3AZFD

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 35
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfD00
5CP6B 1F66A 4WNNA 2RVQD 2NZDA 3UT9B 2YFVA 5B24A 5JRGA 3WTPD 3KWQC 5AV5B 4J8XA 3MNND 4KUDC 4YS3D 3AZGC 1P3IC 1P3FC 1WWSA 3W99A 5B0ZC 3WAAD 4R8PD 5KDMB 2NQBA 4H9QB 5CHLB 5F99A 3W98C 1KX3C 1U35B 4XUJB 3AN2B 5BT1D 5AV8A 3NQJB 4J8WD 1HQ3B 1BH8B 3UTAC 3AZKD 1P3KB 3AZEA 3KUYB 1N1JA 1P3OB 4AWLC 5C3IC 4J8UC 4J8VB 4LD9B 4G91B 1P3ID 3REKC 3X1UC 3AZMC 3LZ0A 3AZIA 5CPJC 1P34A 1AOID 3X1UD 3AZMD 5B40A 2AROC 3VH5W 1P3LB 4HGAC 3NQUB 1AOIC 3AZLC 2BYMB 4UUZA 3WAAB 3TU4A 2FJ7D 3UTBA 3KXBA 5GT0A 4YM6B 5G49B 4Z5TA 4XZQA 3WTPC 3MVDA 3REKD 4H9RA 2FJ7C 4NFTA 3AYWA 4ZUXA 3REJA 1P3FD 3C1CB 4KUDA 4WU9C 4H9PA 3AZNA 4Z66D 2PYOA 4CSRB 1ZLAB 5DNMA 3R45B 5B2IC 4J8VD 3LJAB 5AVCA 2IO5B 4CAYB 1M18A 3X1TC 4G92B 1KX4D 3WAAC 3W97D 1Q9CA 3A6NC 5AV9D 1P3PA 5CP6D 1P3MB 1ULYA 3MGSA 4JJNC 5B2JB 3REHC 5B2ID 3AV1A 5CPKB 3MGQD 4YM6D 3W96A 5BNXB 4H9NB 3O62C 3REKB 5B32A 4R8PB 1F66D 1H3OB 3C1BB 1P3FB 1ID3B 3C1CD 5B40C 4JJND 3X1TD 3W99C 2F8NG 3MNNA 3VH6A 3W97C 5JA4B 4WU8A 3KXBC 5B1MB 3AN2C 3B6GA 3AZJA 3O62D 1KX3B 4Z2MG 1M1AC 4KGCA 3KUYD 3LELA 1M19B 5CPIB 3X1SA 2HUEB 5AV6A 3UTAA 1ZLAC 5AV9C 5DNMC 1R4VA 5FUGB 2NZDC 3LZ1D 4J8UA 5GSUA 3X1VB 3MGQB 2BYKA 5AVCC 2IO5C 3LZ1C 1P3IA 5B31G 1P3PC 3AZLD 3WKJB 5B0ZA 3LZ0D 4JJNB 3AZID 1HTAA 1M1AB 4HGAB 3REHA 1AOIA 2F8NH 5F99C 2NZDD 5AY8A 2CV5A 5B24D 2F8NA 5AV8C 3O62B 4QLCA 3VH6W 4Z66B 5E5AB 3WTPA 3MVDC 1S32B 2FJ7A 4YS3A 4Z5TD 5CPID 3REJC 5B33D 3B0DB 1BH9A 1TZYB 5GT3C 3LJAD 3AZHA 4E45A 3UT9D 3MNNC 4KUDD 3W97B 3WA9B 3MGRA 4WU8C 2PYOD 5BO0A 3REIA 3AFAA 4J8WA 3B6FC 2AROA 4KHAA 3AZFB 3A6NB 1P3AA 3AZLB 2HIOD 5B2JC 1KX5A 4XUJD 5AV9A 4YM6C 5CP6A 2YFWA 4XZQC 3KWQB 1EQZD 2YFVB 5GSUC 5B1LB 5JRGB 4J8XB 1EQZC 5B32C 3AZKB 3WA9C 4R8PC 5B31A 3W96D 1P3OD 3W98B 3MGPA 5KDMA 2NQBB 3B6FD 5F99B 4XZQD 1U35A 3AN2A 3B6GC 3X1TA 3AZJC 5AV8B 1S32C 4WU8D 3AZND 4AWLB 1BH8A 3AZFD 3WTPE 5GT3A 3KUYA 3X1SC 2HUEC 1N1JB 4NE5A 5B24C 4G91C 4J8VA 4LD9A 1M18D 1KX4A 5B1LD 3REIC 4ZBJC 2NQBC 3KSYA 1P3PD 4X23B 3LZ1A 4J8UD 5B0YC 1P3GA 5DNNA 5BNVB 3AV2B 3B0CW 1P3AC 1HQ3D 3W98D 1S32D 4H9SA 5E5AD 3KXBB 5B1MC 5GT0B 4YM6A 5G49A 4Z5TB 5AVBA 5E5AC 4H9RB 5AY8C 1P3KC 3RELB 2CV5C 3AYWB 1P3BC 3B0BA 3LELC 1P3MD 4ZUXB 3REJB 5AY8D 3C1CA 4KUDB 5B2IB 3X1UB 3AZMB 4CSRA 1ZLAA 1P3LD 5DNMB 4ZBJB 5CPJA 3B6GD 5B33A 3AZJD 1JFIB 3LJAA 1BFMA 4KGCD 5BT1C 1M18B 3LELD 1P3MC 3AZFC 5GXQA 3KWQD 3MGSB 3UTAD 3AV2D 3KUYC 1P3BB 2RVQC 1KX5C 5GSUD 4J8VC 1P3AD 2HIOA 4H9OA 4WU9A 4H9NA 4QLCC 3C1BC 3RELD 1EQZA 1TAFB 1ID3A 1B67A 5B0YA 5B0ZD 1P3GC 3AZGA 3MGPC 3MNNB 5B2JD 5B31D 3V9RA 5JA4A 4WU8B 5B1MA 2CV5D 2F8ND 3MGPD 4QLCD 1KX3A 3MGSC 5CPKD 4KGCB 3B6FA 3LELB 1M19A 5CPIA 5CPKC 3X1SB 3VH5T 1F66B 4WNNB 3AZHD 2NZDB 3C1BD 3UT9A 3B0CT 3UTAB 3AV1C 3MGRD 5B24B 1P3BD 5FUGA 5AV5A 4X23D 4J8UB 5GT3D 5B1LC 2BYKB 3REID 3AFAD 3WKJC 4X23C 1KX4C 3W99B 4LD9D 3LZ0C 2AROD 3AZIC 4NE3A 4H9QA 4DRAA 5B0ZB 1KX5D 1M1AA 4KGCC 4XUJA 1AOIB 4Z66C 5DNND 3NQJA 5AY8B 2L5AA 1HQ3A 4Z5TC 1S32A 5AVBC 5E5AA 2FJ7B 3X1VD 3AZEB 1P3KA 4YS3B 3AYWC 1P3OA 5AVBD 3X1VC 3VH5A 3AZHB 3AZNC 3WKJD 4LD9C 3LZ0B 3AZIB 3MGRB 1U35D 1P34B 5JRGD 4J8XD 3AN2D 5B33C 1ZLAD 5B40B 1P3LA 5CPJD 3NQUA 2BYMA 4UUZB 4G92C 3W99D 3WAAA 3TU4B 3AZFA 3A6NA 2NQBD 3UTBB 1P3AB 1F66C 5F99D 4XZQB 3MVDB 1KX5B 1TZYD 5AV9B 4YS3C 2YFWB 3KWQA 5B1LA 3WA9D 4H9PB 3AZHC 3AZNB 2CWEA 2PYOB 3AZKA 3AZED 3C1CC 1P3GD 5B31B 3R45A 1F1EA 1ID3C 3W98A 3MGPB 3MGQC 5AVCB 4XUJC 4CAYA 5BS7A 1ID3D 4WV4B 3AZGD 1P3PB 3X1TB 1P3MA 5B2JA 4E44A 5B1MD 5CP6C 1A7WA 5CPIC 4EO5B 3AV1B 5CPKA 5GT3B 3KXBD 5GT0D 3W96B 5BNXA 3MVDD 3REKA 3UT9C 5B32B 5B31C 2HIOC 5B32G 4R8PA 1P34C 1H3OA 4ZUXD 5AV5C 3C1BA 3REJD 1P3FA 1TZYC 1KX4B 1P3LC 5GXQD 4X23A 3LZ1B 1WWIA 5AV8D 1P3GB 3TU4C 5DNNB 2JSSA 1U35C 5BNVA 3AV2A 3B6GB 3AZJB 5AVCD 1KU5A 4WU9D 5AVBB 1M1AD 3RELA 1HQ3C 1M19C 5AV6B 3AZKC 5B0YD 5B2IA 1P34D 5C3IB 3B0DC 3X1UA 5GSUB 3AZMA 3MGQA 3X1VA 5B40D 1P3KD 5CPJB 5JRGC 4J8XC 5B33B 5B32D 4Z2MH 1KX3D 3TU4D 5DNNC 1JFIA 3MGRC 3UTBD 1P3IB 3WKJA 1M19D 4H9SC 3VH6T 4JJNA 5GXQB 3AFAC 3REHB 4J8WC 3AYWD 2CV5B 2F8NB 3W96C 1P3BA 3O62A 4QLCB 3WTPB 4ZUXC 4NE6A 5AV5D 4Z66A 3A6ND 5DNMD 4H9OB 2HIOB 4WU9B 2PYOC 1BH9B 1TZYA 3X1SD 3AZEC 1P3OC 2LY8A 1EQZB 5AV6D 1TAFA 4M6BA 5B0YB 4WZSB 3W97A 3WA9A 3LJAC 3AZGB 3AV2C 1M18C 5BO0B 3REIB 1B6WA 3MGSD 3V9RB 5GXQC 3AFAB 2F8NK 5BS7C 4J8WB 2AROB 4KHAB 3AV1D 3RELC 3AZLA 4DRBA 3B6FB 5AV6C 4EO5C 3UTBC 3REHD 5GT0C
chains in the Genus database with same CATH superfamily
5CP6B 1F66A 4WNNA 2RVQD 2NZDA 3UT9B 2YFVA 1PZRA 5B24A 5JRGA 3WTPD 3KWQC 5AV5B 4J8XA 3MNND 4KUDC 4YS3D 3AZGC 1P3IC 1P3FC 1WWSA 3W99A 5B0ZC 3WAAD 2ZY4A 4R8PD 5KDMB 2NQBA 4H9QB 5CHLB 5F99A 3W98C 1KX3C 1U35B 3A1IA 4XUJB 3AN2B 5BT1D 3H0LC 2W8SA 5AV8A 3NQJB 4J8WD 1HQ3B 2Y2MA 1BH8B 3UTAC 3AZKD 1P3KB 3AZEA 3KUYB 1N1JA 1P3OB 4AWLC 5C3IC 2DQNC 4J8UC 4J8VB 4LD9B 4G91B 1P3ID 3REKC 3X1UC 3AZMC 3LZ0A 3AZIA 5CPJC 1P34A 1AOID 3X1UD 3AZMD 5B40A 2AROC 3VH5W 1P3LB 4HGAC 3NQUB 2UWXA 1AOIC 3EPJA 2BYMB 4UUZA 3AZLC 3WAAB 3TU4A 2FJ7D 2G5IC 3KXBA 3UTBA 5GT0A 4YM6B 5G49B 4Z5TA 4XZQA 3WTPC 3MVDA 3REKD 4H9RA 2FJ7C 4NFTA 3AYWA 4ZUXA 3REJA 1P3FD 3C1CB 4KUDA 4WU9C 4H9PA 3AZNA 4Z66D 2PYOA 4CSRB 1ZLAB 5DNMA 3R45B 5B2IC 3A1KA 4J8VD 2Y2KA 3LJAB 5AVCA 2IO5B 4CAYB 1M18A 3X1TC 4G92B 1KX4D 3WAAC 3W97D 1Q9CA 3A6NC 5AV9D 1P3PA 5CP6D 1P3MB 1ULYA 3MGSA 4JJNC 5B2JB 3REHC 5B2ID 3AV1A 5CPKB 3MGQD 4YM6D 3W96A 5BNXB 4H9NB 3O62C 3REKB 5B32A 4R8PB 1F66D 1H3OB 3C1BB 1P3FB 1ID3B 3C1CD 5B40C 4JJND 3X1TD 3W99C 2F8NG 3MNNA 3VH6A 3W97C 5JA4B 4WU8A 3KXBC 5B1MB 3AN2C 3B6GA 3AZJA 3O62D 1KX3B 4Z2MG 1M1AC 4KGCA 3KUYD 2VQRA 3LELA 1M19B 5CPIB 3X1SA 3EPLA 2HUEB 4WJ3C 5AV6A 3UTAA 1ZLAC 5AV9C 5DNMC 1R4VA 5FUGB 2NZDC 3LZ1D 4J8UA 5GSUA 3X1VB 3MGQB 2BYKA 5AVCC 2IO5C 3LZ1C 1P3IA 5B31G 1P3PC 3AZLD 3WKJB 4UPKA 5B0ZA 3LZ0D 4JJNB 3AZID 1HTAA 1M1AB 4HGAB 3REHA 2XD5A 1AOIA 2F8NH 5F99C 2NZDD 5AY8A 1T3UA 2CV5A 5B24D 2F8NA 5AV8C 4QLCA 3WTPA 3VH6W 4Z66B 5E5AB 3O62B 3MVDC 1S32B 2BG1A 2FJ7A 4YS3A 4Z5TD 5CPID 3REJC 5B33D 3B0DB 1BH9A 1TZYB 5GT3C 3LJAD 3AZHA 4E45A 3UT9D 3KFUG 3MNNC 4KUDD 3W97B 3WA9B 3MGRA 4WU8C 2PYOD 5BO0A 3REIA 3AFAA 4J8WA 3B6FC 2JE5A 2AROA 4KHAA 3AZFB 3A6NB 1P3AA 3AZLB 2HIOD 5B2JC 1KX5A 2Y2JA 4XUJD 5AV9A 4YM6C 5CP6A 2YFWA 4XZQC 3KWQB 1EQZD 2YFVB 5GSUC 5B1LB 5JRGB 4J8XB 1EQZC 5B32C 3EPKA 3AZKB 2JCHA 3WA9C 4R8PC 5B31A 3W96D 1P3OD 3W98B 3MGPA 2ZY3A 5KDMA 2NQBB 3EG5B 3B6FD 5F99B 4XZQD 3H0RC 1U35A 2Y2LA 3AN2A 3B6GC 3X1TA 3AZJC 5AV8B 1S32C 4WU8D 3AZND 4AWLB 1BH8A 3AZFD 3WTPE 5GT3A 3KUYA 3X1SC 2HUEC 1N1JB 4NE5A 5B24C 4G91C 4J8VA 2Y2PA 4LD9A 2Y2HA 1M18D 1KX4A 5B1LD 3REIC 4ZBJC 2NQBC 3KSYA 1P3PD 4X23B 3LZ1A 4J8UD 5B0YC 1P3GA 5DNNA 5BNVB 3AV2B 3B0CW 1P3AC 1HQ3D 3W98D 1S32D 4H9SA 5E5AD 3KXBB 5B1MC 5GT0B 4YM6A 5G49A 4Z5TB 5AVBA 5E5AC 4H9RB 5AY8C 1P3KC 3RELB 2CV5C 3AYWB 1P3BC 3B0BA 3LELC 1P3MD 4ZUXB 3REJB 5AY8D 3C1CA 4KUDB 5B2IB 2Y2QA 1Z2CB 3X1UB 3AZMB 4CSRA 1ZLAA 1P3LD 5DNMB 4ZBJB 5CPJA 3B6GD 5B33A 3FDDA 3AZJD 1JFIB 3LJAA 1BFMA 4KGCD 2FFFB 5BT1C 3F6TA 1M18B 3LELD 1P3MC 3AZFC 5GXQA 3KWQD 3MGSB 3UTAD 3AV2D 3KUYC 1P3BB 2RVQC 1KX5C 5GSUD 4J8VC 2DF4C 1P3AD 2HIOA 4H9OA 4WU9A 4H9NA 4QLCC 3C1BC 3RELD 1EQZA 1TAFB 1ID3A 1B67A 5B0YA 5B0ZD 1P3GC 3AZGA 3MGPC 3MNNB 5B2JD 5B31D 3V9RA 5JA4A 4WU8B 5B1MA 2CV5D 2F8ND 3MGPD 4QLCD 1KX3A 3MGSC 5CPKD 4KGCB 2ZY5A 3B6FA 3LELB 1M19A 5CPIA 5CPKC 3X1SB 3VH5T 2ZM5A 1F66B 4WNNB 3AZHD 2NZDB 3C1BD 3UT9A 3B0CT 3UTAB 3AV1C 3MGRD 5B24B 1P3BD 5FUGA 5AV5A 4X23D 4J8UB 5GT3D 5B1LC 2BYKB 3REID 3AFAD 2J8PA 3WKJC 4X23C 1KX4C 3W99B 4LD9D 3LZ0C 2AROD 3AZIC 4NE3A 4H9QA 4DRAA 5B0ZB 1KX5D 1M1AA 4KGCC 4XUJA 1AOIB 4Z66C 5DNND 3NQJA 5AY8B 2L5AA 1HQ3A 4Z5TC 1S32A 5AVBC 5E5AA 2FJ7B 3X1VD 3AZEB 1P3KA 4YS3B 3AYWC 1P3OA 5AVBD 3X1VC 3VH5A 2G5HC 3AZHB 3AZNC 3WKJD 4LD9C 3LZ0B 3AZIB 3MGRB 1U35D 1P34B 5JRGD 4J8XD 2XD1A 3AN2D 5B33C 1ZLAD 5B40B 1P3LA 5CPJD 3NQUA 2BYMA 4UUZB 4G92C 3W99D 3WAAA 3TU4B 1W2EA 3AZFA 3A6NA 3AL0C 2NQBD 3UTBB 1P3AB 1F66C 5F99D 4XZQB 3MVDB 1KX5B 1TZYD 5AV9B 2Y2OA 4YS3C 2YFWB 3KWQA 3EPHA 5B1LA 3WA9D 4H9PB 3AZHC 3AZNB 2CWEA 2PYOB 3AZKA 3AZED 3C1CC 1P3GD 5B31B 3R45A 1F1EA 1ID3C 3W98A 3MGPB 3MGQC 5AVCB 4XUJC 4CAYA 5BS7A 1ID3D 4WV4B 3AZGD 1P3PB 3X1TB 1P3MA 5B2JA 4E44A 5B1MD 5CP6C 1A7WA 2Y2IA 5CPIC 4EO5B 3AV1B 5CPKA 5GT3B 3KXBD 5GT0D 3W96B 5BNXA 3MVDD 3REKA 3UT9C 5B32B 5B31C 2HIOC 5B32G 4R8PA 1P34C 1H3OA 4ZUXD 5AV5C 3C1BA 3REJD 1P3FA 1TZYC 1KX4B 1P3LC 5GXQD 4X23A 3LZ1B 1WWIA 5AV8D 1P3GB 3TU4C 5DNNB 2JSSA 1U35C 5BNVA 3AV2A 3B6GB 4DQYB 3AZJB 5AVCD 1KU5A 4WU9D 5AVBB 1M1AD 3RELA 1HQ3C 1M19C 5AV6B 3AZKC 5B0YD 5B2IA 2ZY2A 1P34D 3H0MC 5C3IB 2F2AC 3B0DC 3X1UA 5GSUB 3AZMA 3MGQA 3X1VA 5B40D 1P3KD 5CPJB 5JRGC 4J8XC 5B33B 3P5JB 5B32D 4Z2MH 1KX3D 3TU4D 5DNNC 1JFIA 3MGRC 3UTBD 1P3IB 2Y2GA 3WKJA 1M19D 4H9SC 3VH6T 4JJNA 5GXQB 3AFAC 3REHB 4J8WC 3AYWD 2RIQA 2CV5B 2F8NB 3W96C 1P3BA 4QLCB 3WTPB 4Z66A 4ZUXC 4NE6A 5AV5D 3O62A 3A6ND 5DNMD 2HIOB 4H9OB 4WU9B 2PYOC 1BH9B 1TZYA 3X1SD 3AZEC 2Y2NA 1P3OC 2LY8A 1EQZB 5AV6D 1TAFA 3IP4C 4M6BA 5B0YB 4WZSB 3W97A 3WA9A 3LJAC 3AZGB 3AV2C 1M18C 5BO0B 3REIB 1B6WA 3MGSD 3V9RB 5GXQC 3AFAB 2F8NK 5BS7C 4J8WB 2AROB 4KHAB 3AV1D 3RELC 3AZLA 4DRBA 3B6FB 5AV6C 4EO5C 3UTBC 3REHD 5GT0C
chains in the Genus database with same CATH topology
5CP6B 1F66A 4WNNA 2RVQD 2NZDA 3UT9B 2YFVA 1PZRA 5B24A 5JRGA 3WTPD 3KWQC 5AV5B 4J8XA 3MNND 4KUDC 4YS3D 3AZGC 1P3IC 1P3FC 1WWSA 3W99A 5B0ZC 3WAAD 2ZY4A 4R8PD 5KDMB 2NQBA 4H9QB 5CHLB 5F99A 3W98C 1KX3C 1U35B 3A1IA 4XUJB 3AN2B 5BT1D 3H0LC 2W8SA 5AV8A 3NQJB 4J8WD 1HQ3B 2Y2MA 1BH8B 3UTAC 3AZKD 1P3KB 3AZEA 3KUYB 1N1JA 1P3OB 4AWLC 5C3IC 2DQNC 4J8UC 4J8VB 4LD9B 4G91B 1P3ID 3REKC 3X1UC 3AZMC 3LZ0A 3AZIA 5CPJC 1P34A 1AOID 3X1UD 3AZMD 5B40A 2AROC 3VH5W 1P3LB 4HGAC 3NQUB 2UWXA 1AOIC 3EPJA 2BYMB 4UUZA 3AZLC 3WAAB 3TU4A 2FJ7D 2G5IC 3KXBA 3UTBA 5GT0A 4YM6B 5G49B 4Z5TA 4XZQA 3WTPC 3MVDA 3REKD 4H9RA 2FJ7C 4NFTA 3AYWA 4ZUXA 3REJA 1P3FD 3C1CB 4KUDA 4WU9C 4H9PA 3AZNA 4Z66D 2PYOA 4CSRB 1ZLAB 5DNMA 3R45B 5B2IC 3A1KA 4J8VD 2Y2KA 3LJAB 5AVCA 2IO5B 4CAYB 1M18A 3X1TC 4G92B 1KX4D 3WAAC 3W97D 1Q9CA 3A6NC 5AV9D 1P3PA 5CP6D 1P3MB 1ULYA 3MGSA 4JJNC 5B2JB 3REHC 5B2ID 3AV1A 5CPKB 3MGQD 4YM6D 3W96A 5BNXB 4H9NB 3O62C 3REKB 5B32A 4R8PB 1F66D 1H3OB 3C1BB 1P3FB 1ID3B 3C1CD 5B40C 4JJND 3X1TD 3W99C 2F8NG 3MNNA 3VH6A 3W97C 5JA4B 4WU8A 3KXBC 5B1MB 3AN2C 3B6GA 3AZJA 3O62D 1KX3B 4Z2MG 1M1AC 4KGCA 3KUYD 2VQRA 3LELA 1M19B 5CPIB 3X1SA 3EPLA 2HUEB 4WJ3C 5AV6A 3UTAA 1ZLAC 5AV9C 5DNMC 1R4VA 5FUGB 2NZDC 3LZ1D 4J8UA 5GSUA 3X1VB 3MGQB 2BYKA 5AVCC 2IO5C 3LZ1C 1P3IA 5B31G 1P3PC 3AZLD 3WKJB 4UPKA 5B0ZA 3LZ0D 4JJNB 3AZID 1HTAA 1M1AB 4HGAB 3REHA 2XD5A 1AOIA 2F8NH 5F99C 2NZDD 5AY8A 1T3UA 2CV5A 5B24D 2F8NA 5AV8C 4QLCA 3WTPA 3VH6W 4Z66B 5E5AB 3O62B 3MVDC 1S32B 2BG1A 2FJ7A 4YS3A 4Z5TD 5CPID 3REJC 5B33D 3B0DB 1BH9A 1TZYB 5GT3C 3LJAD 3AZHA 4E45A 3UT9D 3KFUG 3MNNC 4KUDD 3W97B 3WA9B 3MGRA 4WU8C 2PYOD 5BO0A 3REIA 3AFAA 4J8WA 3B6FC 2JE5A 2AROA 4KHAA 3AZFB 3A6NB 1P3AA 3AZLB 2HIOD 5B2JC 1KX5A 2Y2JA 4XUJD 5AV9A 4YM6C 5CP6A 2YFWA 4XZQC 3KWQB 1EQZD 2YFVB 5GSUC 5B1LB 5JRGB 4J8XB 1EQZC 5B32C 3EPKA 3AZKB 2JCHA 3WA9C 4R8PC 5B31A 3W96D 1P3OD 3W98B 3MGPA 2ZY3A 5KDMA 2NQBB 3EG5B 3B6FD 5F99B 4XZQD 3H0RC 1U35A 2Y2LA 3AN2A 3B6GC 3X1TA 3AZJC 5AV8B 1S32C 4WU8D 3AZND 4AWLB 1BH8A 3AZFD 3WTPE 5GT3A 3KUYA 3X1SC 2HUEC 1N1JB 4NE5A 5B24C 4G91C 4J8VA 2Y2PA 4LD9A 2Y2HA 1M18D 1KX4A 5B1LD 3REIC 4ZBJC 2NQBC 3KSYA 1P3PD 4X23B 3LZ1A 4J8UD 5B0YC 1P3GA 5DNNA 5BNVB 3AV2B 3B0CW 1P3AC 1HQ3D 3W98D 1S32D 4H9SA 5E5AD 3KXBB 5B1MC 5GT0B 4YM6A 5G49A 4Z5TB 5AVBA 5E5AC 4H9RB 5AY8C 1P3KC 3RELB 2CV5C 3AYWB 1P3BC 3B0BA 3LELC 1P3MD 4ZUXB 3REJB 5AY8D 3C1CA 4KUDB 5B2IB 2Y2QA 1Z2CB 3X1UB 3AZMB 4CSRA 1ZLAA 1P3LD 5DNMB 4ZBJB 5CPJA 3B6GD 5B33A 3FDDA 3AZJD 1JFIB 3LJAA 1BFMA 4KGCD 2FFFB 5BT1C 3F6TA 1M18B 3LELD 1P3MC 3AZFC 5GXQA 3KWQD 3MGSB 3UTAD 3AV2D 3KUYC 1P3BB 2RVQC 1KX5C 5GSUD 4J8VC 2DF4C 1P3AD 2HIOA 4H9OA 4WU9A 4H9NA 4QLCC 3C1BC 3RELD 1EQZA 1TAFB 1ID3A 1B67A 5B0YA 5B0ZD 1P3GC 3AZGA 3MGPC 3MNNB 5B2JD 5B31D 3V9RA 5JA4A 4WU8B 5B1MA 2CV5D 2F8ND 3MGPD 4QLCD 1KX3A 3MGSC 5CPKD 4KGCB 2ZY5A 3B6FA 3LELB 1M19A 5CPIA 5CPKC 3X1SB 3VH5T 2ZM5A 1F66B 4WNNB 3AZHD 2NZDB 3C1BD 3UT9A 3B0CT 3UTAB 3AV1C 3MGRD 5B24B 1P3BD 5FUGA 5AV5A 4X23D 4J8UB 5GT3D 5B1LC 2BYKB 3REID 3AFAD 2J8PA 3WKJC 4X23C 1KX4C 3W99B 4LD9D 3LZ0C 2AROD 3AZIC 4NE3A 4H9QA 4DRAA 5B0ZB 1KX5D 1M1AA 4KGCC 4XUJA 1AOIB 4Z66C 5DNND 3NQJA 5AY8B 2L5AA 1HQ3A 4Z5TC 1S32A 5AVBC 5E5AA 2FJ7B 3X1VD 3AZEB 1P3KA 4YS3B 3AYWC 1P3OA 5AVBD 3X1VC 3VH5A 2G5HC 3AZHB 3AZNC 3WKJD 4LD9C 3LZ0B 3AZIB 3MGRB 1U35D 1P34B 5JRGD 4J8XD 2XD1A 3AN2D 5B33C 1ZLAD 5B40B 1P3LA 5CPJD 3NQUA 2BYMA 4UUZB 4G92C 3W99D 3WAAA 3TU4B 1W2EA 3AZFA 3A6NA 3AL0C 2NQBD 3UTBB 1P3AB 1F66C 5F99D 4XZQB 3MVDB 1KX5B 1TZYD 5AV9B 2Y2OA 4YS3C 2YFWB 3KWQA 3EPHA 5B1LA 3WA9D 4H9PB 3AZHC 3AZNB 2CWEA 2PYOB 3AZKA 3AZED 3C1CC 1P3GD 5B31B 3R45A 1F1EA 1ID3C 3W98A 3MGPB 3MGQC 5AVCB 4XUJC 4CAYA 5BS7A 1ID3D 4WV4B 3AZGD 1P3PB 3X1TB 1P3MA 5B2JA 4E44A 5B1MD 5CP6C 1A7WA 2Y2IA 5CPIC 4EO5B 3AV1B 5CPKA 5GT3B 3KXBD 5GT0D 3W96B 5BNXA 3MVDD 3REKA 3UT9C 5B32B 5B31C 2HIOC 5B32G 4R8PA 1P34C 1H3OA 4ZUXD 5AV5C 3C1BA 3REJD 1P3FA 1TZYC 1KX4B 1P3LC 5GXQD 4X23A 3LZ1B 1WWIA 5AV8D 1P3GB 3TU4C 5DNNB 2JSSA 1U35C 5BNVA 3AV2A 3B6GB 4DQYB 3AZJB 5AVCD 1KU5A 4WU9D 5AVBB 1M1AD 3RELA 1HQ3C 1M19C 5AV6B 3AZKC 5B0YD 5B2IA 2ZY2A 1P34D 3H0MC 5C3IB 2F2AC 3B0DC 3X1UA 5GSUB 3AZMA 3MGQA 3X1VA 5B40D 1P3KD 5CPJB 5JRGC 4J8XC 5B33B 3P5JB 5B32D 4Z2MH 1KX3D 3TU4D 5DNNC 1JFIA 3MGRC 3UTBD 1P3IB 2Y2GA 3WKJA 1M19D 4H9SC 3VH6T 4JJNA 5GXQB 3AFAC 3REHB 4J8WC 3AYWD 2RIQA 2CV5B 2F8NB 3W96C 1P3BA 4QLCB 3WTPB 4Z66A 4ZUXC 4NE6A 5AV5D 3O62A 3A6ND 5DNMD 2HIOB 4H9OB 4WU9B 2PYOC 1BH9B 1TZYA 3X1SD 3AZEC 2Y2NA 1P3OC 2LY8A 1EQZB 5AV6D 1TAFA 3IP4C 4M6BA 5B0YB 4WZSB 3W97A 3WA9A 3LJAC 3AZGB 3AV2C 1M18C 5BO0B 3REIB 1B6WA 3MGSD 3V9RB 5GXQC 3AFAB 2F8NK 5BS7C 4J8WB 2AROB 4KHAB 3AV1D 3RELC 3AZLA 4DRBA 3B6FB 5AV6C 4EO5C 3UTBC 3REHD 5GT0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 B;  1F66 A;  4WNN A;  2RVQ D;  2NZD A;  3UT9 B;  2YFV A;  5B24 A;  5JRG A;  3WTP D;  3KWQ C;  5AV5 B;  4J8X A;  3MNN D;  4KUD C;  4YS3 D;  3AZG C;  1P3I C;  1P3F C;  1WWS A;  3W99 A;  5B0Z C;  3WAA D;  4R8P D;  5KDM B;  2NQB A;  4H9Q B;  5CHL B;  5F99 A;  3W98 C;  1KX3 C;  1U35 B;  4XUJ B;  3AN2 B;  5BT1 D;  5AV8 A;  3NQJ B;  4J8W D;  1HQ3 B;  1BH8 B;  3UTA C;  3AZK D;  1P3K B;  3AZE A;  3KUY B;  1N1J A;  1P3O B;  4AWL C;  5C3I C;  4J8U C;  4J8V B;  4LD9 B;  4G91 B;  1P3I D;  3REK C;  3X1U C;  3AZM C;  3LZ0 A;  3AZI A;  5CPJ C;  1P34 A;  1AOI D;  3X1U D;  3AZM D;  5B40 A;  2ARO C;  3VH5 W;  1P3L B;  4HGA C;  3NQU B;  1AOI C;  3AZL C;  2BYM B;  4UUZ A;  3WAA B;  3TU4 A;  2FJ7 D;  3UTB A;  3KXB A;  5GT0 A;  4YM6 B;  5G49 B;  4Z5T A;  4XZQ A;  3WTP C;  3MVD A;  3REK D;  4H9R A;  2FJ7 C;  4NFT A;  3AYW A;  4ZUX A;  3REJ A;  1P3F D;  3C1C B;  4KUD A;  4WU9 C;  4H9P A;  3AZN A;  4Z66 D;  2PYO A;  4CSR B;  1ZLA B;  5DNM A;  3R45 B;  5B2I C;  4J8V D;  3LJA B;  5AVC A;  2IO5 B;  4CAY B;  1M18 A;  3X1T C;  4G92 B;  1KX4 D;  3WAA C;  3W97 D;  1Q9C A;  3A6N C;  5AV9 D;  1P3P A;  5CP6 D;  1P3M B;  1ULY A;  3MGS A;  4JJN C;  5B2J B;  3REH C;  5B2I D;  3AV1 A;  5CPK B;  3MGQ D;  4YM6 D;  3W96 A;  5BNX B;  4H9N B;  3O62 C;  3REK B;  5B32 A;  4R8P B;  1F66 D;  1H3O B;  3C1B B;  1P3F B;  1ID3 B;  3C1C D;  5B40 C;  4JJN D;  3X1T D;  3W99 C;  2F8N G;  3MNN A;  3VH6 A;  3W97 C;  5JA4 B;  4WU8 A;  3KXB C;  5B1M B;  3AN2 C;  3B6G A;  3AZJ A;  3O62 D;  1KX3 B;  4Z2M G;  1M1A C;  4KGC A;  3KUY D;  3LEL A;  1M19 B;  5CPI B;  3X1S A;  2HUE B;  5AV6 A;  3UTA A;  1ZLA C;  5AV9 C;  5DNM C;  1R4V A;  5FUG B;  2NZD C;  3LZ1 D;  4J8U A;  5GSU A;  3X1V B;  3MGQ B;  2BYK A;  5AVC C;  2IO5 C;  3LZ1 C;  1P3I A;  5B31 G;  1P3P C;  3AZL D;  3WKJ B;  5B0Z A;  3LZ0 D;  4JJN B;  3AZI D;  1HTA A;  1M1A B;  4HGA B;  3REH A;  1AOI A;  2F8N H;  5F99 C;  2NZD D;  5AY8 A;  2CV5 A;  5B24 D;  2F8N A;  5AV8 C;  3O62 B;  4QLC A;  3VH6 W;  4Z66 B;  5E5A B;  3WTP A;  3MVD C;  1S32 B;  2FJ7 A;  4YS3 A;  4Z5T D;  5CPI D;  3REJ C;  5B33 D;  3B0D B;  1BH9 A;  1TZY B;  5GT3 C;  3LJA D;  3AZH A;  4E45 A;  3UT9 D;  3MNN C;  4KUD D;  3W97 B;  3WA9 B;  3MGR A;  4WU8 C;  2PYO D;  5BO0 A;  3REI A;  3AFA A;  4J8W A;  3B6F C;  2ARO A;  4KHA A;  3AZF B;  3A6N B;  1P3A A;  3AZL B;  2HIO D;  5B2J C;  1KX5 A;  4XUJ D;  5AV9 A;  4YM6 C;  5CP6 A;  2YFW A;  4XZQ C;  3KWQ B;  1EQZ D;  2YFV B;  5GSU C;  5B1L B;  5JRG B;  4J8X B;  1EQZ C;  5B32 C;  3AZK B;  3WA9 C;  4R8P C;  5B31 A;  3W96 D;  1P3O D;  3W98 B;  3MGP A;  5KDM A;  2NQB B;  3B6F D;  5F99 B;  4XZQ D;  1U35 A;  3AN2 A;  3B6G C;  3X1T A;  3AZJ C;  5AV8 B;  1S32 C;  4WU8 D;  3AZN D;  4AWL B;  1BH8 A;  3AZF D;  3WTP E;  5GT3 A;  3KUY A;  3X1S C;  2HUE C;  1N1J B;  4NE5 A;  5B24 C;  4G91 C;  4J8V A;  4LD9 A;  1M18 D;  1KX4 A;  5B1L D;  3REI C;  4ZBJ C;  2NQB C;  3KSY A;  1P3P D;  4X23 B;  3LZ1 A;  4J8U D;  5B0Y C;  1P3G A;  5DNN A;  5BNV B;  3AV2 B;  3B0C W;  1P3A C;  1HQ3 D;  3W98 D;  1S32 D;  4H9S A;  5E5A D;  3KXB B;  5B1M C;  5GT0 B;  4YM6 A;  5G49 A;  4Z5T B;  5AVB A;  5E5A C;  4H9R B;  5AY8 C;  1P3K C;  3REL B;  2CV5 C;  3AYW B;  1P3B C;  3B0B A;  3LEL C;  1P3M D;  4ZUX B;  3REJ B;  5AY8 D;  3C1C A;  4KUD B;  5B2I B;  3X1U B;  3AZM B;  4CSR A;  1ZLA A;  1P3L D;  5DNM B;  4ZBJ B;  5CPJ A;  3B6G D;  5B33 A;  3AZJ D;  1JFI B;  3LJA A;  1BFM A;  4KGC D;  5BT1 C;  1M18 B;  3LEL D;  1P3M C;  3AZF C;  5GXQ A;  3KWQ D;  3MGS B;  3UTA D;  3AV2 D;  3KUY C;  1P3B B;  2RVQ C;  1KX5 C;  5GSU D;  4J8V C;  1P3A D;  2HIO A;  4H9O A;  4WU9 A;  4H9N A;  4QLC C;  3C1B C;  3REL D;  1EQZ A;  1TAF B;  1ID3 A;  1B67 A;  5B0Y A;  5B0Z D;  1P3G C;  3AZG A;  3MGP C;  3MNN B;  5B2J D;  5B31 D;  3V9R A;  5JA4 A;  4WU8 B;  5B1M A;  2CV5 D;  2F8N D;  3MGP D;  4QLC D;  1KX3 A;  3MGS C;  5CPK D;  4KGC B;  3B6F A;  3LEL B;  1M19 A;  5CPI A;  5CPK C;  3X1S B;  3VH5 T;  1F66 B;  4WNN B;  3AZH D;  2NZD B;  3C1B D;  3UT9 A;  3B0C T;  3UTA B;  3AV1 C;  3MGR D;  5B24 B;  1P3B D;  5FUG A;  5AV5 A;  4X23 D;  4J8U B;  5GT3 D;  5B1L C;  2BYK B;  3REI D;  3AFA D;  3WKJ C;  4X23 C;  1KX4 C;  3W99 B;  4LD9 D;  3LZ0 C;  2ARO D;  3AZI C;  4NE3 A;  4H9Q A;  4DRA A;  5B0Z B;  1KX5 D;  1M1A A;  4KGC C;  4XUJ A;  1AOI B;  4Z66 C;  5DNN D;  3NQJ A;  5AY8 B;  2L5A A;  1HQ3 A;  4Z5T C;  1S32 A;  5AVB C;  5E5A A;  2FJ7 B;  3X1V D;  3AZE B;  1P3K A;  4YS3 B;  3AYW C;  1P3O A;  5AVB D;  3X1V C;  3VH5 A;  3AZH B;  3AZN C;  3WKJ D;  4LD9 C;  3LZ0 B;  3AZI B;  3MGR B;  1U35 D;  1P34 B;  5JRG D;  4J8X D;  3AN2 D;  5B33 C;  1ZLA D;  5B40 B;  1P3L A;  5CPJ D;  3NQU A;  2BYM A;  4UUZ B;  4G92 C;  3W99 D;  3WAA A;  3TU4 B;  3AZF A;  3A6N A;  2NQB D;  3UTB B;  1P3A B;  1F66 C;  5F99 D;  4XZQ B;  3MVD B;  1KX5 B;  1TZY D;  5AV9 B;  4YS3 C;  2YFW B;  3KWQ A;  5B1L A;  3WA9 D;  4H9P B;  3AZH C;  3AZN B;  2CWE A;  2PYO B;  3AZK A;  3AZE D;  3C1C C;  1P3G D;  5B31 B;  3R45 A;  1F1E A;  1ID3 C;  3W98 A;  3MGP B;  3MGQ C;  5AVC B;  4XUJ C;  4CAY A;  5BS7 A;  1ID3 D;  4WV4 B;  3AZG D;  1P3P B;  3X1T B;  1P3M A;  5B2J A;  4E44 A;  5B1M D;  5CP6 C;  1A7W A;  5CPI C;  4EO5 B;  3AV1 B;  5CPK A;  5GT3 B;  3KXB D;  5GT0 D;  3W96 B;  5BNX A;  3MVD D;  3REK A;  3UT9 C;  5B32 B;  5B31 C;  2HIO C;  5B32 G;  4R8P A;  1P34 C;  1H3O A;  4ZUX D;  5AV5 C;  3C1B A;  3REJ D;  1P3F A;  1TZY C;  1KX4 B;  1P3L C;  5GXQ D;  4X23 A;  3LZ1 B;  1WWI A;  5AV8 D;  1P3G B;  3TU4 C;  5DNN B;  2JSS A;  1U35 C;  5BNV A;  3AV2 A;  3B6G B;  3AZJ B;  5AVC D;  1KU5 A;  4WU9 D;  5AVB B;  1M1A D;  3REL A;  1HQ3 C;  1M19 C;  5AV6 B;  3AZK C;  5B0Y D;  5B2I A;  1P34 D;  5C3I B;  3B0D C;  3X1U A;  5GSU B;  3AZM A;  3MGQ A;  3X1V A;  5B40 D;  1P3K D;  5CPJ B;  5JRG C;  4J8X C;  5B33 B;  5B32 D;  4Z2M H;  1KX3 D;  3TU4 D;  5DNN C;  1JFI A;  3MGR C;  3UTB D;  1P3I B;  3WKJ A;  1M19 D;  4H9S C;  3VH6 T;  4JJN A;  5GXQ B;  3AFA C;  3REH B;  4J8W C;  3AYW D;  2CV5 B;  2F8N B;  3W96 C;  1P3B A;  3O62 A;  4QLC B;  3WTP B;  4ZUX C;  4NE6 A;  5AV5 D;  4Z66 A;  3A6N D;  5DNM D;  4H9O B;  2HIO B;  4WU9 B;  2PYO C;  1BH9 B;  1TZY A;  3X1S D;  3AZE C;  1P3O C;  2LY8 A;  1EQZ B;  5AV6 D;  1TAF A;  4M6B A;  5B0Y B;  4WZS B;  3W97 A;  3WA9 A;  3LJA C;  3AZG B;  3AV2 C;  1M18 C;  5BO0 B;  3REI B;  1B6W A;  3MGS D;  3V9R B;  5GXQ C;  3AFA B;  2F8N K;  5BS7 C;  4J8W B;  2ARO B;  4KHA B;  3AV1 D;  3REL C;  3AZL A;  4DRB A;  3B6F B;  5AV6 C;  4EO5 C;  3UTB C;  3REH D;  5GT0 C; 
#chains in the Genus database with same CATH topology
 5CP6 B;  1F66 A;  4WNN A;  2RVQ D;  2NZD A;  3UT9 B;  2YFV A;  1PZR A;  5B24 A;  5JRG A;  3WTP D;  3KWQ C;  5AV5 B;  4J8X A;  3MNN D;  4KUD C;  4YS3 D;  3AZG C;  1P3I C;  1P3F C;  1WWS A;  3W99 A;  5B0Z C;  3WAA D;  2ZY4 A;  4R8P D;  5KDM B;  2NQB A;  4H9Q B;  5CHL B;  5F99 A;  3W98 C;  1KX3 C;  1U35 B;  3A1I A;  4XUJ B;  3AN2 B;  5BT1 D;  3H0L C;  2W8S A;  5AV8 A;  3NQJ B;  4J8W D;  1HQ3 B;  2Y2M A;  1BH8 B;  3UTA C;  3AZK D;  1P3K B;  3AZE A;  3KUY B;  1N1J A;  1P3O B;  4AWL C;  5C3I C;  2DQN C;  4J8U C;  4J8V B;  4LD9 B;  4G91 B;  1P3I D;  3REK C;  3X1U C;  3AZM C;  3LZ0 A;  3AZI A;  5CPJ C;  1P34 A;  1AOI D;  3X1U D;  3AZM D;  5B40 A;  2ARO C;  3VH5 W;  1P3L B;  4HGA C;  3NQU B;  2UWX A;  1AOI C;  3EPJ A;  2BYM B;  4UUZ A;  3AZL C;  3WAA B;  3TU4 A;  2FJ7 D;  2G5I C;  3KXB A;  3UTB A;  5GT0 A;  4YM6 B;  5G49 B;  4Z5T A;  4XZQ A;  3WTP C;  3MVD A;  3REK D;  4H9R A;  2FJ7 C;  4NFT A;  3AYW A;  4ZUX A;  3REJ A;  1P3F D;  3C1C B;  4KUD A;  4WU9 C;  4H9P A;  3AZN A;  4Z66 D;  2PYO A;  4CSR B;  1ZLA B;  5DNM A;  3R45 B;  5B2I C;  3A1K A;  4J8V D;  2Y2K A;  3LJA B;  5AVC A;  2IO5 B;  4CAY B;  1M18 A;  3X1T C;  4G92 B;  1KX4 D;  3WAA C;  3W97 D;  1Q9C A;  3A6N C;  5AV9 D;  1P3P A;  5CP6 D;  1P3M B;  1ULY A;  3MGS A;  4JJN C;  5B2J B;  3REH C;  5B2I D;  3AV1 A;  5CPK B;  3MGQ D;  4YM6 D;  3W96 A;  5BNX B;  4H9N B;  3O62 C;  3REK B;  5B32 A;  4R8P B;  1F66 D;  1H3O B;  3C1B B;  1P3F B;  1ID3 B;  3C1C D;  5B40 C;  4JJN D;  3X1T D;  3W99 C;  2F8N G;  3MNN A;  3VH6 A;  3W97 C;  5JA4 B;  4WU8 A;  3KXB C;  5B1M B;  3AN2 C;  3B6G A;  3AZJ A;  3O62 D;  1KX3 B;  4Z2M G;  1M1A C;  4KGC A;  3KUY D;  2VQR A;  3LEL A;  1M19 B;  5CPI B;  3X1S A;  3EPL A;  2HUE B;  4WJ3 C;  5AV6 A;  3UTA A;  1ZLA C;  5AV9 C;  5DNM C;  1R4V A;  5FUG B;  2NZD C;  3LZ1 D;  4J8U A;  5GSU A;  3X1V B;  3MGQ B;  2BYK A;  5AVC C;  2IO5 C;  3LZ1 C;  1P3I A;  5B31 G;  1P3P C;  3AZL D;  3WKJ B;  4UPK A;  5B0Z A;  3LZ0 D;  4JJN B;  3AZI D;  1HTA A;  1M1A B;  4HGA B;  3REH A;  2XD5 A;  1AOI A;  2F8N H;  5F99 C;  2NZD D;  5AY8 A;  1T3U A;  2CV5 A;  5B24 D;  2F8N A;  5AV8 C;  4QLC A;  3WTP A;  3VH6 W;  4Z66 B;  5E5A B;  3O62 B;  3MVD C;  1S32 B;  2BG1 A;  2FJ7 A;  4YS3 A;  4Z5T D;  5CPI D;  3REJ C;  5B33 D;  3B0D B;  1BH9 A;  1TZY B;  5GT3 C;  3LJA D;  3AZH A;  4E45 A;  3UT9 D;  3KFU G;  3MNN C;  4KUD D;  3W97 B;  3WA9 B;  3MGR A;  4WU8 C;  2PYO D;  5BO0 A;  3REI A;  3AFA A;  4J8W A;  3B6F C;  2JE5 A;  2ARO A;  4KHA A;  3AZF B;  3A6N B;  1P3A A;  3AZL B;  2HIO D;  5B2J C;  1KX5 A;  2Y2J A;  4XUJ D;  5AV9 A;  4YM6 C;  5CP6 A;  2YFW A;  4XZQ C;  3KWQ B;  1EQZ D;  2YFV B;  5GSU C;  5B1L B;  5JRG B;  4J8X B;  1EQZ C;  5B32 C;  3EPK A;  3AZK B;  2JCH A;  3WA9 C;  4R8P C;  5B31 A;  3W96 D;  1P3O D;  3W98 B;  3MGP A;  2ZY3 A;  5KDM A;  2NQB B;  3EG5 B;  3B6F D;  5F99 B;  4XZQ D;  3H0R C;  1U35 A;  2Y2L A;  3AN2 A;  3B6G C;  3X1T A;  3AZJ C;  5AV8 B;  1S32 C;  4WU8 D;  3AZN D;  4AWL B;  1BH8 A;  3AZF D;  3WTP E;  5GT3 A;  3KUY A;  3X1S C;  2HUE C;  1N1J B;  4NE5 A;  5B24 C;  4G91 C;  4J8V A;  2Y2P A;  4LD9 A;  2Y2H A;  1M18 D;  1KX4 A;  5B1L D;  3REI C;  4ZBJ C;  2NQB C;  3KSY A;  1P3P D;  4X23 B;  3LZ1 A;  4J8U D;  5B0Y C;  1P3G A;  5DNN A;  5BNV B;  3AV2 B;  3B0C W;  1P3A C;  1HQ3 D;  3W98 D;  1S32 D;  4H9S A;  5E5A D;  3KXB B;  5B1M C;  5GT0 B;  4YM6 A;  5G49 A;  4Z5T B;  5AVB A;  5E5A C;  4H9R B;  5AY8 C;  1P3K C;  3REL B;  2CV5 C;  3AYW B;  1P3B C;  3B0B A;  3LEL C;  1P3M D;  4ZUX B;  3REJ B;  5AY8 D;  3C1C A;  4KUD B;  5B2I B;  2Y2Q A;  1Z2C B;  3X1U B;  3AZM B;  4CSR A;  1ZLA A;  1P3L D;  5DNM B;  4ZBJ B;  5CPJ A;  3B6G D;  5B33 A;  3FDD A;  3AZJ D;  1JFI B;  3LJA A;  1BFM A;  4KGC D;  2FFF B;  5BT1 C;  3F6T A;  1M18 B;  3LEL D;  1P3M C;  3AZF C;  5GXQ A;  3KWQ D;  3MGS B;  3UTA D;  3AV2 D;  3KUY C;  1P3B B;  2RVQ C;  1KX5 C;  5GSU D;  4J8V C;  2DF4 C;  1P3A D;  2HIO A;  4H9O A;  4WU9 A;  4H9N A;  4QLC C;  3C1B C;  3REL D;  1EQZ A;  1TAF B;  1ID3 A;  1B67 A;  5B0Y A;  5B0Z D;  1P3G C;  3AZG A;  3MGP C;  3MNN B;  5B2J D;  5B31 D;  3V9R A;  5JA4 A;  4WU8 B;  5B1M A;  2CV5 D;  2F8N D;  3MGP D;  4QLC D;  1KX3 A;  3MGS C;  5CPK D;  4KGC B;  2ZY5 A;  3B6F A;  3LEL B;  1M19 A;  5CPI A;  5CPK C;  3X1S B;  3VH5 T;  2ZM5 A;  1F66 B;  4WNN B;  3AZH D;  2NZD B;  3C1B D;  3UT9 A;  3B0C T;  3UTA B;  3AV1 C;  3MGR D;  5B24 B;  1P3B D;  5FUG A;  5AV5 A;  4X23 D;  4J8U B;  5GT3 D;  5B1L C;  2BYK B;  3REI D;  3AFA D;  2J8P A;  3WKJ C;  4X23 C;  1KX4 C;  3W99 B;  4LD9 D;  3LZ0 C;  2ARO D;  3AZI C;  4NE3 A;  4H9Q A;  4DRA A;  5B0Z B;  1KX5 D;  1M1A A;  4KGC C;  4XUJ A;  1AOI B;  4Z66 C;  5DNN D;  3NQJ A;  5AY8 B;  2L5A A;  1HQ3 A;  4Z5T C;  1S32 A;  5AVB C;  5E5A A;  2FJ7 B;  3X1V D;  3AZE B;  1P3K A;  4YS3 B;  3AYW C;  1P3O A;  5AVB D;  3X1V C;  3VH5 A;  2G5H C;  3AZH B;  3AZN C;  3WKJ D;  4LD9 C;  3LZ0 B;  3AZI B;  3MGR B;  1U35 D;  1P34 B;  5JRG D;  4J8X D;  2XD1 A;  3AN2 D;  5B33 C;  1ZLA D;  5B40 B;  1P3L A;  5CPJ D;  3NQU A;  2BYM A;  4UUZ B;  4G92 C;  3W99 D;  3WAA A;  3TU4 B;  1W2E A;  3AZF A;  3A6N A;  3AL0 C;  2NQB D;  3UTB B;  1P3A B;  1F66 C;  5F99 D;  4XZQ B;  3MVD B;  1KX5 B;  1TZY D;  5AV9 B;  2Y2O A;  4YS3 C;  2YFW B;  3KWQ A;  3EPH A;  5B1L A;  3WA9 D;  4H9P B;  3AZH C;  3AZN B;  2CWE A;  2PYO B;  3AZK A;  3AZE D;  3C1C C;  1P3G D;  5B31 B;  3R45 A;  1F1E A;  1ID3 C;  3W98 A;  3MGP B;  3MGQ C;  5AVC B;  4XUJ C;  4CAY A;  5BS7 A;  1ID3 D;  4WV4 B;  3AZG D;  1P3P B;  3X1T B;  1P3M A;  5B2J A;  4E44 A;  5B1M D;  5CP6 C;  1A7W A;  2Y2I A;  5CPI C;  4EO5 B;  3AV1 B;  5CPK A;  5GT3 B;  3KXB D;  5GT0 D;  3W96 B;  5BNX A;  3MVD D;  3REK A;  3UT9 C;  5B32 B;  5B31 C;  2HIO C;  5B32 G;  4R8P A;  1P34 C;  1H3O A;  4ZUX D;  5AV5 C;  3C1B A;  3REJ D;  1P3F A;  1TZY C;  1KX4 B;  1P3L C;  5GXQ D;  4X23 A;  3LZ1 B;  1WWI A;  5AV8 D;  1P3G B;  3TU4 C;  5DNN B;  2JSS A;  1U35 C;  5BNV A;  3AV2 A;  3B6G B;  4DQY B;  3AZJ B;  5AVC D;  1KU5 A;  4WU9 D;  5AVB B;  1M1A D;  3REL A;  1HQ3 C;  1M19 C;  5AV6 B;  3AZK C;  5B0Y D;  5B2I A;  2ZY2 A;  1P34 D;  3H0M C;  5C3I B;  2F2A C;  3B0D C;  3X1U A;  5GSU B;  3AZM A;  3MGQ A;  3X1V A;  5B40 D;  1P3K D;  5CPJ B;  5JRG C;  4J8X C;  5B33 B;  3P5J B;  5B32 D;  4Z2M H;  1KX3 D;  3TU4 D;  5DNN C;  1JFI A;  3MGR C;  3UTB D;  1P3I B;  2Y2G A;  3WKJ A;  1M19 D;  4H9S C;  3VH6 T;  4JJN A;  5GXQ B;  3AFA C;  3REH B;  4J8W C;  3AYW D;  2RIQ A;  2CV5 B;  2F8N B;  3W96 C;  1P3B A;  4QLC B;  3WTP B;  4Z66 A;  4ZUX C;  4NE6 A;  5AV5 D;  3O62 A;  3A6N D;  5DNM D;  2HIO B;  4H9O B;  4WU9 B;  2PYO C;  1BH9 B;  1TZY A;  3X1S D;  3AZE C;  2Y2N A;  1P3O C;  2LY8 A;  1EQZ B;  5AV6 D;  1TAF A;  3IP4 C;  4M6B A;  5B0Y B;  4WZS B;  3W97 A;  3WA9 A;  3LJA C;  3AZG B;  3AV2 C;  1M18 C;  5BO0 B;  3REI B;  1B6W A;  3MGS D;  3V9R B;  5GXQ C;  3AFA B;  2F8N K;  5BS7 C;  4J8W B;  2ARO B;  4KHA B;  3AV1 D;  3REL C;  3AZL A;  4DRB A;  3B6F B;  5AV6 C;  4EO5 C;  3UTB C;  3REH D;  5GT0 C; 
#chains in the Genus database with same CATH homology
 5CP6 B;  1F66 A;  4WNN A;  2RVQ D;  2NZD A;  3UT9 B;  2YFV A;  1PZR A;  5B24 A;  5JRG A;  3WTP D;  3KWQ C;  5AV5 B;  4J8X A;  3MNN D;  4KUD C;  4YS3 D;  3AZG C;  1P3I C;  1P3F C;  1WWS A;  3W99 A;  5B0Z C;  3WAA D;  2ZY4 A;  4R8P D;  5KDM B;  2NQB A;  4H9Q B;  5CHL B;  5F99 A;  3W98 C;  1KX3 C;  1U35 B;  3A1I A;  4XUJ B;  3AN2 B;  5BT1 D;  3H0L C;  2W8S A;  5AV8 A;  3NQJ B;  4J8W D;  1HQ3 B;  2Y2M A;  1BH8 B;  3UTA C;  3AZK D;  1P3K B;  3AZE A;  3KUY B;  1N1J A;  1P3O B;  4AWL C;  5C3I C;  2DQN C;  4J8U C;  4J8V B;  4LD9 B;  4G91 B;  1P3I D;  3REK C;  3X1U C;  3AZM C;  3LZ0 A;  3AZI A;  5CPJ C;  1P34 A;  1AOI D;  3X1U D;  3AZM D;  5B40 A;  2ARO C;  3VH5 W;  1P3L B;  4HGA C;  3NQU B;  2UWX A;  1AOI C;  3EPJ A;  2BYM B;  4UUZ A;  3AZL C;  3WAA B;  3TU4 A;  2FJ7 D;  2G5I C;  3KXB A;  3UTB A;  5GT0 A;  4YM6 B;  5G49 B;  4Z5T A;  4XZQ A;  3WTP C;  3MVD A;  3REK D;  4H9R A;  2FJ7 C;  4NFT A;  3AYW A;  4ZUX A;  3REJ A;  1P3F D;  3C1C B;  4KUD A;  4WU9 C;  4H9P A;  3AZN A;  4Z66 D;  2PYO A;  4CSR B;  1ZLA B;  5DNM A;  3R45 B;  5B2I C;  3A1K A;  4J8V D;  2Y2K A;  3LJA B;  5AVC A;  2IO5 B;  4CAY B;  1M18 A;  3X1T C;  4G92 B;  1KX4 D;  3WAA C;  3W97 D;  1Q9C A;  3A6N C;  5AV9 D;  1P3P A;  5CP6 D;  1P3M B;  1ULY A;  3MGS A;  4JJN C;  5B2J B;  3REH C;  5B2I D;  3AV1 A;  5CPK B;  3MGQ D;  4YM6 D;  3W96 A;  5BNX B;  4H9N B;  3O62 C;  3REK B;  5B32 A;  4R8P B;  1F66 D;  1H3O B;  3C1B B;  1P3F B;  1ID3 B;  3C1C D;  5B40 C;  4JJN D;  3X1T D;  3W99 C;  2F8N G;  3MNN A;  3VH6 A;  3W97 C;  5JA4 B;  4WU8 A;  3KXB C;  5B1M B;  3AN2 C;  3B6G A;  3AZJ A;  3O62 D;  1KX3 B;  4Z2M G;  1M1A C;  4KGC A;  3KUY D;  2VQR A;  3LEL A;  1M19 B;  5CPI B;  3X1S A;  3EPL A;  2HUE B;  4WJ3 C;  5AV6 A;  3UTA A;  1ZLA C;  5AV9 C;  5DNM C;  1R4V A;  5FUG B;  2NZD C;  3LZ1 D;  4J8U A;  5GSU A;  3X1V B;  3MGQ B;  2BYK A;  5AVC C;  2IO5 C;  3LZ1 C;  1P3I A;  5B31 G;  1P3P C;  3AZL D;  3WKJ B;  4UPK A;  5B0Z A;  3LZ0 D;  4JJN B;  3AZI D;  1HTA A;  1M1A B;  4HGA B;  3REH A;  2XD5 A;  1AOI A;  2F8N H;  5F99 C;  2NZD D;  5AY8 A;  1T3U A;  2CV5 A;  5B24 D;  2F8N A;  5AV8 C;  4QLC A;  3WTP A;  3VH6 W;  4Z66 B;  5E5A B;  3O62 B;  3MVD C;  1S32 B;  2BG1 A;  2FJ7 A;  4YS3 A;  4Z5T D;  5CPI D;  3REJ C;  5B33 D;  3B0D B;  1BH9 A;  1TZY B;  5GT3 C;  3LJA D;  3AZH A;  4E45 A;  3UT9 D;  3KFU G;  3MNN C;  4KUD D;  3W97 B;  3WA9 B;  3MGR A;  4WU8 C;  2PYO D;  5BO0 A;  3REI A;  3AFA A;  4J8W A;  3B6F C;  2JE5 A;  2ARO A;  4KHA A;  3AZF B;  3A6N B;  1P3A A;  3AZL B;  2HIO D;  5B2J C;  1KX5 A;  2Y2J A;  4XUJ D;  5AV9 A;  4YM6 C;  5CP6 A;  2YFW A;  4XZQ C;  3KWQ B;  1EQZ D;  2YFV B;  5GSU C;  5B1L B;  5JRG B;  4J8X B;  1EQZ C;  5B32 C;  3EPK A;  3AZK B;  2JCH A;  3WA9 C;  4R8P C;  5B31 A;  3W96 D;  1P3O D;  3W98 B;  3MGP A;  2ZY3 A;  5KDM A;  2NQB B;  3EG5 B;  3B6F D;  5F99 B;  4XZQ D;  3H0R C;  1U35 A;  2Y2L A;  3AN2 A;  3B6G C;  3X1T A;  3AZJ C;  5AV8 B;  1S32 C;  4WU8 D;  3AZN D;  4AWL B;  1BH8 A;  3AZF D;  3WTP E;  5GT3 A;  3KUY A;  3X1S C;  2HUE C;  1N1J B;  4NE5 A;  5B24 C;  4G91 C;  4J8V A;  2Y2P A;  4LD9 A;  2Y2H A;  1M18 D;  1KX4 A;  5B1L D;  3REI C;  4ZBJ C;  2NQB C;  3KSY A;  1P3P D;  4X23 B;  3LZ1 A;  4J8U D;  5B0Y C;  1P3G A;  5DNN A;  5BNV B;  3AV2 B;  3B0C W;  1P3A C;  1HQ3 D;  3W98 D;  1S32 D;  4H9S A;  5E5A D;  3KXB B;  5B1M C;  5GT0 B;  4YM6 A;  5G49 A;  4Z5T B;  5AVB A;  5E5A C;  4H9R B;  5AY8 C;  1P3K C;  3REL B;  2CV5 C;  3AYW B;  1P3B C;  3B0B A;  3LEL C;  1P3M D;  4ZUX B;  3REJ B;  5AY8 D;  3C1C A;  4KUD B;  5B2I B;  2Y2Q A;  1Z2C B;  3X1U B;  3AZM B;  4CSR A;  1ZLA A;  1P3L D;  5DNM B;  4ZBJ B;  5CPJ A;  3B6G D;  5B33 A;  3FDD A;  3AZJ D;  1JFI B;  3LJA A;  1BFM A;  4KGC D;  2FFF B;  5BT1 C;  3F6T A;  1M18 B;  3LEL D;  1P3M C;  3AZF C;  5GXQ A;  3KWQ D;  3MGS B;  3UTA D;  3AV2 D;  3KUY C;  1P3B B;  2RVQ C;  1KX5 C;  5GSU D;  4J8V C;  2DF4 C;  1P3A D;  2HIO A;  4H9O A;  4WU9 A;  4H9N A;  4QLC C;  3C1B C;  3REL D;  1EQZ A;  1TAF B;  1ID3 A;  1B67 A;  5B0Y A;  5B0Z D;  1P3G C;  3AZG A;  3MGP C;  3MNN B;  5B2J D;  5B31 D;  3V9R A;  5JA4 A;  4WU8 B;  5B1M A;  2CV5 D;  2F8N D;  3MGP D;  4QLC D;  1KX3 A;  3MGS C;  5CPK D;  4KGC B;  2ZY5 A;  3B6F A;  3LEL B;  1M19 A;  5CPI A;  5CPK C;  3X1S B;  3VH5 T;  2ZM5 A;  1F66 B;  4WNN B;  3AZH D;  2NZD B;  3C1B D;  3UT9 A;  3B0C T;  3UTA B;  3AV1 C;  3MGR D;  5B24 B;  1P3B D;  5FUG A;  5AV5 A;  4X23 D;  4J8U B;  5GT3 D;  5B1L C;  2BYK B;  3REI D;  3AFA D;  2J8P A;  3WKJ C;  4X23 C;  1KX4 C;  3W99 B;  4LD9 D;  3LZ0 C;  2ARO D;  3AZI C;  4NE3 A;  4H9Q A;  4DRA A;  5B0Z B;  1KX5 D;  1M1A A;  4KGC C;  4XUJ A;  1AOI B;  4Z66 C;  5DNN D;  3NQJ A;  5AY8 B;  2L5A A;  1HQ3 A;  4Z5T C;  1S32 A;  5AVB C;  5E5A A;  2FJ7 B;  3X1V D;  3AZE B;  1P3K A;  4YS3 B;  3AYW C;  1P3O A;  5AVB D;  3X1V C;  3VH5 A;  2G5H C;  3AZH B;  3AZN C;  3WKJ D;  4LD9 C;  3LZ0 B;  3AZI B;  3MGR B;  1U35 D;  1P34 B;  5JRG D;  4J8X D;  2XD1 A;  3AN2 D;  5B33 C;  1ZLA D;  5B40 B;  1P3L A;  5CPJ D;  3NQU A;  2BYM A;  4UUZ B;  4G92 C;  3W99 D;  3WAA A;  3TU4 B;  1W2E A;  3AZF A;  3A6N A;  3AL0 C;  2NQB D;  3UTB B;  1P3A B;  1F66 C;  5F99 D;  4XZQ B;  3MVD B;  1KX5 B;  1TZY D;  5AV9 B;  2Y2O A;  4YS3 C;  2YFW B;  3KWQ A;  3EPH A;  5B1L A;  3WA9 D;  4H9P B;  3AZH C;  3AZN B;  2CWE A;  2PYO B;  3AZK A;  3AZE D;  3C1C C;  1P3G D;  5B31 B;  3R45 A;  1F1E A;  1ID3 C;  3W98 A;  3MGP B;  3MGQ C;  5AVC B;  4XUJ C;  4CAY A;  5BS7 A;  1ID3 D;  4WV4 B;  3AZG D;  1P3P B;  3X1T B;  1P3M A;  5B2J A;  4E44 A;  5B1M D;  5CP6 C;  1A7W A;  2Y2I A;  5CPI C;  4EO5 B;  3AV1 B;  5CPK A;  5GT3 B;  3KXB D;  5GT0 D;  3W96 B;  5BNX A;  3MVD D;  3REK A;  3UT9 C;  5B32 B;  5B31 C;  2HIO C;  5B32 G;  4R8P A;  1P34 C;  1H3O A;  4ZUX D;  5AV5 C;  3C1B A;  3REJ D;  1P3F A;  1TZY C;  1KX4 B;  1P3L C;  5GXQ D;  4X23 A;  3LZ1 B;  1WWI A;  5AV8 D;  1P3G B;  3TU4 C;  5DNN B;  2JSS A;  1U35 C;  5BNV A;  3AV2 A;  3B6G B;  4DQY B;  3AZJ B;  5AVC D;  1KU5 A;  4WU9 D;  5AVB B;  1M1A D;  3REL A;  1HQ3 C;  1M19 C;  5AV6 B;  3AZK C;  5B0Y D;  5B2I A;  2ZY2 A;  1P34 D;  3H0M C;  5C3I B;  2F2A C;  3B0D C;  3X1U A;  5GSU B;  3AZM A;  3MGQ A;  3X1V A;  5B40 D;  1P3K D;  5CPJ B;  5JRG C;  4J8X C;  5B33 B;  3P5J B;  5B32 D;  4Z2M H;  1KX3 D;  3TU4 D;  5DNN C;  1JFI A;  3MGR C;  3UTB D;  1P3I B;  2Y2G A;  3WKJ A;  1M19 D;  4H9S C;  3VH6 T;  4JJN A;  5GXQ B;  3AFA C;  3REH B;  4J8W C;  3AYW D;  2RIQ A;  2CV5 B;  2F8N B;  3W96 C;  1P3B A;  4QLC B;  3WTP B;  4Z66 A;  4ZUX C;  4NE6 A;  5AV5 D;  3O62 A;  3A6N D;  5DNM D;  2HIO B;  4H9O B;  4WU9 B;  2PYO C;  1BH9 B;  1TZY A;  3X1S D;  3AZE C;  2Y2N A;  1P3O C;  2LY8 A;  1EQZ B;  5AV6 D;  1TAF A;  3IP4 C;  4M6B A;  5B0Y B;  4WZS B;  3W97 A;  3WA9 A;  3LJA C;  3AZG B;  3AV2 C;  1M18 C;  5BO0 B;  3REI B;  1B6W A;  3MGS D;  3V9R B;  5GXQ C;  3AFA B;  2F8N K;  5BS7 C;  4J8W B;  2ARO B;  4KHA B;  3AV1 D;  3REL C;  3AZL A;  4DRB A;  3B6F B;  5AV6 C;  4EO5 C;  3UTB C;  3REH D;  5GT0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...