;  5B1M A;  2FJ7 D;  2NZD C;  3MNN C;  3AZE C;  4WV4 B;  5GT3 D;  5B2J C;  1P3M D;  3KSY A;  3REL A;  3WA9 D;  3REK D;  2RVQ D;  5GT0 C;  3LEL C;  2JSS A;  3A6N C;  5GT3 B;  1P3B A;  2G5H C;  1P3O A;  3WA9 B;  5B1L D;  3REK B;  5F99 A;  3UT9 A;  4KUD C;  5JRG D;  1P34 C;  2Y2J A;  3MGP D;  5B0Y A;  2W8S A;  2YFW A;  3KWQ D;  5GXQ D;  3REH D;  3MGP B;  4XUJ C;  5CPI D;  3KWQ B;  1ZLA A;  5B40 C;  5GXQ B;  4ZUX B;  3REH B;  5JRG A;  4X23 A;  1KX3 B;  2ARO D;  5AV5 B;  5AVB C;  3W99 D;  4G92 B;  2FJ7 C;  3R45 A;  3O62 A;  1P3L A;  5GT3 C;  1P3M C;  3AZJ D;  3WA9 C;  4UUZ B;  3REK C;  2RVQ C;  3AYW A;  1TAF A;  1P3K D;  5CPJ D;  3UTA B;  5B1L C;  3REI A;  2F8N H;  3C1B A;  5CPJ B;  1KX4 D;  3W99 A;  1BH8 B;  4H9Q A;  3W96 A;  3MGP C;  3KWQ C;  3AZJ A;  2F8N A;  5GXQ C;  3REH C;  2BYM A;  5CPI C;  1P3K A;  1T3U A;  5B32 A;  3KUY A;  5AV5 C;  5KDM B;  4DRA A;  4H9N A;  3F6T A;  1P3G B;  4ZBJ B;  2ARO C;  4JJN A;  3X1V D;  2HUE B;  3AFA A;  3X1V B;  4LD9 A;  1ID3 B;  4QLC D;  4Z66 B;  3MGQ B;  4WU9 A;  5CPJ C;  1U35 B;  1HQ3 D;  2CWE A;  4QLC B;  4WNN B;  1KX4 C;  4J8V A;  5FUG A;  5BO0 B;  2Y2Q A;  3VH5 A;  1P3I A;  3AZH B;  4YS3 A;  1KX5 A;  1HQ3 A;  2F2A C;  3MGS A;  5JA4 A;  1N1J A;  5GSU D;  3WTP A;  4H9R B;  4CAY A;  3X1V C;  5GSU B;  3LZ0 D;  3WAA D;  2ZY3 A;  1U35 C;  3LZ0 B;  1EQZ B;  3WAA B;  3AL0 C;  1KU5 A;  3VH5 W;  4QLC C;  1P3P D;  5B2I A;  5C3I B;  5CP6 D;  3AZM A;  1P3F A;  3KXB A;  1S32 D;  4WU8 D;  1P3P B;  5CP6 B;  5AV9 D;  1S32 B;  4WU8 B;  4R8P D;  5G49 B;  3B0C T;  1P3A D;  4DQY B;  5B31 A;  1AOI A;  5BNX B;  4R8P B;  1P3A B;  3MVD D;  3AV2 A;  2CV5 A;  2Y2I A;  1Z2C B;  3W97 A;  5GSU C;  5AV9 A;  3MVD B;  5B24 D;  3AZL A;  3V9R A;  3LZ0 C;  3WAA C;  2YFV A;  3LEL D;  3LJA A;  3LZ1 A;  1M19 D;  5B24 B;  5C3I C;  3B6G B;  1M19 B;  3AN2 D;  4J8X D;  5B33 B;  3TU4 A;  1P3P C;  5CP6 C;  2NZD A;  3MNN A;  1S32 C;  4J8X B;  3AZE A;  4KGC D;  4WU8 C;  5B2J A;  5BNV A;  5AV9 C;  5GT0 A;  3LEL A;  1M18 D;  4R8P C;  3AZI B;  1W2E A;  1P3A C;  4KUD A;  1P34 A;  3AZK B;  2LY8 A;  3NQJ B;  1M18 B;  3MVD C;  5AY8 D;  1JFI A;  2BYK B;  5AV8 B;  1Q9C A;  5B24 C;  3AZF D;  5AY8 B;  4J8W D;  4XUJ A;  2VQR A;  1BH9 A;  4HGA B;  3UTB D;  3B6G C;  5B40 A;  4H9P A;  1M19 C;  3AZF B;  4J8W B;  3WKJ B;  3A1K A;  3UTB B;  3AN2 C;  4J8X C;  5AVB A;  5DNN D;  5B1M B;  2FJ7 A;  3AZG D;  4KGC C;  5GT3 A;  1P3M A;  5DNN B;  1R4V A;  3REL B;  4ZUX D;  3REK A;  3WA9 A;  3X1U D;  3AZG B;  3WTP E;  3EPK A;  4XZQ D;  1P3B B;  4UPK A;  5B1L A;  2JE5 A;  1KX3 D;  1M18 C;  3X1U B;  5AV5 D;  4WJ3 C;  4H9S C;  4XZQ B;  1B6W A;  5AY8 C;  3MGP A;  2HIO D;  2PYO D;  4CSR A;  3KWQ A;  2YFW B;  4HGA C;  5GXQ A;  3REH A;  3AZF C;  3NQU B;  4J8W C;  3UTA D;  2HIO B;  2PYO B;  5CPI A;  3UTB C;  3REJ D;  5AV5 A;  3B6F B;  4X23 B;  3REJ B;  2ARO A;  5DNN C;  4UUZ A;  4Z5T D;  3AZG C;  2NQB D;  3R45 B;  4ZUX C;  3X1U C;  4Z5T B;  3AYW B;  4Z2M H;  5BT1 D;  2NQB B;  4XZQ C;  5AVC D;  5CPK D;  5CPJ A;  1KX3 C;  1P3G D;  1BH8 A;  3B0B A;  1H3O A;  1TZY D;  5AVC B;  4G92 C;  5CPK B;  1KX4 A;  1PZR A;  2XD5 A;  1TZY B;  5E5A D;  2HIO C;  2PYO C;  4YM6 D;  1ID3 D;  2F8N B;  4Z66 D;  3MGQ D;  5E5A B;  3UTA C;  1U35 D;  5KDM A;  4YM6 B;  3VH6 T;  3B6F C;  1WWS A;  5B32 B;  3REJ C;  1P3G A;  3KUY B;  3X1V A;  4Z5T C;  2BG1 A;  1B67 A;  2NQB C;  3EPH A;  3AZH D;  3W98 D;  1U35 A;  3AFA B;  4G91 B;  5BT1 C;  4LD9 B;  4QLC A;  4WNN A;  5AVC C;  5CPK C;  3W98 B;  1P3G C;  4ZBJ C;  5BO0 A;  1TZY C;  4KHA A;  2HUE C;  5FUG B;  2JCH A;  5E5A C;  4YM6 C;  3A1I A;  1EQZ D;  1ID3 C;  4Z66 C;  3MGQ C;  4E45 A;  4YS3 B;  4H9R A;  2DF4 C;  5B0Z D;  5GSU A;  3H0R C;  2IO5 B;  5B0Z B;  4CAY B;  3LZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...