3AZFD

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfD00
1P3AA 4YM6B 5B2ID 4J8WB 1P34D 2BYKA 2CV5D 3WKJD 4Z2MH 3X1VD 5AV6B 3AZJA 3AZFD 5GT0C 3VH6W 5BNVA 1TZYD 4Z66A 5BNXB 3REID 3MGRC 5BO0A 3A6NA 1ID3C 3WA9A 4H9PA 2BYMB 5AV9C 3AV1B 3W96D 5GXQB 5E5AA 5GT3D 1M19C 3VH5A 3LJAD 2YFWB 3REKD 5GSUD 3W98A 4XZQC 4H9NA 5AV5C 1EQZC 3WAAA 3MVDD 4JJNB 3UTBD 5B24B 3KUYA 5JRGA 3AN2A 2NZDB 5B33A 1S32A 5B0ZB 3B0CT 4XUJA 4H9OA 5F99D 1BH8B 4WU8A 3AZLB 1R4VA 5B40A 5CPJC 4AWLB 3LZ1D 5DNMA 5B31B 1AOID 3AZMC 1F66A 1HTAA 4LD9B 4ZUXC 3MGSC 1P3LA 4UUZB 1BFMA 5B2JA 3WKJB 3X1SD 1HQ3C 5AVBD 3X1VB 1P3FD 4KGCC 3LELA 3AZFB 3W97D 1TZYB 1ZLAA 2PYOA 4HGAC 3MGQA 1P3KD 1P3GD 3AZND 5AVCC 4KUDC 5CHLB 1P3PD 4J8VC 4H9SA 1P3IA 4NFTA 3VH5T 5C3IB 5GT3B 3B6FC 4EO5B 3REKB 2RVQD 2YFVB 5GSUB 2NQBD 5CP6B 3MVDB 3UTBB 3LZ0D 1M1AC 1TAFA 3AZIB 5GT0A 2F8NH 1P3OC 4WZSB 3AZHD 3MGRA 5AV8D 4ZBJC 1P3AD 1ID3A 2F8NK 5AV9A 3LZ1B 1AOIB 1M19A 3B0BA 3AZJC 4YS3C 3R45B 5JA4A 4G92C 3B0DC 5AV5A 3X1SB 5AVBB 4Z66D 1EQZA 1BH9A 1M18B 3WA9D 3W97B 3V9RB 5E5AD 1KX3C 1P3GB 3AZNB 3WTPE 4WNNB 1B67A 3W98C 4J8WD 5CPJA 3AZEC 5BT1C 5DNNC 3RELC 3AZMA 1U35C 3KUYD 5JRGD 4ZUXA 4WU9C 1KX4D 5B33D 3MGSA 1S32D 1KX5C 2NQBB 4XUJD 3MNNB 4NE3A 5B1LD 1HQ3A 4KGCA 4R8PC 5B0YD 3W99C 1P3BA 1F66D 4QLCC 1P3AB 4KUDA 3C1BC 4J8VA 3C1CC 4J8UC 1KU5A 3LELD 3KXBC 5B24D 2PYOD 4Z66B 3MGQD 5BO0B 2L5AA 1M1AA 3WA9B 4KHAA 1P3OA 5E5AB 1ULYA 3UT9D 4H9RA 4H9NB 3KWQC 2F8NA 3KUYB 3AN2B 5JRGB 1KX4B 4Z2MG 5B33B 4YS3A 1S32B 5CPIC 3O62C 4XUJB 1A7WA 5B1LB 2IO5B 4E44A 2HIOC 4WV4B 4DRBA 3MGRD 4WU8B 1ID3D 3VH6T 4CAYA 5B0YB 5DNMB 1F66B 1M19D 1KX3A 5B2IC 5AY8D 5B2JB 5AV5D 4XZQD 3AZEA 1P34C 3UTAA 2CV5C 5CP6D 5DNNA 1U35A 3RELA 3LELB 1KX5A 3AZID 4WU9A 2PYOB 3MGQB 4J8XD 3AZKA 3MGPA 1WWSA 3REHD 3REIC 4R8PA 5CPJD 1P3MA 3W99A 3W96C 3UT9B 4QLCA 3C1BA 3MGSD 3LJAC 4YM6A 3REJC 1HQ3D 3C1CA 4J8UA 4KGCD 1M18D 4X23C 3KXBA 3UTBC 5GT0B 4Z5TC 4G91C 1P3BC 3MGRB 1ID3B 3AZGC 5AVCD 4KUDD 5F99C 3AYWC 3AV2C 5CPKC 3X1UC 1M19B 3B6FD 3LZ1C 4XZQB 5AY8B 5AV5B 3MNND 3KWQA 1EQZB 1BH9B 1M1AD 4JJNA 5CPIA 1P3FC 3O62A 2HUEC 4J8XB 2HIOA 5B0ZA 3REHB 1P3KC 5CPJB 1P3GC 1N1JB 1P3PC 1H3OA 3AZLA 2FJ7C 4ZUXB 3AZJD 5B31A 4YS3D 3MGSB 5B2IA 1P34A 2CV5A 1HQ3B 5B1MC 3A6ND 4KGCB 5KDMA 3NQJA 3LZ0C 3AZFA 3X1TC 1KX3D 3B6GC 2AROC 5AVCB 4KUDB 3AZHC 3REIA 5B32C 5AV8C 4J8VB 3W98D 3WTPC 3UTAC 3B6FB 3TU4C 3WAAD 5BT1D 3W96A 5DNND 3RELD 1U35D 3AN2D 5BS7C 3LJAA 3REKA 3REJA 4DRAA 3AZKC 4NE5A 1JFIB 3MGPC 1M1AB 4KHAB 4WU8D 4R8PD 4X23A 5B40D 3UTBA 5FUGB 1P3OB 4Z5TA 1P3MC 4CSRA 5DNMD 4H9RB 4ZBJB 4QLCD 3AFAC 3AZGA 5F99A 2BYKB 1P3LD 3AYWA 4YM6C 5B2JD 3AV2A 5CPKA 4J8WC 3X1UA 2F8NB 3C1CD 3LZ1A 3AZJB 3KXBD 4YS3B 4G92B 3B0DB 5BNVB 1KX4C 5AV6C 1ZLAD 5G49A 3A6NB 5B1LC 3X1SA 4H9PB 5AVBA 4CAYB 1P3FA 1P3ID 1KX3B 3AV1C 5B0YC 5GXQC 1P3KA 3W98B 1P3GA 4WNNA 1P3PA 4NE6A 3KWQD 3WAAB 5DNNB 1U35B 3RELB 2FJ7A 4WU9B 4JJNC 5GT0D 5CPID 3O62D 5B24C 2NZDC 4H9OB 5B0ZC 5B1MA 3NQUA 4R8PB 5B40B 5AV9D 3LZ0A 3W99B 3AZLC 3X1TA 3B6GA 4QLCB 2AROA 4AWLC 3C1BB 3AZHA 5B31C 3UT9C 5B32A 5AV8A 1P3LB 4LD9C 3WTPA 3C1CB 4J8UB 3TU4A 1EQZD 3WKJC 3KXBB 5BS7A 3X1VC 1Q9CA 1ZLAB 3AZFC 1TZYC 1P3IB 4H9QA 3AZMD 5C3IC 3AFAA 5GT3C 4ZUXD 4EO5C 3REKC 3REJD 3KWQB 5GSUC 4J8WA 5AY8C 3B0CW 1TAFB 5CP6C 4X23D 3MVDC 5CPIB 4Z5TD 3O62B 3AZIC 5AV6A 1KX4A 2HIOB 1P3BD 4J8XC 3AZGD 5B1LA 5BNXA 4J8VD 5AV9B 3REHC 3AYWD 3AV2D 1H3OB 5CPKD 3X1UD 2BYMA 3AV1A 5B0YA 5GXQA 1AOIC 5JA4B 5B2IB 2YFWA 1P34B 2CV5B 5KDMB 3X1SC 5AVBC 4E45A 3NQJB 1P3OD 1M18C 5B24A 2F8NG 3W97C 2NZDA 3VH5W 3REIB 3AZNC 1BH8A 2LY8A 2F8ND 3W96B 3AZMB 2FJ7D 4LD9A 3LJAB 3UT9A 2RVQC 3REJB 1F1EA 4UUZA 2NQBC 5B1MD 3MNNC 3WKJA 4X23B 5B32G 4Z5TB 3X1VA 4CSRB 4G91B 4HGAB 3X1TD 1P3BB 3B6GD 1TZYA 2AROD 3AZGB 5F99B 5B32D 4M6BA 3AYWB 3AV2B 3AZED 3KSYA 3WTPD 5CPKB 1P3AC 3X1UB 3UTAD 3TU4D 5GT3A 1KX5D 2JSSA 4WU9D 2YFVA 5G49B 5GSUA 3AZKD 5AY8A 4XZQA 3MGPD 4Z66C 5CP6A 3MVDA 3A6NC 1P3FB 2HUEB 1P3MD 3WA9C 3AZIA 3W99D 5E5AC 4J8XA 3AFAD 1P3KB 3C1BD 3REHA 4YM6D 1P3PB 1N1JA 4J8UD 2FJ7B 3WAAC 1AOIA 3KUYC 3AN2C 5JRGC 5AV6D 5B33C 1S32C 3R45A 5B1MB 4XUJC 3NQUB 2IO5C 3LZ0B 4WU8C 1M18A 5B40C 3X1TB 3W97A 3B6GB 3AV1D 2AROB 5GXQD 3V9RA 3VH6A 3AZHB 5DNMC 1F66C 5B32B 5AV8B 3AZEB 3WTPB 5AVCA 3AZNA 3UTAB 1P3LC 3TU4B 5B2JC 1KX5B 3B6FA 2CWEA 4JJND 3LELC 1WWIA 2NZDD 3AZKB 2HIOD 3MGPB 1ZLAC 5B0ZD 2NQBA 2PYOC 3MNNA 3MGQC 5B31G 1JFIA 1P3MB 1B6WA 4H9QB 4H9SC 3AZLD 5FUGA 1P3IC 3AFAB 4LD9D 5B31D
chains in the Genus database with same CATH superfamily
2Y2IA 1P3AA 4YM6B 5B2ID 4J8WB 1P34D 2BYKA 2CV5D 3WKJD 4Z2MH 3X1VD 5AV6B 3AZJA 3AZFD 5GT0C 3VH6W 5BNVA 1TZYD 4Z66A 5BNXB 3REID 3MGRC 5BO0A 3A6NA 1ID3C 3WA9A 4H9PA 2BYMB 5AV9C 3P5JB 3AV1B 3W96D 5GXQB 5E5AA 5GT3D 1M19C 3VH5A 3LJAD 2YFWB 3REKD 5GSUD 3W98A 4XZQC 4H9NA 5AV5C 1EQZC 3WAAA 3MVDD 4JJNB 3UTBD 2XD1A 5B24B 3KUYA 5JRGA 3AN2A 2NZDB 5B33A 1S32A 5B0ZB 3B0CT 4XUJA 4H9OA 5F99D 1BH8B 4WU8A 3AZLB 1R4VA 5B40A 5CPJC 4AWLB 3LZ1D 5DNMA 5B31B 1AOID 3AZMC 1F66A 1HTAA 4LD9B 4ZUXC 2ZY5A 3MGSC 1P3LA 4UUZB 1BFMA 5B2JA 2Y2QA 3X1SD 3WKJB 1HQ3C 5AVBD 3X1VB 1P3FD 4KGCC 3LELA 3AZFB 3W97D 1TZYB 1ZLAA 2PYOA 4HGAC 3MGQA 1P3KD 2ZY3A 1P3GD 3AZND 5AVCC 4KUDC 3EPHA 5CHLB 1P3PD 4J8VC 4H9SA 1P3IA 4NFTA 3VH5T 5C3IB 5GT3B 3B6FC 4EO5B 3REKB 2RVQD 2YFVB 5GSUB 2NQBD 5CP6B 3MVDB 2ZM5A 3UTBB 3LZ0D 3EPLA 1TAFA 3AZIB 1M1AC 5GT0A 2F8NH 1P3OC 4WZSB 3AZHD 3MGRA 5AV8D 4ZBJC 1P3AD 1ID3A 2F8NK 5AV9A 3LZ1B 1AOIB 1M19A 3B0BA 3AZJC 4YS3C 3R45B 5JA4A 4G92C 3B0DC 3IP4C 5AV5A 3EPJA 3X1SB 2ZY4A 5AVBB 4Z66D 1EQZA 1BH9A 1M18B 3WA9D 3W97B 3V9RB 5E5AD 1KX3C 3F6TA 1P3GB 3AZNB 3A1IA 3WTPE 4WNNB 3FDDA 1B67A 3W98C 4J8WD 5CPJA 3AZEC 5BT1C 5DNNC 3RELC 3AZMA 4UPKA 1U35C 3KUYD 5JRGD 4ZUXA 4WU9C 1KX4D 5B33D 3MGSA 1S32D 1KX5C 2NQBB 4XUJD 3MNNB 4NE3A 5B1LD 1HQ3A 4KGCA 4R8PC 5B0YD 3W99C 1P3BA 1F66D 4QLCC 1P3AB 4KUDA 3C1BC 1PZRA 4J8VA 3C1CC 4J8UC 1KU5A 3LELD 3KXBC 5B24D 2PYOD 4Z66B 3MGQD 2Y2MA 5BO0B 2L5AA 1M1AA 3WA9B 4KHAA 2Y2OA 1P3OA 5E5AB 1ULYA 3UT9D 4H9RA 4H9NB 2JE5A 3KWQC 2F8NA 3KUYB 3AN2B 5JRGB 1KX4B 4Z2MG 5B33B 4YS3A 1S32B 5CPIC 3O62C 4XUJB 1A7WA 5B1LB 2IO5B 4E44A 2HIOC 4WV4B 4DRBA 3MGRD 4WU8B 1ID3D 3VH6T 4CAYA 5B0YB 5DNMB 1F66B 1M19D 1KX3A 5B2IC 5AY8D 5B2JB 5AV5D 4XZQD 3AZEA 1P34C 3UTAA 2BG1A 2CV5C 5CP6D 5DNNA 1U35A 3RELA 3LELB 1KX5A 3AZID 4WU9A 2DQNC 2PYOB 3MGQB 4J8XD 3AZKA 3MGPA 1WWSA 3REHD 3REIC 4R8PA 5CPJD 1P3MA 3W99A 1Z2CB 3W96C 3UT9B 4WJ3C 4QLCA 3C1BA 3MGSD 3LJAC 3KFUG 3A1KA 4YM6A 3REJC 1HQ3D 3C1CA 4J8UA 2Y2JA 4KGCD 1M18D 4X23C 3KXBA 3UTBC 5GT0B 4Z5TC 4G91C 2RIQA 1P3BC 3MGRB 1ID3B 3AZGC 5AVCD 4KUDD 5F99C 3AYWC 3AV2C 5CPKC 1T3UA 3X1UC 1M19B 3B6FD 3LZ1C 4XZQB 5AY8B 5AV5B 3MNND 3KWQA 1EQZB 1BH9B 1M1AD 4JJNA 5CPIA 1P3FC 3O62A 2HUEC 4J8XB 2Y2NA 2HIOA 5B0ZA 3REHB 1P3KC 5CPJB 1P3GC 1N1JB 3EG5B 1P3PC 1H3OA 3AZLA 2FJ7C 4ZUXB 3AZJD 5B31A 4YS3D 3MGSB 5B2IA 2G5IC 1P34A 2CV5A 1HQ3B 5B1MC 3A6ND 4KGCB 5KDMA 3NQJA 3LZ0C 3AZFA 3X1TC 1KX3D 3B6GC 2AROC 5AVCB 4KUDB 3AZHC 3REIA 5B32C 5AV8C 4J8VB 3W98D 3WTPC 3UTAC 3B6FB 3TU4C 3WAAD 5BT1D 3W96A 5DNND 3RELD 1U35D 3AN2D 5BS7C 3LJAA 3REKA 3REJA 4DRAA 3AZKC 4NE5A 1JFIB 3MGPC 1M1AB 4KHAB 4WU8D 4R8PD 4X23A 5B40D 3UTBA 5FUGB 1P3OB 4Z5TA 1P3MC 4CSRA 5DNMD 4H9RB 4ZBJB 4QLCD 3AFAC 3AZGA 5F99A 2BYKB 1P3LD 2Y2HA 3AYWA 4YM6C 5B2JD 3AV2A 5CPKA 4J8WC 3X1UA 2F8NB 3C1CD 3LZ1A 3AZJB 3KXBD 4YS3B 4G92B 3B0DB 5BNVB 1KX4C 5AV6C 1ZLAD 5G49A 3A6NB 5B1LC 3X1SA 4H9PB 5AVBA 4CAYB 1P3FA 1P3ID 1KX3B 3AV1C 5B0YC 5GXQC 1P3KA 3W98B 1P3GA 4WNNA 3H0LC 1P3PA 4NE6A 3KWQD 2JCHA 3WAAB 2FFFB 5DNNB 3RELB 1U35B 2FJ7A 4WU9B 4JJNC 5GT0D 2DF4C 5CPID 3O62D 5B24C 2NZDC 4H9OB 4DQYB 5B0ZC 5B1MA 3NQUA 4R8PB 5B40B 5AV9D 3LZ0A 3W99B 3AZLC 3X1TA 3B6GA 4QLCB 2AROA 4AWLC 3C1BB 3AZHA 5B31C 3UT9C 5B32A 5AV8A 1P3LB 4LD9C 3WTPA 3C1CB 4J8UB 3TU4A 1EQZD 2VQRA 3WKJC 3KXBB 5BS7A 3X1VC 1Q9CA 1ZLAB 3AZFC 1TZYC 3H0MC 1P3IB 4H9QA 3AZMD 5C3IC 3AFAA 5GT3C 4ZUXD 2Y2LA 4EO5C 3REKC 3REJD 3KWQB 5GSUC 4J8WA 5AY8C 3B0CW 1TAFB 5CP6C 4X23D 3MVDC 5CPIB 4Z5TD 3O62B 3AZIC 5AV6A 1KX4A 2HIOB 1P3BD 4J8XC 3AZGD 5B1LA 5BNXA 4J8VD 5AV9B 3REHC 3AYWD 3AV2D 1H3OB 5CPKD 3X1UD 2BYMA 3AV1A 5B0YA 5GXQA 1AOIC 5JA4B 5B2IB 2YFWA 1P34B 2CV5B 2G5HC 5KDMB 3X1SC 5AVBC 2W8SA 4E45A 3NQJB 1P3OD 1M18C 5B24A 2F8NG 3W97C 2NZDA 3VH5W 3REIB 3AZNC 1BH8A 2LY8A 2F8ND 3W96B 3AZMB 2FJ7D 4LD9A 3LJAB 3UT9A 2Y2KA 2RVQC 3REJB 1F1EA 4UUZA 2NQBC 5B1MD 3MNNC 3WKJA 4X23B 5B32G 4Z5TB 3X1VA 4CSRB 4G91B 4HGAB 3X1TD 1P3BB 3B6GD 1TZYA 2AROD 3AZGB 2Y2PA 5F99B 5B32D 4M6BA 3AYWB 3AV2B 3AZED 3KSYA 3WTPD 1W2EA 5CPKB 1P3AC 3X1UB 3UTAD 3TU4D 5GT3A 1KX5D 2JSSA 4WU9D 2YFVA 5G49B 5GSUA 3AZKD 5AY8A 4XZQA 3MGPD 3H0RC 4Z66C 5CP6A 3MVDA 3A6NC 1P3FB 2HUEB 1P3MD 3WA9C 3AZIA 2XD5A 3W99D 3AL0C 5E5AC 4J8XA 3AFAD 1P3KB 3C1BD 3REHA 4YM6D 1P3PB 1N1JA 4J8UD 2FJ7B 3WAAC 1AOIA 2UWXA 3KUYC 3AN2C 5JRGC 5AV6D 5B33C 1S32C 2J8PA 3R45A 5B1MB 4XUJC 3NQUB 2IO5C 3LZ0B 4WU8C 1M18A 5B40C 3X1TB 3W97A 3B6GB 3AV1D 2AROB 5GXQD 3V9RA 3VH6A 3AZHB 5DNMC 1F66C 5B32B 5AV8B 3AZEB 3WTPB 5AVCA 3AZNA 3UTAB 1P3LC 3TU4B 5B2JC 1KX5B 3B6FA 2CWEA 4JJND 3LELC 1WWIA 2NZDD 3AZKB 2HIOD 3MGPB 1ZLAC 5B0ZD 2NQBA 2PYOC 3MNNA 3MGQC 5B31G 1JFIA 1P3MB 1B6WA 4H9QB 4H9SC 3AZLD 2F2AC 2Y2GA 5FUGA 1P3IC 3EPKA 2ZY2A 3AFAB 4LD9D 5B31D
chains in the Genus database with same CATH topology
2Y2IA 1P3AA 4YM6B 5B2ID 4J8WB 1P34D 2BYKA 2CV5D 3WKJD 4Z2MH 3X1VD 5AV6B 3AZJA 3AZFD 5GT0C 3VH6W 5BNVA 1TZYD 4Z66A 5BNXB 3REID 3MGRC 5BO0A 3A6NA 1ID3C 3WA9A 4H9PA 2BYMB 5AV9C 3P5JB 3AV1B 3W96D 5GXQB 5E5AA 5GT3D 1M19C 3VH5A 3LJAD 2YFWB 3REKD 5GSUD 3W98A 4XZQC 4H9NA 5AV5C 1EQZC 3WAAA 3MVDD 4JJNB 3UTBD 2XD1A 5B24B 3KUYA 5JRGA 3AN2A 2NZDB 5B33A 1S32A 5B0ZB 3B0CT 4XUJA 4H9OA 5F99D 1BH8B 4WU8A 3AZLB 1R4VA 5B40A 5CPJC 4AWLB 3LZ1D 5DNMA 5B31B 1AOID 3AZMC 1F66A 1HTAA 4LD9B 4ZUXC 2ZY5A 3MGSC 1P3LA 4UUZB 1BFMA 5B2JA 2Y2QA 3X1SD 3WKJB 1HQ3C 5AVBD 3X1VB 1P3FD 4KGCC 3LELA 3AZFB 3W97D 1TZYB 1ZLAA 2PYOA 4HGAC 3MGQA 1P3KD 2ZY3A 1P3GD 3AZND 5AVCC 4KUDC 3EPHA 5CHLB 1P3PD 4J8VC 4H9SA 1P3IA 4NFTA 3VH5T 5C3IB 5GT3B 3B6FC 4EO5B 3REKB 2RVQD 2YFVB 5GSUB 2NQBD 5CP6B 3MVDB 2ZM5A 3UTBB 3LZ0D 3EPLA 1TAFA 3AZIB 1M1AC 5GT0A 2F8NH 1P3OC 4WZSB 3AZHD 3MGRA 5AV8D 4ZBJC 1P3AD 1ID3A 2F8NK 5AV9A 3LZ1B 1AOIB 1M19A 3B0BA 3AZJC 4YS3C 3R45B 5JA4A 4G92C 3B0DC 3IP4C 5AV5A 3EPJA 3X1SB 2ZY4A 5AVBB 4Z66D 1EQZA 1BH9A 1M18B 3WA9D 3W97B 3V9RB 5E5AD 1KX3C 3F6TA 1P3GB 3AZNB 3A1IA 3WTPE 4WNNB 3FDDA 1B67A 3W98C 4J8WD 5CPJA 3AZEC 5BT1C 5DNNC 3RELC 3AZMA 4UPKA 1U35C 3KUYD 5JRGD 4ZUXA 4WU9C 1KX4D 5B33D 3MGSA 1S32D 1KX5C 2NQBB 4XUJD 3MNNB 4NE3A 5B1LD 1HQ3A 4KGCA 4R8PC 5B0YD 3W99C 1P3BA 1F66D 4QLCC 1P3AB 4KUDA 3C1BC 1PZRA 4J8VA 3C1CC 4J8UC 1KU5A 3LELD 3KXBC 5B24D 2PYOD 4Z66B 3MGQD 2Y2MA 5BO0B 2L5AA 1M1AA 3WA9B 4KHAA 2Y2OA 1P3OA 5E5AB 1ULYA 3UT9D 4H9RA 4H9NB 2JE5A 3KWQC 2F8NA 3KUYB 3AN2B 5JRGB 1KX4B 4Z2MG 5B33B 4YS3A 1S32B 5CPIC 3O62C 4XUJB 1A7WA 5B1LB 2IO5B 4E44A 2HIOC 4WV4B 4DRBA 3MGRD 4WU8B 1ID3D 3VH6T 4CAYA 5B0YB 5DNMB 1F66B 1M19D 1KX3A 5B2IC 5AY8D 5B2JB 5AV5D 4XZQD 3AZEA 1P34C 3UTAA 2BG1A 2CV5C 5CP6D 5DNNA 1U35A 3RELA 3LELB 1KX5A 3AZID 4WU9A 2DQNC 2PYOB 3MGQB 4J8XD 3AZKA 3MGPA 1WWSA 3REHD 3REIC 4R8PA 5CPJD 1P3MA 3W99A 1Z2CB 3W96C 3UT9B 4WJ3C 4QLCA 3C1BA 3MGSD 3LJAC 3KFUG 3A1KA 4YM6A 3REJC 1HQ3D 3C1CA 4J8UA 2Y2JA 4KGCD 1M18D 4X23C 3KXBA 3UTBC 5GT0B 4Z5TC 4G91C 2RIQA 1P3BC 3MGRB 1ID3B 3AZGC 5AVCD 4KUDD 5F99C 3AYWC 3AV2C 5CPKC 1T3UA 3X1UC 1M19B 3B6FD 3LZ1C 4XZQB 5AY8B 5AV5B 3MNND 3KWQA 1EQZB 1BH9B 1M1AD 4JJNA 5CPIA 1P3FC 3O62A 2HUEC 4J8XB 2Y2NA 2HIOA 5B0ZA 3REHB 1P3KC 5CPJB 1P3GC 1N1JB 3EG5B 1P3PC 1H3OA 3AZLA 2FJ7C 4ZUXB 3AZJD 5B31A 4YS3D 3MGSB 5B2IA 2G5IC 1P34A 2CV5A 1HQ3B 5B1MC 3A6ND 4KGCB 5KDMA 3NQJA 3LZ0C 3AZFA 3X1TC 1KX3D 3B6GC 2AROC 5AVCB 4KUDB 3AZHC 3REIA 5B32C 5AV8C 4J8VB 3W98D 3WTPC 3UTAC 3B6FB 3TU4C 3WAAD 5BT1D 3W96A 5DNND 3RELD 1U35D 3AN2D 5BS7C 3LJAA 3REKA 3REJA 4DRAA 3AZKC 4NE5A 1JFIB 3MGPC 1M1AB 4KHAB 4WU8D 4R8PD 4X23A 5B40D 3UTBA 5FUGB 1P3OB 4Z5TA 1P3MC 4CSRA 5DNMD 4H9RB 4ZBJB 4QLCD 3AFAC 3AZGA 5F99A 2BYKB 1P3LD 2Y2HA 3AYWA 4YM6C 5B2JD 3AV2A 5CPKA 4J8WC 3X1UA 2F8NB 3C1CD 3LZ1A 3AZJB 3KXBD 4YS3B 4G92B 3B0DB 5BNVB 1KX4C 5AV6C 1ZLAD 5G49A 3A6NB 5B1LC 3X1SA 4H9PB 5AVBA 4CAYB 1P3FA 1P3ID 1KX3B 3AV1C 5B0YC 5GXQC 1P3KA 3W98B 1P3GA 4WNNA 3H0LC 1P3PA 4NE6A 3KWQD 2JCHA 3WAAB 2FFFB 5DNNB 3RELB 1U35B 2FJ7A 4WU9B 4JJNC 5GT0D 2DF4C 5CPID 3O62D 5B24C 2NZDC 4H9OB 4DQYB 5B0ZC 5B1MA 3NQUA 4R8PB 5B40B 5AV9D 3LZ0A 3W99B 3AZLC 3X1TA 3B6GA 4QLCB 2AROA 4AWLC 3C1BB 3AZHA 5B31C 3UT9C 5B32A 5AV8A 1P3LB 4LD9C 3WTPA 3C1CB 4J8UB 3TU4A 1EQZD 2VQRA 3WKJC 3KXBB 5BS7A 3X1VC 1Q9CA 1ZLAB 3AZFC 1TZYC 3H0MC 1P3IB 4H9QA 3AZMD 5C3IC 3AFAA 5GT3C 4ZUXD 2Y2LA 4EO5C 3REKC 3REJD 3KWQB 5GSUC 4J8WA 5AY8C 3B0CW 1TAFB 5CP6C 4X23D 3MVDC 5CPIB 4Z5TD 3O62B 3AZIC 5AV6A 1KX4A 2HIOB 1P3BD 4J8XC 3AZGD 5B1LA 5BNXA 4J8VD 5AV9B 3REHC 3AYWD 3AV2D 1H3OB 5CPKD 3X1UD 2BYMA 3AV1A 5B0YA 5GXQA 1AOIC 5JA4B 5B2IB 2YFWA 1P34B 2CV5B 2G5HC 5KDMB 3X1SC 5AVBC 2W8SA 4E45A 3NQJB 1P3OD 1M18C 5B24A 2F8NG 3W97C 2NZDA 3VH5W 3REIB 3AZNC 1BH8A 2LY8A 2F8ND 3W96B 3AZMB 2FJ7D 4LD9A 3LJAB 3UT9A 2Y2KA 2RVQC 3REJB 1F1EA 4UUZA 2NQBC 5B1MD 3MNNC 3WKJA 4X23B 5B32G 4Z5TB 3X1VA 4CSRB 4G91B 4HGAB 3X1TD 1P3BB 3B6GD 1TZYA 2AROD 3AZGB 2Y2PA 5F99B 5B32D 4M6BA 3AYWB 3AV2B 3AZED 3KSYA 3WTPD 1W2EA 5CPKB 1P3AC 3X1UB 3UTAD 3TU4D 5GT3A 1KX5D 2JSSA 4WU9D 2YFVA 5G49B 5GSUA 3AZKD 5AY8A 4XZQA 3MGPD 3H0RC 4Z66C 5CP6A 3MVDA 3A6NC 1P3FB 2HUEB 1P3MD 3WA9C 3AZIA 2XD5A 3W99D 3AL0C 5E5AC 4J8XA 3AFAD 1P3KB 3C1BD 3REHA 4YM6D 1P3PB 1N1JA 4J8UD 2FJ7B 3WAAC 1AOIA 2UWXA 3KUYC 3AN2C 5JRGC 5AV6D 5B33C 1S32C 2J8PA 3R45A 5B1MB 4XUJC 3NQUB 2IO5C 3LZ0B 4WU8C 1M18A 5B40C 3X1TB 3W97A 3B6GB 3AV1D 2AROB 5GXQD 3V9RA 3VH6A 3AZHB 5DNMC 1F66C 5B32B 5AV8B 3AZEB 3WTPB 5AVCA 3AZNA 3UTAB 1P3LC 3TU4B 5B2JC 1KX5B 3B6FA 2CWEA 4JJND 3LELC 1WWIA 2NZDD 3AZKB 2HIOD 3MGPB 1ZLAC 5B0ZD 2NQBA 2PYOC 3MNNA 3MGQC 5B31G 1JFIA 1P3MB 1B6WA 4H9QB 4H9SC 3AZLD 2F2AC 2Y2GA 5FUGA 1P3IC 3EPKA 2ZY2A 3AFAB 4LD9D 5B31D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A A;  4YM6 B;  5B2I D;  4J8W B;  1P34 D;  2BYK A;  2CV5 D;  3WKJ D;  4Z2M H;  3X1V D;  5AV6 B;  3AZJ A;  3AZF D;  5GT0 C;  3VH6 W;  5BNV A;  1TZY D;  4Z66 A;  5BNX B;  3REI D;  3MGR C;  5BO0 A;  3A6N A;  1ID3 C;  3WA9 A;  4H9P A;  2BYM B;  5AV9 C;  3AV1 B;  3W96 D;  5GXQ B;  5E5A A;  5GT3 D;  1M19 C;  3VH5 A;  3LJA D;  2YFW B;  3REK D;  5GSU D;  3W98 A;  4XZQ C;  4H9N A;  5AV5 C;  1EQZ C;  3WAA A;  3MVD D;  4JJN B;  3UTB D;  5B24 B;  3KUY A;  5JRG A;  3AN2 A;  2NZD B;  5B33 A;  1S32 A;  5B0Z B;  3B0C T;  4XUJ A;  4H9O A;  5F99 D;  1BH8 B;  4WU8 A;  3AZL B;  1R4V A;  5B40 A;  5CPJ C;  4AWL B;  3LZ1 D;  5DNM A;  5B31 B;  1AOI D;  3AZM C;  1F66 A;  1HTA A;  4LD9 B;  4ZUX C;  3MGS C;  1P3L A;  4UUZ B;  1BFM A;  5B2J A;  3WKJ B;  3X1S D;  1HQ3 C;  5AVB D;  3X1V B;  1P3F D;  4KGC C;  3LEL A;  3AZF B;  3W97 D;  1TZY B;  1ZLA A;  2PYO A;  4HGA C;  3MGQ A;  1P3K D;  1P3G D;  3AZN D;  5AVC C;  4KUD C;  5CHL B;  1P3P D;  4J8V C;  4H9S A;  1P3I A;  4NFT A;  3VH5 T;  5C3I B;  5GT3 B;  3B6F C;  4EO5 B;  3REK B;  2RVQ D;  2YFV B;  5GSU B;  2NQB D;  5CP6 B;  3MVD B;  3UTB B;  3LZ0 D;  1M1A C;  1TAF A;  3AZI B;  5GT0 A;  2F8N H;  1P3O C;  4WZS B;  3AZH D;  3MGR A;  5AV8 D;  4ZBJ C;  1P3A D;  1ID3 A;  2F8N K;  5AV9 A;  3LZ1 B;  1AOI B;  1M19 A;  3B0B A;  3AZJ C;  4YS3 C;  3R45 B;  5JA4 A;  4G92 C;  3B0D C;  5AV5 A;  3X1S B;  5AVB B;  4Z66 D;  1EQZ A;  1BH9 A;  1M18 B;  3WA9 D;  3W97 B;  3V9R B;  5E5A D;  1KX3 C;  1P3G B;  3AZN B;  3WTP E;  4WNN B;  1B67 A;  3W98 C;  4J8W D;  5CPJ A;  3AZE C;  5BT1 C;  5DNN C;  3REL C;  3AZM A;  1U35 C;  3KUY D;  5JRG D;  4ZUX A;  4WU9 C;  1KX4 D;  5B33 D;  3MGS A;  1S32 D;  1KX5 C;  2NQB B;  4XUJ D;  3MNN B;  4NE3 A;  5B1L D;  1HQ3 A;  4KGC A;  4R8P C;  5B0Y D;  3W99 C;  1P3B A;  1F66 D;  4QLC C;  1P3A B;  4KUD A;  3C1B C;  4J8V A;  3C1C C;  4J8U C;  1KU5 A;  3LEL D;  3KXB C;  5B24 D;  2PYO D;  4Z66 B;  3MGQ D;  5BO0 B;  2L5A A;  1M1A A;  3WA9 B;  4KHA A;  1P3O A;  5E5A B;  1ULY A;  3UT9 D;  4H9R A;  4H9N B;  3KWQ C;  2F8N A;  3KUY B;  3AN2 B;  5JRG B;  1KX4 B;  4Z2M G;  5B33 B;  4YS3 A;  1S32 B;  5CPI C;  3O62 C;  4XUJ B;  1A7W A;  5B1L B;  2IO5 B;  4E44 A;  2HIO C;  4WV4 B;  4DRB A;  3MGR D;  4WU8 B;  1ID3 D;  3VH6 T;  4CAY A;  5B0Y B;  5DNM B;  1F66 B;  1M19 D;  1KX3 A;  5B2I C;  5AY8 D;  5B2J B;  5AV5 D;  4XZQ D;  3AZE A;  1P34 C;  3UTA A;  2CV5 C;  5CP6 D;  5DNN A;  1U35 A;  3REL A;  3LEL B;  1KX5 A;  3AZI D;  4WU9 A;  2PYO B;  3MGQ B;  4J8X D;  3AZK A;  3MGP A;  1WWS A;  3REH D;  3REI C;  4R8P A;  5CPJ D;  1P3M A;  3W99 A;  3W96 C;  3UT9 B;  4QLC A;  3C1B A;  3MGS D;  3LJA C;  4YM6 A;  3REJ C;  1HQ3 D;  3C1C A;  4J8U A;  4KGC D;  1M18 D;  4X23 C;  3KXB A;  3UTB C;  5GT0 B;  4Z5T C;  4G91 C;  1P3B C;  3MGR B;  1ID3 B;  3AZG C;  5AVC D;  4KUD D;  5F99 C;  3AYW C;  3AV2 C;  5CPK C;  3X1U C;  1M19 B;  3B6F D;  3LZ1 C;  4XZQ B;  5AY8 B;  5AV5 B;  3MNN D;  3KWQ A;  1EQZ B;  1BH9 B;  1M1A D;  4JJN A;  5CPI A;  1P3F C;  3O62 A;  2HUE C;  4J8X B;  2HIO A;  5B0Z A;  3REH B;  1P3K C;  5CPJ B;  1P3G C;  1N1J B;  1P3P C;  1H3O A;  3AZL A;  2FJ7 C;  4ZUX B;  3AZJ D;  5B31 A;  4YS3 D;  3MGS B;  5B2I A;  1P34 A;  2CV5 A;  1HQ3 B;  5B1M C;  3A6N D;  4KGC B;  5KDM A;  3NQJ A;  3LZ0 C;  3AZF A;  3X1T C;  1KX3 D;  3B6G C;  2ARO C;  5AVC B;  4KUD B;  3AZH C;  3REI A;  5B32 C;  5AV8 C;  4J8V B;  3W98 D;  3WTP C;  3UTA C;  3B6F B;  3TU4 C;  3WAA D;  5BT1 D;  3W96 A;  5DNN D;  3REL D;  1U35 D;  3AN2 D;  5BS7 C;  3LJA A;  3REK A;  3REJ A;  4DRA A;  3AZK C;  4NE5 A;  1JFI B;  3MGP C;  1M1A B;  4KHA B;  4WU8 D;  4R8P D;  4X23 A;  5B40 D;  3UTB A;  5FUG B;  1P3O B;  4Z5T A;  1P3M C;  4CSR A;  5DNM D;  4H9R B;  4ZBJ B;  4QLC D;  3AFA C;  3AZG A;  5F99 A;  2BYK B;  1P3L D;  3AYW A;  4YM6 C;  5B2J D;  3AV2 A;  5CPK A;  4J8W C;  3X1U A;  2F8N B;  3C1C D;  3LZ1 A;  3AZJ B;  3KXB D;  4YS3 B;  4G92 B;  3B0D B;  5BNV B;  1KX4 C;  5AV6 C;  1ZLA D;  5G49 A;  3A6N B;  5B1L C;  3X1S A;  4H9P B;  5AVB A;  4CAY B;  1P3F A;  1P3I D;  1KX3 B;  3AV1 C;  5B0Y C;  5GXQ C;  1P3K A;  3W98 B;  1P3G A;  4WNN A;  1P3P A;  4NE6 A;  3KWQ D;  3WAA B;  5DNN B;  1U35 B;  3REL B;  2FJ7 A;  4WU9 B;  4JJN C;  5GT0 D;  5CPI D;  3O62 D;  5B24 C;  2NZD C;  4H9O B;  5B0Z C;  5B1M A;  3NQU A;  4R8P B;  5B40 B;  5AV9 D;  3LZ0 A;  3W99 B;  3AZL C;  3X1T A;  3B6G A;  4QLC B;  2ARO A;  4AWL C;  3C1B B;  3AZH A;  5B31 C;  3UT9 C;  5B32 A;  5AV8 A;  1P3L B;  4LD9 C;  3WTP A;  3C1C B;  4J8U B;  3TU4 A;  1EQZ D;  3WKJ C;  3KXB B;  5BS7 A;  3X1V C;  1Q9C A;  1ZLA B;  3AZF C;  1TZY C;  1P3I B;  4H9Q A;  3AZM D;  5C3I C;  3AFA A;  5GT3 C;  4ZUX D;  4EO5 C;  3REK C;  3REJ D;  3KWQ B;  5GSU C;  4J8W A;  5AY8 C;  3B0C W;  1TAF B;  5CP6 C;  4X23 D;  3MVD C;  5CPI B;  4Z5T D;  3O62 B;  3AZI C;  5AV6 A;  1KX4 A;  2HIO B;  1P3B D;  4J8X C;  3AZG D;  5B1L A;  5BNX A;  4J8V D;  5AV9 B;  3REH C;  3AYW D;  3AV2 D;  1H3O B;  5CPK D;  3X1U D;  2BYM A;  3AV1 A;  5B0Y A;  5GXQ A;  1AOI C;  5JA4 B;  5B2I B;  2YFW A;  1P34 B;  2CV5 B;  5KDM B;  3X1S C;  5AVB C;  4E45 A;  3NQJ B;  1P3O D;  1M18 C;  5B24 A;  2F8N G;  3W97 C;  2NZD A;  3VH5 W;  3REI B;  3AZN C;  1BH8 A;  2LY8 A;  2F8N D;  3W96 B;  3AZM B;  2FJ7 D;  4LD9 A;  3LJA B;  3UT9 A;  2RVQ C;  3REJ B;  1F1E A;  4UUZ A;  2NQB C;  5B1M D;  3MNN C;  3WKJ A;  4X23 B;  5B32 G;  4Z5T B;  3X1V A;  4CSR B;  4G91 B;  4HGA B;  3X1T D;  1P3B B;  3B6G D;  1TZY A;  2ARO D;  3AZG B;  5F99 B;  5B32 D;  4M6B A;  3AYW B;  3AV2 B;  3AZE D;  3KSY A;  3WTP D;  5CPK B;  1P3A C;  3X1U B;  3UTA D;  3TU4 D;  5GT3 A;  1KX5 D;  2JSS A;  4WU9 D;  2YFV A;  5G49 B;  5GSU A;  3AZK D;  5AY8 A;  4XZQ A;  3MGP D;  4Z66 C;  5CP6 A;  3MVD A;  3A6N C;  1P3F B;  2HUE B;  1P3M D;  3WA9 C;  3AZI A;  3W99 D;  5E5A C;  4J8X A;  3AFA D;  1P3K B;  3C1B D;  3REH A;  4YM6 D;  1P3P B;  1N1J A;  4J8U D;  2FJ7 B;  3WAA C;  1AOI A;  3KUY C;  3AN2 C;  5JRG C;  5AV6 D;  5B33 C;  1S32 C;  3R45 A;  5B1M B;  4XUJ C;  3NQU B;  2IO5 C;  3LZ0 B;  4WU8 C;  1M18 A;  5B40 C;  3X1T B;  3W97 A;  3B6G B;  3AV1 D;  2ARO B;  5GXQ D;  3V9R A;  3VH6 A;  3AZH B;  5DNM C;  1F66 C;  5B32 B;  5AV8 B;  3AZE B;  3WTP B;  5AVC A;  3AZN A;  3UTA B;  1P3L C;  3TU4 B;  5B2J C;  1KX5 B;  3B6F A;  2CWE A;  4JJN D;  3LEL C;  1WWI A;  2NZD D;  3AZK B;  2HIO D;  3MGP B;  1ZLA C;  5B0Z D;  2NQB A;  2PYO C;  3MNN A;  3MGQ C;  5B31 G;  1JFI A;  1P3M B;  1B6W A;  4H9Q B;  4H9S C;  3AZL D;  5FUG A;  1P3I C;  3AFA B;  4LD9 D;  5B31 D; 
#chains in the Genus database with same CATH topology
 2Y2I A;  1P3A A;  4YM6 B;  5B2I D;  4J8W B;  1P34 D;  2BYK A;  2CV5 D;  3WKJ D;  4Z2M H;  3X1V D;  5AV6 B;  3AZJ A;  3AZF D;  5GT0 C;  3VH6 W;  5BNV A;  1TZY D;  4Z66 A;  5BNX B;  3REI D;  3MGR C;  5BO0 A;  3A6N A;  1ID3 C;  3WA9 A;  4H9P A;  2BYM B;  5AV9 C;  3P5J B;  3AV1 B;  3W96 D;  5GXQ B;  5E5A A;  5GT3 D;  1M19 C;  3VH5 A;  3LJA D;  2YFW B;  3REK D;  5GSU D;  3W98 A;  4XZQ C;  4H9N A;  5AV5 C;  1EQZ C;  3WAA A;  3MVD D;  4JJN B;  3UTB D;  2XD1 A;  5B24 B;  3KUY A;  5JRG A;  3AN2 A;  2NZD B;  5B33 A;  1S32 A;  5B0Z B;  3B0C T;  4XUJ A;  4H9O A;  5F99 D;  1BH8 B;  4WU8 A;  3AZL B;  1R4V A;  5B40 A;  5CPJ C;  4AWL B;  3LZ1 D;  5DNM A;  5B31 B;  1AOI D;  3AZM C;  1F66 A;  1HTA A;  4LD9 B;  4ZUX C;  2ZY5 A;  3MGS C;  1P3L A;  4UUZ B;  1BFM A;  5B2J A;  2Y2Q A;  3X1S D;  3WKJ B;  1HQ3 C;  5AVB D;  3X1V B;  1P3F D;  4KGC C;  3LEL A;  3AZF B;  3W97 D;  1TZY B;  1ZLA A;  2PYO A;  4HGA C;  3MGQ A;  1P3K D;  2ZY3 A;  1P3G D;  3AZN D;  5AVC C;  4KUD C;  3EPH A;  5CHL B;  1P3P D;  4J8V C;  4H9S A;  1P3I A;  4NFT A;  3VH5 T;  5C3I B;  5GT3 B;  3B6F C;  4EO5 B;  3REK B;  2RVQ D;  2YFV B;  5GSU B;  2NQB D;  5CP6 B;  3MVD B;  2ZM5 A;  3UTB B;  3LZ0 D;  3EPL A;  1TAF A;  3AZI B;  1M1A C;  5GT0 A;  2F8N H;  1P3O C;  4WZS B;  3AZH D;  3MGR A;  5AV8 D;  4ZBJ C;  1P3A D;  1ID3 A;  2F8N K;  5AV9 A;  3LZ1 B;  1AOI B;  1M19 A;  3B0B A;  3AZJ C;  4YS3 C;  3R45 B;  5JA4 A;  4G92 C;  3B0D C;  3IP4 C;  5AV5 A;  3EPJ A;  3X1S B;  2ZY4 A;  5AVB B;  4Z66 D;  1EQZ A;  1BH9 A;  1M18 B;  3WA9 D;  3W97 B;  3V9R B;  5E5A D;  1KX3 C;  3F6T A;  1P3G B;  3AZN B;  3A1I A;  3WTP E;  4WNN B;  3FDD A;  1B67 A;  3W98 C;  4J8W D;  5CPJ A;  3AZE C;  5BT1 C;  5DNN C;  3REL C;  3AZM A;  4UPK A;  1U35 C;  3KUY D;  5JRG D;  4ZUX A;  4WU9 C;  1KX4 D;  5B33 D;  3MGS A;  1S32 D;  1KX5 C;  2NQB B;  4XUJ D;  3MNN B;  4NE3 A;  5B1L D;  1HQ3 A;  4KGC A;  4R8P C;  5B0Y D;  3W99 C;  1P3B A;  1F66 D;  4QLC C;  1P3A B;  4KUD A;  3C1B C;  1PZR A;  4J8V A;  3C1C C;  4J8U C;  1KU5 A;  3LEL D;  3KXB C;  5B24 D;  2PYO D;  4Z66 B;  3MGQ D;  2Y2M A;  5BO0 B;  2L5A A;  1M1A A;  3WA9 B;  4KHA A;  2Y2O A;  1P3O A;  5E5A B;  1ULY A;  3UT9 D;  4H9R A;  4H9N B;  2JE5 A;  3KWQ C;  2F8N A;  3KUY B;  3AN2 B;  5JRG B;  1KX4 B;  4Z2M G;  5B33 B;  4YS3 A;  1S32 B;  5CPI C;  3O62 C;  4XUJ B;  1A7W A;  5B1L B;  2IO5 B;  4E44 A;  2HIO C;  4WV4 B;  4DRB A;  3MGR D;  4WU8 B;  1ID3 D;  3VH6 T;  4CAY A;  5B0Y B;  5DNM B;  1F66 B;  1M19 D;  1KX3 A;  5B2I C;  5AY8 D;  5B2J B;  5AV5 D;  4XZQ D;  3AZE A;  1P34 C;  3UTA A;  2BG1 A;  2CV5 C;  5CP6 D;  5DNN A;  1U35 A;  3REL A;  3LEL B;  1KX5 A;  3AZI D;  4WU9 A;  2DQN C;  2PYO B;  3MGQ B;  4J8X D;  3AZK A;  3MGP A;  1WWS A;  3REH D;  3REI C;  4R8P A;  5CPJ D;  1P3M A;  3W99 A;  1Z2C B;  3W96 C;  3UT9 B;  4WJ3 C;  4QLC A;  3C1B A;  3MGS D;  3LJA C;  3KFU G;  3A1K A;  4YM6 A;  3REJ C;  1HQ3 D;  3C1C A;  4J8U A;  2Y2J A;  4KGC D;  1M18 D;  4X23 C;  3KXB A;  3UTB C;  5GT0 B;  4Z5T C;  4G91 C;  2RIQ A;  1P3B C;  3MGR B;  1ID3 B;  3AZG C;  5AVC D;  4KUD D;  5F99 C;  3AYW C;  3AV2 C;  5CPK C;  1T3U A;  3X1U C;  1M19 B;  3B6F D;  3LZ1 C;  4XZQ B;  5AY8 B;  5AV5 B;  3MNN D;  3KWQ A;  1EQZ B;  1BH9 B;  1M1A D;  4JJN A;  5CPI A;  1P3F C;  3O62 A;  2HUE C;  4J8X B;  2Y2N A;  2HIO A;  5B0Z A;  3REH B;  1P3K C;  5CPJ B;  1P3G C;  1N1J B;  3EG5 B;  1P3P C;  1H3O A;  3AZL A;  2FJ7 C;  4ZUX B;  3AZJ D;  5B31 A;  4YS3 D;  3MGS B;  5B2I A;  2G5I C;  1P34 A;  2CV5 A;  1HQ3 B;  5B1M C;  3A6N D;  4KGC B;  5KDM A;  3NQJ A;  3LZ0 C;  3AZF A;  3X1T C;  1KX3 D;  3B6G C;  2ARO C;  5AVC B;  4KUD B;  3AZH C;  3REI A;  5B32 C;  5AV8 C;  4J8V B;  3W98 D;  3WTP C;  3UTA C;  3B6F B;  3TU4 C;  3WAA D;  5BT1 D;  3W96 A;  5DNN D;  3REL D;  1U35 D;  3AN2 D;  5BS7 C;  3LJA A;  3REK A;  3REJ A;  4DRA A;  3AZK C;  4NE5 A;  1JFI B;  3MGP C;  1M1A B;  4KHA B;  4WU8 D;  4R8P D;  4X23 A;  5B40 D;  3UTB A;  5FUG B;  1P3O B;  4Z5T A;  1P3M C;  4CSR A;  5DNM D;  4H9R B;  4ZBJ B;  4QLC D;  3AFA C;  3AZG A;  5F99 A;  2BYK B;  1P3L D;  2Y2H A;  3AYW A;  4YM6 C;  5B2J D;  3AV2 A;  5CPK A;  4J8W C;  3X1U A;  2F8N B;  3C1C D;  3LZ1 A;  3AZJ B;  3KXB D;  4YS3 B;  4G92 B;  3B0D B;  5BNV B;  1KX4 C;  5AV6 C;  1ZLA D;  5G49 A;  3A6N B;  5B1L C;  3X1S A;  4H9P B;  5AVB A;  4CAY B;  1P3F A;  1P3I D;  1KX3 B;  3AV1 C;  5B0Y C;  5GXQ C;  1P3K A;  3W98 B;  1P3G A;  4WNN A;  3H0L C;  1P3P A;  4NE6 A;  3KWQ D;  2JCH A;  3WAA B;  2FFF B;  5DNN B;  3REL B;  1U35 B;  2FJ7 A;  4WU9 B;  4JJN C;  5GT0 D;  2DF4 C;  5CPI D;  3O62 D;  5B24 C;  2NZD C;  4H9O B;  4DQY B;  5B0Z C;  5B1M A;  3NQU A;  4R8P B;  5B40 B;  5AV9 D;  3LZ0 A;  3W99 B;  3AZL C;  3X1T A;  3B6G A;  4QLC B;  2ARO A;  4AWL C;  3C1B B;  3AZH A;  5B31 C;  3UT9 C;  5B32 A;  5AV8 A;  1P3L B;  4LD9 C;  3WTP A;  3C1C B;  4J8U B;  3TU4 A;  1EQZ D;  2VQR A;  3WKJ C;  3KXB B;  5BS7 A;  3X1V C;  1Q9C A;  1ZLA B;  3AZF C;  1TZY C;  3H0M C;  1P3I B;  4H9Q A;  3AZM D;  5C3I C;  3AFA A;  5GT3 C;  4ZUX D;  2Y2L A;  4EO5 C;  3REK C;  3REJ D;  3KWQ B;  5GSU C;  4J8W A;  5AY8 C;  3B0C W;  1TAF B;  5CP6 C;  4X23 D;  3MVD C;  5CPI B;  4Z5T D;  3O62 B;  3AZI C;  5AV6 A;  1KX4 A;  2HIO B;  1P3B D;  4J8X C;  3AZG D;  5B1L A;  5BNX A;  4J8V D;  5AV9 B;  3REH C;  3AYW D;  3AV2 D;  1H3O B;  5CPK D;  3X1U D;  2BYM A;  3AV1 A;  5B0Y A;  5GXQ A;  1AOI C;  5JA4 B;  5B2I B;  2YFW A;  1P34 B;  2CV5 B;  2G5H C;  5KDM B;  3X1S C;  5AVB C;  2W8S A;  4E45 A;  3NQJ B;  1P3O D;  1M18 C;  5B24 A;  2F8N G;  3W97 C;  2NZD A;  3VH5 W;  3REI B;  3AZN C;  1BH8 A;  2LY8 A;  2F8N D;  3W96 B;  3AZM B;  2FJ7 D;  4LD9 A;  3LJA B;  3UT9 A;  2Y2K A;  2RVQ C;  3REJ B;  1F1E A;  4UUZ A;  2NQB C;  5B1M D;  3MNN C;  3WKJ A;  4X23 B;  5B32 G;  4Z5T B;  3X1V A;  4CSR B;  4G91 B;  4HGA B;  3X1T D;  1P3B B;  3B6G D;  1TZY A;  2ARO D;  3AZG B;  2Y2P A;  5F99 B;  5B32 D;  4M6B A;  3AYW B;  3AV2 B;  3AZE D;  3KSY A;  3WTP D;  1W2E A;  5CPK B;  1P3A C;  3X1U B;  3UTA D;  3TU4 D;  5GT3 A;  1KX5 D;  2JSS A;  4WU9 D;  2YFV A;  5G49 B;  5GSU A;  3AZK D;  5AY8 A;  4XZQ A;  3MGP D;  3H0R C;  4Z66 C;  5CP6 A;  3MVD A;  3A6N C;  1P3F B;  2HUE B;  1P3M D;  3WA9 C;  3AZI A;  2XD5 A;  3W99 D;  3AL0 C;  5E5A C;  4J8X A;  3AFA D;  1P3K B;  3C1B D;  3REH A;  4YM6 D;  1P3P B;  1N1J A;  4J8U D;  2FJ7 B;  3WAA C;  1AOI A;  2UWX A;  3KUY C;  3AN2 C;  5JRG C;  5AV6 D;  5B33 C;  1S32 C;  2J8P A;  3R45 A;  5B1M B;  4XUJ C;  3NQU B;  2IO5 C;  3LZ0 B;  4WU8 C;  1M18 A;  5B40 C;  3X1T B;  3W97 A;  3B6G B;  3AV1 D;  2ARO B;  5GXQ D;  3V9R A;  3VH6 A;  3AZH B;  5DNM C;  1F66 C;  5B32 B;  5AV8 B;  3AZE B;  3WTP B;  5AVC A;  3AZN A;  3UTA B;  1P3L C;  3TU4 B;  5B2J C;  1KX5 B;  3B6F A;  2CWE A;  4JJN D;  3LEL C;  1WWI A;  2NZD D;  3AZK B;  2HIO D;  3MGP B;  1ZLA C;  5B0Z D;  2NQB A;  2PYO C;  3MNN A;  3MGQ C;  5B31 G;  1JFI A;  1P3M B;  1B6W A;  4H9Q B;  4H9S C;  3AZL D;  2F2A C;  2Y2G A;  5FUG A;  1P3I C;  3EPK A;  2ZY2 A;  3AFA B;  4LD9 D;  5B31 D; 
#chains in the Genus database with same CATH homology
 2Y2I A;  1P3A A;  4YM6 B;  5B2I D;  4J8W B;  1P34 D;  2BYK A;  2CV5 D;  3WKJ D;  4Z2M H;  3X1V D;  5AV6 B;  3AZJ A;  3AZF D;  5GT0 C;  3VH6 W;  5BNV A;  1TZY D;  4Z66 A;  5BNX B;  3REI D;  3MGR C;  5BO0 A;  3A6N A;  1ID3 C;  3WA9 A;  4H9P A;  2BYM B;  5AV9 C;  3P5J B;  3AV1 B;  3W96 D;  5GXQ B;  5E5A A;  5GT3 D;  1M19 C;  3VH5 A;  3LJA D;  2YFW B;  3REK D;  5GSU D;  3W98 A;  4XZQ C;  4H9N A;  5AV5 C;  1EQZ C;  3WAA A;  3MVD D;  4JJN B;  3UTB D;  2XD1 A;  5B24 B;  3KUY A;  5JRG A;  3AN2 A;  2NZD B;  5B33 A;  1S32 A;  5B0Z B;  3B0C T;  4XUJ A;  4H9O A;  5F99 D;  1BH8 B;  4WU8 A;  3AZL B;  1R4V A;  5B40 A;  5CPJ C;  4AWL B;  3LZ1 D;  5DNM A;  5B31 B;  1AOI D;  3AZM C;  1F66 A;  1HTA A;  4LD9 B;  4ZUX C;  2ZY5 A;  3MGS C;  1P3L A;  4UUZ B;  1BFM A;  5B2J A;  2Y2Q A;  3X1S D;  3WKJ B;  1HQ3 C;  5AVB D;  3X1V B;  1P3F D;  4KGC C;  3LEL A;  3AZF B;  3W97 D;  1TZY B;  1ZLA A;  2PYO A;  4HGA C;  3MGQ A;  1P3K D;  2ZY3 A;  1P3G D;  3AZN D;  5AVC C;  4KUD C;  3EPH A;  5CHL B;  1P3P D;  4J8V C;  4H9S A;  1P3I A;  4NFT A;  3VH5 T;  5C3I B;  5GT3 B;  3B6F C;  4EO5 B;  3REK B;  2RVQ D;  2YFV B;  5GSU B;  2NQB D;  5CP6 B;  3MVD B;  2ZM5 A;  3UTB B;  3LZ0 D;  3EPL A;  1TAF A;  3AZI B;  1M1A C;  5GT0 A;  2F8N H;  1P3O C;  4WZS B;  3AZH D;  3MGR A;  5AV8 D;  4ZBJ C;  1P3A D;  1ID3 A;  2F8N K;  5AV9 A;  3LZ1 B;  1AOI B;  1M19 A;  3B0B A;  3AZJ C;  4YS3 C;  3R45 B;  5JA4 A;  4G92 C;  3B0D C;  3IP4 C;  5AV5 A;  3EPJ A;  3X1S B;  2ZY4 A;  5AVB B;  4Z66 D;  1EQZ A;  1BH9 A;  1M18 B;  3WA9 D;  3W97 B;  3V9R B;  5E5A D;  1KX3 C;  3F6T A;  1P3G B;  3AZN B;  3A1I A;  3WTP E;  4WNN B;  3FDD A;  1B67 A;  3W98 C;  4J8W D;  5CPJ A;  3AZE C;  5BT1 C;  5DNN C;  3REL C;  3AZM A;  4UPK A;  1U35 C;  3KUY D;  5JRG D;  4ZUX A;  4WU9 C;  1KX4 D;  5B33 D;  3MGS A;  1S32 D;  1KX5 C;  2NQB B;  4XUJ D;  3MNN B;  4NE3 A;  5B1L D;  1HQ3 A;  4KGC A;  4R8P C;  5B0Y D;  3W99 C;  1P3B A;  1F66 D;  4QLC C;  1P3A B;  4KUD A;  3C1B C;  1PZR A;  4J8V A;  3C1C C;  4J8U C;  1KU5 A;  3LEL D;  3KXB C;  5B24 D;  2PYO D;  4Z66 B;  3MGQ D;  2Y2M A;  5BO0 B;  2L5A A;  1M1A A;  3WA9 B;  4KHA A;  2Y2O A;  1P3O A;  5E5A B;  1ULY A;  3UT9 D;  4H9R A;  4H9N B;  2JE5 A;  3KWQ C;  2F8N A;  3KUY B;  3AN2 B;  5JRG B;  1KX4 B;  4Z2M G;  5B33 B;  4YS3 A;  1S32 B;  5CPI C;  3O62 C;  4XUJ B;  1A7W A;  5B1L B;  2IO5 B;  4E44 A;  2HIO C;  4WV4 B;  4DRB A;  3MGR D;  4WU8 B;  1ID3 D;  3VH6 T;  4CAY A;  5B0Y B;  5DNM B;  1F66 B;  1M19 D;  1KX3 A;  5B2I C;  5AY8 D;  5B2J B;  5AV5 D;  4XZQ D;  3AZE A;  1P34 C;  3UTA A;  2BG1 A;  2CV5 C;  5CP6 D;  5DNN A;  1U35 A;  3REL A;  3LEL B;  1KX5 A;  3AZI D;  4WU9 A;  2DQN C;  2PYO B;  3MGQ B;  4J8X D;  3AZK A;  3MGP A;  1WWS A;  3REH D;  3REI C;  4R8P A;  5CPJ D;  1P3M A;  3W99 A;  1Z2C B;  3W96 C;  3UT9 B;  4WJ3 C;  4QLC A;  3C1B A;  3MGS D;  3LJA C;  3KFU G;  3A1K A;  4YM6 A;  3REJ C;  1HQ3 D;  3C1C A;  4J8U A;  2Y2J A;  4KGC D;  1M18 D;  4X23 C;  3KXB A;  3UTB C;  5GT0 B;  4Z5T C;  4G91 C;  2RIQ A;  1P3B C;  3MGR B;  1ID3 B;  3AZG C;  5AVC D;  4KUD D;  5F99 C;  3AYW C;  3AV2 C;  5CPK C;  1T3U A;  3X1U C;  1M19 B;  3B6F D;  3LZ1 C;  4XZQ B;  5AY8 B;  5AV5 B;  3MNN D;  3KWQ A;  1EQZ B;  1BH9 B;  1M1A D;  4JJN A;  5CPI A;  1P3F C;  3O62 A;  2HUE C;  4J8X B;  2Y2N A;  2HIO A;  5B0Z A;  3REH B;  1P3K C;  5CPJ B;  1P3G C;  1N1J B;  3EG5 B;  1P3P C;  1H3O A;  3AZL A;  2FJ7 C;  4ZUX B;  3AZJ D;  5B31 A;  4YS3 D;  3MGS B;  5B2I A;  2G5I C;  1P34 A;  2CV5 A;  1HQ3 B;  5B1M C;  3A6N D;  4KGC B;  5KDM A;  3NQJ A;  3LZ0 C;  3AZF A;  3X1T C;  1KX3 D;  3B6G C;  2ARO C;  5AVC B;  4KUD B;  3AZH C;  3REI A;  5B32 C;  5AV8 C;  4J8V B;  3W98 D;  3WTP C;  3UTA C;  3B6F B;  3TU4 C;  3WAA D;  5BT1 D;  3W96 A;  5DNN D;  3REL D;  1U35 D;  3AN2 D;  5BS7 C;  3LJA A;  3REK A;  3REJ A;  4DRA A;  3AZK C;  4NE5 A;  1JFI B;  3MGP C;  1M1A B;  4KHA B;  4WU8 D;  4R8P D;  4X23 A;  5B40 D;  3UTB A;  5FUG B;  1P3O B;  4Z5T A;  1P3M C;  4CSR A;  5DNM D;  4H9R B;  4ZBJ B;  4QLC D;  3AFA C;  3AZG A;  5F99 A;  2BYK B;  1P3L D;  2Y2H A;  3AYW A;  4YM6 C;  5B2J D;  3AV2 A;  5CPK A;  4J8W C;  3X1U A;  2F8N B;  3C1C D;  3LZ1 A;  3AZJ B;  3KXB D;  4YS3 B;  4G92 B;  3B0D B;  5BNV B;  1KX4 C;  5AV6 C;  1ZLA D;  5G49 A;  3A6N B;  5B1L C;  3X1S A;  4H9P B;  5AVB A;  4CAY B;  1P3F A;  1P3I D;  1KX3 B;  3AV1 C;  5B0Y C;  5GXQ C;  1P3K A;  3W98 B;  1P3G A;  4WNN A;  3H0L C;  1P3P A;  4NE6 A;  3KWQ D;  2JCH A;  3WAA B;  2FFF B;  5DNN B;  3REL B;  1U35 B;  2FJ7 A;  4WU9 B;  4JJN C;  5GT0 D;  2DF4 C;  5CPI D;  3O62 D;  5B24 C;  2NZD C;  4H9O B;  4DQY B;  5B0Z C;  5B1M A;  3NQU A;  4R8P B;  5B40 B;  5AV9 D;  3LZ0 A;  3W99 B;  3AZL C;  3X1T A;  3B6G A;  4QLC B;  2ARO A;  4AWL C;  3C1B B;  3AZH A;  5B31 C;  3UT9 C;  5B32 A;  5AV8 A;  1P3L B;  4LD9 C;  3WTP A;  3C1C B;  4J8U B;  3TU4 A;  1EQZ D;  2VQR A;  3WKJ C;  3KXB B;  5BS7 A;  3X1V C;  1Q9C A;  1ZLA B;  3AZF C;  1TZY C;  3H0M C;  1P3I B;  4H9Q A;  3AZM D;  5C3I C;  3AFA A;  5GT3 C;  4ZUX D;  2Y2L A;  4EO5 C;  3REK C;  3REJ D;  3KWQ B;  5GSU C;  4J8W A;  5AY8 C;  3B0C W;  1TAF B;  5CP6 C;  4X23 D;  3MVD C;  5CPI B;  4Z5T D;  3O62 B;  3AZI C;  5AV6 A;  1KX4 A;  2HIO B;  1P3B D;  4J8X C;  3AZG D;  5B1L A;  5BNX A;  4J8V D;  5AV9 B;  3REH C;  3AYW D;  3AV2 D;  1H3O B;  5CPK D;  3X1U D;  2BYM A;  3AV1 A;  5B0Y A;  5GXQ A;  1AOI C;  5JA4 B;  5B2I B;  2YFW A;  1P34 B;  2CV5 B;  2G5H C;  5KDM B;  3X1S C;  5AVB C;  2W8S A;  4E45 A;  3NQJ B;  1P3O D;  1M18 C;  5B24 A;  2F8N G;  3W97 C;  2NZD A;  3VH5 W;  3REI B;  3AZN C;  1BH8 A;  2LY8 A;  2F8N D;  3W96 B;  3AZM B;  2FJ7 D;  4LD9 A;  3LJA B;  3UT9 A;  2Y2K A;  2RVQ C;  3REJ B;  1F1E A;  4UUZ A;  2NQB C;  5B1M D;  3MNN C;  3WKJ A;  4X23 B;  5B32 G;  4Z5T B;  3X1V A;  4CSR B;  4G91 B;  4HGA B;  3X1T D;  1P3B B;  3B6G D;  1TZY A;  2ARO D;  3AZG B;  2Y2P A;  5F99 B;  5B32 D;  4M6B A;  3AYW B;  3AV2 B;  3AZE D;  3KSY A;  3WTP D;  1W2E A;  5CPK B;  1P3A C;  3X1U B;  3UTA D;  3TU4 D;  5GT3 A;  1KX5 D;  2JSS A;  4WU9 D;  2YFV A;  5G49 B;  5GSU A;  3AZK D;  5AY8 A;  4XZQ A;  3MGP D;  3H0R C;  4Z66 C;  5CP6 A;  3MVD A;  3A6N C;  1P3F B;  2HUE B;  1P3M D;  3WA9 C;  3AZI A;  2XD5 A;  3W99 D;  3AL0 C;  5E5A C;  4J8X A;  3AFA D;  1P3K B;  3C1B D;  3REH A;  4YM6 D;  1P3P B;  1N1J A;  4J8U D;  2FJ7 B;  3WAA C;  1AOI A;  2UWX A;  3KUY C;  3AN2 C;  5JRG C;  5AV6 D;  5B33 C;  1S32 C;  2J8P A;  3R45 A;  5B1M B;  4XUJ C;  3NQU B;  2IO5 C;  3LZ0 B;  4WU8 C;  1M18 A;  5B40 C;  3X1T B;  3W97 A;  3B6G B;  3AV1 D;  2ARO B;  5GXQ D;  3V9R A;  3VH6 A;  3AZH B;  5DNM C;  1F66 C;  5B32 B;  5AV8 B;  3AZE B;  3WTP B;  5AVC A;  3AZN A;  3UTA B;  1P3L C;  3TU4 B;  5B2J C;  1KX5 B;  3B6F A;  2CWE A;  4JJN D;  3LEL C;  1WWI A;  2NZD D;  3AZK B;  2HIO D;  3MGP B;  1ZLA C;  5B0Z D;  2NQB A;  2PYO C;  3MNN A;  3MGQ C;  5B31 G;  1JFI A;  1P3M B;  1B6W A;  4H9Q B;  4H9S C;  3AZL D;  2F2A C;  2Y2G A;  5FUG A;  1P3I C;  3EPK A;  2ZY2 A;  3AFA B;  4LD9 D;  5B31 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...