4Z5TA

The nucleosome containing human h3.5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3C
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tA00
5CP6D 4Z2MG 3AZFB 3B0CT 4JJNC 3AZIA 4QLCD 4J8UA 4Z5TB 3W96C 3AZMD 5B1LC 5AY8C 1ZLAD 3MNNC 5GT0B 5B0ZC 1F66D 5AVCD 3KUYB 3KWQC 5GSUB 5GT3A 1JFIB 1AOIB 2FJ7A 4G92B 3AZED 2F8NA 4ZBJC 1ID3D 5CPJB 5AV6A 1P3GD 3WAAA 4J8XA 3C1CA 3X1VA 2AROB 5CPKB 3MGRD 5DNMB 3AZLA 4J8UB 4XZQC 2NQBA 2YFVA 5C3IB 3AV2D 3AZIB 4WU9B 5DNNC 5G49A 5F99D 4WU8D 1P3AA 3AZKD 5B2JD 3AV1A 3MGPB 3AFAA 2FJ7B 1P3MA 5AV8A 5B33D 3A6NC 3B6GA 2NZDC 1KX3A 3REJA 2CV5D 4H9PA 4J8XB 3C1BD 5E5AD 3C1CB 1BH9A 1P3LD 3X1VB 3WKJA 2HUEC 5AV5C 2BYMB 3O62C 3AZGD 1P3FA 3AZLB 2NQBB 4X23A 2YFVB 5B1MD 4YS3A 4R8PC 5G49B 3LELA 1ULYA 5BNXA 3AYWB 4YM6D 5B32A 3LZ0D 1P3AB 5AVBC 3WTPA 1P34D 3AV1B 5AV9C 3AZNA 1BH8A 5AV8B 3AZJB 5BT1C 1S32A 3LJAC 1KX5A 3W97D 3B6FA 5B40B 1KX4D 5B0YA 1M1AD 5GXQA 3REJB 1M19A 1M18A 3MVDA 3NQUA 3X1UD 1BH9B 3B0BA 1TZYD 4H9SA 1P3FB 1P3PB 4ZUXA 5B24C 4X23B 4KUDA 1N1JB 4JJND 1P3BA 4Z5TC 3UTBA 4YS3B 3W96D 5B1LD 5AY8D 3REKA 5GT0C 5BNXB 4QLCA 4XUJA 3MNND 1HTAA 4Z66B 4KGCD 3VH6A 5B32B 5B0ZD 5BNVA 3AZMA 3KUYC 3WTPB 1ZLAA 2IO5B 5GSUC 4NE3A 3KWQD 1AOIC 2RVQC 3AZNB 5AVCA 2PYOD 1BH8B 5CPJC 3AN2A 3R45B 3AZEA 1KX5B 1ID3A 3X1SA 3B6FB 5GXQB 3AZHC 1M19B 1M18B 3KSYA 3REIC 3MVDB 2AROC 3NQUB 5DNMC 5CPKC 4J8UC 3TU4B 4XZQD 5C3IC 5JA4A 1Q9CA 3AZIC 3MGRA 4WU9C 4CSRB 4H9NA 3UTBB 3AV2A 3REKB 3UT9A 2F8NK 4QLCB 4XUJB 1EQZD 5BNVB 3MGPC 3AZMB 1ZLAB 4LD9A 4WU8A 2FJ7C 4NFTA 3AZKA 3A6ND 5AVCB 2NZDD 3AN2B 4HGAB 3AZEB 5B33A 3X1SB 5BO0A 4J8XC 3X1VC 5BS7A 5AV5D 3O62D 3AZLC 1U35A 2NQBC 2CV5A 3C1BA 5E5AA 5JA4B 5B31A 3UTAC 3AZGA 3MGRB 4H9NB 3AYWC 5B2IA 3UT9B 5B1MA 3REHA 1TAFA 3AV1C 3B0DC 4LD9B 5AV9D 3W99B 4WU8B 5JRGA 3LZ0A 5AV8C 3AZKB 3AZJC 1P3IA 5BT1D 3LJAD 5B40C 5B33B 3REJC 5BO0B 5B32G 1KX4A 2HIOD 4J8VA 1P3FC 1P3PC 1U35B 5B24D 1HQ3C 4X23C 4AWLB 3C1BB 5B31B 3AZGB 5GT3B 4YS3C 2F8NB 5GT0D 4Z66C 5B32C 4H9RA 5B2IB 5B1MB 3RELC 3REHB 4WNNA 1TAFB 4UUZA 5B1LA 2IO5C 5AY8A 5AV6B 3KUYD 3MNNA 5GSUD 1AOID 3KXBA 3WAAB 4KGCA 5JRGB 2RVQD 3W98D 5CPIA 3KWQA 5CPJD 4H9OA 1P3IB 4E45A 1KX5C 4G91C 3B6FC 2PYOA 3MGSA 5GXQC 1M18C 3AZHD 3LZ1A 3MVDC 1P3KA 3REID 1KX4B 5CPKD 5DNMD 4J8VB 3TU4C 1F1EA 4J8UD 4H9SC 4WU9D 3AFAB 3VH5A 5KDMA 3UTBC 3X1TA 1P3MB 4J8WD 3REKC 4QLCC 4DRAA 4XUJC 3B6GB 4H9RB 1KX3B 4WNNB 3MGPD 3MGQD 4UUZB 5AY8B 3MNNB 3VH6W 3KXBB 1EQZA 2FJ7D 4KGCB 3WA9D 2F8NH 4H9PB 5CPIB 3WKJB 3AN2C 3KWQB 1KU5A 4H9OB 4HGAC 3AZEC 3X1SC 3A6NA 3AZFC 2PYOB 1A7WA 3MGSB 1P3OA 5CP6A 3LZ1B 3X1VD 1P3KB 1B6WA 3LELB 3AZLD 2NQBD 1WWIA 3UTAD 1B67A 4G92C 3X1TB 4CAYA 1F66A 3AYWD 3UT9C 2CWEA 1S32B 3AV1D 4LD9C 3W99C 4WU8C 5B0YB 4M6BA 1EQZB 5AV8D 1P3GA 3AZJD 2YFWA 5B31G 4H9QA 5B40D 4ZUXB 3REJD 4KUDB 2F8NG 1P3BB 5DNND 1P3OB 5CP6B 1U35C 1P3FD 1P3PD 3C1BC 1BFMA 1HQ3D 2HIOA 5B31C 3AZGC 2HUEB 5F99A 5GT3C 5B24A 4YS3D 5B2JA 4CAYB 1F66B 2L5AA 5B2IC 4Z66D 5B32D 3REHC 3RELD 5AV6C 1WWSA 1ID3B 3WAAC 5JRGC 3C1CC 1P3GB 1JFIA 1P3IC 2YFWB 3W98A 4H9QB 3B6FD 1H3OA 2LY8A 1P3LA 5GXQD 4WV4B 1M18D 3MVDD 4R8PD 4J8VC 3AV2B 3TU4D 3AZHA 1P3AC 3REIA 4EO5B 5AVBD 2HIOB 3AFAC 4YM6A 5F99B 3UTBD 1P3MC 5B24B 1P34A 5B2JB 3REKD 4WU9A 3B6GC 4XUJD 1KX3C 4J8WA 3KXBC 4WZSB 4KGCC 3W97A 3MGPA 5CPIC 3MGQA 3WKJC 3AN2D 1M1AA 3W98B 2PYOC 3WA9A 3X1SD 2CV5B 3AZFD 1H3OB 5E5AB 3X1UA 3MGSC 1P3LB 1TZYA 4Z5TD 3LZ1C 1P3KC 3VH6T 3LELC 4JJNA 4NE5A 2BYKA 3V9RA 3AZHB 3W96A 3WTPC 3REIB 2BYMA 4YM6B 3AZNC 5B0ZA 3LZ0B 3X1TC 1P34B 3UTAA 3UT9D 3VH5W 1S32C 4LD9D 3AYWA 4J8WB 5B0YC 3W99D 1EQZC 3B0CW 1M19C 3W97B 3MGQB 2AROD 1M1AB 4ZUXC 3AZJA 3WA9B 4KUDC 3X1UB 3AZID 1P3BC 1TZYB 4XZQA 5B40A 1P3OC 5CP6C 4JJNB 1U35D 5DNNA 2BYKB 4KHAA 3V9RB 3AZMC 1ZLAC 3W96B 5B31D 5B1LB 5FUGA 3NQJA 1P3PA 5GT3D 5B0ZB 1HQ3A 3WTPE 1F66C 1N1JA 5AVCC 2F8ND 3UTAB 5B2ID 3REHD 5AV6D 1ID3C 4ZBJB 4Z66A 3WAAD 5JRGD 2NZDA 3RELA 1P3GC 4J8XD 3C1CD 3B0DB 1P3ID 1R4VA 3MGRC 3R45A 5AV5A 3O62A 5KDMB 4XZQB 4J8VD 3AV2C 4DRBA 1P3AD 4EO5C 4KHAB 5DNNB 2HIOC 4R8PA 3AFAD 5F99C 5FUGB 3TU4A 3NQJB 3AZKC 5B2JC 5AVBA 1HQ3B 1P3MD 4CSRA 5CHLB 3B6GD 5AV9A 1KX3D 5B33C 3A6NB 3KXBD 2NZDB 3LJAA 3RELB 5CPID 3WKJD 5BS7C 4Z2MH 3W98C 4AWLC 2CV5C 1P3LC 5E5AC 4X23D 4NE6A 3MGSD 5AV5B 3O62B 3LZ1D 4G91B 1P3KD 3AZFA 3LELD 5B1MC 4Z5TA 3WTPD 4R8PB 5GT0A 4YM6C 3LZ0C 3AZND 3X1TD 2JSSA 1P34C 3KUYA 5AVBB 5GSUA 1AOIA 5AV9B 1S32D 1KX5D 4J8WC 5B0YD 5CPJA 1M19D 3LJAB 3W97C 3MGQC 1KX4C 3W99A 1M1AC 3WA9C 3VH5T 4ZUXD 3X1UC 2AROA 5CPKA 5DNMA 4KUDD 1TZYC 1P3BD 1P3OD 4E44A
chains in the Genus database with same CATH superfamily
5CP6D 4Z2MG 3AZFB 3B0CT 4JJNC 3AZIA 4QLCD 4J8UA 4Z5TB 3W96C 3AZMD 5B1LC 5AY8C 1ZLAD 3MNNC 5GT0B 5B0ZC 1F66D 5AVCD 3KUYB 3KWQC 5GSUB 5GT3A 1JFIB 1AOIB 2FJ7A 4G92B 3AZED 2F8NA 4ZBJC 1ID3D 3IP4C 5CPJB 5AV6A 1P3GD 3WAAA 2BG1A 4J8XA 3C1CA 3X1VA 2AROB 5CPKB 3MGRD 5DNMB 3AZLA 4J8UB 4XZQC 2NQBA 2YFVA 3H0RC 5C3IB 3AV2D 3AZIB 4WU9B 5DNNC 5G49A 5F99D 4WU8D 1P3AA 3AZKD 5B2JD 3AV1A 3MGPB 3AFAA 2FJ7B 1P3MA 5AV8A 5B33D 3A6NC 3B6GA 2NZDC 1KX3A 3EPJA 3REJA 2CV5D 4H9PA 4J8XB 3C1BD 5E5AD 3C1CB 1BH9A 1P3LD 3X1VB 3WKJA 2HUEC 5AV5C 2BYMB 3O62C 3AZGD 1P3FA 3AZLB 2NQBB 4X23A 2YFVB 5B1MD 3F6TA 4YS3A 4R8PC 5G49B 3LELA 1ULYA 5BNXA 3AYWB 4YM6D 5B32A 3LZ0D 1P3AB 5AVBC 3WTPA 1P34D 3AV1B 5AV9C 3AZNA 1BH8A 5AV8B 3AZJB 5BT1C 1S32A 3LJAC 2Y2PA 1KX5A 3W97D 3B6FA 5B40B 1KX4D 5B0YA 1M1AD 5GXQA 3REJB 1M19A 1M18A 3MVDA 3NQUA 3X1UD 1BH9B 3B0BA 1TZYD 4H9SA 1P3FB 1P3PB 4ZUXA 5B24C 4X23B 4KUDA 1N1JB 4JJND 1P3BA 4Z5TC 3UTBA 4YS3B 3W96D 5B1LD 5AY8D 2UWXA 3REKA 5GT0C 5BNXB 4QLCA 4XUJA 3MNND 1HTAA 4Z66B 4KGCD 3VH6A 5B32B 5B0ZD 5BNVA 3AZMA 3KUYC 3WTPB 1ZLAA 2IO5B 5GSUC 4NE3A 3KWQD 1AOIC 2RVQC 3AZNB 5AVCA 2PYOD 1BH8B 5CPJC 3AN2A 3R45B 3AZEA 1KX5B 1ID3A 3X1SA 3B6FB 2Y2KA 3EPKA 5GXQB 3AZHC 1M19B 1M18B 3KSYA 3REIC 3MVDB 2AROC 3NQUB 5DNMC 5CPKC 4J8UC 3TU4B 4XZQD 5C3IC 5JA4A 1Q9CA 3AZIC 3MGRA 1W2EA 4CSRB 4WU9C 2Y2NA 4H9NA 3UTBB 3AV2A 3REKB 3UT9A 2F8NK 4QLCB 4XUJB 1EQZD 4UPKA 4DQYB 5BNVB 3MGPC 3AZMB 1ZLAB 4LD9A 4WU8A 2FJ7C 4NFTA 3AZKA 3A6ND 5AVCB 2NZDD 2J8PA 3AN2B 4HGAB 3AZEB 5B33A 3X1SB 5BO0A 4J8XC 3X1VC 5BS7A 5AV5D 3O62D 3AZLC 1U35A 2NQBC 2CV5A 3C1BA 5E5AA 5JA4B 5B31A 3UTAC 3AZGA 3MGRB 4H9NB 3AYWC 5B2IA 3UT9B 5B1MA 3REHA 2G5IC 1TAFA 3AV1C 3B0DC 4LD9B 5AV9D 3W99B 4WU8B 5JRGA 3LZ0A 5AV8C 3AZKB 2Y2LA 3AZJC 1P3IA 5BT1D 3LJAD 5B40C 5B33B 3REJC 5BO0B 5B32G 1KX4A 2HIOD 4J8VA 1P3FC 1P3PC 3H0MC 3EPHA 1U35B 5B24D 1HQ3C 4X23C 4AWLB 3C1BB 2ZM5A 5B31B 3AZGB 5GT3B 4YS3C 2F8NB 5GT0D 4Z66C 5B32C 4H9RA 5B2IB 5B1MB 2RIQA 3RELC 3REHB 4WNNA 1TAFB 4UUZA 5B1LA 2IO5C 5AY8A 5AV6B 3KUYD 3MNNA 5GSUD 1AOID 3KXBA 3WAAB 4KGCA 5JRGB 2RVQD 1T3UA 3W98D 5CPIA 2W8SA 3KWQA 5CPJD 4H9OA 1P3IB 4E45A 1KX5C 4G91C 3B6FC 2PYOA 3MGSA 5GXQC 1M18C 3AZHD 3LZ1A 3MVDC 1P3KA 3REID 1KX4B 5CPKD 5DNMD 4J8VB 3TU4C 1F1EA 4J8UD 4H9SC 4WU9D 3AFAB 3VH5A 5KDMA 3UTBC 3X1TA 1P3MB 4J8WD 3REKC 4QLCC 4DRAA 4XUJC 3B6GB 4H9RB 1KX3B 4WNNB 3MGPD 3MGQD 4UUZB 5AY8B 3MNNB 3VH6W 3KXBB 1EQZA 2FJ7D 4KGCB 3WA9D 2F8NH 4H9PB 5CPIB 3WKJB 3AN2C 3KWQB 1KU5A 4H9OB 4HGAC 3AZEC 3X1SC 3A6NA 3AZFC 2PYOB 1A7WA 3MGSB 2XD1A 1P3OA 5CP6A 3LZ1B 3X1VD 1P3KB 1B6WA 3LELB 3A1KA 3AZLD 2NQBD 1WWIA 3FDDA 3UTAD 1B67A 4G92C 3X1TB 4CAYA 1F66A 3AYWD 3UT9C 2CWEA 1S32B 4WJ3C 3AV1D 4LD9C 3W99C 4WU8C 5B0YB 4M6BA 1EQZB 3H0LC 5AV8D 1P3GA 3AZJD 2YFWA 5B31G 4H9QA 5B40D 4ZUXB 3REJD 4KUDB 2F8NG 1P3BB 5DNND 1P3OB 5CP6B 2ZY4A 1U35C 1P3FD 1P3PD 3C1BC 1BFMA 1HQ3D 2HIOA 5B31C 3AZGC 2HUEB 5F99A 5GT3C 2ZY5A 5B24A 4YS3D 5B2JA 4CAYB 1F66B 2L5AA 5B2IC 2JE5A 4Z66D 5B32D 3REHC 3RELD 5AV6C 1WWSA 1ID3B 3WAAC 5JRGC 3C1CC 1P3GB 1JFIA 2VQRA 1PZRA 1P3IC 2YFWB 3W98A 4H9QB 3B6FD 1H3OA 2LY8A 1P3LA 3KFUG 5GXQD 4WV4B 2Y2GA 1M18D 3MVDD 4R8PD 4J8VC 3AV2B 3TU4D 2ZY2A 3AZHA 1P3AC 3REIA 5AVBD 4EO5B 2HIOB 3AFAC 4YM6A 5F99B 3UTBD 1P3MC 5B24B 1P34A 5B2JB 3REKD 4WU9A 3B6GC 4XUJD 1KX3C 4J8WA 2JCHA 3KXBC 4WZSB 4KGCC 3W97A 3MGPA 5CPIC 3MGQA 3WKJC 3AN2D 1M1AA 3W98B 2PYOC 3WA9A 3X1SD 2CV5B 3AZFD 1H3OB 5E5AB 3X1UA 3MGSC 1P3LB 1TZYA 3AL0C 4Z5TD 3LZ1C 1P3KC 3VH6T 3LELC 4JJNA 4NE5A 2BYKA 3V9RA 3AZHB 3W96A 3WTPC 3REIB 2BYMA 4YM6B 3AZNC 2Y2HA 5B0ZA 3LZ0B 3X1TC 1P34B 3UTAA 3UT9D 3VH5W 1S32C 2Y2JA 2Y2MA 4LD9D 3AYWA 4J8WB 5B0YC 3W99D 1EQZC 3B0CW 1M19C 3W97B 3MGQB 2AROD 1M1AB 4ZUXC 3AZJA 3WA9B 4KUDC 2Y2IA 3X1UB 3AZID 1P3BC 1TZYB 4XZQA 5B40A 1P3OC 2DQNC 5CP6C 2G5HC 4JJNB 1U35D 5DNNA 2BYKB 4KHAA 3V9RB 3AZMC 1ZLAC 3W96B 5B31D 5B1LB 3A1IA 5FUGA 3NQJA 1P3PA 5GT3D 5B0ZB 1HQ3A 3WTPE 1F66C 1N1JA 5AVCC 2F8ND 3UTAB 5B2ID 3REHD 5AV6D 1ID3C 4ZBJB 4Z66A 2F2AC 5JRGD 3WAAD 3RELA 2NZDA 1P3GC 4J8XD 3C1CD 3B0DB 1P3ID 1R4VA 3MGRC 3R45A 5AV5A 3EPLA 3O62A 5KDMB 4XZQB 4J8VD 3AV2C 4DRBA 2Y2QA 1P3AD 4EO5C 4KHAB 5DNNB 2HIOC 4R8PA 3AFAD 5F99C 5FUGB 3TU4A 3NQJB 3AZKC 5B2JC 5AVBA 1HQ3B 1P3MD 4CSRA 5CHLB 3B6GD 5AV9A 1KX3D 5B33C 3A6NB 3KXBD 2NZDB 3P5JB 3LJAA 3RELB 5CPID 3WKJD 5BS7C 2FFFB 4Z2MH 3W98C 4AWLC 2CV5C 1Z2CB 1P3LC 5E5AC 4X23D 4NE6A 3MGSD 5AV5B 3O62B 3LZ1D 4G91B 1P3KD 3AZFA 3LELD 2Y2OA 5B1MC 4Z5TA 3WTPD 4R8PB 5GT0A 4YM6C 3LZ0C 3AZND 3X1TD 2JSSA 1P34C 3KUYA 5AVBB 3EG5B 5GSUA 1AOIA 5AV9B 1S32D 1KX5D 4J8WC 5B0YD 5CPJA 2XD5A 1M19D 3LJAB 3W97C 3MGQC 1KX4C 3W99A 1M1AC 3WA9C 3VH5T 4ZUXD 2DF4C 2ZY3A 3X1UC 2AROA 5CPKA 5DNMA 4KUDD 1TZYC 1P3BD 1P3OD 4E44A
chains in the Genus database with same CATH topology
5CP6D 4Z2MG 3AZFB 3B0CT 4JJNC 3AZIA 4QLCD 4J8UA 4Z5TB 3W96C 3AZMD 5B1LC 5AY8C 1ZLAD 3MNNC 5GT0B 5B0ZC 1F66D 5AVCD 3KUYB 3KWQC 5GSUB 5GT3A 1JFIB 1AOIB 2FJ7A 4G92B 3AZED 2F8NA 4ZBJC 1ID3D 3IP4C 5CPJB 5AV6A 1P3GD 3WAAA 2BG1A 4J8XA 3C1CA 3X1VA 2AROB 5CPKB 3MGRD 5DNMB 3AZLA 4J8UB 4XZQC 2NQBA 2YFVA 3H0RC 5C3IB 3AV2D 3AZIB 4WU9B 5DNNC 5G49A 5F99D 4WU8D 1P3AA 3AZKD 5B2JD 3AV1A 3MGPB 3AFAA 2FJ7B 1P3MA 5AV8A 5B33D 3A6NC 3B6GA 2NZDC 1KX3A 3EPJA 3REJA 2CV5D 4H9PA 4J8XB 3C1BD 5E5AD 3C1CB 1BH9A 1P3LD 3X1VB 3WKJA 2HUEC 5AV5C 2BYMB 3O62C 3AZGD 1P3FA 3AZLB 2NQBB 4X23A 2YFVB 5B1MD 3F6TA 4YS3A 4R8PC 5G49B 3LELA 1ULYA 5BNXA 3AYWB 4YM6D 5B32A 3LZ0D 1P3AB 5AVBC 3WTPA 1P34D 3AV1B 5AV9C 3AZNA 1BH8A 5AV8B 3AZJB 5BT1C 1S32A 3LJAC 2Y2PA 1KX5A 3W97D 3B6FA 5B40B 1KX4D 5B0YA 1M1AD 5GXQA 3REJB 1M19A 1M18A 3MVDA 3NQUA 3X1UD 1BH9B 3B0BA 1TZYD 4H9SA 1P3FB 1P3PB 4ZUXA 5B24C 4X23B 4KUDA 1N1JB 4JJND 1P3BA 4Z5TC 3UTBA 4YS3B 3W96D 5B1LD 5AY8D 2UWXA 3REKA 5GT0C 5BNXB 4QLCA 4XUJA 3MNND 1HTAA 4Z66B 4KGCD 3VH6A 5B32B 5B0ZD 5BNVA 3AZMA 3KUYC 3WTPB 1ZLAA 2IO5B 5GSUC 4NE3A 3KWQD 1AOIC 2RVQC 3AZNB 5AVCA 2PYOD 1BH8B 5CPJC 3AN2A 3R45B 3AZEA 1KX5B 1ID3A 3X1SA 3B6FB 2Y2KA 3EPKA 5GXQB 3AZHC 1M19B 1M18B 3KSYA 3REIC 3MVDB 2AROC 3NQUB 5DNMC 5CPKC 4J8UC 3TU4B 4XZQD 5C3IC 5JA4A 1Q9CA 3AZIC 3MGRA 1W2EA 4CSRB 4WU9C 2Y2NA 4H9NA 3UTBB 3AV2A 3REKB 3UT9A 2F8NK 4QLCB 4XUJB 1EQZD 4UPKA 4DQYB 5BNVB 3MGPC 3AZMB 1ZLAB 4LD9A 4WU8A 2FJ7C 4NFTA 3AZKA 3A6ND 5AVCB 2NZDD 2J8PA 3AN2B 4HGAB 3AZEB 5B33A 3X1SB 5BO0A 4J8XC 3X1VC 5BS7A 5AV5D 3O62D 3AZLC 1U35A 2NQBC 2CV5A 3C1BA 5E5AA 5JA4B 5B31A 3UTAC 3AZGA 3MGRB 4H9NB 3AYWC 5B2IA 3UT9B 5B1MA 3REHA 2G5IC 1TAFA 3AV1C 3B0DC 4LD9B 5AV9D 3W99B 4WU8B 5JRGA 3LZ0A 5AV8C 3AZKB 2Y2LA 3AZJC 1P3IA 5BT1D 3LJAD 5B40C 5B33B 3REJC 5BO0B 5B32G 1KX4A 2HIOD 4J8VA 1P3FC 1P3PC 3H0MC 3EPHA 1U35B 5B24D 1HQ3C 4X23C 4AWLB 3C1BB 2ZM5A 5B31B 3AZGB 5GT3B 4YS3C 2F8NB 5GT0D 4Z66C 5B32C 4H9RA 5B2IB 5B1MB 2RIQA 3RELC 3REHB 4WNNA 1TAFB 4UUZA 5B1LA 2IO5C 5AY8A 5AV6B 3KUYD 3MNNA 5GSUD 1AOID 3KXBA 3WAAB 4KGCA 5JRGB 2RVQD 1T3UA 3W98D 5CPIA 2W8SA 3KWQA 5CPJD 4H9OA 1P3IB 4E45A 1KX5C 4G91C 3B6FC 2PYOA 3MGSA 5GXQC 1M18C 3AZHD 3LZ1A 3MVDC 1P3KA 3REID 1KX4B 5CPKD 5DNMD 4J8VB 3TU4C 1F1EA 4J8UD 4H9SC 4WU9D 3AFAB 3VH5A 5KDMA 3UTBC 3X1TA 1P3MB 4J8WD 3REKC 4QLCC 4DRAA 4XUJC 3B6GB 4H9RB 1KX3B 4WNNB 3MGPD 3MGQD 4UUZB 5AY8B 3MNNB 3VH6W 3KXBB 1EQZA 2FJ7D 4KGCB 3WA9D 2F8NH 4H9PB 5CPIB 3WKJB 3AN2C 3KWQB 1KU5A 4H9OB 4HGAC 3AZEC 3X1SC 3A6NA 3AZFC 2PYOB 1A7WA 3MGSB 2XD1A 1P3OA 5CP6A 3LZ1B 3X1VD 1P3KB 1B6WA 3LELB 3A1KA 3AZLD 2NQBD 1WWIA 3FDDA 3UTAD 1B67A 4G92C 3X1TB 4CAYA 1F66A 3AYWD 3UT9C 2CWEA 1S32B 4WJ3C 3AV1D 4LD9C 3W99C 4WU8C 5B0YB 4M6BA 1EQZB 3H0LC 5AV8D 1P3GA 3AZJD 2YFWA 5B31G 4H9QA 5B40D 4ZUXB 3REJD 4KUDB 2F8NG 1P3BB 5DNND 1P3OB 5CP6B 2ZY4A 1U35C 1P3FD 1P3PD 3C1BC 1BFMA 1HQ3D 2HIOA 5B31C 3AZGC 2HUEB 5F99A 5GT3C 2ZY5A 5B24A 4YS3D 5B2JA 4CAYB 1F66B 2L5AA 5B2IC 2JE5A 4Z66D 5B32D 3REHC 3RELD 5AV6C 1WWSA 1ID3B 3WAAC 5JRGC 3C1CC 1P3GB 1JFIA 2VQRA 1PZRA 1P3IC 2YFWB 3W98A 4H9QB 3B6FD 1H3OA 2LY8A 1P3LA 3KFUG 5GXQD 4WV4B 2Y2GA 1M18D 3MVDD 4R8PD 4J8VC 3AV2B 3TU4D 2ZY2A 3AZHA 1P3AC 3REIA 5AVBD 4EO5B 2HIOB 3AFAC 4YM6A 5F99B 3UTBD 1P3MC 5B24B 1P34A 5B2JB 3REKD 4WU9A 3B6GC 4XUJD 1KX3C 4J8WA 2JCHA 3KXBC 4WZSB 4KGCC 3W97A 3MGPA 5CPIC 3MGQA 3WKJC 3AN2D 1M1AA 3W98B 2PYOC 3WA9A 3X1SD 2CV5B 3AZFD 1H3OB 5E5AB 3X1UA 3MGSC 1P3LB 1TZYA 3AL0C 4Z5TD 3LZ1C 1P3KC 3VH6T 3LELC 4JJNA 4NE5A 2BYKA 3V9RA 3AZHB 3W96A 3WTPC 3REIB 2BYMA 4YM6B 3AZNC 2Y2HA 5B0ZA 3LZ0B 3X1TC 1P34B 3UTAA 3UT9D 3VH5W 1S32C 2Y2JA 2Y2MA 4LD9D 3AYWA 4J8WB 5B0YC 3W99D 1EQZC 3B0CW 1M19C 3W97B 3MGQB 2AROD 1M1AB 4ZUXC 3AZJA 3WA9B 4KUDC 2Y2IA 3X1UB 3AZID 1P3BC 1TZYB 4XZQA 5B40A 1P3OC 2DQNC 5CP6C 2G5HC 4JJNB 1U35D 5DNNA 2BYKB 4KHAA 3V9RB 3AZMC 1ZLAC 3W96B 5B31D 5B1LB 3A1IA 5FUGA 3NQJA 1P3PA 5GT3D 5B0ZB 1HQ3A 3WTPE 1F66C 1N1JA 5AVCC 2F8ND 3UTAB 5B2ID 3REHD 5AV6D 1ID3C 4ZBJB 4Z66A 2F2AC 5JRGD 3WAAD 3RELA 2NZDA 1P3GC 4J8XD 3C1CD 3B0DB 1P3ID 1R4VA 3MGRC 3R45A 5AV5A 3EPLA 3O62A 5KDMB 4XZQB 4J8VD 3AV2C 4DRBA 2Y2QA 1P3AD 4EO5C 4KHAB 5DNNB 2HIOC 4R8PA 3AFAD 5F99C 5FUGB 3TU4A 3NQJB 3AZKC 5B2JC 5AVBA 1HQ3B 1P3MD 4CSRA 5CHLB 3B6GD 5AV9A 1KX3D 5B33C 3A6NB 3KXBD 2NZDB 3P5JB 3LJAA 3RELB 5CPID 3WKJD 5BS7C 2FFFB 4Z2MH 3W98C 4AWLC 2CV5C 1Z2CB 1P3LC 5E5AC 4X23D 4NE6A 3MGSD 5AV5B 3O62B 3LZ1D 4G91B 1P3KD 3AZFA 3LELD 2Y2OA 5B1MC 4Z5TA 3WTPD 4R8PB 5GT0A 4YM6C 3LZ0C 3AZND 3X1TD 2JSSA 1P34C 3KUYA 5AVBB 3EG5B 5GSUA 1AOIA 5AV9B 1S32D 1KX5D 4J8WC 5B0YD 5CPJA 2XD5A 1M19D 3LJAB 3W97C 3MGQC 1KX4C 3W99A 1M1AC 3WA9C 3VH5T 4ZUXD 2DF4C 2ZY3A 3X1UC 2AROA 5CPKA 5DNMA 4KUDD 1TZYC 1P3BD 1P3OD 4E44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 D;  4Z2M G;  3AZF B;  3B0C T;  4JJN C;  3AZI A;  4QLC D;  4J8U A;  4Z5T B;  3W96 C;  3AZM D;  5B1L C;  5AY8 C;  1ZLA D;  3MNN C;  5GT0 B;  5B0Z C;  1F66 D;  5AVC D;  3KUY B;  3KWQ C;  5GSU B;  5GT3 A;  1JFI B;  1AOI B;  2FJ7 A;  4G92 B;  3AZE D;  2F8N A;  4ZBJ C;  1ID3 D;  5CPJ B;  5AV6 A;  1P3G D;  3WAA A;  4J8X A;  3C1C A;  3X1V A;  2ARO B;  5CPK B;  3MGR D;  5DNM B;  3AZL A;  4J8U B;  4XZQ C;  2NQB A;  2YFV A;  5C3I B;  3AV2 D;  3AZI B;  4WU9 B;  5DNN C;  5G49 A;  5F99 D;  4WU8 D;  1P3A A;  3AZK D;  5B2J D;  3AV1 A;  3MGP B;  3AFA A;  2FJ7 B;  1P3M A;  5AV8 A;  5B33 D;  3A6N C;  3B6G A;  2NZD C;  1KX3 A;  3REJ A;  2CV5 D;  4H9P A;  4J8X B;  3C1B D;  5E5A D;  3C1C B;  1BH9 A;  1P3L D;  3X1V B;  3WKJ A;  2HUE C;  5AV5 C;  2BYM B;  3O62 C;  3AZG D;  1P3F A;  3AZL B;  2NQB B;  4X23 A;  2YFV B;  5B1M D;  4YS3 A;  4R8P C;  5G49 B;  3LEL A;  1ULY A;  5BNX A;  3AYW B;  4YM6 D;  5B32 A;  3LZ0 D;  1P3A B;  5AVB C;  3WTP A;  1P34 D;  3AV1 B;  5AV9 C;  3AZN A;  1BH8 A;  5AV8 B;  3AZJ B;  5BT1 C;  1S32 A;  3LJA C;  1KX5 A;  3W97 D;  3B6F A;  5B40 B;  1KX4 D;  5B0Y A;  1M1A D;  5GXQ A;  3REJ B;  1M19 A;  1M18 A;  3MVD A;  3NQU A;  3X1U D;  1BH9 B;  3B0B A;  1TZY D;  4H9S A;  1P3F B;  1P3P B;  4ZUX A;  5B24 C;  4X23 B;  4KUD A;  1N1J B;  4JJN D;  1P3B A;  4Z5T C;  3UTB A;  4YS3 B;  3W96 D;  5B1L D;  5AY8 D;  3REK A;  5GT0 C;  5BNX B;  4QLC A;  4XUJ A;  3MNN D;  1HTA A;  4Z66 B;  4KGC D;  3VH6 A;  5B32 B;  5B0Z D;  5BNV A;  3AZM A;  3KUY C;  3WTP B;  1ZLA A;  2IO5 B;  5GSU C;  4NE3 A;  3KWQ D;  1AOI C;  2RVQ C;  3AZN B;  5AVC A;  2PYO D;  1BH8 B;  5CPJ C;  3AN2 A;  3R45 B;  3AZE A;  1KX5 B;  1ID3 A;  3X1S A;  3B6F B;  5GXQ B;  3AZH C;  1M19 B;  1M18 B;  3KSY A;  3REI C;  3MVD B;  2ARO C;  3NQU B;  5DNM C;  5CPK C;  4J8U C;  3TU4 B;  4XZQ D;  5C3I C;  5JA4 A;  1Q9C A;  3AZI C;  3MGR A;  4WU9 C;  4CSR B;  4H9N A;  3UTB B;  3AV2 A;  3REK B;  3UT9 A;  2F8N K;  4QLC B;  4XUJ B;  1EQZ D;  5BNV B;  3MGP C;  3AZM B;  1ZLA B;  4LD9 A;  4WU8 A;  2FJ7 C;  4NFT A;  3AZK A;  3A6N D;  5AVC B;  2NZD D;  3AN2 B;  4HGA B;  3AZE B;  5B33 A;  3X1S B;  5BO0 A;  4J8X C;  3X1V C;  5BS7 A;  5AV5 D;  3O62 D;  3AZL C;  1U35 A;  2NQB C;  2CV5 A;  3C1B A;  5E5A A;  5JA4 B;  5B31 A;  3UTA C;  3AZG A;  3MGR B;  4H9N B;  3AYW C;  5B2I A;  3UT9 B;  5B1M A;  3REH A;  1TAF A;  3AV1 C;  3B0D C;  4LD9 B;  5AV9 D;  3W99 B;  4WU8 B;  5JRG A;  3LZ0 A;  5AV8 C;  3AZK B;  3AZJ C;  1P3I A;  5BT1 D;  3LJA D;  5B40 C;  5B33 B;  3REJ C;  5BO0 B;  5B32 G;  1KX4 A;  2HIO D;  4J8V A;  1P3F C;  1P3P C;  1U35 B;  5B24 D;  1HQ3 C;  4X23 C;  4AWL B;  3C1B B;  5B31 B;  3AZG B;  5GT3 B;  4YS3 C;  2F8N B;  5GT0 D;  4Z66 C;  5B32 C;  4H9R A;  5B2I B;  5B1M B;  3REL C;  3REH B;  4WNN A;  1TAF B;  4UUZ A;  5B1L A;  2IO5 C;  5AY8 A;  5AV6 B;  3KUY D;  3MNN A;  5GSU D;  1AOI D;  3KXB A;  3WAA B;  4KGC A;  5JRG B;  2RVQ D;  3W98 D;  5CPI A;  3KWQ A;  5CPJ D;  4H9O A;  1P3I B;  4E45 A;  1KX5 C;  4G91 C;  3B6F C;  2PYO A;  3MGS A;  5GXQ C;  1M18 C;  3AZH D;  3LZ1 A;  3MVD C;  1P3K A;  3REI D;  1KX4 B;  5CPK D;  5DNM D;  4J8V B;  3TU4 C;  1F1E A;  4J8U D;  4H9S C;  4WU9 D;  3AFA B;  3VH5 A;  5KDM A;  3UTB C;  3X1T A;  1P3M B;  4J8W D;  3REK C;  4QLC C;  4DRA A;  4XUJ C;  3B6G B;  4H9R B;  1KX3 B;  4WNN B;  3MGP D;  3MGQ D;  4UUZ B;  5AY8 B;  3MNN B;  3VH6 W;  3KXB B;  1EQZ A;  2FJ7 D;  4KGC B;  3WA9 D;  2F8N H;  4H9P B;  5CPI B;  3WKJ B;  3AN2 C;  3KWQ B;  1KU5 A;  4H9O B;  4HGA C;  3AZE C;  3X1S C;  3A6N A;  3AZF C;  2PYO B;  1A7W A;  3MGS B;  1P3O A;  5CP6 A;  3LZ1 B;  3X1V D;  1P3K B;  1B6W A;  3LEL B;  3AZL D;  2NQB D;  1WWI A;  3UTA D;  1B67 A;  4G92 C;  3X1T B;  4CAY A;  1F66 A;  3AYW D;  3UT9 C;  2CWE A;  1S32 B;  3AV1 D;  4LD9 C;  3W99 C;  4WU8 C;  5B0Y B;  4M6B A;  1EQZ B;  5AV8 D;  1P3G A;  3AZJ D;  2YFW A;  5B31 G;  4H9Q A;  5B40 D;  4ZUX B;  3REJ D;  4KUD B;  2F8N G;  1P3B B;  5DNN D;  1P3O B;  5CP6 B;  1U35 C;  1P3F D;  1P3P D;  3C1B C;  1BFM A;  1HQ3 D;  2HIO A;  5B31 C;  3AZG C;  2HUE B;  5F99 A;  5GT3 C;  5B24 A;  4YS3 D;  5B2J A;  4CAY B;  1F66 B;  2L5A A;  5B2I C;  4Z66 D;  5B32 D;  3REH C;  3REL D;  5AV6 C;  1WWS A;  1ID3 B;  3WAA C;  5JRG C;  3C1C C;  1P3G B;  1JFI A;  1P3I C;  2YFW B;  3W98 A;  4H9Q B;  3B6F D;  1H3O A;  2LY8 A;  1P3L A;  5GXQ D;  4WV4 B;  1M18 D;  3MVD D;  4R8P D;  4J8V C;  3AV2 B;  3TU4 D;  3AZH A;  1P3A C;  3REI A;  4EO5 B;  5AVB D;  2HIO B;  3AFA C;  4YM6 A;  5F99 B;  3UTB D;  1P3M C;  5B24 B;  1P34 A;  5B2J B;  3REK D;  4WU9 A;  3B6G C;  4XUJ D;  1KX3 C;  4J8W A;  3KXB C;  4WZS B;  4KGC C;  3W97 A;  3MGP A;  5CPI C;  3MGQ A;  3WKJ C;  3AN2 D;  1M1A A;  3W98 B;  2PYO C;  3WA9 A;  3X1S D;  2CV5 B;  3AZF D;  1H3O B;  5E5A B;  3X1U A;  3MGS C;  1P3L B;  1TZY A;  4Z5T D;  3LZ1 C;  1P3K C;  3VH6 T;  3LEL C;  4JJN A;  4NE5 A;  2BYK A;  3V9R A;  3AZH B;  3W96 A;  3WTP C;  3REI B;  2BYM A;  4YM6 B;  3AZN C;  5B0Z A;  3LZ0 B;  3X1T C;  1P34 B;  3UTA A;  3UT9 D;  3VH5 W;  1S32 C;  4LD9 D;  3AYW A;  4J8W B;  5B0Y C;  3W99 D;  1EQZ C;  3B0C W;  1M19 C;  3W97 B;  3MGQ B;  2ARO D;  1M1A B;  4ZUX C;  3AZJ A;  3WA9 B;  4KUD C;  3X1U B;  3AZI D;  1P3B C;  1TZY B;  4XZQ A;  5B40 A;  1P3O C;  5CP6 C;  4JJN B;  1U35 D;  5DNN A;  2BYK B;  4KHA A;  3V9R B;  3AZM C;  1ZLA C;  3W96 B;  5B31 D;  5B1L B;  5FUG A;  3NQJ A;  1P3P A;  5GT3 D;  5B0Z B;  1HQ3 A;  3WTP E;  1F66 C;  1N1J A;  5AVC C;  2F8N D;  3UTA B;  5B2I D;  3REH D;  5AV6 D;  1ID3 C;  4ZBJ B;  4Z66 A;  3WAA D;  5JRG D;  2NZD A;  3REL A;  1P3G C;  4J8X D;  3C1C D;  3B0D B;  1P3I D;  1R4V A;  3MGR C;  3R45 A;  5AV5 A;  3O62 A;  5KDM B;  4XZQ B;  4J8V D;  3AV2 C;  4DRB A;  1P3A D;  4EO5 C;  4KHA B;  5DNN B;  2HIO C;  4R8P A;  3AFA D;  5F99 C;  5FUG B;  3TU4 A;  3NQJ B;  3AZK C;  5B2J C;  5AVB A;  1HQ3 B;  1P3M D;  4CSR A;  5CHL B;  3B6G D;  5AV9 A;  1KX3 D;  5B33 C;  3A6N B;  3KXB D;  2NZD B;  3LJA A;  3REL B;  5CPI D;  3WKJ D;  5BS7 C;  4Z2M H;  3W98 C;  4AWL C;  2CV5 C;  1P3L C;  5E5A C;  4X23 D;  4NE6 A;  3MGS D;  5AV5 B;  3O62 B;  3LZ1 D;  4G91 B;  1P3K D;  3AZF A;  3LEL D;  5B1M C;  4Z5T A;  3WTP D;  4R8P B;  5GT0 A;  4YM6 C;  3LZ0 C;  3AZN D;  3X1T D;  2JSS A;  1P34 C;  3KUY A;  5AVB B;  5GSU A;  1AOI A;  5AV9 B;  1S32 D;  1KX5 D;  4J8W C;  5B0Y D;  5CPJ A;  1M19 D;  3LJA B;  3W97 C;  3MGQ C;  1KX4 C;  3W99 A;  1M1A C;  3WA9 C;  3VH5 T;  4ZUX D;  3X1U C;  2ARO A;  5CPK A;  5DNM A;  4KUD D;  1TZY C;  1P3B D;  1P3O D;  4E44 A; 
#chains in the Genus database with same CATH topology
 5CP6 D;  4Z2M G;  3AZF B;  3B0C T;  4JJN C;  3AZI A;  4QLC D;  4J8U A;  4Z5T B;  3W96 C;  3AZM D;  5B1L C;  5AY8 C;  1ZLA D;  3MNN C;  5GT0 B;  5B0Z C;  1F66 D;  5AVC D;  3KUY B;  3KWQ C;  5GSU B;  5GT3 A;  1JFI B;  1AOI B;  2FJ7 A;  4G92 B;  3AZE D;  2F8N A;  4ZBJ C;  1ID3 D;  3IP4 C;  5CPJ B;  5AV6 A;  1P3G D;  3WAA A;  2BG1 A;  4J8X A;  3C1C A;  3X1V A;  2ARO B;  5CPK B;  3MGR D;  5DNM B;  3AZL A;  4J8U B;  4XZQ C;  2NQB A;  2YFV A;  3H0R C;  5C3I B;  3AV2 D;  3AZI B;  4WU9 B;  5DNN C;  5G49 A;  5F99 D;  4WU8 D;  1P3A A;  3AZK D;  5B2J D;  3AV1 A;  3MGP B;  3AFA A;  2FJ7 B;  1P3M A;  5AV8 A;  5B33 D;  3A6N C;  3B6G A;  2NZD C;  1KX3 A;  3EPJ A;  3REJ A;  2CV5 D;  4H9P A;  4J8X B;  3C1B D;  5E5A D;  3C1C B;  1BH9 A;  1P3L D;  3X1V B;  3WKJ A;  2HUE C;  5AV5 C;  2BYM B;  3O62 C;  3AZG D;  1P3F A;  3AZL B;  2NQB B;  4X23 A;  2YFV B;  5B1M D;  3F6T A;  4YS3 A;  4R8P C;  5G49 B;  3LEL A;  1ULY A;  5BNX A;  3AYW B;  4YM6 D;  5B32 A;  3LZ0 D;  1P3A B;  5AVB C;  3WTP A;  1P34 D;  3AV1 B;  5AV9 C;  3AZN A;  1BH8 A;  5AV8 B;  3AZJ B;  5BT1 C;  1S32 A;  3LJA C;  2Y2P A;  1KX5 A;  3W97 D;  3B6F A;  5B40 B;  1KX4 D;  5B0Y A;  1M1A D;  5GXQ A;  3REJ B;  1M19 A;  1M18 A;  3MVD A;  3NQU A;  3X1U D;  1BH9 B;  3B0B A;  1TZY D;  4H9S A;  1P3F B;  1P3P B;  4ZUX A;  5B24 C;  4X23 B;  4KUD A;  1N1J B;  4JJN D;  1P3B A;  4Z5T C;  3UTB A;  4YS3 B;  3W96 D;  5B1L D;  5AY8 D;  2UWX A;  3REK A;  5GT0 C;  5BNX B;  4QLC A;  4XUJ A;  3MNN D;  1HTA A;  4Z66 B;  4KGC D;  3VH6 A;  5B32 B;  5B0Z D;  5BNV A;  3AZM A;  3KUY C;  3WTP B;  1ZLA A;  2IO5 B;  5GSU C;  4NE3 A;  3KWQ D;  1AOI C;  2RVQ C;  3AZN B;  5AVC A;  2PYO D;  1BH8 B;  5CPJ C;  3AN2 A;  3R45 B;  3AZE A;  1KX5 B;  1ID3 A;  3X1S A;  3B6F B;  2Y2K A;  3EPK A;  5GXQ B;  3AZH C;  1M19 B;  1M18 B;  3KSY A;  3REI C;  3MVD B;  2ARO C;  3NQU B;  5DNM C;  5CPK C;  4J8U C;  3TU4 B;  4XZQ D;  5C3I C;  5JA4 A;  1Q9C A;  3AZI C;  3MGR A;  1W2E A;  4CSR B;  4WU9 C;  2Y2N A;  4H9N A;  3UTB B;  3AV2 A;  3REK B;  3UT9 A;  2F8N K;  4QLC B;  4XUJ B;  1EQZ D;  4UPK A;  4DQY B;  5BNV B;  3MGP C;  3AZM B;  1ZLA B;  4LD9 A;  4WU8 A;  2FJ7 C;  4NFT A;  3AZK A;  3A6N D;  5AVC B;  2NZD D;  2J8P A;  3AN2 B;  4HGA B;  3AZE B;  5B33 A;  3X1S B;  5BO0 A;  4J8X C;  3X1V C;  5BS7 A;  5AV5 D;  3O62 D;  3AZL C;  1U35 A;  2NQB C;  2CV5 A;  3C1B A;  5E5A A;  5JA4 B;  5B31 A;  3UTA C;  3AZG A;  3MGR B;  4H9N B;  3AYW C;  5B2I A;  3UT9 B;  5B1M A;  3REH A;  2G5I C;  1TAF A;  3AV1 C;  3B0D C;  4LD9 B;  5AV9 D;  3W99 B;  4WU8 B;  5JRG A;  3LZ0 A;  5AV8 C;  3AZK B;  2Y2L A;  3AZJ C;  1P3I A;  5BT1 D;  3LJA D;  5B40 C;  5B33 B;  3REJ C;  5BO0 B;  5B32 G;  1KX4 A;  2HIO D;  4J8V A;  1P3F C;  1P3P C;  3H0M C;  3EPH A;  1U35 B;  5B24 D;  1HQ3 C;  4X23 C;  4AWL B;  3C1B B;  2ZM5 A;  5B31 B;  3AZG B;  5GT3 B;  4YS3 C;  2F8N B;  5GT0 D;  4Z66 C;  5B32 C;  4H9R A;  5B2I B;  5B1M B;  2RIQ A;  3REL C;  3REH B;  4WNN A;  1TAF B;  4UUZ A;  5B1L A;  2IO5 C;  5AY8 A;  5AV6 B;  3KUY D;  3MNN A;  5GSU D;  1AOI D;  3KXB A;  3WAA B;  4KGC A;  5JRG B;  2RVQ D;  1T3U A;  3W98 D;  5CPI A;  2W8S A;  3KWQ A;  5CPJ D;  4H9O A;  1P3I B;  4E45 A;  1KX5 C;  4G91 C;  3B6F C;  2PYO A;  3MGS A;  5GXQ C;  1M18 C;  3AZH D;  3LZ1 A;  3MVD C;  1P3K A;  3REI D;  1KX4 B;  5CPK D;  5DNM D;  4J8V B;  3TU4 C;  1F1E A;  4J8U D;  4H9S C;  4WU9 D;  3AFA B;  3VH5 A;  5KDM A;  3UTB C;  3X1T A;  1P3M B;  4J8W D;  3REK C;  4QLC C;  4DRA A;  4XUJ C;  3B6G B;  4H9R B;  1KX3 B;  4WNN B;  3MGP D;  3MGQ D;  4UUZ B;  5AY8 B;  3MNN B;  3VH6 W;  3KXB B;  1EQZ A;  2FJ7 D;  4KGC B;  3WA9 D;  2F8N H;  4H9P B;  5CPI B;  3WKJ B;  3AN2 C;  3KWQ B;  1KU5 A;  4H9O B;  4HGA C;  3AZE C;  3X1S C;  3A6N A;  3AZF C;  2PYO B;  1A7W A;  3MGS B;  2XD1 A;  1P3O A;  5CP6 A;  3LZ1 B;  3X1V D;  1P3K B;  1B6W A;  3LEL B;  3A1K A;  3AZL D;  2NQB D;  1WWI A;  3FDD A;  3UTA D;  1B67 A;  4G92 C;  3X1T B;  4CAY A;  1F66 A;  3AYW D;  3UT9 C;  2CWE A;  1S32 B;  4WJ3 C;  3AV1 D;  4LD9 C;  3W99 C;  4WU8 C;  5B0Y B;  4M6B A;  1EQZ B;  3H0L C;  5AV8 D;  1P3G A;  3AZJ D;  2YFW A;  5B31 G;  4H9Q A;  5B40 D;  4ZUX B;  3REJ D;  4KUD B;  2F8N G;  1P3B B;  5DNN D;  1P3O B;  5CP6 B;  2ZY4 A;  1U35 C;  1P3F D;  1P3P D;  3C1B C;  1BFM A;  1HQ3 D;  2HIO A;  5B31 C;  3AZG C;  2HUE B;  5F99 A;  5GT3 C;  2ZY5 A;  5B24 A;  4YS3 D;  5B2J A;  4CAY B;  1F66 B;  2L5A A;  5B2I C;  2JE5 A;  4Z66 D;  5B32 D;  3REH C;  3REL D;  5AV6 C;  1WWS A;  1ID3 B;  3WAA C;  5JRG C;  3C1C C;  1P3G B;  1JFI A;  2VQR A;  1PZR A;  1P3I C;  2YFW B;  3W98 A;  4H9Q B;  3B6F D;  1H3O A;  2LY8 A;  1P3L A;  3KFU G;  5GXQ D;  4WV4 B;  2Y2G A;  1M18 D;  3MVD D;  4R8P D;  4J8V C;  3AV2 B;  3TU4 D;  2ZY2 A;  3AZH A;  1P3A C;  3REI A;  5AVB D;  4EO5 B;  2HIO B;  3AFA C;  4YM6 A;  5F99 B;  3UTB D;  1P3M C;  5B24 B;  1P34 A;  5B2J B;  3REK D;  4WU9 A;  3B6G C;  4XUJ D;  1KX3 C;  4J8W A;  2JCH A;  3KXB C;  4WZS B;  4KGC C;  3W97 A;  3MGP A;  5CPI C;  3MGQ A;  3WKJ C;  3AN2 D;  1M1A A;  3W98 B;  2PYO C;  3WA9 A;  3X1S D;  2CV5 B;  3AZF D;  1H3O B;  5E5A B;  3X1U A;  3MGS C;  1P3L B;  1TZY A;  3AL0 C;  4Z5T D;  3LZ1 C;  1P3K C;  3VH6 T;  3LEL C;  4JJN A;  4NE5 A;  2BYK A;  3V9R A;  3AZH B;  3W96 A;  3WTP C;  3REI B;  2BYM A;  4YM6 B;  3AZN C;  2Y2H A;  5B0Z A;  3LZ0 B;  3X1T C;  1P34 B;  3UTA A;  3UT9 D;  3VH5 W;  1S32 C;  2Y2J A;  2Y2M A;  4LD9 D;  3AYW A;  4J8W B;  5B0Y C;  3W99 D;  1EQZ C;  3B0C W;  1M19 C;  3W97 B;  3MGQ B;  2ARO D;  1M1A B;  4ZUX C;  3AZJ A;  3WA9 B;  4KUD C;  2Y2I A;  3X1U B;  3AZI D;  1P3B C;  1TZY B;  4XZQ A;  5B40 A;  1P3O C;  2DQN C;  5CP6 C;  2G5H C;  4JJN B;  1U35 D;  5DNN A;  2BYK B;  4KHA A;  3V9R B;  3AZM C;  1ZLA C;  3W96 B;  5B31 D;  5B1L B;  3A1I A;  5FUG A;  3NQJ A;  1P3P A;  5GT3 D;  5B0Z B;  1HQ3 A;  3WTP E;  1F66 C;  1N1J A;  5AVC C;  2F8N D;  3UTA B;  5B2I D;  3REH D;  5AV6 D;  1ID3 C;  4ZBJ B;  4Z66 A;  2F2A C;  5JRG D;  3WAA D;  3REL A;  2NZD A;  1P3G C;  4J8X D;  3C1C D;  3B0D B;  1P3I D;  1R4V A;  3MGR C;  3R45 A;  5AV5 A;  3EPL A;  3O62 A;  5KDM B;  4XZQ B;  4J8V D;  3AV2 C;  4DRB A;  2Y2Q A;  1P3A D;  4EO5 C;  4KHA B;  5DNN B;  2HIO C;  4R8P A;  3AFA D;  5F99 C;  5FUG B;  3TU4 A;  3NQJ B;  3AZK C;  5B2J C;  5AVB A;  1HQ3 B;  1P3M D;  4CSR A;  5CHL B;  3B6G D;  5AV9 A;  1KX3 D;  5B33 C;  3A6N B;  3KXB D;  2NZD B;  3P5J B;  3LJA A;  3REL B;  5CPI D;  3WKJ D;  5BS7 C;  2FFF B;  4Z2M H;  3W98 C;  4AWL C;  2CV5 C;  1Z2C B;  1P3L C;  5E5A C;  4X23 D;  4NE6 A;  3MGS D;  5AV5 B;  3O62 B;  3LZ1 D;  4G91 B;  1P3K D;  3AZF A;  3LEL D;  2Y2O A;  5B1M C;  4Z5T A;  3WTP D;  4R8P B;  5GT0 A;  4YM6 C;  3LZ0 C;  3AZN D;  3X1T D;  2JSS A;  1P34 C;  3KUY A;  5AVB B;  3EG5 B;  5GSU A;  1AOI A;  5AV9 B;  1S32 D;  1KX5 D;  4J8W C;  5B0Y D;  5CPJ A;  2XD5 A;  1M19 D;  3LJA B;  3W97 C;  3MGQ C;  1KX4 C;  3W99 A;  1M1A C;  3WA9 C;  3VH5 T;  4ZUX D;  2DF4 C;  2ZY3 A;  3X1U C;  2ARO A;  5CPK A;  5DNM A;  4KUD D;  1TZY C;  1P3B D;  1P3O D;  4E44 A; 
#chains in the Genus database with same CATH homology
 5CP6 D;  4Z2M G;  3AZF B;  3B0C T;  4JJN C;  3AZI A;  4QLC D;  4J8U A;  4Z5T B;  3W96 C;  3AZM D;  5B1L C;  5AY8 C;  1ZLA D;  3MNN C;  5GT0 B;  5B0Z C;  1F66 D;  5AVC D;  3KUY B;  3KWQ C;  5GSU B;  5GT3 A;  1JFI B;  1AOI B;  2FJ7 A;  4G92 B;  3AZE D;  2F8N A;  4ZBJ C;  1ID3 D;  3IP4 C;  5CPJ B;  5AV6 A;  1P3G D;  3WAA A;  2BG1 A;  4J8X A;  3C1C A;  3X1V A;  2ARO B;  5CPK B;  3MGR D;  5DNM B;  3AZL A;  4J8U B;  4XZQ C;  2NQB A;  2YFV A;  3H0R C;  5C3I B;  3AV2 D;  3AZI B;  4WU9 B;  5DNN C;  5G49 A;  5F99 D;  4WU8 D;  1P3A A;  3AZK D;  5B2J D;  3AV1 A;  3MGP B;  3AFA A;  2FJ7 B;  1P3M A;  5AV8 A;  5B33 D;  3A6N C;  3B6G A;  2NZD C;  1KX3 A;  3EPJ A;  3REJ A;  2CV5 D;  4H9P A;  4J8X B;  3C1B D;  5E5A D;  3C1C B;  1BH9 A;  1P3L D;  3X1V B;  3WKJ A;  2HUE C;  5AV5 C;  2BYM B;  3O62 C;  3AZG D;  1P3F A;  3AZL B;  2NQB B;  4X23 A;  2YFV B;  5B1M D;  3F6T A;  4YS3 A;  4R8P C;  5G49 B;  3LEL A;  1ULY A;  5BNX A;  3AYW B;  4YM6 D;  5B32 A;  3LZ0 D;  1P3A B;  5AVB C;  3WTP A;  1P34 D;  3AV1 B;  5AV9 C;  3AZN A;  1BH8 A;  5AV8 B;  3AZJ B;  5BT1 C;  1S32 A;  3LJA C;  2Y2P A;  1KX5 A;  3W97 D;  3B6F A;  5B40 B;  1KX4 D;  5B0Y A;  1M1A D;  5GXQ A;  3REJ B;  1M19 A;  1M18 A;  3MVD A;  3NQU A;  3X1U D;  1BH9 B;  3B0B A;  1TZY D;  4H9S A;  1P3F B;  1P3P B;  4ZUX A;  5B24 C;  4X23 B;  4KUD A;  1N1J B;  4JJN D;  1P3B A;  4Z5T C;  3UTB A;  4YS3 B;  3W96 D;  5B1L D;  5AY8 D;  2UWX A;  3REK A;  5GT0 C;  5BNX B;  4QLC A;  4XUJ A;  3MNN D;  1HTA A;  4Z66 B;  4KGC D;  3VH6 A;  5B32 B;  5B0Z D;  5BNV A;  3AZM A;  3KUY C;  3WTP B;  1ZLA A;  2IO5 B;  5GSU C;  4NE3 A;  3KWQ D;  1AOI C;  2RVQ C;  3AZN B;  5AVC A;  2PYO D;  1BH8 B;  5CPJ C;  3AN2 A;  3R45 B;  3AZE A;  1KX5 B;  1ID3 A;  3X1S A;  3B6F B;  2Y2K A;  3EPK A;  5GXQ B;  3AZH C;  1M19 B;  1M18 B;  3KSY A;  3REI C;  3MVD B;  2ARO C;  3NQU B;  5DNM C;  5CPK C;  4J8U C;  3TU4 B;  4XZQ D;  5C3I C;  5JA4 A;  1Q9C A;  3AZI C;  3MGR A;  1W2E A;  4CSR B;  4WU9 C;  2Y2N A;  4H9N A;  3UTB B;  3AV2 A;  3REK B;  3UT9 A;  2F8N K;  4QLC B;  4XUJ B;  1EQZ D;  4UPK A;  4DQY B;  5BNV B;  3MGP C;  3AZM B;  1ZLA B;  4LD9 A;  4WU8 A;  2FJ7 C;  4NFT A;  3AZK A;  3A6N D;  5AVC B;  2NZD D;  2J8P A;  3AN2 B;  4HGA B;  3AZE B;  5B33 A;  3X1S B;  5BO0 A;  4J8X C;  3X1V C;  5BS7 A;  5AV5 D;  3O62 D;  3AZL C;  1U35 A;  2NQB C;  2CV5 A;  3C1B A;  5E5A A;  5JA4 B;  5B31 A;  3UTA C;  3AZG A;  3MGR B;  4H9N B;  3AYW C;  5B2I A;  3UT9 B;  5B1M A;  3REH A;  2G5I C;  1TAF A;  3AV1 C;  3B0D C;  4LD9 B;  5AV9 D;  3W99 B;  4WU8 B;  5JRG A;  3LZ0 A;  5AV8 C;  3AZK B;  2Y2L A;  3AZJ C;  1P3I A;  5BT1 D;  3LJA D;  5B40 C;  5B33 B;  3REJ C;  5BO0 B;  5B32 G;  1KX4 A;  2HIO D;  4J8V A;  1P3F C;  1P3P C;  3H0M C;  3EPH A;  1U35 B;  5B24 D;  1HQ3 C;  4X23 C;  4AWL B;  3C1B B;  2ZM5 A;  5B31 B;  3AZG B;  5GT3 B;  4YS3 C;  2F8N B;  5GT0 D;  4Z66 C;  5B32 C;  4H9R A;  5B2I B;  5B1M B;  2RIQ A;  3REL C;  3REH B;  4WNN A;  1TAF B;  4UUZ A;  5B1L A;  2IO5 C;  5AY8 A;  5AV6 B;  3KUY D;  3MNN A;  5GSU D;  1AOI D;  3KXB A;  3WAA B;  4KGC A;  5JRG B;  2RVQ D;  1T3U A;  3W98 D;  5CPI A;  2W8S A;  3KWQ A;  5CPJ D;  4H9O A;  1P3I B;  4E45 A;  1KX5 C;  4G91 C;  3B6F C;  2PYO A;  3MGS A;  5GXQ C;  1M18 C;  3AZH D;  3LZ1 A;  3MVD C;  1P3K A;  3REI D;  1KX4 B;  5CPK D;  5DNM D;  4J8V B;  3TU4 C;  1F1E A;  4J8U D;  4H9S C;  4WU9 D;  3AFA B;  3VH5 A;  5KDM A;  3UTB C;  3X1T A;  1P3M B;  4J8W D;  3REK C;  4QLC C;  4DRA A;  4XUJ C;  3B6G B;  4H9R B;  1KX3 B;  4WNN B;  3MGP D;  3MGQ D;  4UUZ B;  5AY8 B;  3MNN B;  3VH6 W;  3KXB B;  1EQZ A;  2FJ7 D;  4KGC B;  3WA9 D;  2F8N H;  4H9P B;  5CPI B;  3WKJ B;  3AN2 C;  3KWQ B;  1KU5 A;  4H9O B;  4HGA C;  3AZE C;  3X1S C;  3A6N A;  3AZF C;  2PYO B;  1A7W A;  3MGS B;  2XD1 A;  1P3O A;  5CP6 A;  3LZ1 B;  3X1V D;  1P3K B;  1B6W A;  3LEL B;  3A1K A;  3AZL D;  2NQB D;  1WWI A;  3FDD A;  3UTA D;  1B67 A;  4G92 C;  3X1T B;  4CAY A;  1F66 A;  3AYW D;  3UT9 C;  2CWE A;  1S32 B;  4WJ3 C;  3AV1 D;  4LD9 C;  3W99 C;  4WU8 C;  5B0Y B;  4M6B A;  1EQZ B;  3H0L C;  5AV8 D;  1P3G A;  3AZJ D;  2YFW A;  5B31 G;  4H9Q A;  5B40 D;  4ZUX B;  3REJ D;  4KUD B;  2F8N G;  1P3B B;  5DNN D;  1P3O B;  5CP6 B;  2ZY4 A;  1U35 C;  1P3F D;  1P3P D;  3C1B C;  1BFM A;  1HQ3 D;  2HIO A;  5B31 C;  3AZG C;  2HUE B;  5F99 A;  5GT3 C;  2ZY5 A;  5B24 A;  4YS3 D;  5B2J A;  4CAY B;  1F66 B;  2L5A A;  5B2I C;  2JE5 A;  4Z66 D;  5B32 D;  3REH C;  3REL D;  5AV6 C;  1WWS A;  1ID3 B;  3WAA C;  5JRG C;  3C1C C;  1P3G B;  1JFI A;  2VQR A;  1PZR A;  1P3I C;  2YFW B;  3W98 A;  4H9Q B;  3B6F D;  1H3O A;  2LY8 A;  1P3L A;  3KFU G;  5GXQ D;  4WV4 B;  2Y2G A;  1M18 D;  3MVD D;  4R8P D;  4J8V C;  3AV2 B;  3TU4 D;  2ZY2 A;  3AZH A;  1P3A C;  3REI A;  5AVB D;  4EO5 B;  2HIO B;  3AFA C;  4YM6 A;  5F99 B;  3UTB D;  1P3M C;  5B24 B;  1P34 A;  5B2J B;  3REK D;  4WU9 A;  3B6G C;  4XUJ D;  1KX3 C;  4J8W A;  2JCH A;  3KXB C;  4WZS B;  4KGC C;  3W97 A;  3MGP A;  5CPI C;  3MGQ A;  3WKJ C;  3AN2 D;  1M1A A;  3W98 B;  2PYO C;  3WA9 A;  3X1S D;  2CV5 B;  3AZF D;  1H3O B;  5E5A B;  3X1U A;  3MGS C;  1P3L B;  1TZY A;  3AL0 C;  4Z5T D;  3LZ1 C;  1P3K C;  3VH6 T;  3LEL C;  4JJN A;  4NE5 A;  2BYK A;  3V9R A;  3AZH B;  3W96 A;  3WTP C;  3REI B;  2BYM A;  4YM6 B;  3AZN C;  2Y2H A;  5B0Z A;  3LZ0 B;  3X1T C;  1P34 B;  3UTA A;  3UT9 D;  3VH5 W;  1S32 C;  2Y2J A;  2Y2M A;  4LD9 D;  3AYW A;  4J8W B;  5B0Y C;  3W99 D;  1EQZ C;  3B0C W;  1M19 C;  3W97 B;  3MGQ B;  2ARO D;  1M1A B;  4ZUX C;  3AZJ A;  3WA9 B;  4KUD C;  2Y2I A;  3X1U B;  3AZI D;  1P3B C;  1TZY B;  4XZQ A;  5B40 A;  1P3O C;  2DQN C;  5CP6 C;  2G5H C;  4JJN B;  1U35 D;  5DNN A;  2BYK B;  4KHA A;  3V9R B;  3AZM C;  1ZLA C;  3W96 B;  5B31 D;  5B1L B;  3A1I A;  5FUG A;  3NQJ A;  1P3P A;  5GT3 D;  5B0Z B;  1HQ3 A;  3WTP E;  1F66 C;  1N1J A;  5AVC C;  2F8N D;  3UTA B;  5B2I D;  3REH D;  5AV6 D;  1ID3 C;  4ZBJ B;  4Z66 A;  2F2A C;  5JRG D;  3WAA D;  3REL A;  2NZD A;  1P3G C;  4J8X D;  3C1C D;  3B0D B;  1P3I D;  1R4V A;  3MGR C;  3R45 A;  5AV5 A;  3EPL A;  3O62 A;  5KDM B;  4XZQ B;  4J8V D;  3AV2 C;  4DRB A;  2Y2Q A;  1P3A D;  4EO5 C;  4KHA B;  5DNN B;  2HIO C;  4R8P A;  3AFA D;  5F99 C;  5FUG B;  3TU4 A;  3NQJ B;  3AZK C;  5B2J C;  5AVB A;  1HQ3 B;  1P3M D;  4CSR A;  5CHL B;  3B6G D;  5AV9 A;  1KX3 D;  5B33 C;  3A6N B;  3KXB D;  2NZD B;  3P5J B;  3LJA A;  3REL B;  5CPI D;  3WKJ D;  5BS7 C;  2FFF B;  4Z2M H;  3W98 C;  4AWL C;  2CV5 C;  1Z2C B;  1P3L C;  5E5A C;  4X23 D;  4NE6 A;  3MGS D;  5AV5 B;  3O62 B;  3LZ1 D;  4G91 B;  1P3K D;  3AZF A;  3LEL D;  2Y2O A;  5B1M C;  4Z5T A;  3WTP D;  4R8P B;  5GT0 A;  4YM6 C;  3LZ0 C;  3AZN D;  3X1T D;  2JSS A;  1P34 C;  3KUY A;  5AVB B;  3EG5 B;  5GSU A;  1AOI A;  5AV9 B;  1S32 D;  1KX5 D;  4J8W C;  5B0Y D;  5CPJ A;  2XD5 A;  1M19 D;  3LJA B;  3W97 C;  3MGQ C;  1KX4 C;  3W99 A;  1M1A C;  3WA9 C;  3VH5 T;  4ZUX D;  2DF4 C;  2ZY3 A;  3X1U C;  2ARO A;  5CPK A;  5DNM A;  4KUD D;  1TZY C;  1P3B D;  1P3O D;  4E44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...