3AZFD

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfD00
1P3AA 4Z66C 2HUEC 3B6FB 1EQZA 4QLCC 3WA9D 4DRBA 3W98B 5GSUA 5AVBC 3MVDB 1P3GD 1U35C 4G91C 2FJ7C 3AV2C 4H9PB 1KX5C 4LD9D 1R4VA 3X1SB 3LZ0B 4QLCB 1TZYC 1P34D 4CSRA 2YFWB 5G49A 1M1AC 5B1LA 4YS3D 5AVBB 4WU9A 4J8UC 3AZJB 3MGQC 5KDMB 3UTAA 1HQ3D 1U35B 1M18A 3AFAC 2FJ7B 3REHB 3B6GC 1KX5B 3X1SD 3LZ0D 4WU8A 3KUYB 4J8VD 3AZIA 1TZYB 4Z5TA 4KUDD 3REJC 5GT0A 1M1AB 2BYKA 5JRGA 4NFTA 4XZQA 4XUJB 5AVCA 3MGSA 4J8UB 1P3BD 4HGAC 3MGQB 4UUZA 1AOIC 1H3OB 5CP6D 3REHD 4R8PD 5AV5C 3KUYD 5B2JD 3B6GB 4WZSB 4E44A 5AV6C 5E5AD 4M6BA 5CPIC 3AYWB 3REJB 4XUJD 3AV1C 3KXBD 2YFVA 3MGPC 3MGRD 5B33C 4KGCA 3B0DB 5B0ZA 3KWQB 1EQZC 5AV8B 1KX4D 5DNNC 5B32B 5FUGB 4ZUXD 4H9NB 2F8ND 3X1TA 3A6ND 1BH8B 5GSUC 5AV6B 3AYWD 5B0YA 1KX3C 1P3MD 2CV5D 3NQJA 5AV9B 3AZND 1S32A 5GXQB 3KWQD 5CPKB 5DNMA 4H9OA 1JFIB 1P3FB 4ZBJC 5DNNB 3AZMC 2PYOB 3NQUB 5F99D 3WA9A 3AZHD 5B1LC 5GSUB 5AV9D 4WU9C 3W97C 1KX3B 3UTAC 3C1CD 1KU5A 1P3KD 1ID3A 3WAAB 1M19C 3RELC 1N1JB 1P3FD 2PYOD 3AZIC 4Z5TC 2F8NH 3WTPD 3AZMB 5GT0C 1P34A 3O62B 3W97B 5JRGC 4XZQC 5GT3D 4YS3A 3W99D 2AROB 5B40D 1HQ3A 2BYMB 1M19B 3RELB 3MNND 3LELB 4KHAA 5BNXA 2NZDA 4J8VA 4YM6C 1F66C 4KUDA 4KGCC 5B0ZC 1P3BA 5CPJC 3AZEB 4R8PA 4J8XB 5B2JA 1P3OD 3UT9D 4JJNA 5B0YC 4YM6B 1P3PD 5E5AA 1F66B 1P3LD 5B31D 3AZKB 1TAFB 3KXBA 5B24C 3AZGA 3AZED 4J8XD 5CPJB 3C1BB 1KX4A 3X1VC 3WA9C 4ZUXA 3B0BA 3UTBD 3A6NA 5BO0A 5JA4A 3REKD 5BS7C 2CV5A 3AZNA 1ID3C 5B24B 4WNNB 1BH9B 4H9RB 3X1UD 3AN2B 3X1VB 1P34C 1P3IB 3V9RA 3B6FD 5F99A 1ZLAC 4Z66B 2HUEB 5AY8C 5B2IC 3W98D 4NE5A 3TU4C 3C1CA 4Z2MH 3MVDD 2NZDC 5BT1C 4J8WA 1P3ID 4G91B 3WTPA 3AV2B 4QLCD 1ZLAB 5AY8B 2NQBA 5B2IB 3W99A 3TU4B 5B40A 5AVBD 2RVQD 4R8PC 3W96C 3VH5A 3AZJD 1U35D 5B2JC 4EO5C 3AZFA 3MNNA 3LZ1A 4JJNC 2NZDB 2FJ7D 3AV2D 3AFAB 1KX5D 1TZYD 3REIA 3R45A 3VH6W 3AZGC 5BNVA 1M1AD 4H9QA 2HIOA 4J8UD 3W96B 3MGQD 4ZUXC 4CAYA 1AOIB 3WKJC 4HGAB 4JJNB 3A6NC 1P3AC 1P3OA 3VH6A 3UT9A 3B6GD 5AV5B 1P3PA 5B31A 4H9SA 3REJD 3AZLA 4WV4B 5CPIB 5B1MA 3AV1B 1AOID 3MGPB 5B33B 2CWEA 5F99C 3WKJB 4NE6A 1P3AB 5AV8D 5AV5D 4X23A 5B32D 3LJAA 1EQZB 3REKA 5AV6D 3C1CC 5GXQD 4J8WC 3MGPD 1M18C 5B33D 1P3GA 5CPKD 3X1UA 2F8NG 4WU8C 3B6FA 5DNND 2NQBC 4LD9A 4ZBJB 3W99C 4CSRB 5GSUD 3W98A 2IO5C 1KX3D 5G49B 5B1LB 4WU9B 5AVCC 3MVDA 3MGSC 3AZFC 3MNNC 3LZ1C 3UTAB 1M18B 5B32G 3WAAD 5C3IC 4H9PA 1BFMA 4WU8B 3REIC 3AZMD 3X1SA 3LZ0A 4QLCA 3AZIB 4Z5TB 3O62D 3W97D 5GT0B 2YFWA 2HIOC 2BYKB 5AVBA 5JRGB 2AROD 3UTAD 4XZQB 5AVCB 3MGSB 3AZJA 1U35A 4UUZB 4AWLC 1M19D 4NE3A 3RELD 5CP6A 3REHA 3LELD 1P3PC 5C3IB 1KX5A 4Z5TD 3X1TC 3KUYA 4H9SC 3AZLC 3VH5T 5B1MC 5JRGD 1M1AA 1S32C 2YFVB 1B6WA 4XUJA 4J8UA 4KGCB 5DNMC 3MGRA 5B0ZB 1H3OA 4X23C 3LJAC 3X1TB 2F8NA 4YM6D 1F66D 5B0YB 3AYWA 3NQJB 3REJA 3AZKD 1P3MA 1S32B 1B67A 1P3GC 3X1UC 3VH6T 5B0ZD 5DNMB 5CPJD 3B6FC 2LY8A 4H9OB 3KWQA 3LJAB 3C1BD 4LD9C 5AV8A 5B32A 5FUGA 4H9NA 3WA9B 2JSSA 5B0YD 5B31G 1BH8A 3AZHA 4YS3C 5AV9A 4Z2MG 1HTAA 1P3GB 5GXQA 1HQ3C 1ID3B 2F8NK 5B24D 4DRAA 1P3KA 5CPKA 1F1EA 1JFIA 3LZ0C 3X1SC 4LD9B 1P3FA 5DNNA 3AN2D 4J8VC 3X1VD 2PYOA 3NQUA 1A7WA 5CHLB 3B0CW 3VH5W 1P34B 4KUDC 4Z66D 2RVQC 1KX3A 3AZJC 4YS3B 5GT3A 1ID3D 1P3BC 1HQ3B 5CP6C 3REHC 3WAAA 1N1JA 4KHAB 3KUYC 5BNXB 3AZMA 4J8VB 5E5AC 4KUDB 1ZLAD 3O62A 3W97A 5AY8D 5B2ID 4XUJC 3KXBC 3TU4D 2AROA 3MGRC 1P3BB 5CP6B 2BYMA 1M19A 4R8PB 3RELA 1KX4C 3LELA 2NZDD 5BT1D 5B2JB 4EO5B 3AFAD 3AYWC 5E5AB 3KSYA 1P3MC 2CV5C 1P3LA 3AZNC 3KXBB 3B0DC 3MGRB 3AZGB 3KWQC 5AV8C 3W96D 3AZEA 5B32C 4J8XA 1KX4B 4G92C 4JJND 4ZUXB 2F8NB 3AZHC 3A6NB 4YM6A 5AV9C 3UTBA 1F66A 5BO0B 5JA4B 1P3MB 2CV5B 3AZKA 5GXQC 3AZNB 3AZGD 1TAFA 1P3KC 5CPKC 1ULYA 5CPID 3AV1D 5CPJA 1P3FC 3C1BA 2PYOC 4G92B 3WTPC 3WKJD 1P3AD 3V9RB 5F99B 3AZHB 1EQZD 5GT3C 5B40C 3C1CB 3WAAC 1P3KB 5B24A 4J8WB 4WNNA 1BH9A 4H9RA 3WTPB 1Q9CA 3AN2A 1WWIA 3X1VA 1P3IA 3O62C 4Z66A 2NQBB 2AROC 5GT3B 2L5AA 5BS7A 3W99B 5B40B 5B1LD 4WU9D 2IO5B 3LELC 4J8WD 3AZFB 1M18D 3MNNB 3LZ1B 5KDMA 1P3OC 3UT9C 2FJ7A 3WTPE 3AV2A 4WU8D 1P3LC 2NQBD 3AZID 1ZLAA 5B31C 4E45A 3REIB 3R45B 5AY8A 5B2IA 1TZYA 5BNVB 5GT0D 3TU4A 3B0CT 4H9QB 3AZEC 4XZQD 5AVCD 2HIOB 3MGSD 4J8XC 3AZFD 3LZ1D 4CAYB 3MGQA 4AWLB 1P3OB 3AFAA 3UT9B 3UTBC 1P3PB 3AZKC 3REID 3REKC 1P3LB 3B6GA 5B31B 3AZLB 2HIOD 5B1MB 3C1BC 3W96A 4KGCD 1AOIA 4X23B 3UTBB 5AV5A 3X1TD 3REKB 3W98C 3AZLD 5AV6A 5B1MD 3MVDC 5CPIA 1S32D 3AV1A 3MGPA 3AN2C 5DNMD 5B33A 3X1UB 1P3IC 1WWSA 4X23D 3WKJA 3LJAD
chains in the Genus database with same CATH superfamily
1P3AA 4Z66C 2HUEC 3B6FB 1EQZA 4QLCC 3WA9D 4DRBA 3W98B 5GSUA 5AVBC 3MVDB 1P3GD 1U35C 4G91C 2FJ7C 3AV2C 4H9PB 1KX5C 2G5IC 4LD9D 1R4VA 3X1SB 3LZ0B 4QLCB 1TZYC 1P34D 4CSRA 2YFWB 5G49A 1M1AC 5B1LA 4YS3D 5AVBB 4WU9A 4J8UC 3AZJB 3MGQC 5KDMB 3UTAA 1HQ3D 1U35B 1M18A 3AFAC 2FJ7B 3REHB 3B6GC 1KX5B 3X1SD 2Y2PA 3LZ0D 4WU8A 3KUYB 4J8VD 2Y2IA 3AZIA 1TZYB 4Z5TA 4KUDD 3REJC 5GT0A 1M1AB 2BYKA 5JRGA 4NFTA 4XZQA 4XUJB 5AVCA 3MGSA 4J8UB 1P3BD 4HGAC 3MGQB 4UUZA 1AOIC 1H3OB 5CP6D 3REHD 4R8PD 5AV5C 2Y2HA 3KUYD 5B2JD 3B6GB 4WZSB 4E44A 5AV6C 5E5AD 2BG1A 4M6BA 5CPIC 3AYWB 3REJB 4XUJD 3AV1C 3KXBD 2YFVA 3MGPC 3MGRD 5B33C 4KGCA 3B0DB 5B0ZA 3KWQB 1EQZC 5AV8B 1KX4D 5DNNC 5B32B 5FUGB 4ZUXD 4H9NB 2F8ND 2ZY2A 3A6ND 3X1TA 1BH8B 5GSUC 5AV6B 3AYWD 4WJ3C 5B0YA 1KX3C 1P3MD 2CV5D 3NQJA 5AV9B 3AZND 1S32A 5GXQB 1T3UA 3KWQD 5CPKB 5DNMA 3H0LC 4H9OA 1JFIB 3H0MC 1P3FB 4ZBJC 5DNNB 3AZMC 2PYOB 3NQUB 5F99D 3WA9A 3AZHD 5B1LC 5GSUB 5AV9D 4WU9C 3W97C 1KX3B 3UTAC 3C1CD 1KU5A 1P3KD 1ID3A 3WAAB 1M19C 3RELC 1N1JB 1P3FD 2PYOD 2ZM5A 3AZIC 4Z5TC 2F8NH 3WTPD 3AZMB 1W2EA 5GT0C 1P34A 3O62B 3W97B 5JRGC 4XZQC 5GT3D 4YS3A 3W99D 2AROB 5B40D 1HQ3A 2BYMB 1M19B 3RELB 2Y2GA 3MNND 3LELB 2Y2KA 4KHAA 5BNXA 2NZDA 4J8VA 4YM6C 1F66C 4KUDA 2ZY5A 4KGCC 5B0ZC 1P3BA 5CPJC 3AZEB 4R8PA 4J8XB 5B2JA 1P3OD 3UT9D 4JJNA 5B0YC 4YM6B 1P3PD 5E5AA 1F66B 1P3LD 2XD1A 5B31D 3AZKB 1TAFB 3KXBA 5B24C 3AZGA 3AZED 4J8XD 5CPJB 3C1BB 1KX4A 3X1VC 3WA9C 4ZUXA 3B0BA 3UTBD 3A6NA 2Y2LA 5BO0A 5JA4A 3REKD 5BS7C 2CV5A 3AZNA 1ID3C 2W8SA 5B24B 4WNNB 1BH9B 4H9RB 3X1UD 3AN2B 3X1VB 1P34C 1P3IB 3V9RA 2XD5A 3B6FD 5F99A 1ZLAC 4Z66B 2HUEB 2Y2NA 5AY8C 5B2IC 3EPJA 3W98D 4NE5A 2ZY4A 3TU4C 3C1CA 3H0RC 4Z2MH 3MVDD 2NZDC 2RIQA 5BT1C 4J8WA 1P3ID 4G91B 2UWXA 3WTPA 3AV2B 4QLCD 1ZLAB 5AY8B 2NQBA 5B2IB 2JE5A 2G5HC 3W99A 3TU4B 5B40A 5AVBD 2RVQD 4R8PC 3W96C 3VH5A 3AZJD 1U35D 5B2JC 4EO5C 3AZFA 3MNNA 3LZ1A 4JJNC 2NZDB 2FJ7D 3AV2D 3AFAB 1KX5D 3FDDA 1TZYD 3REIA 3R45A 3VH6W 3AZGC 5BNVA 1M1AD 2J8PA 4H9QA 2HIOA 4J8UD 3W96B 3MGQD 4ZUXC 4CAYA 1AOIB 3WKJC 4HGAB 4JJNB 3A6NC 1P3AC 1P3OA 3VH6A 3UT9A 3B6GD 5AV5B 1P3PA 5B31A 2JCHA 4H9SA 3REJD 3AZLA 4WV4B 5CPIB 5B1MA 3AV1B 1AOID 2F2AC 3MGPB 5B33B 2CWEA 5F99C 3WKJB 4NE6A 1P3AB 5AV8D 5AV5D 4X23A 5B32D 3LJAA 1EQZB 3REKA 3A1IA 5AV6D 2Y2OA 3C1CC 3EG5B 3EPLA 3AL0C 5GXQD 4J8WC 3MGPD 1M18C 5B33D 1P3GA 5CPKD 3X1UA 2F8NG 3F6TA 4WU8C 3B6FA 5DNND 2NQBC 4LD9A 4ZBJB 3W99C 4CSRB 3KFUG 5GSUD 3W98A 2IO5C 1KX3D 5G49B 5B1LB 4WU9B 5AVCC 3MVDA 3MGSC 3AZFC 3MNNC 3LZ1C 3UTAB 1M18B 5B32G 3WAAD 5C3IC 4H9PA 1BFMA 4WU8B 3REIC 3AZMD 3X1SA 3LZ0A 4QLCA 3AZIB 4Z5TB 3O62D 3W97D 5GT0B 2YFWA 2HIOC 5AVBA 2BYKB 5JRGB 2AROD 3UTAD 4XZQB 5AVCB 3MGSB 3AZJA 1U35A 4UUZB 4AWLC 1M19D 4NE3A 3RELD 5CP6A 2Y2JA 3LELD 3REHA 5C3IB 1P3PC 1KX5A 4Z5TD 3X1TC 3KUYA 4H9SC 3AZLC 3VH5T 5B1MC 5JRGD 1M1AA 1S32C 2YFVB 4UPKA 1B6WA 4XUJA 4J8UA 4KGCB 5DNMC 3MGRA 5B0ZB 1H3OA 4X23C 3LJAC 3X1TB 2F8NA 4YM6D 1F66D 5B0YB 3AYWA 3NQJB 3REJA 3AZKD 1P3MA 1S32B 1B67A 1P3GC 3X1UC 3VH6T 5B0ZD 5DNMB 5CPJD 3B6FC 2LY8A 4H9OB 3KWQA 3LJAB 3C1BD 4LD9C 5AV8A 5B32A 5FUGA 4H9NA 3WA9B 2JSSA 5B0YD 5B31G 1BH8A 3AZHA 4YS3C 5AV9A 4Z2MG 1HTAA 1P3GB 5GXQA 1HQ3C 1ID3B 2F8NK 5B24D 4DRAA 1P3KA 5CPKA 1F1EA 1JFIA 3LZ0C 3EPKA 3X1SC 1P3FA 4LD9B 5DNNA 3AN2D 4J8VC 3X1VD 2PYOA 3NQUA 1A7WA 5CHLB 3B0CW 2DF4C 3VH5W 1P34B 4KUDC 4Z66D 2RVQC 2DQNC 1KX3A 3AZJC 4YS3B 5GT3A 1ID3D 1P3BC 1HQ3B 5CP6C 3REHC 3WAAA 1N1JA 4KHAB 3KUYC 3EPHA 5BNXB 3AZMA 4J8VB 5E5AC 4KUDB 1ZLAD 3O62A 3W97A 5AY8D 5B2ID 4XUJC 3KXBC 3TU4D 2AROA 3MGRC 1P3BB 5CP6B 2BYMA 1M19A 4R8PB 3RELA 1KX4C 3A1KA 3LELA 2NZDD 5BT1D 5B2JB 4EO5B 4DQYB 3AFAD 3AYWC 5E5AB 3KSYA 1P3MC 2CV5C 1P3LA 3AZNC 2VQRA 3KXBB 3B0DC 3MGRB 3AZGB 3KWQC 5AV8C 3W96D 3AZEA 5B32C 4J8XA 1KX4B 4G92C 4JJND 4ZUXB 2F8NB 2ZY3A 3AZHC 3A6NB 4YM6A 5AV9C 3UTBA 1F66A 5BO0B 5JA4B 1P3MB 2CV5B 3AZKA 5GXQC 3AZNB 3AZGD 1TAFA 1P3KC 5CPKC 1ULYA 5CPID 3AV1D 5CPJA 1P3FC 3C1BA 1Z2CB 2PYOC 4G92B 3WTPC 3WKJD 1P3AD 3V9RB 5F99B 3AZHB 1EQZD 3IP4C 5GT3C 5B40C 3C1CB 3WAAC 1P3KB 5B24A 4J8WB 4WNNA 1BH9A 4H9RA 3WTPB 1Q9CA 3AN2A 1WWIA 3X1VA 1P3IA 3O62C 4Z66A 2NQBB 2AROC 5GT3B 2L5AA 5BS7A 3W99B 5B40B 5B1LD 4WU9D 2IO5B 1PZRA 3LELC 4J8WD 3AZFB 1M18D 3MNNB 3LZ1B 5KDMA 1P3OC 3UT9C 2FJ7A 3WTPE 3AV2A 4WU8D 1P3LC 2NQBD 3AZID 1ZLAA 5B31C 4E45A 3REIB 3R45B 5AY8A 5B2IA 1TZYA 5BNVB 5GT0D 3TU4A 3B0CT 4H9QB 3AZEC 2Y2QA 4XZQD 5AVCD 2HIOB 3MGSD 4J8XC 3AZFD 3LZ1D 4CAYB 3MGQA 4AWLB 1P3OB 3AFAA 3UT9B 2Y2MA 3UTBC 1P3PB 3AZKC 3REID 3REKC 1P3LB 3B6GA 5B31B 3AZLB 2HIOD 5B1MB 3C1BC 3W96A 4KGCD 1AOIA 2FFFB 3P5JB 4X23B 3UTBB 5AV5A 3X1TD 3REKB 3W98C 3AZLD 5AV6A 5B1MD 3MVDC 5CPIA 1S32D 3AV1A 3MGPA 3AN2C 5DNMD 5B33A 3X1UB 1P3IC 1WWSA 4X23D 3WKJA 3LJAD
chains in the Genus database with same CATH topology
1P3AA 4Z66C 2HUEC 3B6FB 1EQZA 4QLCC 3WA9D 4DRBA 3W98B 5GSUA 5AVBC 3MVDB 1P3GD 1U35C 4G91C 2FJ7C 3AV2C 4H9PB 1KX5C 2G5IC 4LD9D 1R4VA 3X1SB 3LZ0B 4QLCB 1TZYC 1P34D 4CSRA 2YFWB 5G49A 1M1AC 5B1LA 4YS3D 5AVBB 4WU9A 4J8UC 3AZJB 3MGQC 5KDMB 3UTAA 1HQ3D 1U35B 1M18A 3AFAC 2FJ7B 3REHB 3B6GC 1KX5B 3X1SD 2Y2PA 3LZ0D 4WU8A 3KUYB 4J8VD 2Y2IA 3AZIA 1TZYB 4Z5TA 4KUDD 3REJC 5GT0A 1M1AB 2BYKA 5JRGA 4NFTA 4XZQA 4XUJB 5AVCA 3MGSA 4J8UB 1P3BD 4HGAC 3MGQB 4UUZA 1AOIC 1H3OB 5CP6D 3REHD 4R8PD 5AV5C 2Y2HA 3KUYD 5B2JD 3B6GB 4WZSB 4E44A 5AV6C 5E5AD 2BG1A 4M6BA 5CPIC 3AYWB 3REJB 4XUJD 3AV1C 3KXBD 2YFVA 3MGPC 3MGRD 5B33C 4KGCA 3B0DB 5B0ZA 3KWQB 1EQZC 5AV8B 1KX4D 5DNNC 5B32B 5FUGB 4ZUXD 4H9NB 2F8ND 2ZY2A 3A6ND 3X1TA 1BH8B 5GSUC 5AV6B 3AYWD 4WJ3C 5B0YA 1KX3C 1P3MD 2CV5D 3NQJA 5AV9B 3AZND 1S32A 5GXQB 1T3UA 3KWQD 5CPKB 5DNMA 3H0LC 4H9OA 1JFIB 3H0MC 1P3FB 4ZBJC 5DNNB 3AZMC 2PYOB 3NQUB 5F99D 3WA9A 3AZHD 5B1LC 5GSUB 5AV9D 4WU9C 3W97C 1KX3B 3UTAC 3C1CD 1KU5A 1P3KD 1ID3A 3WAAB 1M19C 3RELC 1N1JB 1P3FD 2PYOD 2ZM5A 3AZIC 4Z5TC 2F8NH 3WTPD 3AZMB 1W2EA 5GT0C 1P34A 3O62B 3W97B 5JRGC 4XZQC 5GT3D 4YS3A 3W99D 2AROB 5B40D 1HQ3A 2BYMB 1M19B 3RELB 2Y2GA 3MNND 3LELB 2Y2KA 4KHAA 5BNXA 2NZDA 4J8VA 4YM6C 1F66C 4KUDA 2ZY5A 4KGCC 5B0ZC 1P3BA 5CPJC 3AZEB 4R8PA 4J8XB 5B2JA 1P3OD 3UT9D 4JJNA 5B0YC 4YM6B 1P3PD 5E5AA 1F66B 1P3LD 2XD1A 5B31D 3AZKB 1TAFB 3KXBA 5B24C 3AZGA 3AZED 4J8XD 5CPJB 3C1BB 1KX4A 3X1VC 3WA9C 4ZUXA 3B0BA 3UTBD 3A6NA 2Y2LA 5BO0A 5JA4A 3REKD 5BS7C 2CV5A 3AZNA 1ID3C 2W8SA 5B24B 4WNNB 1BH9B 4H9RB 3X1UD 3AN2B 3X1VB 1P34C 1P3IB 3V9RA 2XD5A 3B6FD 5F99A 1ZLAC 4Z66B 2HUEB 2Y2NA 5AY8C 5B2IC 3EPJA 3W98D 4NE5A 2ZY4A 3TU4C 3C1CA 3H0RC 4Z2MH 3MVDD 2NZDC 2RIQA 5BT1C 4J8WA 1P3ID 4G91B 2UWXA 3WTPA 3AV2B 4QLCD 1ZLAB 5AY8B 2NQBA 5B2IB 2JE5A 2G5HC 3W99A 3TU4B 5B40A 5AVBD 2RVQD 4R8PC 3W96C 3VH5A 3AZJD 1U35D 5B2JC 4EO5C 3AZFA 3MNNA 3LZ1A 4JJNC 2NZDB 2FJ7D 3AV2D 3AFAB 1KX5D 3FDDA 1TZYD 3REIA 3R45A 3VH6W 3AZGC 5BNVA 1M1AD 2J8PA 4H9QA 2HIOA 4J8UD 3W96B 3MGQD 4ZUXC 4CAYA 1AOIB 3WKJC 4HGAB 4JJNB 3A6NC 1P3AC 1P3OA 3VH6A 3UT9A 3B6GD 5AV5B 1P3PA 5B31A 2JCHA 4H9SA 3REJD 3AZLA 4WV4B 5CPIB 5B1MA 3AV1B 1AOID 2F2AC 3MGPB 5B33B 2CWEA 5F99C 3WKJB 4NE6A 1P3AB 5AV8D 5AV5D 4X23A 5B32D 3LJAA 1EQZB 3REKA 3A1IA 5AV6D 2Y2OA 3C1CC 3EG5B 3EPLA 3AL0C 5GXQD 4J8WC 3MGPD 1M18C 5B33D 1P3GA 5CPKD 3X1UA 2F8NG 3F6TA 4WU8C 3B6FA 5DNND 2NQBC 4LD9A 4ZBJB 3W99C 4CSRB 3KFUG 5GSUD 3W98A 2IO5C 1KX3D 5G49B 5B1LB 4WU9B 5AVCC 3MVDA 3MGSC 3AZFC 3MNNC 3LZ1C 3UTAB 1M18B 5B32G 3WAAD 5C3IC 4H9PA 1BFMA 4WU8B 3REIC 3AZMD 3X1SA 3LZ0A 4QLCA 3AZIB 4Z5TB 3O62D 3W97D 5GT0B 2YFWA 2HIOC 5AVBA 2BYKB 5JRGB 2AROD 3UTAD 4XZQB 5AVCB 3MGSB 3AZJA 1U35A 4UUZB 4AWLC 1M19D 4NE3A 3RELD 5CP6A 2Y2JA 3LELD 3REHA 5C3IB 1P3PC 1KX5A 4Z5TD 3X1TC 3KUYA 4H9SC 3AZLC 3VH5T 5B1MC 5JRGD 1M1AA 1S32C 2YFVB 4UPKA 1B6WA 4XUJA 4J8UA 4KGCB 5DNMC 3MGRA 5B0ZB 1H3OA 4X23C 3LJAC 3X1TB 2F8NA 4YM6D 1F66D 5B0YB 3AYWA 3NQJB 3REJA 3AZKD 1P3MA 1S32B 1B67A 1P3GC 3X1UC 3VH6T 5B0ZD 5DNMB 5CPJD 3B6FC 2LY8A 4H9OB 3KWQA 3LJAB 3C1BD 4LD9C 5AV8A 5B32A 5FUGA 4H9NA 3WA9B 2JSSA 5B0YD 5B31G 1BH8A 3AZHA 4YS3C 5AV9A 4Z2MG 1HTAA 1P3GB 5GXQA 1HQ3C 1ID3B 2F8NK 5B24D 4DRAA 1P3KA 5CPKA 1F1EA 1JFIA 3LZ0C 3EPKA 3X1SC 1P3FA 4LD9B 5DNNA 3AN2D 4J8VC 3X1VD 2PYOA 3NQUA 1A7WA 5CHLB 3B0CW 2DF4C 3VH5W 1P34B 4KUDC 4Z66D 2RVQC 2DQNC 1KX3A 3AZJC 4YS3B 5GT3A 1ID3D 1P3BC 1HQ3B 5CP6C 3REHC 3WAAA 1N1JA 4KHAB 3KUYC 3EPHA 5BNXB 3AZMA 4J8VB 5E5AC 4KUDB 1ZLAD 3O62A 3W97A 5AY8D 5B2ID 4XUJC 3KXBC 3TU4D 2AROA 3MGRC 1P3BB 5CP6B 2BYMA 1M19A 4R8PB 3RELA 1KX4C 3A1KA 3LELA 2NZDD 5BT1D 5B2JB 4EO5B 4DQYB 3AFAD 3AYWC 5E5AB 3KSYA 1P3MC 2CV5C 1P3LA 3AZNC 2VQRA 3KXBB 3B0DC 3MGRB 3AZGB 3KWQC 5AV8C 3W96D 3AZEA 5B32C 4J8XA 1KX4B 4G92C 4JJND 4ZUXB 2F8NB 2ZY3A 3AZHC 3A6NB 4YM6A 5AV9C 3UTBA 1F66A 5BO0B 5JA4B 1P3MB 2CV5B 3AZKA 5GXQC 3AZNB 3AZGD 1TAFA 1P3KC 5CPKC 1ULYA 5CPID 3AV1D 5CPJA 1P3FC 3C1BA 1Z2CB 2PYOC 4G92B 3WTPC 3WKJD 1P3AD 3V9RB 5F99B 3AZHB 1EQZD 3IP4C 5GT3C 5B40C 3C1CB 3WAAC 1P3KB 5B24A 4J8WB 4WNNA 1BH9A 4H9RA 3WTPB 1Q9CA 3AN2A 1WWIA 3X1VA 1P3IA 3O62C 4Z66A 2NQBB 2AROC 5GT3B 2L5AA 5BS7A 3W99B 5B40B 5B1LD 4WU9D 2IO5B 1PZRA 3LELC 4J8WD 3AZFB 1M18D 3MNNB 3LZ1B 5KDMA 1P3OC 3UT9C 2FJ7A 3WTPE 3AV2A 4WU8D 1P3LC 2NQBD 3AZID 1ZLAA 5B31C 4E45A 3REIB 3R45B 5AY8A 5B2IA 1TZYA 5BNVB 5GT0D 3TU4A 3B0CT 4H9QB 3AZEC 2Y2QA 4XZQD 5AVCD 2HIOB 3MGSD 4J8XC 3AZFD 3LZ1D 4CAYB 3MGQA 4AWLB 1P3OB 3AFAA 3UT9B 2Y2MA 3UTBC 1P3PB 3AZKC 3REID 3REKC 1P3LB 3B6GA 5B31B 3AZLB 2HIOD 5B1MB 3C1BC 3W96A 4KGCD 1AOIA 2FFFB 3P5JB 4X23B 3UTBB 5AV5A 3X1TD 3REKB 3W98C 3AZLD 5AV6A 5B1MD 3MVDC 5CPIA 1S32D 3AV1A 3MGPA 3AN2C 5DNMD 5B33A 3X1UB 1P3IC 1WWSA 4X23D 3WKJA 3LJAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A A;  4Z66 C;  2HUE C;  3B6F B;  1EQZ A;  4QLC C;  3WA9 D;  4DRB A;  3W98 B;  5GSU A;  5AVB C;  3MVD B;  1P3G D;  1U35 C;  4G91 C;  2FJ7 C;  3AV2 C;  4H9P B;  1KX5 C;  4LD9 D;  1R4V A;  3X1S B;  3LZ0 B;  4QLC B;  1TZY C;  1P34 D;  4CSR A;  2YFW B;  5G49 A;  1M1A C;  5B1L A;  4YS3 D;  5AVB B;  4WU9 A;  4J8U C;  3AZJ B;  3MGQ C;  5KDM B;  3UTA A;  1HQ3 D;  1U35 B;  1M18 A;  3AFA C;  2FJ7 B;  3REH B;  3B6G C;  1KX5 B;  3X1S D;  3LZ0 D;  4WU8 A;  3KUY B;  4J8V D;  3AZI A;  1TZY B;  4Z5T A;  4KUD D;  3REJ C;  5GT0 A;  1M1A B;  2BYK A;  5JRG A;  4NFT A;  4XZQ A;  4XUJ B;  5AVC A;  3MGS A;  4J8U B;  1P3B D;  4HGA C;  3MGQ B;  4UUZ A;  1AOI C;  1H3O B;  5CP6 D;  3REH D;  4R8P D;  5AV5 C;  3KUY D;  5B2J D;  3B6G B;  4WZS B;  4E44 A;  5AV6 C;  5E5A D;  4M6B A;  5CPI C;  3AYW B;  3REJ B;  4XUJ D;  3AV1 C;  3KXB D;  2YFV A;  3MGP C;  3MGR D;  5B33 C;  4KGC A;  3B0D B;  5B0Z A;  3KWQ B;  1EQZ C;  5AV8 B;  1KX4 D;  5DNN C;  5B32 B;  5FUG B;  4ZUX D;  4H9N B;  2F8N D;  3X1T A;  3A6N D;  1BH8 B;  5GSU C;  5AV6 B;  3AYW D;  5B0Y A;  1KX3 C;  1P3M D;  2CV5 D;  3NQJ A;  5AV9 B;  3AZN D;  1S32 A;  5GXQ B;  3KWQ D;  5CPK B;  5DNM A;  4H9O A;  1JFI B;  1P3F B;  4ZBJ C;  5DNN B;  3AZM C;  2PYO B;  3NQU B;  5F99 D;  3WA9 A;  3AZH D;  5B1L C;  5GSU B;  5AV9 D;  4WU9 C;  3W97 C;  1KX3 B;  3UTA C;  3C1C D;  1KU5 A;  1P3K D;  1ID3 A;  3WAA B;  1M19 C;  3REL C;  1N1J B;  1P3F D;  2PYO D;  3AZI C;  4Z5T C;  2F8N H;  3WTP D;  3AZM B;  5GT0 C;  1P34 A;  3O62 B;  3W97 B;  5JRG C;  4XZQ C;  5GT3 D;  4YS3 A;  3W99 D;  2ARO B;  5B40 D;  1HQ3 A;  2BYM B;  1M19 B;  3REL B;  3MNN D;  3LEL B;  4KHA A;  5BNX A;  2NZD A;  4J8V A;  4YM6 C;  1F66 C;  4KUD A;  4KGC C;  5B0Z C;  1P3B A;  5CPJ C;  3AZE B;  4R8P A;  4J8X B;  5B2J A;  1P3O D;  3UT9 D;  4JJN A;  5B0Y C;  4YM6 B;  1P3P D;  5E5A A;  1F66 B;  1P3L D;  5B31 D;  3AZK B;  1TAF B;  3KXB A;  5B24 C;  3AZG A;  3AZE D;  4J8X D;  5CPJ B;  3C1B B;  1KX4 A;  3X1V C;  3WA9 C;  4ZUX A;  3B0B A;  3UTB D;  3A6N A;  5BO0 A;  5JA4 A;  3REK D;  5BS7 C;  2CV5 A;  3AZN A;  1ID3 C;  5B24 B;  4WNN B;  1BH9 B;  4H9R B;  3X1U D;  3AN2 B;  3X1V B;  1P34 C;  1P3I B;  3V9R A;  3B6F D;  5F99 A;  1ZLA C;  4Z66 B;  2HUE B;  5AY8 C;  5B2I C;  3W98 D;  4NE5 A;  3TU4 C;  3C1C A;  4Z2M H;  3MVD D;  2NZD C;  5BT1 C;  4J8W A;  1P3I D;  4G91 B;  3WTP A;  3AV2 B;  4QLC D;  1ZLA B;  5AY8 B;  2NQB A;  5B2I B;  3W99 A;  3TU4 B;  5B40 A;  5AVB D;  2RVQ D;  4R8P C;  3W96 C;  3VH5 A;  3AZJ D;  1U35 D;  5B2J C;  4EO5 C;  3AZF A;  3MNN A;  3LZ1 A;  4JJN C;  2NZD B;  2FJ7 D;  3AV2 D;  3AFA B;  1KX5 D;  1TZY D;  3REI A;  3R45 A;  3VH6 W;  3AZG C;  5BNV A;  1M1A D;  4H9Q A;  2HIO A;  4J8U D;  3W96 B;  3MGQ D;  4ZUX C;  4CAY A;  1AOI B;  3WKJ C;  4HGA B;  4JJN B;  3A6N C;  1P3A C;  1P3O A;  3VH6 A;  3UT9 A;  3B6G D;  5AV5 B;  1P3P A;  5B31 A;  4H9S A;  3REJ D;  3AZL A;  4WV4 B;  5CPI B;  5B1M A;  3AV1 B;  1AOI D;  3MGP B;  5B33 B;  2CWE A;  5F99 C;  3WKJ B;  4NE6 A;  1P3A B;  5AV8 D;  5AV5 D;  4X23 A;  5B32 D;  3LJA A;  1EQZ B;  3REK A;  5AV6 D;  3C1C C;  5GXQ D;  4J8W C;  3MGP D;  1M18 C;  5B33 D;  1P3G A;  5CPK D;  3X1U A;  2F8N G;  4WU8 C;  3B6F A;  5DNN D;  2NQB C;  4LD9 A;  4ZBJ B;  3W99 C;  4CSR B;  5GSU D;  3W98 A;  2IO5 C;  1KX3 D;  5G49 B;  5B1L B;  4WU9 B;  5AVC C;  3MVD A;  3MGS C;  3AZF C;  3MNN C;  3LZ1 C;  3UTA B;  1M18 B;  5B32 G;  3WAA D;  5C3I C;  4H9P A;  1BFM A;  4WU8 B;  3REI C;  3AZM D;  3X1S A;  3LZ0 A;  4QLC A;  3AZI B;  4Z5T B;  3O62 D;  3W97 D;  5GT0 B;  2YFW A;  2HIO C;  2BYK B;  5AVB A;  5JRG B;  2ARO D;  3UTA D;  4XZQ B;  5AVC B;  3MGS B;  3AZJ A;  1U35 A;  4UUZ B;  4AWL C;  1M19 D;  4NE3 A;  3REL D;  5CP6 A;  3REH A;  3LEL D;  1P3P C;  5C3I B;  1KX5 A;  4Z5T D;  3X1T C;  3KUY A;  4H9S C;  3AZL C;  3VH5 T;  5B1M C;  5JRG D;  1M1A A;  1S32 C;  2YFV B;  1B6W A;  4XUJ A;  4J8U A;  4KGC B;  5DNM C;  3MGR A;  5B0Z B;  1H3O A;  4X23 C;  3LJA C;  3X1T B;  2F8N A;  4YM6 D;  1F66 D;  5B0Y B;  3AYW A;  3NQJ B;  3REJ A;  3AZK D;  1P3M A;  1S32 B;  1B67 A;  1P3G C;  3X1U C;  3VH6 T;  5B0Z D;  5DNM B;  5CPJ D;  3B6F C;  2LY8 A;  4H9O B;  3KWQ A;  3LJA B;  3C1B D;  4LD9 C;  5AV8 A;  5B32 A;  5FUG A;  4H9N A;  3WA9 B;  2JSS A;  5B0Y D;  5B31 G;  1BH8 A;  3AZH A;  4YS3 C;  5AV9 A;  4Z2M G;  1HTA A;  1P3G B;  5GXQ A;  1HQ3 C;  1ID3 B;  2F8N K;  5B24 D;  4DRA A;  1P3K A;  5CPK A;  1F1E A;  1JFI A;  3LZ0 C;  3X1S C;  4LD9 B;  1P3F A;  5DNN A;  3AN2 D;  4J8V C;  3X1V D;  2PYO A;  3NQU A;  1A7W A;  5CHL B;  3B0C W;  3VH5 W;  1P34 B;  4KUD C;  4Z66 D;  2RVQ C;  1KX3 A;  3AZJ C;  4YS3 B;  5GT3 A;  1ID3 D;  1P3B C;  1HQ3 B;  5CP6 C;  3REH C;  3WAA A;  1N1J A;  4KHA B;  3KUY C;  5BNX B;  3AZM A;  4J8V B;  5E5A C;  4KUD B;  1ZLA D;  3O62 A;  3W97 A;  5AY8 D;  5B2I D;  4XUJ C;  3KXB C;  3TU4 D;  2ARO A;  3MGR C;  1P3B B;  5CP6 B;  2BYM A;  1M19 A;  4R8P B;  3REL A;  1KX4 C;  3LEL A;  2NZD D;  5BT1 D;  5B2J B;  4EO5 B;  3AFA D;  3AYW C;  5E5A B;  3KSY A;  1P3M C;  2CV5 C;  1P3L A;  3AZN C;  3KXB B;  3B0D C;  3MGR B;  3AZG B;  3KWQ C;  5AV8 C;  3W96 D;  3AZE A;  5B32 C;  4J8X A;  1KX4 B;  4G92 C;  4JJN D;  4ZUX B;  2F8N B;  3AZH C;  3A6N B;  4YM6 A;  5AV9 C;  3UTB A;  1F66 A;  5BO0 B;  5JA4 B;  1P3M B;  2CV5 B;  3AZK A;  5GXQ C;  3AZN B;  3AZG D;  1TAF A;  1P3K C;  5CPK C;  1ULY A;  5CPI D;  3AV1 D;  5CPJ A;  1P3F C;  3C1B A;  2PYO C;  4G92 B;  3WTP C;  3WKJ D;  1P3A D;  3V9R B;  5F99 B;  3AZH B;  1EQZ D;  5GT3 C;  5B40 C;  3C1C B;  3WAA C;  1P3K B;  5B24 A;  4J8W B;  4WNN A;  1BH9 A;  4H9R A;  3WTP B;  1Q9C A;  3AN2 A;  1WWI A;  3X1V A;  1P3I A;  3O62 C;  4Z66 A;  2NQB B;  2ARO C;  5GT3 B;  2L5A A;  5BS7 A;  3W99 B;  5B40 B;  5B1L D;  4WU9 D;  2IO5 B;  3LEL C;  4J8W D;  3AZF B;  1M18 D;  3MNN B;  3LZ1 B;  5KDM A;  1P3O C;  3UT9 C;  2FJ7 A;  3WTP E;  3AV2 A;  4WU8 D;  1P3L C;  2NQB D;  3AZI D;  1ZLA A;  5B31 C;  4E45 A;  3REI B;  3R45 B;  5AY8 A;  5B2I A;  1TZY A;  5BNV B;  5GT0 D;  3TU4 A;  3B0C T;  4H9Q B;  3AZE C;  4XZQ D;  5AVC D;  2HIO B;  3MGS D;  4J8X C;  3AZF D;  3LZ1 D;  4CAY B;  3MGQ A;  4AWL B;  1P3O B;  3AFA A;  3UT9 B;  3UTB C;  1P3P B;  3AZK C;  3REI D;  3REK C;  1P3L B;  3B6G A;  5B31 B;  3AZL B;  2HIO D;  5B1M B;  3C1B C;  3W96 A;  4KGC D;  1AOI A;  4X23 B;  3UTB B;  5AV5 A;  3X1T D;  3REK B;  3W98 C;  3AZL D;  5AV6 A;  5B1M D;  3MVD C;  5CPI A;  1S32 D;  3AV1 A;  3MGP A;  3AN2 C;  5DNM D;  5B33 A;  3X1U B;  1P3I C;  1WWS A;  4X23 D;  3WKJ A;  3LJA D; 
#chains in the Genus database with same CATH topology
 1P3A A;  4Z66 C;  2HUE C;  3B6F B;  1EQZ A;  4QLC C;  3WA9 D;  4DRB A;  3W98 B;  5GSU A;  5AVB C;  3MVD B;  1P3G D;  1U35 C;  4G91 C;  2FJ7 C;  3AV2 C;  4H9P B;  1KX5 C;  2G5I C;  4LD9 D;  1R4V A;  3X1S B;  3LZ0 B;  4QLC B;  1TZY C;  1P34 D;  4CSR A;  2YFW B;  5G49 A;  1M1A C;  5B1L A;  4YS3 D;  5AVB B;  4WU9 A;  4J8U C;  3AZJ B;  3MGQ C;  5KDM B;  3UTA A;  1HQ3 D;  1U35 B;  1M18 A;  3AFA C;  2FJ7 B;  3REH B;  3B6G C;  1KX5 B;  3X1S D;  2Y2P A;  3LZ0 D;  4WU8 A;  3KUY B;  4J8V D;  2Y2I A;  3AZI A;  1TZY B;  4Z5T A;  4KUD D;  3REJ C;  5GT0 A;  1M1A B;  2BYK A;  5JRG A;  4NFT A;  4XZQ A;  4XUJ B;  5AVC A;  3MGS A;  4J8U B;  1P3B D;  4HGA C;  3MGQ B;  4UUZ A;  1AOI C;  1H3O B;  5CP6 D;  3REH D;  4R8P D;  5AV5 C;  2Y2H A;  3KUY D;  5B2J D;  3B6G B;  4WZS B;  4E44 A;  5AV6 C;  5E5A D;  2BG1 A;  4M6B A;  5CPI C;  3AYW B;  3REJ B;  4XUJ D;  3AV1 C;  3KXB D;  2YFV A;  3MGP C;  3MGR D;  5B33 C;  4KGC A;  3B0D B;  5B0Z A;  3KWQ B;  1EQZ C;  5AV8 B;  1KX4 D;  5DNN C;  5B32 B;  5FUG B;  4ZUX D;  4H9N B;  2F8N D;  2ZY2 A;  3A6N D;  3X1T A;  1BH8 B;  5GSU C;  5AV6 B;  3AYW D;  4WJ3 C;  5B0Y A;  1KX3 C;  1P3M D;  2CV5 D;  3NQJ A;  5AV9 B;  3AZN D;  1S32 A;  5GXQ B;  1T3U A;  3KWQ D;  5CPK B;  5DNM A;  3H0L C;  4H9O A;  1JFI B;  3H0M C;  1P3F B;  4ZBJ C;  5DNN B;  3AZM C;  2PYO B;  3NQU B;  5F99 D;  3WA9 A;  3AZH D;  5B1L C;  5GSU B;  5AV9 D;  4WU9 C;  3W97 C;  1KX3 B;  3UTA C;  3C1C D;  1KU5 A;  1P3K D;  1ID3 A;  3WAA B;  1M19 C;  3REL C;  1N1J B;  1P3F D;  2PYO D;  2ZM5 A;  3AZI C;  4Z5T C;  2F8N H;  3WTP D;  3AZM B;  1W2E A;  5GT0 C;  1P34 A;  3O62 B;  3W97 B;  5JRG C;  4XZQ C;  5GT3 D;  4YS3 A;  3W99 D;  2ARO B;  5B40 D;  1HQ3 A;  2BYM B;  1M19 B;  3REL B;  2Y2G A;  3MNN D;  3LEL B;  2Y2K A;  4KHA A;  5BNX A;  2NZD A;  4J8V A;  4YM6 C;  1F66 C;  4KUD A;  2ZY5 A;  4KGC C;  5B0Z C;  1P3B A;  5CPJ C;  3AZE B;  4R8P A;  4J8X B;  5B2J A;  1P3O D;  3UT9 D;  4JJN A;  5B0Y C;  4YM6 B;  1P3P D;  5E5A A;  1F66 B;  1P3L D;  2XD1 A;  5B31 D;  3AZK B;  1TAF B;  3KXB A;  5B24 C;  3AZG A;  3AZE D;  4J8X D;  5CPJ B;  3C1B B;  1KX4 A;  3X1V C;  3WA9 C;  4ZUX A;  3B0B A;  3UTB D;  3A6N A;  2Y2L A;  5BO0 A;  5JA4 A;  3REK D;  5BS7 C;  2CV5 A;  3AZN A;  1ID3 C;  2W8S A;  5B24 B;  4WNN B;  1BH9 B;  4H9R B;  3X1U D;  3AN2 B;  3X1V B;  1P34 C;  1P3I B;  3V9R A;  2XD5 A;  3B6F D;  5F99 A;  1ZLA C;  4Z66 B;  2HUE B;  2Y2N A;  5AY8 C;  5B2I C;  3EPJ A;  3W98 D;  4NE5 A;  2ZY4 A;  3TU4 C;  3C1C A;  3H0R C;  4Z2M H;  3MVD D;  2NZD C;  2RIQ A;  5BT1 C;  4J8W A;  1P3I D;  4G91 B;  2UWX A;  3WTP A;  3AV2 B;  4QLC D;  1ZLA B;  5AY8 B;  2NQB A;  5B2I B;  2JE5 A;  2G5H C;  3W99 A;  3TU4 B;  5B40 A;  5AVB D;  2RVQ D;  4R8P C;  3W96 C;  3VH5 A;  3AZJ D;  1U35 D;  5B2J C;  4EO5 C;  3AZF A;  3MNN A;  3LZ1 A;  4JJN C;  2NZD B;  2FJ7 D;  3AV2 D;  3AFA B;  1KX5 D;  3FDD A;  1TZY D;  3REI A;  3R45 A;  3VH6 W;  3AZG C;  5BNV A;  1M1A D;  2J8P A;  4H9Q A;  2HIO A;  4J8U D;  3W96 B;  3MGQ D;  4ZUX C;  4CAY A;  1AOI B;  3WKJ C;  4HGA B;  4JJN B;  3A6N C;  1P3A C;  1P3O A;  3VH6 A;  3UT9 A;  3B6G D;  5AV5 B;  1P3P A;  5B31 A;  2JCH A;  4H9S A;  3REJ D;  3AZL A;  4WV4 B;  5CPI B;  5B1M A;  3AV1 B;  1AOI D;  2F2A C;  3MGP B;  5B33 B;  2CWE A;  5F99 C;  3WKJ B;  4NE6 A;  1P3A B;  5AV8 D;  5AV5 D;  4X23 A;  5B32 D;  3LJA A;  1EQZ B;  3REK A;  3A1I A;  5AV6 D;  2Y2O A;  3C1C C;  3EG5 B;  3EPL A;  3AL0 C;  5GXQ D;  4J8W C;  3MGP D;  1M18 C;  5B33 D;  1P3G A;  5CPK D;  3X1U A;  2F8N G;  3F6T A;  4WU8 C;  3B6F A;  5DNN D;  2NQB C;  4LD9 A;  4ZBJ B;  3W99 C;  4CSR B;  3KFU G;  5GSU D;  3W98 A;  2IO5 C;  1KX3 D;  5G49 B;  5B1L B;  4WU9 B;  5AVC C;  3MVD A;  3MGS C;  3AZF C;  3MNN C;  3LZ1 C;  3UTA B;  1M18 B;  5B32 G;  3WAA D;  5C3I C;  4H9P A;  1BFM A;  4WU8 B;  3REI C;  3AZM D;  3X1S A;  3LZ0 A;  4QLC A;  3AZI B;  4Z5T B;  3O62 D;  3W97 D;  5GT0 B;  2YFW A;  2HIO C;  5AVB A;  2BYK B;  5JRG B;  2ARO D;  3UTA D;  4XZQ B;  5AVC B;  3MGS B;  3AZJ A;  1U35 A;  4UUZ B;  4AWL C;  1M19 D;  4NE3 A;  3REL D;  5CP6 A;  2Y2J A;  3LEL D;  3REH A;  5C3I B;  1P3P C;  1KX5 A;  4Z5T D;  3X1T C;  3KUY A;  4H9S C;  3AZL C;  3VH5 T;  5B1M C;  5JRG D;  1M1A A;  1S32 C;  2YFV B;  4UPK A;  1B6W A;  4XUJ A;  4J8U A;  4KGC B;  5DNM C;  3MGR A;  5B0Z B;  1H3O A;  4X23 C;  3LJA C;  3X1T B;  2F8N A;  4YM6 D;  1F66 D;  5B0Y B;  3AYW A;  3NQJ B;  3REJ A;  3AZK D;  1P3M A;  1S32 B;  1B67 A;  1P3G C;  3X1U C;  3VH6 T;  5B0Z D;  5DNM B;  5CPJ D;  3B6F C;  2LY8 A;  4H9O B;  3KWQ A;  3LJA B;  3C1B D;  4LD9 C;  5AV8 A;  5B32 A;  5FUG A;  4H9N A;  3WA9 B;  2JSS A;  5B0Y D;  5B31 G;  1BH8 A;  3AZH A;  4YS3 C;  5AV9 A;  4Z2M G;  1HTA A;  1P3G B;  5GXQ A;  1HQ3 C;  1ID3 B;  2F8N K;  5B24 D;  4DRA A;  1P3K A;  5CPK A;  1F1E A;  1JFI A;  3LZ0 C;  3EPK A;  3X1S C;  1P3F A;  4LD9 B;  5DNN A;  3AN2 D;  4J8V C;  3X1V D;  2PYO A;  3NQU A;  1A7W A;  5CHL B;  3B0C W;  2DF4 C;  3VH5 W;  1P34 B;  4KUD C;  4Z66 D;  2RVQ C;  2DQN C;  1KX3 A;  3AZJ C;  4YS3 B;  5GT3 A;  1ID3 D;  1P3B C;  1HQ3 B;  5CP6 C;  3REH C;  3WAA A;  1N1J A;  4KHA B;  3KUY C;  3EPH A;  5BNX B;  3AZM A;  4J8V B;  5E5A C;  4KUD B;  1ZLA D;  3O62 A;  3W97 A;  5AY8 D;  5B2I D;  4XUJ C;  3KXB C;  3TU4 D;  2ARO A;  3MGR C;  1P3B B;  5CP6 B;  2BYM A;  1M19 A;  4R8P B;  3REL A;  1KX4 C;  3A1K A;  3LEL A;  2NZD D;  5BT1 D;  5B2J B;  4EO5 B;  4DQY B;  3AFA D;  3AYW C;  5E5A B;  3KSY A;  1P3M C;  2CV5 C;  1P3L A;  3AZN C;  2VQR A;  3KXB B;  3B0D C;  3MGR B;  3AZG B;  3KWQ C;  5AV8 C;  3W96 D;  3AZE A;  5B32 C;  4J8X A;  1KX4 B;  4G92 C;  4JJN D;  4ZUX B;  2F8N B;  2ZY3 A;  3AZH C;  3A6N B;  4YM6 A;  5AV9 C;  3UTB A;  1F66 A;  5BO0 B;  5JA4 B;  1P3M B;  2CV5 B;  3AZK A;  5GXQ C;  3AZN B;  3AZG D;  1TAF A;  1P3K C;  5CPK C;  1ULY A;  5CPI D;  3AV1 D;  5CPJ A;  1P3F C;  3C1B A;  1Z2C B;  2PYO C;  4G92 B;  3WTP C;  3WKJ D;  1P3A D;  3V9R B;  5F99 B;  3AZH B;  1EQZ D;  3IP4 C;  5GT3 C;  5B40 C;  3C1C B;  3WAA C;  1P3K B;  5B24 A;  4J8W B;  4WNN A;  1BH9 A;  4H9R A;  3WTP B;  1Q9C A;  3AN2 A;  1WWI A;  3X1V A;  1P3I A;  3O62 C;  4Z66 A;  2NQB B;  2ARO C;  5GT3 B;  2L5A A;  5BS7 A;  3W99 B;  5B40 B;  5B1L D;  4WU9 D;  2IO5 B;  1PZR A;  3LEL C;  4J8W D;  3AZF B;  1M18 D;  3MNN B;  3LZ1 B;  5KDM A;  1P3O C;  3UT9 C;  2FJ7 A;  3WTP E;  3AV2 A;  4WU8 D;  1P3L C;  2NQB D;  3AZI D;  1ZLA A;  5B31 C;  4E45 A;  3REI B;  3R45 B;  5AY8 A;  5B2I A;  1TZY A;  5BNV B;  5GT0 D;  3TU4 A;  3B0C T;  4H9Q B;  3AZE C;  2Y2Q A;  4XZQ D;  5AVC D;  2HIO B;  3MGS D;  4J8X C;  3AZF D;  3LZ1 D;  4CAY B;  3MGQ A;  4AWL B;  1P3O B;  3AFA A;  3UT9 B;  2Y2M A;  3UTB C;  1P3P B;  3AZK C;  3REI D;  3REK C;  1P3L B;  3B6G A;  5B31 B;  3AZL B;  2HIO D;  5B1M B;  3C1B C;  3W96 A;  4KGC D;  1AOI A;  2FFF B;  3P5J B;  4X23 B;  3UTB B;  5AV5 A;  3X1T D;  3REK B;  3W98 C;  3AZL D;  5AV6 A;  5B1M D;  3MVD C;  5CPI A;  1S32 D;  3AV1 A;  3MGP A;  3AN2 C;  5DNM D;  5B33 A;  3X1U B;  1P3I C;  1WWS A;  4X23 D;  3WKJ A;  3LJA D; 
#chains in the Genus database with same CATH homology
 1P3A A;  4Z66 C;  2HUE C;  3B6F B;  1EQZ A;  4QLC C;  3WA9 D;  4DRB A;  3W98 B;  5GSU A;  5AVB C;  3MVD B;  1P3G D;  1U35 C;  4G91 C;  2FJ7 C;  3AV2 C;  4H9P B;  1KX5 C;  2G5I C;  4LD9 D;  1R4V A;  3X1S B;  3LZ0 B;  4QLC B;  1TZY C;  1P34 D;  4CSR A;  2YFW B;  5G49 A;  1M1A C;  5B1L A;  4YS3 D;  5AVB B;  4WU9 A;  4J8U C;  3AZJ B;  3MGQ C;  5KDM B;  3UTA A;  1HQ3 D;  1U35 B;  1M18 A;  3AFA C;  2FJ7 B;  3REH B;  3B6G C;  1KX5 B;  3X1S D;  2Y2P A;  3LZ0 D;  4WU8 A;  3KUY B;  4J8V D;  2Y2I A;  3AZI A;  1TZY B;  4Z5T A;  4KUD D;  3REJ C;  5GT0 A;  1M1A B;  2BYK A;  5JRG A;  4NFT A;  4XZQ A;  4XUJ B;  5AVC A;  3MGS A;  4J8U B;  1P3B D;  4HGA C;  3MGQ B;  4UUZ A;  1AOI C;  1H3O B;  5CP6 D;  3REH D;  4R8P D;  5AV5 C;  2Y2H A;  3KUY D;  5B2J D;  3B6G B;  4WZS B;  4E44 A;  5AV6 C;  5E5A D;  2BG1 A;  4M6B A;  5CPI C;  3AYW B;  3REJ B;  4XUJ D;  3AV1 C;  3KXB D;  2YFV A;  3MGP C;  3MGR D;  5B33 C;  4KGC A;  3B0D B;  5B0Z A;  3KWQ B;  1EQZ C;  5AV8 B;  1KX4 D;  5DNN C;  5B32 B;  5FUG B;  4ZUX D;  4H9N B;  2F8N D;  2ZY2 A;  3A6N D;  3X1T A;  1BH8 B;  5GSU C;  5AV6 B;  3AYW D;  4WJ3 C;  5B0Y A;  1KX3 C;  1P3M D;  2CV5 D;  3NQJ A;  5AV9 B;  3AZN D;  1S32 A;  5GXQ B;  1T3U A;  3KWQ D;  5CPK B;  5DNM A;  3H0L C;  4H9O A;  1JFI B;  3H0M C;  1P3F B;  4ZBJ C;  5DNN B;  3AZM C;  2PYO B;  3NQU B;  5F99 D;  3WA9 A;  3AZH D;  5B1L C;  5GSU B;  5AV9 D;  4WU9 C;  3W97 C;  1KX3 B;  3UTA C;  3C1C D;  1KU5 A;  1P3K D;  1ID3 A;  3WAA B;  1M19 C;  3REL C;  1N1J B;  1P3F D;  2PYO D;  2ZM5 A;  3AZI C;  4Z5T C;  2F8N H;  3WTP D;  3AZM B;  1W2E A;  5GT0 C;  1P34 A;  3O62 B;  3W97 B;  5JRG C;  4XZQ C;  5GT3 D;  4YS3 A;  3W99 D;  2ARO B;  5B40 D;  1HQ3 A;  2BYM B;  1M19 B;  3REL B;  2Y2G A;  3MNN D;  3LEL B;  2Y2K A;  4KHA A;  5BNX A;  2NZD A;  4J8V A;  4YM6 C;  1F66 C;  4KUD A;  2ZY5 A;  4KGC C;  5B0Z C;  1P3B A;  5CPJ C;  3AZE B;  4R8P A;  4J8X B;  5B2J A;  1P3O D;  3UT9 D;  4JJN A;  5B0Y C;  4YM6 B;  1P3P D;  5E5A A;  1F66 B;  1P3L D;  2XD1 A;  5B31 D;  3AZK B;  1TAF B;  3KXB A;  5B24 C;  3AZG A;  3AZE D;  4J8X D;  5CPJ B;  3C1B B;  1KX4 A;  3X1V C;  3WA9 C;  4ZUX A;  3B0B A;  3UTB D;  3A6N A;  2Y2L A;  5BO0 A;  5JA4 A;  3REK D;  5BS7 C;  2CV5 A;  3AZN A;  1ID3 C;  2W8S A;  5B24 B;  4WNN B;  1BH9 B;  4H9R B;  3X1U D;  3AN2 B;  3X1V B;  1P34 C;  1P3I B;  3V9R A;  2XD5 A;  3B6F D;  5F99 A;  1ZLA C;  4Z66 B;  2HUE B;  2Y2N A;  5AY8 C;  5B2I C;  3EPJ A;  3W98 D;  4NE5 A;  2ZY4 A;  3TU4 C;  3C1C A;  3H0R C;  4Z2M H;  3MVD D;  2NZD C;  2RIQ A;  5BT1 C;  4J8W A;  1P3I D;  4G91 B;  2UWX A;  3WTP A;  3AV2 B;  4QLC D;  1ZLA B;  5AY8 B;  2NQB A;  5B2I B;  2JE5 A;  2G5H C;  3W99 A;  3TU4 B;  5B40 A;  5AVB D;  2RVQ D;  4R8P C;  3W96 C;  3VH5 A;  3AZJ D;  1U35 D;  5B2J C;  4EO5 C;  3AZF A;  3MNN A;  3LZ1 A;  4JJN C;  2NZD B;  2FJ7 D;  3AV2 D;  3AFA B;  1KX5 D;  3FDD A;  1TZY D;  3REI A;  3R45 A;  3VH6 W;  3AZG C;  5BNV A;  1M1A D;  2J8P A;  4H9Q A;  2HIO A;  4J8U D;  3W96 B;  3MGQ D;  4ZUX C;  4CAY A;  1AOI B;  3WKJ C;  4HGA B;  4JJN B;  3A6N C;  1P3A C;  1P3O A;  3VH6 A;  3UT9 A;  3B6G D;  5AV5 B;  1P3P A;  5B31 A;  2JCH A;  4H9S A;  3REJ D;  3AZL A;  4WV4 B;  5CPI B;  5B1M A;  3AV1 B;  1AOI D;  2F2A C;  3MGP B;  5B33 B;  2CWE A;  5F99 C;  3WKJ B;  4NE6 A;  1P3A B;  5AV8 D;  5AV5 D;  4X23 A;  5B32 D;  3LJA A;  1EQZ B;  3REK A;  3A1I A;  5AV6 D;  2Y2O A;  3C1C C;  3EG5 B;  3EPL A;  3AL0 C;  5GXQ D;  4J8W C;  3MGP D;  1M18 C;  5B33 D;  1P3G A;  5CPK D;  3X1U A;  2F8N G;  3F6T A;  4WU8 C;  3B6F A;  5DNN D;  2NQB C;  4LD9 A;  4ZBJ B;  3W99 C;  4CSR B;  3KFU G;  5GSU D;  3W98 A;  2IO5 C;  1KX3 D;  5G49 B;  5B1L B;  4WU9 B;  5AVC C;  3MVD A;  3MGS C;  3AZF C;  3MNN C;  3LZ1 C;  3UTA B;  1M18 B;  5B32 G;  3WAA D;  5C3I C;  4H9P A;  1BFM A;  4WU8 B;  3REI C;  3AZM D;  3X1S A;  3LZ0 A;  4QLC A;  3AZI B;  4Z5T B;  3O62 D;  3W97 D;  5GT0 B;  2YFW A;  2HIO C;  5AVB A;  2BYK B;  5JRG B;  2ARO D;  3UTA D;  4XZQ B;  5AVC B;  3MGS B;  3AZJ A;  1U35 A;  4UUZ B;  4AWL C;  1M19 D;  4NE3 A;  3REL D;  5CP6 A;  2Y2J A;  3LEL D;  3REH A;  5C3I B;  1P3P C;  1KX5 A;  4Z5T D;  3X1T C;  3KUY A;  4H9S C;  3AZL C;  3VH5 T;  5B1M C;  5JRG D;  1M1A A;  1S32 C;  2YFV B;  4UPK A;  1B6W A;  4XUJ A;  4J8U A;  4KGC B;  5DNM C;  3MGR A;  5B0Z B;  1H3O A;  4X23 C;  3LJA C;  3X1T B;  2F8N A;  4YM6 D;  1F66 D;  5B0Y B;  3AYW A;  3NQJ B;  3REJ A;  3AZK D;  1P3M A;  1S32 B;  1B67 A;  1P3G C;  3X1U C;  3VH6 T;  5B0Z D;  5DNM B;  5CPJ D;  3B6F C;  2LY8 A;  4H9O B;  3KWQ A;  3LJA B;  3C1B D;  4LD9 C;  5AV8 A;  5B32 A;  5FUG A;  4H9N A;  3WA9 B;  2JSS A;  5B0Y D;  5B31 G;  1BH8 A;  3AZH A;  4YS3 C;  5AV9 A;  4Z2M G;  1HTA A;  1P3G B;  5GXQ A;  1HQ3 C;  1ID3 B;  2F8N K;  5B24 D;  4DRA A;  1P3K A;  5CPK A;  1F1E A;  1JFI A;  3LZ0 C;  3EPK A;  3X1S C;  1P3F A;  4LD9 B;  5DNN A;  3AN2 D;  4J8V C;  3X1V D;  2PYO A;  3NQU A;  1A7W A;  5CHL B;  3B0C W;  2DF4 C;  3VH5 W;  1P34 B;  4KUD C;  4Z66 D;  2RVQ C;  2DQN C;  1KX3 A;  3AZJ C;  4YS3 B;  5GT3 A;  1ID3 D;  1P3B C;  1HQ3 B;  5CP6 C;  3REH C;  3WAA A;  1N1J A;  4KHA B;  3KUY C;  3EPH A;  5BNX B;  3AZM A;  4J8V B;  5E5A C;  4KUD B;  1ZLA D;  3O62 A;  3W97 A;  5AY8 D;  5B2I D;  4XUJ C;  3KXB C;  3TU4 D;  2ARO A;  3MGR C;  1P3B B;  5CP6 B;  2BYM A;  1M19 A;  4R8P B;  3REL A;  1KX4 C;  3A1K A;  3LEL A;  2NZD D;  5BT1 D;  5B2J B;  4EO5 B;  4DQY B;  3AFA D;  3AYW C;  5E5A B;  3KSY A;  1P3M C;  2CV5 C;  1P3L A;  3AZN C;  2VQR A;  3KXB B;  3B0D C;  3MGR B;  3AZG B;  3KWQ C;  5AV8 C;  3W96 D;  3AZE A;  5B32 C;  4J8X A;  1KX4 B;  4G92 C;  4JJN D;  4ZUX B;  2F8N B;  2ZY3 A;  3AZH C;  3A6N B;  4YM6 A;  5AV9 C;  3UTB A;  1F66 A;  5BO0 B;  5JA4 B;  1P3M B;  2CV5 B;  3AZK A;  5GXQ C;  3AZN B;  3AZG D;  1TAF A;  1P3K C;  5CPK C;  1ULY A;  5CPI D;  3AV1 D;  5CPJ A;  1P3F C;  3C1B A;  1Z2C B;  2PYO C;  4G92 B;  3WTP C;  3WKJ D;  1P3A D;  3V9R B;  5F99 B;  3AZH B;  1EQZ D;  3IP4 C;  5GT3 C;  5B40 C;  3C1C B;  3WAA C;  1P3K B;  5B24 A;  4J8W B;  4WNN A;  1BH9 A;  4H9R A;  3WTP B;  1Q9C A;  3AN2 A;  1WWI A;  3X1V A;  1P3I A;  3O62 C;  4Z66 A;  2NQB B;  2ARO C;  5GT3 B;  2L5A A;  5BS7 A;  3W99 B;  5B40 B;  5B1L D;  4WU9 D;  2IO5 B;  1PZR A;  3LEL C;  4J8W D;  3AZF B;  1M18 D;  3MNN B;  3LZ1 B;  5KDM A;  1P3O C;  3UT9 C;  2FJ7 A;  3WTP E;  3AV2 A;  4WU8 D;  1P3L C;  2NQB D;  3AZI D;  1ZLA A;  5B31 C;  4E45 A;  3REI B;  3R45 B;  5AY8 A;  5B2I A;  1TZY A;  5BNV B;  5GT0 D;  3TU4 A;  3B0C T;  4H9Q B;  3AZE C;  2Y2Q A;  4XZQ D;  5AVC D;  2HIO B;  3MGS D;  4J8X C;  3AZF D;  3LZ1 D;  4CAY B;  3MGQ A;  4AWL B;  1P3O B;  3AFA A;  3UT9 B;  2Y2M A;  3UTB C;  1P3P B;  3AZK C;  3REI D;  3REK C;  1P3L B;  3B6G A;  5B31 B;  3AZL B;  2HIO D;  5B1M B;  3C1B C;  3W96 A;  4KGC D;  1AOI A;  2FFF B;  3P5J B;  4X23 B;  3UTB B;  5AV5 A;  3X1T D;  3REK B;  3W98 C;  3AZL D;  5AV6 A;  5B1M D;  3MVD C;  5CPI A;  1S32 D;  3AV1 A;  3MGP A;  3AN2 C;  5DNM D;  5B33 A;  3X1U B;  1P3I C;  1WWS A;  4X23 D;  3WKJ A;  3LJA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...