4Z5TA

The nucleosome containing human h3.5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.3C
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tA00
3B6GD 5AV5B 4JJNA 3AZHB 5G49B 3RELC 3AZEC 3TU4C 1KU5A 2CV5D 3LZ0D 5GT0A 5GXQB 4YM6C 1KX5C 4H9PA 5B0ZD 3RELB 3UT9D 5B1LC 4H9NA 3KUYC 5FUGB 3MNND 2PYOD 5AVBD 3MGRA 2AROC 5GSUB 3AZIA 4G91C 1P3LC 3B0DB 4J8XD 3MGPA 3REHA 2NQBB 1BH8A 3LJAA 5F99D 3WA9A 5B24B 3X1TD 5GT3A 3X1SA 3A6ND 5B33C 3AV1D 5BNVA 4QLCB 5DNMB 5CPJA 5B1MB 4WU9D 4KUDA 5B2JD 3V9RB 3AZGA 3AZMC 3UTBD 2FJ7B 2NZDB 5B33B 4Z66B 3AZLC 3WAAA 3VH5A 5CPKA 1KX5A 5CPID 1HQ3C 1HTAA 5B31G 3WKJC 2HIOB 5AV8B 3KUYA 1EQZC 3W97D 1F1EA 1HQ3B 4H9OA 4Z5TB 5B32C 4J8WB 3WKJB 1P3OB 1P3BA 3AZJD 3REKD 1P3LA 3VH6T 3WTPA 4WU8D 2IO5B 2YFWA 5B31B 3MVDB 3VH6W 3B6GC 3W99D 4R8PA 3B0CT 1S32A 4H9QB 5B40B 4NE3A 4CAYA 5E5AC 4XUJD 3O62A 4EO5B 4YS3A 3LZ0C 3B6GB 5AY8B 3AZLA 1P3MD 3MGQC 3VH6A 4ZBJB 3AN2B 3AZFC 4J8UA 4J8VB 3LZ0B 2CV5B 4KGCA 2LY8A 1WWIA 3MNNC 1P3FB 1EQZA 2PYOC 5B0ZB 5DNNC 5B32A 3KSYA 5CP6D 3UT9B 1M19C 3C1BA 2BYMB 4J8XC 3LELD 3LZ1D 1M1AC 3MNNB 1WWSA 2PYOB 5AVBB 5B0YD 4WU9C 4DRAA 3MGRD 5F99B 3AZNC 3UTBC 3REJD 3X1TB 3A6NB 3AV1B 2F8NA 5AV6C 4WNNB 4WU9B 3R45A 4NFTA 3REIA 5CPIC 2BYKA 4HGAC 5B2JB 5B24D 5JA4B 3MGQA 3AV2A 3AFAA 3W98C 1P3PA 4KUDD 3W97C 5CPIB 3W96C 5B2ID 5AVCD 5DNNA 1M19A 3AZJC 3REKC 1R4VA 1P34A 3W97B 1M1AA 1ZLAA 1BH9A 1JFIB 2HIOD 4ZUXD 3AZJB 1B67A 3AZKA 4WU8B 1P3OD 5BT1D 3AZNA 2HUEB 3KXBD 4X23D 4G92C 5JRGC 3X1VC 3W99B 5AV6A 1U35D 5KDMB 4XUJB 2YFVB 3UTAA 5AV5C 3AZHC 3W98A 4R8PD 3C1CD 1P3MB 1F66A 3W96A 5AY8D 3X1UD 5GXQC 1ID3A 4H9RB 5BNXA 3KWQA 3AN2D 5AV9A 4LD9A 5CP6B 4J8VD 4J8UD 3B6FA 1KX3D 1B6WA 1P3FD 3LELB 3LZ1B 1P3AD 5GSUC 2RVQD 5BO0A 3REJC 3B0DC 3C1BD 5B0YB 2NQBC 1TZYA 2JSSA 5JRGA 3MGRB 1N1JA 5B24C 1KX4D 3REJB 4QLCC 5DNMC 5B1MC 1H3OB 3AZHA 2F8NK 1TAFB 5G49A 4XZQA 1P3IA 1P3GD 2FJ7C 2NZDC 5B2IC 5AVCC 3WTPE 2L5AA 5GT3B 4Z66C 4KUDB 3RELA 3AFAD 3AZEA 5AVCB 5B2IB 2HIOC 3TU4A 1P3PD 5AV8C 3WAAB 5CPKB 5FUGA 4YM6A 3MGSD 4Z5TC 4J8WC 1P3OC 5GSUA 4ZUXB 5B1LA 4X23C 2NQBA 1ZLAD 1AOID 2IO5C 2AROA 2CWEA 5B31C 3MVDC 3KXBB 3AYWD 1P3BB 4X23B 4QLCA 3WTPB 5B1MA 3AZKD 5B40C 1U35B 1M18D 4EO5C 2FJ7A 2NZDA 5C3IB 4WZSB 5AY8C 5B33A 4R8PB 3C1CB 1P3KD 4ZBJC 4CAYB 4CSRB 3AN2C 3O62B 3AZMA 4AWLB 4J8VC 2CV5C 3B0CW 3X1UB 5AV8A 4WV4B 1P3FC 5B0ZC 1HQ3A 4Z5TA 3UT9C 2RVQC 4J8WA 4KHAA 3WKJA 4JJND 4J8UB 1KX3B 4KGCB 1BFMA 5AVBC 1P3AB 4LD9D 5GT0D 5B31A 3MVDA 3C1BB 3NQUB 4H9QA 4NE5A 5F99C 3X1TC 3A6NC 1KX4B 3AV1C 3B6GA 4UUZB 5B2JC 1P3GB 5E5AA 3AZID 3NQJB 3MGPD 3REHD 2CV5A 3LZ0A 3LJAD 1P3ID 2BYKB 3WA9D 5GT3D 3AV2B 5B0ZA 3X1SD 3AFAB 3UT9A 5CPJD 1P3PB 3AZFA 3AZGD 3MGSB 3MNNA 3AZED 2PYOA 5AVBA 4J8XA 5CPKD 3WAAD 1KX5D 1P34B 1ZLAB 4WU8C 1M18C 1AOIB 2HUEC 3X1TA 3A6NA 3AYWB 3AV1A 3KUYD 3W99C 4WNNA 3AZKB 4WU9A 5B2JA 4XUJC 1M18B 3UTBA 1P3BD 1P3LD 3WTPD 1P3MC 1P3KB 5CPIA 3UTAB 1S32D 5BS7C 3W97A 3O62D 3AZMD 1JFIA 4YS3D 5CP6C 1A7WA 4JJNB 3AZLD 3B0BA 3AZJA 3REKA 3LELC 3LZ1C 5BNXB 3KWQB 4WU8A 5AV9B 4LD9B 5GT0B 4KGCD 5B0YC 1EQZD 3W99A 2F8NH 4H9PB 3MGRC 5B32D 2YFVA 4H9NB 1TZYB 3X1VA 3WA9C 5GT3C 3AZIB 3MGPB 5AV5A 3REHB 4KUDC 1BH8B 3LJAB 4XZQB 5BS7A 3AZGC 1P3IB 4M6BA 4H9RA 5CHLB 5E5AD 3WA9B 3X1SB 4Z2MG 2F8ND 5BNVB 5CP6A 5CPJB 3WAAC 3REID 5GXQA 5CPKC 3MGQD 3AZGB 3AV2D 3LELA 3LZ1A 1Q9CA 3AZEB 4ZUXC 3TU4B 3AZFD 5B0YA 4YM6B 1KX5B 5DNND 5BT1C 3KXBC 1M19D 3REJA 5B1LB 4E45A 1P3BC 3VH5T 3WTPC 1H3OA 3KUYB 1P34D 1U35C 1TAFA 1M1AD 4H9OB 5B24A 5C3IC 2AROB 3VH5W 4G91B 1P3LB 5DNMA 1S32C 4R8PC 3C1CC 3V9RA 3O62C 3AZND 2YFWB 4AWLC 4YS3C 5B2IA 5AVCA 3X1UC 4Z66A 1S32B 5AV6D 4DRBA 5B32G 3AZMB 3UTAD 4YS3B 3W98D 4J8UC 2HIOA 4ZUXA 1KX3C 4KGCC 3AZLB 1F66D 1P3AC 3W96D 4KHAB 3C1BC 1P3OA 3KXBA 4X23A 1ID3D 1EQZB 3KWQD 1U35A 4NE6A 5B32B 5AV9D 1KX4C 2F8NG 3B6FD 5B40A 3C1CA 1P3GC 4CSRA 5AY8A 3X1UA 1TZYD 3REIC 5JRGD 3X1VD 3AV2C 3AFAC 5E5AB 3AN2A 1P3PC 5AV5D 2F8NB 4J8VA 3AZHD 1KX3A 4XZQD 3R45B 3REIB 3MGSC 3MGQB 1P3FA 4Z2MH 1P3AA 4E44A 2BYMA 3AZFB 5GXQD 1P34C 1ZLAC 3RELD 1AOIC 3NQUA 3TU4D 5DNNB 3AYWC 1M19B 1KX4A 4J8XB 4YM6D 3AZKC 4UUZA 1M1AB 1BH9B 5F99A 5GSUD 1P3GA 5B1LD 3NQJA 2NQBD 1P3KC 5JA4A 2AROD 3AZNB 3UTBB 3UTAC 4H9SC 4QLCD 5DNMD 5B1MD 5AV6B 3MGSA 1F66C 4HGAB 2FJ7D 2NZDD 5B33D 4Z66D 4JJNC 3W98B 1ID3C 3KWQC 1F66B 1AOIA 5AV9C 4LD9C 3W96B 3B6FC 5GT0C 5AV8D 3AYWA 3REKB 1ID3B 1HQ3D 4Z5TD 1ULYA 4J8WD 1M18A 3WKJD 3B6FB 1TZYC 5KDMA 1P3KA 5BO0B 4XUJA 3AZIC 5B31D 3MVDD 3MGPC 3REHC 4H9SA 3LJAC 4XZQC 4G92B 5JRGB 5B40D 3X1VB 1P3IC 1P3MA 1N1JB 3X1SC 5CPJC
chains in the Genus database with same CATH superfamily
3B6GD 5AV5B 4JJNA 3AZHB 5G49B 3RELC 3AZEC 3TU4C 1KU5A 2CV5D 3LZ0D 5GT0A 5GXQB 4YM6C 1KX5C 2Y2QA 4H9PA 5B0ZD 3RELB 3UT9D 5B1LC 4H9NA 3KUYC 5FUGB 3MNND 2PYOD 5AVBD 3MGRA 2AROC 5GSUB 3AZIA 4G91C 1P3LC 3B0DB 4J8XD 3MGPA 3REHA 2NQBB 1BH8A 3LJAA 5F99D 3WA9A 5B24B 3X1TD 5GT3A 3X1SA 3A6ND 5B33C 3AV1D 5BNVA 4QLCB 5DNMB 5CPJA 5B1MB 4WU9D 4KUDA 5B2JD 3V9RB 3AZGA 4DQYB 3AZMC 3UTBD 2FJ7B 2NZDB 5B33B 4Z66B 3AZLC 3WAAA 3VH5A 5CPKA 1KX5A 5CPID 1HQ3C 1HTAA 5B31G 3WKJC 2HIOB 5AV8B 3KUYA 1EQZC 3W97D 1F1EA 1HQ3B 4H9OA 4Z5TB 5B32C 4J8WB 3WKJB 1P3OB 1P3BA 3AZJD 3REKD 1P3LA 3VH6T 3WTPA 4WU8D 2IO5B 2YFWA 5B31B 3MVDB 3VH6W 3B6GC 3W99D 3A1KA 3B0CT 4R8PA 1S32A 4H9QB 5B40B 4NE3A 2DF4C 5E5AC 4XUJD 4CAYA 3O62A 4EO5B 4YS3A 3LZ0C 3B6GB 5AY8B 3AZLA 1P3MD 3MGQC 3VH6A 4ZBJB 3EPLA 3AN2B 3AZFC 4J8UA 4J8VB 3LZ0B 2CV5B 4KGCA 2LY8A 1WWIA 3MNNC 1P3FB 1EQZA 2PYOC 5B0ZB 5DNNC 5B32A 3KSYA 5CP6D 3UT9B 1M19C 3H0RC 3C1BA 2BYMB 4J8XC 2Y2MA 3LELD 3LZ1D 1M1AC 3MNNB 1WWSA 2PYOB 5AVBB 5B0YD 2ZY4A 4WU9C 4DRAA 3A1IA 3MGRD 5F99B 3AZNC 3UTBC 3REJD 3H0MC 3X1TB 3A6NB 3AV1B 2F8NA 5AV6C 4WNNB 4WU9B 3R45A 4NFTA 3REIA 5CPIC 2BYKA 4HGAC 5B2JB 5JA4B 5B24D 3MGQA 3AV2A 3AFAA 3W98C 1P3PA 4KUDD 3W97C 3IP4C 5CPIB 3W96C 5B2ID 5AVCD 5DNNA 1M19A 3AZJC 3REKC 1R4VA 1P34A 3W97B 1M1AA 1ZLAA 1BH9A 1JFIB 2FFFB 2HIOD 4ZUXD 2Y2NA 3AZJB 1B67A 3AZKA 2G5IC 2ZY2A 4WU8B 1P3OD 5BT1D 3AZNA 2HUEB 3KXBD 2XD5A 4X23D 2Y2PA 4G92C 5JRGC 3X1VC 3W99B 5AV6A 1U35D 5KDMB 4XUJB 2YFVB 3UTAA 5AV5C 3AZHC 3W98A 4R8PD 3C1CD 1P3MB 3EPKA 1F66A 3W96A 5AY8D 3X1UD 5GXQC 1ID3A 4H9RB 5BNXA 3KWQA 3AN2D 5AV9A 4LD9A 5CP6B 4J8VD 4J8UD 3B6FA 1KX3D 3KFUG 2Y2GA 1B6WA 1P3FD 1PZRA 3LELB 3LZ1B 1P3AD 5GSUC 2RVQD 5BO0A 3REJC 3B0DC 3C1BD 5B0YB 2NQBC 1TZYA 2JSSA 5JRGA 3MGRB 1N1JA 5B24C 1KX4D 3REJB 4QLCC 5DNMC 5B1MC 1H3OB 3AZHA 2F8NK 1TAFB 5G49A 4XZQA 1P3IA 1P3GD 2FJ7C 2NZDC 5B2IC 5AVCC 2L5AA 5GT3B 3WTPE 4Z66C 3AL0C 4KUDB 3RELA 3AFAD 3AZEA 5AVCB 5B2IB 2HIOC 3TU4A 2JCHA 1P3PD 5AV8C 3WAAB 5CPKB 5FUGA 4YM6A 3MGSD 4Z5TC 2RIQA 2ZY5A 4J8WC 1P3OC 1Z2CB 5GSUA 4ZUXB 2J8PA 5B1LA 4X23C 2NQBA 1ZLAD 1AOID 2IO5C 2G5HC 2AROA 2CWEA 5B31C 3MVDC 3KXBB 3AYWD 1W2EA 1P3BB 4X23B 4QLCA 3WTPB 5B1MA 3AZKD 5B40C 1U35B 1M18D 4EO5C 2FJ7A 2NZDA 5C3IB 4WZSB 5AY8C 5B33A 4R8PB 3C1CB 1P3KD 4ZBJC 4CAYB 4CSRB 3AN2C 3O62B 3AZMA 4AWLB 4J8VC 2CV5C 3B0CW 3X1UB 5AV8A 3H0LC 4WV4B 1P3FC 5B0ZC 1HQ3A 4Z5TA 3UT9C 2RVQC 4J8WA 4KHAA 3WKJA 4JJND 4J8UB 1KX3B 2Y2IA 4KGCB 1BFMA 2Y2KA 5AVBC 1P3AB 4LD9D 5GT0D 5B31A 3MVDA 3C1BB 3NQUB 4H9QA 4NE5A 5F99C 3X1TC 3A6NC 1KX4B 3AV1C 3B6GA 4UUZB 5B2JC 1P3GB 5E5AA 3AZID 3NQJB 3MGPD 3REHD 2CV5A 3LZ0A 3EPHA 3LJAD 1P3ID 2BYKB 3WA9D 5GT3D 3AV2B 5B0ZA 3X1SD 3AFAB 3UT9A 5CPJD 1P3PB 3AZFA 3AZGD 3MGSB 3MNNA 3AZED 2PYOA 5AVBA 4J8XA 5CPKD 3WAAD 1KX5D 1P34B 1ZLAB 4WU8C 1M18C 1AOIB 2HUEC 3X1TA 3A6NA 3AYWB 3AV1A 3KUYD 3W99C 4WNNA 3AZKB 4WU9A 5B2JA 4XUJC 1M18B 3UTBA 1P3BD 1P3LD 3FDDA 3WTPD 1P3MC 1P3KB 5CPIA 3UTAB 1S32D 5BS7C 3W97A 3O62D 3AZMD 1JFIA 4YS3D 5CP6C 1A7WA 4JJNB 3AZLD 3B0BA 3AZJA 3REKA 2Y2HA 3LELC 3LZ1C 5BNXB 3KWQB 4WU8A 5AV9B 4LD9B 5GT0B 4KGCD 5B0YC 1EQZD 3W99A 2F8NH 4H9PB 3MGRC 5B32D 2YFVA 4H9NB 2ZM5A 1TZYB 3X1VA 3WA9C 5GT3C 3AZIB 3MGPB 5AV5A 3REHB 4KUDC 1BH8B 3LJAB 4XZQB 5BS7A 3AZGC 1P3IB 2W8SA 4H9RA 2Y2JA 4M6BA 5CHLB 5E5AD 3WA9B 3X1SB 4Z2MG 2F8ND 5BNVB 5CP6A 5CPJB 3WAAC 3REID 5GXQA 5CPKC 3MGQD 3AZGB 3AV2D 3LELA 3LZ1A 1Q9CA 3AZEB 4ZUXC 3TU4B 3AZFD 5B0YA 4YM6B 1KX5B 5DNND 5BT1C 3KXBC 1M19D 3REJA 5B1LB 4E45A 1P3BC 3VH5T 3WTPC 1H3OA 2Y2OA 3KUYB 1P34D 1U35C 2UWXA 1TAFA 1M1AD 2JE5A 4H9OB 5B24A 5C3IC 2AROB 3VH5W 2F2AC 4UPKA 4G91B 1P3LB 5DNMA 1S32C 4R8PC 3C1CC 3V9RA 3O62C 3AZND 2YFWB 4AWLC 4YS3C 5B2IA 5AVCA 3X1UC 4Z66A 1S32B 5AV6D 4DRBA 5B32G 3AZMB 3UTAD 4YS3B 3W98D 4J8UC 2HIOA 4ZUXA 1KX3C 4KGCC 3AZLB 1F66D 1P3AC 3F6TA 3W96D 4KHAB 3C1BC 1P3OA 3KXBA 4X23A 1ID3D 1EQZB 3KWQD 3P5JB 1U35A 4NE6A 5B32B 5AV9D 3EPJA 1KX4C 2F8NG 3B6FD 5B40A 3C1CA 1P3GC 4CSRA 5AY8A 3X1UA 1TZYD 3REIC 5JRGD 3X1VD 3AV2C 3AFAC 5E5AB 3AN2A 1P3PC 5AV5D 2F8NB 4J8VA 3AZHD 1KX3A 4XZQD 3R45B 3REIB 3MGSC 3MGQB 1P3FA 4Z2MH 1P3AA 4E44A 2BYMA 3AZFB 5GXQD 1P34C 4WJ3C 1ZLAC 3RELD 1AOIC 3NQUA 2DQNC 3TU4D 5DNNB 3AYWC 1M19B 1KX4A 2Y2LA 4J8XB 4YM6D 3AZKC 4UUZA 1M1AB 2BG1A 1BH9B 5F99A 5GSUD 1P3GA 5B1LD 3NQJA 2NQBD 1P3KC 5JA4A 2AROD 2ZY3A 3AZNB 1T3UA 3UTAC 3UTBB 4H9SC 4QLCD 5DNMD 5B1MD 5AV6B 3MGSA 1F66C 4HGAB 2FJ7D 2NZDD 5B33D 4Z66D 4JJNC 3W98B 1ID3C 3KWQC 1F66B 1AOIA 5AV9C 4LD9C 3W96B 3B6FC 5GT0C 5AV8D 3AYWA 3REKB 1ID3B 2XD1A 1HQ3D 4Z5TD 1ULYA 4J8WD 1M18A 3WKJD 3B6FB 1TZYC 5KDMA 1P3KA 5BO0B 4XUJA 3AZIC 5B31D 3MVDD 3MGPC 3REHC 3EG5B 4H9SA 3LJAC 4XZQC 4G92B 5JRGB 5B40D 3X1VB 1P3IC 1P3MA 1N1JB 2VQRA 3X1SC 5CPJC
chains in the Genus database with same CATH topology
3B6GD 5AV5B 4JJNA 3AZHB 5G49B 3RELC 3AZEC 3TU4C 1KU5A 2CV5D 3LZ0D 5GT0A 5GXQB 4YM6C 1KX5C 2Y2QA 4H9PA 5B0ZD 3RELB 3UT9D 5B1LC 4H9NA 3KUYC 5FUGB 3MNND 2PYOD 5AVBD 3MGRA 2AROC 5GSUB 3AZIA 4G91C 1P3LC 3B0DB 4J8XD 3MGPA 3REHA 2NQBB 1BH8A 3LJAA 5F99D 3WA9A 5B24B 3X1TD 5GT3A 3X1SA 3A6ND 5B33C 3AV1D 5BNVA 4QLCB 5DNMB 5CPJA 5B1MB 4WU9D 4KUDA 5B2JD 3V9RB 3AZGA 4DQYB 3AZMC 3UTBD 2FJ7B 2NZDB 5B33B 4Z66B 3AZLC 3WAAA 3VH5A 5CPKA 1KX5A 5CPID 1HQ3C 1HTAA 5B31G 3WKJC 2HIOB 5AV8B 3KUYA 1EQZC 3W97D 1F1EA 1HQ3B 4H9OA 4Z5TB 5B32C 4J8WB 3WKJB 1P3OB 1P3BA 3AZJD 3REKD 1P3LA 3VH6T 3WTPA 4WU8D 2IO5B 2YFWA 5B31B 3MVDB 3VH6W 3B6GC 3W99D 3A1KA 3B0CT 4R8PA 1S32A 4H9QB 5B40B 4NE3A 2DF4C 5E5AC 4XUJD 4CAYA 3O62A 4EO5B 4YS3A 3LZ0C 3B6GB 5AY8B 3AZLA 1P3MD 3MGQC 3VH6A 4ZBJB 3EPLA 3AN2B 3AZFC 4J8UA 4J8VB 3LZ0B 2CV5B 4KGCA 2LY8A 1WWIA 3MNNC 1P3FB 1EQZA 2PYOC 5B0ZB 5DNNC 5B32A 3KSYA 5CP6D 3UT9B 1M19C 3H0RC 3C1BA 2BYMB 4J8XC 2Y2MA 3LELD 3LZ1D 1M1AC 3MNNB 1WWSA 2PYOB 5AVBB 5B0YD 2ZY4A 4WU9C 4DRAA 3A1IA 3MGRD 5F99B 3AZNC 3UTBC 3REJD 3H0MC 3X1TB 3A6NB 3AV1B 2F8NA 5AV6C 4WNNB 4WU9B 3R45A 4NFTA 3REIA 5CPIC 2BYKA 4HGAC 5B2JB 5JA4B 5B24D 3MGQA 3AV2A 3AFAA 3W98C 1P3PA 4KUDD 3W97C 3IP4C 5CPIB 3W96C 5B2ID 5AVCD 5DNNA 1M19A 3AZJC 3REKC 1R4VA 1P34A 3W97B 1M1AA 1ZLAA 1BH9A 1JFIB 2FFFB 2HIOD 4ZUXD 2Y2NA 3AZJB 1B67A 3AZKA 2G5IC 2ZY2A 4WU8B 1P3OD 5BT1D 3AZNA 2HUEB 3KXBD 2XD5A 4X23D 2Y2PA 4G92C 5JRGC 3X1VC 3W99B 5AV6A 1U35D 5KDMB 4XUJB 2YFVB 3UTAA 5AV5C 3AZHC 3W98A 4R8PD 3C1CD 1P3MB 3EPKA 1F66A 3W96A 5AY8D 3X1UD 5GXQC 1ID3A 4H9RB 5BNXA 3KWQA 3AN2D 5AV9A 4LD9A 5CP6B 4J8VD 4J8UD 3B6FA 1KX3D 3KFUG 2Y2GA 1B6WA 1P3FD 1PZRA 3LELB 3LZ1B 1P3AD 5GSUC 2RVQD 5BO0A 3REJC 3B0DC 3C1BD 5B0YB 2NQBC 1TZYA 2JSSA 5JRGA 3MGRB 1N1JA 5B24C 1KX4D 3REJB 4QLCC 5DNMC 5B1MC 1H3OB 3AZHA 2F8NK 1TAFB 5G49A 4XZQA 1P3IA 1P3GD 2FJ7C 2NZDC 5B2IC 5AVCC 2L5AA 5GT3B 3WTPE 4Z66C 3AL0C 4KUDB 3RELA 3AFAD 3AZEA 5AVCB 5B2IB 2HIOC 3TU4A 2JCHA 1P3PD 5AV8C 3WAAB 5CPKB 5FUGA 4YM6A 3MGSD 4Z5TC 2RIQA 2ZY5A 4J8WC 1P3OC 1Z2CB 5GSUA 4ZUXB 2J8PA 5B1LA 4X23C 2NQBA 1ZLAD 1AOID 2IO5C 2G5HC 2AROA 2CWEA 5B31C 3MVDC 3KXBB 3AYWD 1W2EA 1P3BB 4X23B 4QLCA 3WTPB 5B1MA 3AZKD 5B40C 1U35B 1M18D 4EO5C 2FJ7A 2NZDA 5C3IB 4WZSB 5AY8C 5B33A 4R8PB 3C1CB 1P3KD 4ZBJC 4CAYB 4CSRB 3AN2C 3O62B 3AZMA 4AWLB 4J8VC 2CV5C 3B0CW 3X1UB 5AV8A 3H0LC 4WV4B 1P3FC 5B0ZC 1HQ3A 4Z5TA 3UT9C 2RVQC 4J8WA 4KHAA 3WKJA 4JJND 4J8UB 1KX3B 2Y2IA 4KGCB 1BFMA 2Y2KA 5AVBC 1P3AB 4LD9D 5GT0D 5B31A 3MVDA 3C1BB 3NQUB 4H9QA 4NE5A 5F99C 3X1TC 3A6NC 1KX4B 3AV1C 3B6GA 4UUZB 5B2JC 1P3GB 5E5AA 3AZID 3NQJB 3MGPD 3REHD 2CV5A 3LZ0A 3EPHA 3LJAD 1P3ID 2BYKB 3WA9D 5GT3D 3AV2B 5B0ZA 3X1SD 3AFAB 3UT9A 5CPJD 1P3PB 3AZFA 3AZGD 3MGSB 3MNNA 3AZED 2PYOA 5AVBA 4J8XA 5CPKD 3WAAD 1KX5D 1P34B 1ZLAB 4WU8C 1M18C 1AOIB 2HUEC 3X1TA 3A6NA 3AYWB 3AV1A 3KUYD 3W99C 4WNNA 3AZKB 4WU9A 5B2JA 4XUJC 1M18B 3UTBA 1P3BD 1P3LD 3FDDA 3WTPD 1P3MC 1P3KB 5CPIA 3UTAB 1S32D 5BS7C 3W97A 3O62D 3AZMD 1JFIA 4YS3D 5CP6C 1A7WA 4JJNB 3AZLD 3B0BA 3AZJA 3REKA 2Y2HA 3LELC 3LZ1C 5BNXB 3KWQB 4WU8A 5AV9B 4LD9B 5GT0B 4KGCD 5B0YC 1EQZD 3W99A 2F8NH 4H9PB 3MGRC 5B32D 2YFVA 4H9NB 2ZM5A 1TZYB 3X1VA 3WA9C 5GT3C 3AZIB 3MGPB 5AV5A 3REHB 4KUDC 1BH8B 3LJAB 4XZQB 5BS7A 3AZGC 1P3IB 2W8SA 4H9RA 2Y2JA 4M6BA 5CHLB 5E5AD 3WA9B 3X1SB 4Z2MG 2F8ND 5BNVB 5CP6A 5CPJB 3WAAC 3REID 5GXQA 5CPKC 3MGQD 3AZGB 3AV2D 3LELA 3LZ1A 1Q9CA 3AZEB 4ZUXC 3TU4B 3AZFD 5B0YA 4YM6B 1KX5B 5DNND 5BT1C 3KXBC 1M19D 3REJA 5B1LB 4E45A 1P3BC 3VH5T 3WTPC 1H3OA 2Y2OA 3KUYB 1P34D 1U35C 2UWXA 1TAFA 1M1AD 2JE5A 4H9OB 5B24A 5C3IC 2AROB 3VH5W 2F2AC 4UPKA 4G91B 1P3LB 5DNMA 1S32C 4R8PC 3C1CC 3V9RA 3O62C 3AZND 2YFWB 4AWLC 4YS3C 5B2IA 5AVCA 3X1UC 4Z66A 1S32B 5AV6D 4DRBA 5B32G 3AZMB 3UTAD 4YS3B 3W98D 4J8UC 2HIOA 4ZUXA 1KX3C 4KGCC 3AZLB 1F66D 1P3AC 3F6TA 3W96D 4KHAB 3C1BC 1P3OA 3KXBA 4X23A 1ID3D 1EQZB 3KWQD 3P5JB 1U35A 4NE6A 5B32B 5AV9D 3EPJA 1KX4C 2F8NG 3B6FD 5B40A 3C1CA 1P3GC 4CSRA 5AY8A 3X1UA 1TZYD 3REIC 5JRGD 3X1VD 3AV2C 3AFAC 5E5AB 3AN2A 1P3PC 5AV5D 2F8NB 4J8VA 3AZHD 1KX3A 4XZQD 3R45B 3REIB 3MGSC 3MGQB 1P3FA 4Z2MH 1P3AA 4E44A 2BYMA 3AZFB 5GXQD 1P34C 4WJ3C 1ZLAC 3RELD 1AOIC 3NQUA 2DQNC 3TU4D 5DNNB 3AYWC 1M19B 1KX4A 2Y2LA 4J8XB 4YM6D 3AZKC 4UUZA 1M1AB 2BG1A 1BH9B 5F99A 5GSUD 1P3GA 5B1LD 3NQJA 2NQBD 1P3KC 5JA4A 2AROD 2ZY3A 3AZNB 1T3UA 3UTAC 3UTBB 4H9SC 4QLCD 5DNMD 5B1MD 5AV6B 3MGSA 1F66C 4HGAB 2FJ7D 2NZDD 5B33D 4Z66D 4JJNC 3W98B 1ID3C 3KWQC 1F66B 1AOIA 5AV9C 4LD9C 3W96B 3B6FC 5GT0C 5AV8D 3AYWA 3REKB 1ID3B 2XD1A 1HQ3D 4Z5TD 1ULYA 4J8WD 1M18A 3WKJD 3B6FB 1TZYC 5KDMA 1P3KA 5BO0B 4XUJA 3AZIC 5B31D 3MVDD 3MGPC 3REHC 3EG5B 4H9SA 3LJAC 4XZQC 4G92B 5JRGB 5B40D 3X1VB 1P3IC 1P3MA 1N1JB 2VQRA 3X1SC 5CPJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6G D;  5AV5 B;  4JJN A;  3AZH B;  5G49 B;  3REL C;  3AZE C;  3TU4 C;  1KU5 A;  2CV5 D;  3LZ0 D;  5GT0 A;  5GXQ B;  4YM6 C;  1KX5 C;  4H9P A;  5B0Z D;  3REL B;  3UT9 D;  5B1L C;  4H9N A;  3KUY C;  5FUG B;  3MNN D;  2PYO D;  5AVB D;  3MGR A;  2ARO C;  5GSU B;  3AZI A;  4G91 C;  1P3L C;  3B0D B;  4J8X D;  3MGP A;  3REH A;  2NQB B;  1BH8 A;  3LJA A;  5F99 D;  3WA9 A;  5B24 B;  3X1T D;  5GT3 A;  3X1S A;  3A6N D;  5B33 C;  3AV1 D;  5BNV A;  4QLC B;  5DNM B;  5CPJ A;  5B1M B;  4WU9 D;  4KUD A;  5B2J D;  3V9R B;  3AZG A;  3AZM C;  3UTB D;  2FJ7 B;  2NZD B;  5B33 B;  4Z66 B;  3AZL C;  3WAA A;  3VH5 A;  5CPK A;  1KX5 A;  5CPI D;  1HQ3 C;  1HTA A;  5B31 G;  3WKJ C;  2HIO B;  5AV8 B;  3KUY A;  1EQZ C;  3W97 D;  1F1E A;  1HQ3 B;  4H9O A;  4Z5T B;  5B32 C;  4J8W B;  3WKJ B;  1P3O B;  1P3B A;  3AZJ D;  3REK D;  1P3L A;  3VH6 T;  3WTP A;  4WU8 D;  2IO5 B;  2YFW A;  5B31 B;  3MVD B;  3VH6 W;  3B6G C;  3W99 D;  4R8P A;  3B0C T;  1S32 A;  4H9Q B;  5B40 B;  4NE3 A;  4CAY A;  5E5A C;  4XUJ D;  3O62 A;  4EO5 B;  4YS3 A;  3LZ0 C;  3B6G B;  5AY8 B;  3AZL A;  1P3M D;  3MGQ C;  3VH6 A;  4ZBJ B;  3AN2 B;  3AZF C;  4J8U A;  4J8V B;  3LZ0 B;  2CV5 B;  4KGC A;  2LY8 A;  1WWI A;  3MNN C;  1P3F B;  1EQZ A;  2PYO C;  5B0Z B;  5DNN C;  5B32 A;  3KSY A;  5CP6 D;  3UT9 B;  1M19 C;  3C1B A;  2BYM B;  4J8X C;  3LEL D;  3LZ1 D;  1M1A C;  3MNN B;  1WWS A;  2PYO B;  5AVB B;  5B0Y D;  4WU9 C;  4DRA A;  3MGR D;  5F99 B;  3AZN C;  3UTB C;  3REJ D;  3X1T B;  3A6N B;  3AV1 B;  2F8N A;  5AV6 C;  4WNN B;  4WU9 B;  3R45 A;  4NFT A;  3REI A;  5CPI C;  2BYK A;  4HGA C;  5B2J B;  5B24 D;  5JA4 B;  3MGQ A;  3AV2 A;  3AFA A;  3W98 C;  1P3P A;  4KUD D;  3W97 C;  5CPI B;  3W96 C;  5B2I D;  5AVC D;  5DNN A;  1M19 A;  3AZJ C;  3REK C;  1R4V A;  1P34 A;  3W97 B;  1M1A A;  1ZLA A;  1BH9 A;  1JFI B;  2HIO D;  4ZUX D;  3AZJ B;  1B67 A;  3AZK A;  4WU8 B;  1P3O D;  5BT1 D;  3AZN A;  2HUE B;  3KXB D;  4X23 D;  4G92 C;  5JRG C;  3X1V C;  3W99 B;  5AV6 A;  1U35 D;  5KDM B;  4XUJ B;  2YFV B;  3UTA A;  5AV5 C;  3AZH C;  3W98 A;  4R8P D;  3C1C D;  1P3M B;  1F66 A;  3W96 A;  5AY8 D;  3X1U D;  5GXQ C;  1ID3 A;  4H9R B;  5BNX A;  3KWQ A;  3AN2 D;  5AV9 A;  4LD9 A;  5CP6 B;  4J8V D;  4J8U D;  3B6F A;  1KX3 D;  1B6W A;  1P3F D;  3LEL B;  3LZ1 B;  1P3A D;  5GSU C;  2RVQ D;  5BO0 A;  3REJ C;  3B0D C;  3C1B D;  5B0Y B;  2NQB C;  1TZY A;  2JSS A;  5JRG A;  3MGR B;  1N1J A;  5B24 C;  1KX4 D;  3REJ B;  4QLC C;  5DNM C;  5B1M C;  1H3O B;  3AZH A;  2F8N K;  1TAF B;  5G49 A;  4XZQ A;  1P3I A;  1P3G D;  2FJ7 C;  2NZD C;  5B2I C;  5AVC C;  3WTP E;  2L5A A;  5GT3 B;  4Z66 C;  4KUD B;  3REL A;  3AFA D;  3AZE A;  5AVC B;  5B2I B;  2HIO C;  3TU4 A;  1P3P D;  5AV8 C;  3WAA B;  5CPK B;  5FUG A;  4YM6 A;  3MGS D;  4Z5T C;  4J8W C;  1P3O C;  5GSU A;  4ZUX B;  5B1L A;  4X23 C;  2NQB A;  1ZLA D;  1AOI D;  2IO5 C;  2ARO A;  2CWE A;  5B31 C;  3MVD C;  3KXB B;  3AYW D;  1P3B B;  4X23 B;  4QLC A;  3WTP B;  5B1M A;  3AZK D;  5B40 C;  1U35 B;  1M18 D;  4EO5 C;  2FJ7 A;  2NZD A;  5C3I B;  4WZS B;  5AY8 C;  5B33 A;  4R8P B;  3C1C B;  1P3K D;  4ZBJ C;  4CAY B;  4CSR B;  3AN2 C;  3O62 B;  3AZM A;  4AWL B;  4J8V C;  2CV5 C;  3B0C W;  3X1U B;  5AV8 A;  4WV4 B;  1P3F C;  5B0Z C;  1HQ3 A;  4Z5T A;  3UT9 C;  2RVQ C;  4J8W A;  4KHA A;  3WKJ A;  4JJN D;  4J8U B;  1KX3 B;  4KGC B;  1BFM A;  5AVB C;  1P3A B;  4LD9 D;  5GT0 D;  5B31 A;  3MVD A;  3C1B B;  3NQU B;  4H9Q A;  4NE5 A;  5F99 C;  3X1T C;  3A6N C;  1KX4 B;  3AV1 C;  3B6G A;  4UUZ B;  5B2J C;  1P3G B;  5E5A A;  3AZI D;  3NQJ B;  3MGP D;  3REH D;  2CV5 A;  3LZ0 A;  3LJA D;  1P3I D;  2BYK B;  3WA9 D;  5GT3 D;  3AV2 B;  5B0Z A;  3X1S D;  3AFA B;  3UT9 A;  5CPJ D;  1P3P B;  3AZF A;  3AZG D;  3MGS B;  3MNN A;  3AZE D;  2PYO A;  5AVB A;  4J8X A;  5CPK D;  3WAA D;  1KX5 D;  1P34 B;  1ZLA B;  4WU8 C;  1M18 C;  1AOI B;  2HUE C;  3X1T A;  3A6N A;  3AYW B;  3AV1 A;  3KUY D;  3W99 C;  4WNN A;  3AZK B;  4WU9 A;  5B2J A;  4XUJ C;  1M18 B;  3UTB A;  1P3B D;  1P3L D;  3WTP D;  1P3M C;  1P3K B;  5CPI A;  3UTA B;  1S32 D;  5BS7 C;  3W97 A;  3O62 D;  3AZM D;  1JFI A;  4YS3 D;  5CP6 C;  1A7W A;  4JJN B;  3AZL D;  3B0B A;  3AZJ A;  3REK A;  3LEL C;  3LZ1 C;  5BNX B;  3KWQ B;  4WU8 A;  5AV9 B;  4LD9 B;  5GT0 B;  4KGC D;  5B0Y C;  1EQZ D;  3W99 A;  2F8N H;  4H9P B;  3MGR C;  5B32 D;  2YFV A;  4H9N B;  1TZY B;  3X1V A;  3WA9 C;  5GT3 C;  3AZI B;  3MGP B;  5AV5 A;  3REH B;  4KUD C;  1BH8 B;  3LJA B;  4XZQ B;  5BS7 A;  3AZG C;  1P3I B;  4M6B A;  4H9R A;  5CHL B;  5E5A D;  3WA9 B;  3X1S B;  4Z2M G;  2F8N D;  5BNV B;  5CP6 A;  5CPJ B;  3WAA C;  3REI D;  5GXQ A;  5CPK C;  3MGQ D;  3AZG B;  3AV2 D;  3LEL A;  3LZ1 A;  1Q9C A;  3AZE B;  4ZUX C;  3TU4 B;  3AZF D;  5B0Y A;  4YM6 B;  1KX5 B;  5DNN D;  5BT1 C;  3KXB C;  1M19 D;  3REJ A;  5B1L B;  4E45 A;  1P3B C;  3VH5 T;  3WTP C;  1H3O A;  3KUY B;  1P34 D;  1U35 C;  1TAF A;  1M1A D;  4H9O B;  5B24 A;  5C3I C;  2ARO B;  3VH5 W;  4G91 B;  1P3L B;  5DNM A;  1S32 C;  4R8P C;  3C1C C;  3V9R A;  3O62 C;  3AZN D;  2YFW B;  4AWL C;  4YS3 C;  5B2I A;  5AVC A;  3X1U C;  4Z66 A;  1S32 B;  5AV6 D;  4DRB A;  5B32 G;  3AZM B;  3UTA D;  4YS3 B;  3W98 D;  4J8U C;  2HIO A;  4ZUX A;  1KX3 C;  4KGC C;  3AZL B;  1F66 D;  1P3A C;  3W96 D;  4KHA B;  3C1B C;  1P3O A;  3KXB A;  4X23 A;  1ID3 D;  1EQZ B;  3KWQ D;  1U35 A;  4NE6 A;  5B32 B;  5AV9 D;  1KX4 C;  2F8N G;  3B6F D;  5B40 A;  3C1C A;  1P3G C;  4CSR A;  5AY8 A;  3X1U A;  1TZY D;  3REI C;  5JRG D;  3X1V D;  3AV2 C;  3AFA C;  5E5A B;  3AN2 A;  1P3P C;  5AV5 D;  2F8N B;  4J8V A;  3AZH D;  1KX3 A;  4XZQ D;  3R45 B;  3REI B;  3MGS C;  3MGQ B;  1P3F A;  4Z2M H;  1P3A A;  4E44 A;  2BYM A;  3AZF B;  5GXQ D;  1P34 C;  1ZLA C;  3REL D;  1AOI C;  3NQU A;  3TU4 D;  5DNN B;  3AYW C;  1M19 B;  1KX4 A;  4J8X B;  4YM6 D;  3AZK C;  4UUZ A;  1M1A B;  1BH9 B;  5F99 A;  5GSU D;  1P3G A;  5B1L D;  3NQJ A;  2NQB D;  1P3K C;  5JA4 A;  2ARO D;  3AZN B;  3UTB B;  3UTA C;  4H9S C;  4QLC D;  5DNM D;  5B1M D;  5AV6 B;  3MGS A;  1F66 C;  4HGA B;  2FJ7 D;  2NZD D;  5B33 D;  4Z66 D;  4JJN C;  3W98 B;  1ID3 C;  3KWQ C;  1F66 B;  1AOI A;  5AV9 C;  4LD9 C;  3W96 B;  3B6F C;  5GT0 C;  5AV8 D;  3AYW A;  3REK B;  1ID3 B;  1HQ3 D;  4Z5T D;  1ULY A;  4J8W D;  1M18 A;  3WKJ D;  3B6F B;  1TZY C;  5KDM A;  1P3K A;  5BO0 B;  4XUJ A;  3AZI C;  5B31 D;  3MVD D;  3MGP C;  3REH C;  4H9S A;  3LJA C;  4XZQ C;  4G92 B;  5JRG B;  5B40 D;  3X1V B;  1P3I C;  1P3M A;  1N1J B;  3X1S C;  5CPJ C; 
#chains in the Genus database with same CATH topology
 3B6G D;  5AV5 B;  4JJN A;  3AZH B;  5G49 B;  3REL C;  3AZE C;  3TU4 C;  1KU5 A;  2CV5 D;  3LZ0 D;  5GT0 A;  5GXQ B;  4YM6 C;  1KX5 C;  2Y2Q A;  4H9P A;  5B0Z D;  3REL B;  3UT9 D;  5B1L C;  4H9N A;  3KUY C;  5FUG B;  3MNN D;  2PYO D;  5AVB D;  3MGR A;  2ARO C;  5GSU B;  3AZI A;  4G91 C;  1P3L C;  3B0D B;  4J8X D;  3MGP A;  3REH A;  2NQB B;  1BH8 A;  3LJA A;  5F99 D;  3WA9 A;  5B24 B;  3X1T D;  5GT3 A;  3X1S A;  3A6N D;  5B33 C;  3AV1 D;  5BNV A;  4QLC B;  5DNM B;  5CPJ A;  5B1M B;  4WU9 D;  4KUD A;  5B2J D;  3V9R B;  3AZG A;  4DQY B;  3AZM C;  3UTB D;  2FJ7 B;  2NZD B;  5B33 B;  4Z66 B;  3AZL C;  3WAA A;  3VH5 A;  5CPK A;  1KX5 A;  5CPI D;  1HQ3 C;  1HTA A;  5B31 G;  3WKJ C;  2HIO B;  5AV8 B;  3KUY A;  1EQZ C;  3W97 D;  1F1E A;  1HQ3 B;  4H9O A;  4Z5T B;  5B32 C;  4J8W B;  3WKJ B;  1P3O B;  1P3B A;  3AZJ D;  3REK D;  1P3L A;  3VH6 T;  3WTP A;  4WU8 D;  2IO5 B;  2YFW A;  5B31 B;  3MVD B;  3VH6 W;  3B6G C;  3W99 D;  3A1K A;  3B0C T;  4R8P A;  1S32 A;  4H9Q B;  5B40 B;  4NE3 A;  2DF4 C;  5E5A C;  4XUJ D;  4CAY A;  3O62 A;  4EO5 B;  4YS3 A;  3LZ0 C;  3B6G B;  5AY8 B;  3AZL A;  1P3M D;  3MGQ C;  3VH6 A;  4ZBJ B;  3EPL A;  3AN2 B;  3AZF C;  4J8U A;  4J8V B;  3LZ0 B;  2CV5 B;  4KGC A;  2LY8 A;  1WWI A;  3MNN C;  1P3F B;  1EQZ A;  2PYO C;  5B0Z B;  5DNN C;  5B32 A;  3KSY A;  5CP6 D;  3UT9 B;  1M19 C;  3H0R C;  3C1B A;  2BYM B;  4J8X C;  2Y2M A;  3LEL D;  3LZ1 D;  1M1A C;  3MNN B;  1WWS A;  2PYO B;  5AVB B;  5B0Y D;  2ZY4 A;  4WU9 C;  4DRA A;  3A1I A;  3MGR D;  5F99 B;  3AZN C;  3UTB C;  3REJ D;  3H0M C;  3X1T B;  3A6N B;  3AV1 B;  2F8N A;  5AV6 C;  4WNN B;  4WU9 B;  3R45 A;  4NFT A;  3REI A;  5CPI C;  2BYK A;  4HGA C;  5B2J B;  5JA4 B;  5B24 D;  3MGQ A;  3AV2 A;  3AFA A;  3W98 C;  1P3P A;  4KUD D;  3W97 C;  3IP4 C;  5CPI B;  3W96 C;  5B2I D;  5AVC D;  5DNN A;  1M19 A;  3AZJ C;  3REK C;  1R4V A;  1P34 A;  3W97 B;  1M1A A;  1ZLA A;  1BH9 A;  1JFI B;  2FFF B;  2HIO D;  4ZUX D;  2Y2N A;  3AZJ B;  1B67 A;  3AZK A;  2G5I C;  2ZY2 A;  4WU8 B;  1P3O D;  5BT1 D;  3AZN A;  2HUE B;  3KXB D;  2XD5 A;  4X23 D;  2Y2P A;  4G92 C;  5JRG C;  3X1V C;  3W99 B;  5AV6 A;  1U35 D;  5KDM B;  4XUJ B;  2YFV B;  3UTA A;  5AV5 C;  3AZH C;  3W98 A;  4R8P D;  3C1C D;  1P3M B;  3EPK A;  1F66 A;  3W96 A;  5AY8 D;  3X1U D;  5GXQ C;  1ID3 A;  4H9R B;  5BNX A;  3KWQ A;  3AN2 D;  5AV9 A;  4LD9 A;  5CP6 B;  4J8V D;  4J8U D;  3B6F A;  1KX3 D;  3KFU G;  2Y2G A;  1B6W A;  1P3F D;  1PZR A;  3LEL B;  3LZ1 B;  1P3A D;  5GSU C;  2RVQ D;  5BO0 A;  3REJ C;  3B0D C;  3C1B D;  5B0Y B;  2NQB C;  1TZY A;  2JSS A;  5JRG A;  3MGR B;  1N1J A;  5B24 C;  1KX4 D;  3REJ B;  4QLC C;  5DNM C;  5B1M C;  1H3O B;  3AZH A;  2F8N K;  1TAF B;  5G49 A;  4XZQ A;  1P3I A;  1P3G D;  2FJ7 C;  2NZD C;  5B2I C;  5AVC C;  2L5A A;  5GT3 B;  3WTP E;  4Z66 C;  3AL0 C;  4KUD B;  3REL A;  3AFA D;  3AZE A;  5AVC B;  5B2I B;  2HIO C;  3TU4 A;  2JCH A;  1P3P D;  5AV8 C;  3WAA B;  5CPK B;  5FUG A;  4YM6 A;  3MGS D;  4Z5T C;  2RIQ A;  2ZY5 A;  4J8W C;  1P3O C;  1Z2C B;  5GSU A;  4ZUX B;  2J8P A;  5B1L A;  4X23 C;  2NQB A;  1ZLA D;  1AOI D;  2IO5 C;  2G5H C;  2ARO A;  2CWE A;  5B31 C;  3MVD C;  3KXB B;  3AYW D;  1W2E A;  1P3B B;  4X23 B;  4QLC A;  3WTP B;  5B1M A;  3AZK D;  5B40 C;  1U35 B;  1M18 D;  4EO5 C;  2FJ7 A;  2NZD A;  5C3I B;  4WZS B;  5AY8 C;  5B33 A;  4R8P B;  3C1C B;  1P3K D;  4ZBJ C;  4CAY B;  4CSR B;  3AN2 C;  3O62 B;  3AZM A;  4AWL B;  4J8V C;  2CV5 C;  3B0C W;  3X1U B;  5AV8 A;  3H0L C;  4WV4 B;  1P3F C;  5B0Z C;  1HQ3 A;  4Z5T A;  3UT9 C;  2RVQ C;  4J8W A;  4KHA A;  3WKJ A;  4JJN D;  4J8U B;  1KX3 B;  2Y2I A;  4KGC B;  1BFM A;  2Y2K A;  5AVB C;  1P3A B;  4LD9 D;  5GT0 D;  5B31 A;  3MVD A;  3C1B B;  3NQU B;  4H9Q A;  4NE5 A;  5F99 C;  3X1T C;  3A6N C;  1KX4 B;  3AV1 C;  3B6G A;  4UUZ B;  5B2J C;  1P3G B;  5E5A A;  3AZI D;  3NQJ B;  3MGP D;  3REH D;  2CV5 A;  3LZ0 A;  3EPH A;  3LJA D;  1P3I D;  2BYK B;  3WA9 D;  5GT3 D;  3AV2 B;  5B0Z A;  3X1S D;  3AFA B;  3UT9 A;  5CPJ D;  1P3P B;  3AZF A;  3AZG D;  3MGS B;  3MNN A;  3AZE D;  2PYO A;  5AVB A;  4J8X A;  5CPK D;  3WAA D;  1KX5 D;  1P34 B;  1ZLA B;  4WU8 C;  1M18 C;  1AOI B;  2HUE C;  3X1T A;  3A6N A;  3AYW B;  3AV1 A;  3KUY D;  3W99 C;  4WNN A;  3AZK B;  4WU9 A;  5B2J A;  4XUJ C;  1M18 B;  3UTB A;  1P3B D;  1P3L D;  3FDD A;  3WTP D;  1P3M C;  1P3K B;  5CPI A;  3UTA B;  1S32 D;  5BS7 C;  3W97 A;  3O62 D;  3AZM D;  1JFI A;  4YS3 D;  5CP6 C;  1A7W A;  4JJN B;  3AZL D;  3B0B A;  3AZJ A;  3REK A;  2Y2H A;  3LEL C;  3LZ1 C;  5BNX B;  3KWQ B;  4WU8 A;  5AV9 B;  4LD9 B;  5GT0 B;  4KGC D;  5B0Y C;  1EQZ D;  3W99 A;  2F8N H;  4H9P B;  3MGR C;  5B32 D;  2YFV A;  4H9N B;  2ZM5 A;  1TZY B;  3X1V A;  3WA9 C;  5GT3 C;  3AZI B;  3MGP B;  5AV5 A;  3REH B;  4KUD C;  1BH8 B;  3LJA B;  4XZQ B;  5BS7 A;  3AZG C;  1P3I B;  2W8S A;  4H9R A;  2Y2J A;  4M6B A;  5CHL B;  5E5A D;  3WA9 B;  3X1S B;  4Z2M G;  2F8N D;  5BNV B;  5CP6 A;  5CPJ B;  3WAA C;  3REI D;  5GXQ A;  5CPK C;  3MGQ D;  3AZG B;  3AV2 D;  3LEL A;  3LZ1 A;  1Q9C A;  3AZE B;  4ZUX C;  3TU4 B;  3AZF D;  5B0Y A;  4YM6 B;  1KX5 B;  5DNN D;  5BT1 C;  3KXB C;  1M19 D;  3REJ A;  5B1L B;  4E45 A;  1P3B C;  3VH5 T;  3WTP C;  1H3O A;  2Y2O A;  3KUY B;  1P34 D;  1U35 C;  2UWX A;  1TAF A;  1M1A D;  2JE5 A;  4H9O B;  5B24 A;  5C3I C;  2ARO B;  3VH5 W;  2F2A C;  4UPK A;  4G91 B;  1P3L B;  5DNM A;  1S32 C;  4R8P C;  3C1C C;  3V9R A;  3O62 C;  3AZN D;  2YFW B;  4AWL C;  4YS3 C;  5B2I A;  5AVC A;  3X1U C;  4Z66 A;  1S32 B;  5AV6 D;  4DRB A;  5B32 G;  3AZM B;  3UTA D;  4YS3 B;  3W98 D;  4J8U C;  2HIO A;  4ZUX A;  1KX3 C;  4KGC C;  3AZL B;  1F66 D;  1P3A C;  3F6T A;  3W96 D;  4KHA B;  3C1B C;  1P3O A;  3KXB A;  4X23 A;  1ID3 D;  1EQZ B;  3KWQ D;  3P5J B;  1U35 A;  4NE6 A;  5B32 B;  5AV9 D;  3EPJ A;  1KX4 C;  2F8N G;  3B6F D;  5B40 A;  3C1C A;  1P3G C;  4CSR A;  5AY8 A;  3X1U A;  1TZY D;  3REI C;  5JRG D;  3X1V D;  3AV2 C;  3AFA C;  5E5A B;  3AN2 A;  1P3P C;  5AV5 D;  2F8N B;  4J8V A;  3AZH D;  1KX3 A;  4XZQ D;  3R45 B;  3REI B;  3MGS C;  3MGQ B;  1P3F A;  4Z2M H;  1P3A A;  4E44 A;  2BYM A;  3AZF B;  5GXQ D;  1P34 C;  4WJ3 C;  1ZLA C;  3REL D;  1AOI C;  3NQU A;  2DQN C;  3TU4 D;  5DNN B;  3AYW C;  1M19 B;  1KX4 A;  2Y2L A;  4J8X B;  4YM6 D;  3AZK C;  4UUZ A;  1M1A B;  2BG1 A;  1BH9 B;  5F99 A;  5GSU D;  1P3G A;  5B1L D;  3NQJ A;  2NQB D;  1P3K C;  5JA4 A;  2ARO D;  2ZY3 A;  3AZN B;  1T3U A;  3UTA C;  3UTB B;  4H9S C;  4QLC D;  5DNM D;  5B1M D;  5AV6 B;  3MGS A;  1F66 C;  4HGA B;  2FJ7 D;  2NZD D;  5B33 D;  4Z66 D;  4JJN C;  3W98 B;  1ID3 C;  3KWQ C;  1F66 B;  1AOI A;  5AV9 C;  4LD9 C;  3W96 B;  3B6F C;  5GT0 C;  5AV8 D;  3AYW A;  3REK B;  1ID3 B;  2XD1 A;  1HQ3 D;  4Z5T D;  1ULY A;  4J8W D;  1M18 A;  3WKJ D;  3B6F B;  1TZY C;  5KDM A;  1P3K A;  5BO0 B;  4XUJ A;  3AZI C;  5B31 D;  3MVD D;  3MGP C;  3REH C;  3EG5 B;  4H9S A;  3LJA C;  4XZQ C;  4G92 B;  5JRG B;  5B40 D;  3X1V B;  1P3I C;  1P3M A;  1N1J B;  2VQR A;  3X1S C;  5CPJ C; 
#chains in the Genus database with same CATH homology
 3B6G D;  5AV5 B;  4JJN A;  3AZH B;  5G49 B;  3REL C;  3AZE C;  3TU4 C;  1KU5 A;  2CV5 D;  3LZ0 D;  5GT0 A;  5GXQ B;  4YM6 C;  1KX5 C;  2Y2Q A;  4H9P A;  5B0Z D;  3REL B;  3UT9 D;  5B1L C;  4H9N A;  3KUY C;  5FUG B;  3MNN D;  2PYO D;  5AVB D;  3MGR A;  2ARO C;  5GSU B;  3AZI A;  4G91 C;  1P3L C;  3B0D B;  4J8X D;  3MGP A;  3REH A;  2NQB B;  1BH8 A;  3LJA A;  5F99 D;  3WA9 A;  5B24 B;  3X1T D;  5GT3 A;  3X1S A;  3A6N D;  5B33 C;  3AV1 D;  5BNV A;  4QLC B;  5DNM B;  5CPJ A;  5B1M B;  4WU9 D;  4KUD A;  5B2J D;  3V9R B;  3AZG A;  4DQY B;  3AZM C;  3UTB D;  2FJ7 B;  2NZD B;  5B33 B;  4Z66 B;  3AZL C;  3WAA A;  3VH5 A;  5CPK A;  1KX5 A;  5CPI D;  1HQ3 C;  1HTA A;  5B31 G;  3WKJ C;  2HIO B;  5AV8 B;  3KUY A;  1EQZ C;  3W97 D;  1F1E A;  1HQ3 B;  4H9O A;  4Z5T B;  5B32 C;  4J8W B;  3WKJ B;  1P3O B;  1P3B A;  3AZJ D;  3REK D;  1P3L A;  3VH6 T;  3WTP A;  4WU8 D;  2IO5 B;  2YFW A;  5B31 B;  3MVD B;  3VH6 W;  3B6G C;  3W99 D;  3A1K A;  3B0C T;  4R8P A;  1S32 A;  4H9Q B;  5B40 B;  4NE3 A;  2DF4 C;  5E5A C;  4XUJ D;  4CAY A;  3O62 A;  4EO5 B;  4YS3 A;  3LZ0 C;  3B6G B;  5AY8 B;  3AZL A;  1P3M D;  3MGQ C;  3VH6 A;  4ZBJ B;  3EPL A;  3AN2 B;  3AZF C;  4J8U A;  4J8V B;  3LZ0 B;  2CV5 B;  4KGC A;  2LY8 A;  1WWI A;  3MNN C;  1P3F B;  1EQZ A;  2PYO C;  5B0Z B;  5DNN C;  5B32 A;  3KSY A;  5CP6 D;  3UT9 B;  1M19 C;  3H0R C;  3C1B A;  2BYM B;  4J8X C;  2Y2M A;  3LEL D;  3LZ1 D;  1M1A C;  3MNN B;  1WWS A;  2PYO B;  5AVB B;  5B0Y D;  2ZY4 A;  4WU9 C;  4DRA A;  3A1I A;  3MGR D;  5F99 B;  3AZN C;  3UTB C;  3REJ D;  3H0M C;  3X1T B;  3A6N B;  3AV1 B;  2F8N A;  5AV6 C;  4WNN B;  4WU9 B;  3R45 A;  4NFT A;  3REI A;  5CPI C;  2BYK A;  4HGA C;  5B2J B;  5JA4 B;  5B24 D;  3MGQ A;  3AV2 A;  3AFA A;  3W98 C;  1P3P A;  4KUD D;  3W97 C;  3IP4 C;  5CPI B;  3W96 C;  5B2I D;  5AVC D;  5DNN A;  1M19 A;  3AZJ C;  3REK C;  1R4V A;  1P34 A;  3W97 B;  1M1A A;  1ZLA A;  1BH9 A;  1JFI B;  2FFF B;  2HIO D;  4ZUX D;  2Y2N A;  3AZJ B;  1B67 A;  3AZK A;  2G5I C;  2ZY2 A;  4WU8 B;  1P3O D;  5BT1 D;  3AZN A;  2HUE B;  3KXB D;  2XD5 A;  4X23 D;  2Y2P A;  4G92 C;  5JRG C;  3X1V C;  3W99 B;  5AV6 A;  1U35 D;  5KDM B;  4XUJ B;  2YFV B;  3UTA A;  5AV5 C;  3AZH C;  3W98 A;  4R8P D;  3C1C D;  1P3M B;  3EPK A;  1F66 A;  3W96 A;  5AY8 D;  3X1U D;  5GXQ C;  1ID3 A;  4H9R B;  5BNX A;  3KWQ A;  3AN2 D;  5AV9 A;  4LD9 A;  5CP6 B;  4J8V D;  4J8U D;  3B6F A;  1KX3 D;  3KFU G;  2Y2G A;  1B6W A;  1P3F D;  1PZR A;  3LEL B;  3LZ1 B;  1P3A D;  5GSU C;  2RVQ D;  5BO0 A;  3REJ C;  3B0D C;  3C1B D;  5B0Y B;  2NQB C;  1TZY A;  2JSS A;  5JRG A;  3MGR B;  1N1J A;  5B24 C;  1KX4 D;  3REJ B;  4QLC C;  5DNM C;  5B1M C;  1H3O B;  3AZH A;  2F8N K;  1TAF B;  5G49 A;  4XZQ A;  1P3I A;  1P3G D;  2FJ7 C;  2NZD C;  5B2I C;  5AVC C;  2L5A A;  5GT3 B;  3WTP E;  4Z66 C;  3AL0 C;  4KUD B;  3REL A;  3AFA D;  3AZE A;  5AVC B;  5B2I B;  2HIO C;  3TU4 A;  2JCH A;  1P3P D;  5AV8 C;  3WAA B;  5CPK B;  5FUG A;  4YM6 A;  3MGS D;  4Z5T C;  2RIQ A;  2ZY5 A;  4J8W C;  1P3O C;  1Z2C B;  5GSU A;  4ZUX B;  2J8P A;  5B1L A;  4X23 C;  2NQB A;  1ZLA D;  1AOI D;  2IO5 C;  2G5H C;  2ARO A;  2CWE A;  5B31 C;  3MVD C;  3KXB B;  3AYW D;  1W2E A;  1P3B B;  4X23 B;  4QLC A;  3WTP B;  5B1M A;  3AZK D;  5B40 C;  1U35 B;  1M18 D;  4EO5 C;  2FJ7 A;  2NZD A;  5C3I B;  4WZS B;  5AY8 C;  5B33 A;  4R8P B;  3C1C B;  1P3K D;  4ZBJ C;  4CAY B;  4CSR B;  3AN2 C;  3O62 B;  3AZM A;  4AWL B;  4J8V C;  2CV5 C;  3B0C W;  3X1U B;  5AV8 A;  3H0L C;  4WV4 B;  1P3F C;  5B0Z C;  1HQ3 A;  4Z5T A;  3UT9 C;  2RVQ C;  4J8W A;  4KHA A;  3WKJ A;  4JJN D;  4J8U B;  1KX3 B;  2Y2I A;  4KGC B;  1BFM A;  2Y2K A;  5AVB C;  1P3A B;  4LD9 D;  5GT0 D;  5B31 A;  3MVD A;  3C1B B;  3NQU B;  4H9Q A;  4NE5 A;  5F99 C;  3X1T C;  3A6N C;  1KX4 B;  3AV1 C;  3B6G A;  4UUZ B;  5B2J C;  1P3G B;  5E5A A;  3AZI D;  3NQJ B;  3MGP D;  3REH D;  2CV5 A;  3LZ0 A;  3EPH A;  3LJA D;  1P3I D;  2BYK B;  3WA9 D;  5GT3 D;  3AV2 B;  5B0Z A;  3X1S D;  3AFA B;  3UT9 A;  5CPJ D;  1P3P B;  3AZF A;  3AZG D;  3MGS B;  3MNN A;  3AZE D;  2PYO A;  5AVB A;  4J8X A;  5CPK D;  3WAA D;  1KX5 D;  1P34 B;  1ZLA B;  4WU8 C;  1M18 C;  1AOI B;  2HUE C;  3X1T A;  3A6N A;  3AYW B;  3AV1 A;  3KUY D;  3W99 C;  4WNN A;  3AZK B;  4WU9 A;  5B2J A;  4XUJ C;  1M18 B;  3UTB A;  1P3B D;  1P3L D;  3FDD A;  3WTP D;  1P3M C;  1P3K B;  5CPI A;  3UTA B;  1S32 D;  5BS7 C;  3W97 A;  3O62 D;  3AZM D;  1JFI A;  4YS3 D;  5CP6 C;  1A7W A;  4JJN B;  3AZL D;  3B0B A;  3AZJ A;  3REK A;  2Y2H A;  3LEL C;  3LZ1 C;  5BNX B;  3KWQ B;  4WU8 A;  5AV9 B;  4LD9 B;  5GT0 B;  4KGC D;  5B0Y C;  1EQZ D;  3W99 A;  2F8N H;  4H9P B;  3MGR C;  5B32 D;  2YFV A;  4H9N B;  2ZM5 A;  1TZY B;  3X1V A;  3WA9 C;  5GT3 C;  3AZI B;  3MGP B;  5AV5 A;  3REH B;  4KUD C;  1BH8 B;  3LJA B;  4XZQ B;  5BS7 A;  3AZG C;  1P3I B;  2W8S A;  4H9R A;  2Y2J A;  4M6B A;  5CHL B;  5E5A D;  3WA9 B;  3X1S B;  4Z2M G;  2F8N D;  5BNV B;  5CP6 A;  5CPJ B;  3WAA C;  3REI D;  5GXQ A;  5CPK C;  3MGQ D;  3AZG B;  3AV2 D;  3LEL A;  3LZ1 A;  1Q9C A;  3AZE B;  4ZUX C;  3TU4 B;  3AZF D;  5B0Y A;  4YM6 B;  1KX5 B;  5DNN D;  5BT1 C;  3KXB C;  1M19 D;  3REJ A;  5B1L B;  4E45 A;  1P3B C;  3VH5 T;  3WTP C;  1H3O A;  2Y2O A;  3KUY B;  1P34 D;  1U35 C;  2UWX A;  1TAF A;  1M1A D;  2JE5 A;  4H9O B;  5B24 A;  5C3I C;  2ARO B;  3VH5 W;  2F2A C;  4UPK A;  4G91 B;  1P3L B;  5DNM A;  1S32 C;  4R8P C;  3C1C C;  3V9R A;  3O62 C;  3AZN D;  2YFW B;  4AWL C;  4YS3 C;  5B2I A;  5AVC A;  3X1U C;  4Z66 A;  1S32 B;  5AV6 D;  4DRB A;  5B32 G;  3AZM B;  3UTA D;  4YS3 B;  3W98 D;  4J8U C;  2HIO A;  4ZUX A;  1KX3 C;  4KGC C;  3AZL B;  1F66 D;  1P3A C;  3F6T A;  3W96 D;  4KHA B;  3C1B C;  1P3O A;  3KXB A;  4X23 A;  1ID3 D;  1EQZ B;  3KWQ D;  3P5J B;  1U35 A;  4NE6 A;  5B32 B;  5AV9 D;  3EPJ A;  1KX4 C;  2F8N G;  3B6F D;  5B40 A;  3C1C A;  1P3G C;  4CSR A;  5AY8 A;  3X1U A;  1TZY D;  3REI C;  5JRG D;  3X1V D;  3AV2 C;  3AFA C;  5E5A B;  3AN2 A;  1P3P C;  5AV5 D;  2F8N B;  4J8V A;  3AZH D;  1KX3 A;  4XZQ D;  3R45 B;  3REI B;  3MGS C;  3MGQ B;  1P3F A;  4Z2M H;  1P3A A;  4E44 A;  2BYM A;  3AZF B;  5GXQ D;  1P34 C;  4WJ3 C;  1ZLA C;  3REL D;  1AOI C;  3NQU A;  2DQN C;  3TU4 D;  5DNN B;  3AYW C;  1M19 B;  1KX4 A;  2Y2L A;  4J8X B;  4YM6 D;  3AZK C;  4UUZ A;  1M1A B;  2BG1 A;  1BH9 B;  5F99 A;  5GSU D;  1P3G A;  5B1L D;  3NQJ A;  2NQB D;  1P3K C;  5JA4 A;  2ARO D;  2ZY3 A;  3AZN B;  1T3U A;  3UTA C;  3UTB B;  4H9S C;  4QLC D;  5DNM D;  5B1M D;  5AV6 B;  3MGS A;  1F66 C;  4HGA B;  2FJ7 D;  2NZD D;  5B33 D;  4Z66 D;  4JJN C;  3W98 B;  1ID3 C;  3KWQ C;  1F66 B;  1AOI A;  5AV9 C;  4LD9 C;  3W96 B;  3B6F C;  5GT0 C;  5AV8 D;  3AYW A;  3REK B;  1ID3 B;  2XD1 A;  1HQ3 D;  4Z5T D;  1ULY A;  4J8W D;  1M18 A;  3WKJ D;  3B6F B;  1TZY C;  5KDM A;  1P3K A;  5BO0 B;  4XUJ A;  3AZI C;  5B31 D;  3MVD D;  3MGP C;  3REH C;  3EG5 B;  4H9S A;  3LJA C;  4XZQ C;  4G92 B;  5JRG B;  5B40 D;  3X1V B;  1P3I C;  1P3M A;  1N1J B;  2VQR A;  3X1S C;  5CPJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...