4Z5TA

The nucleosome containing human h3.5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.3C
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tA00
3X1TB 3MGRC 4E45A 3VH6A 5B31D 3MGRA 3LJAC 3AZND 3WKJA 4KGCC 3MGQB 4XZQA 3KUYC 3LJAD 1BH8A 3AZHA 4YS3B 1M19D 5DNMC 5B32B 1P34A 5DNMA 5GSUB 1P34C 4J8XA 2NZDB 4WZSB 5CPIC 3LELA 3RELB 4XUJC 4CSRB 4J8XC 3V9RA 2YFVA 1N1JA 4XUJA 3C1CB 3WTPE 5B0ZB 3REKB 3REIA 5CPJD 5CP6A 4Z66C 3LZ1C 1P3AC 4Z66A 3WTPB 3LELD 4Z5TD 3X1VA 3AZIA 1N1JB 5AVCD 4X23D 5B31C 1M19A 1H3OA 3AZED 3AZHD 2AROC 3KXBD 3UT9A 1KX5D 1TZYB 1ULYA 5CPKA 5B1MC 2AROB 2BYKB 3UT9C 5AV8D 4JJNC 3AV2A 3AV1D 4CAYB 3B6GD 1P3PD 5DNNB 1EQZD 4DRBA 3AZLD 3W98D 3W96D 3LZ1B 3UTBD 3X1UB 5BT1D 3X1SA 3C1CC 5JRGB 1ID3A 4XUJB 3C1CA 5B0YC 2IO5C 3AN2B 2NQBC 4ZBJB 1M1AA 1JFIA 2RVQC 1M1AC 2FJ7A 5JA4B 3AV2D 3X1TA 4J8WD 1S32D 3X1TC 3MGRB 5B1LB 2NQBD 3AZEA 4YM6B 1M1AB 5AVCA 1S32A 1P3KD 3W99C 5BNVA 1P3GB 1P3OD 3X1VD 1AOIB 2HIOB 3AZGB 3W99A 4KHAA 3AFAC 3AZJB 5B2IB 5AVBB 3REKA 2YFWA 3WAAC 5GXQC 1P3FA 3W98C 3LZ0C 3WA9B 5B32G 3VH5W 3AZFD 2BYMB 3AYWC 1P3BD 3LZ0A 5BNVB 4Z5TC 4H9RB 2LY8A 3MVDD 4H9QA 1HQ3B 4WV4B 1P34D 1Q9CA 5CPJC 1P3LB 3LJAA 3WKJC 3KUYA 3AZHC 3KWQB 5AY8A 3UT9B 5B1MB 5CPKB 1P3GD 3LELC 4Z2MH 2AROD 5FUGB 5AY8D 4G91B 4M6BA 1P3LA 1A7WA 5GT3A 3O62B 5CP6B 1KX3B 4H9NA 4X23B 1P3AB 4Z66B 3TU4C 2HIOA 3AZGA 4WNNA 1M18C 3MGPA 1TAFB 2F8NA 1P3FC 1M18A 1P3FD 1M19C 5GT3B 4NE6A 3O62A 3REKD 3MGSB 4WU9B 1HQ3D 5GSUC 5B32A 4XUJD 1P34B 2NZDC 3VH5T 3MGPD 5AV6B 5GSUA 5B32C 2NZDA 4WU8C 4EO5C 4JJNA 4G92C 4G92B 5B2JD 5B33D 4QLCD 3KWQC 5AY8C 5GT3D 5AVBD 4NFTA 3MGSA 3KWQA 4WU9A 3WKJD 1BH9B 1B67A 3AZJD 1P3PB 3B0BA 3X1TD 1P3OC 4E44A 3TU4B 1P3KC 3NQJA 1ID3C 5B24A 1M1AD 3KXBB 1KX3D 5G49B 5CP6C 5E5AB 4R8PA 4H9NB 1P3AA 4R8PC 2HIOC 3AZGC 4ZUXC 3AV2B 3LELB 3RELA 4J8VB 3UTBA 3AZIC 3AZFA 1ZLAB 4KUDB 3VH6W 3UTBC 5B0YD 3AZMA 2L5AA 3AZLA 4WU8A 5GT0B 5B24D 5F99B 3C1BD 5B2JB 5AV6A 3AZLC 5AV5B 3W99D 3R45A 3REJD 3AV2C 5AV6C 4LD9D 5AV5D 3B0DC 3AZFB 3C1BB 1ZLAA 1KX5A 3MGSC 4WU9C 1M19B 5AVBA 4WU9D 3MGSD 3AN2A 5B0YB 3W98B 1P3FB 3KXBC 4QLCA 1P3IA 5AVBC 4X23A 5B33A 1ZLAD 3VH5A 3B6FB 3AYWA 4QLCC 1P3IC 4JJND 1P3OB 4CSRA 3VH6T 5DNNA 1KX5B 5E5AD 5BS7C 5B1LA 4G91C 5CP6D 5CPJA 5B0YA 5AY8B 5B1LC 4ZUXA 1ID3D 1S32B 1F66B 5BT1C 4JJNB 4EO5B 3UTAB 3KSYA 4J8VA 3B0CT 5B1MD 4J8UC 3WKJB 5CPJB 1P3LC 5GT3C 4ZBJC 2F8NK 3MVDB 5AVCC 1F1EA 1KX4D 4LD9B 5AV8A 1WWIA 3TU4A 2JSSA 3V9RB 3AFAA 3MGPB 3MGPC 5F99D 5B24B 5GT0D 3LZ1D 3KXBA 1U35A 3REKC 3O62C 4YM6A 1P3MC 3MVDA 3B6FA 4J8VD 1P3MA 1AOID 1P3GC 5DNNC 4Z5TA 3A6NA 4Z66D 2HUEC 1F66D 4UUZB 2F8NG 3UTAC 3MGQA 3O62D 3AZHB 4YS3A 5B1LD 1M18D 1F66C 2F8ND 1F66A 3A6ND 4Z5TB 2CV5D 4J8UA 3WTPC 3AYWD 1P3BC 3B6FD 4H9OA 4H9QB 5AV9B 3AZNC 4KGCD 5G49A 3MNNA 5GXQB 4XZQD 3WAAB 1P3LD 3AZNA 4QLCB 5B33B 4LD9A 3RELC 3W99B 5AV6D 1P3BB 3AZFC 4HGAB 3WA9D 5BO0B 1HTAA 4YM6C 3W96B 3REHA 3AZMD 1BH8B 5B2ID 3AZLB 1BH9A 1TZYA 4KUDD 3REJC 5JA4A 3UTAA 3LZ0D 4H9PA 1ZLAC 1TZYD 4UUZA 4ZUXD 3W96A 5BO0A 2NQBB 2IO5B 3AN2C 4R8PB 4J8WB 3WTPA 3AV1A 1P3OA 3B6GC 4KHAB 1P3KA 5JRGA 3NQUA 3AZJA 5B24C 3UT9D 5BS7A 3MNNB 3AN2D 3MNND 4J8WC 4LD9C 4Z2MG 5JRGD 5B2JA 4J8WA 3R45B 5C3IB 2PYOC 4AWLB 5BNXB 2CV5C 3X1UD 3C1BA 1HQ3A 5B32D 3LJAB 4XZQC 3AZMC 5B31B 2HIOD 3AZGD 5CPIA 3X1VB 3X1SD 5AV8C 3W96C 1P3AD 4HGAC 4KUDA 1KX5C 4DRAA 4YM6D 1U35B 3REHD 5B0ZC 3WA9A 2CWEA 4X23C 5B33C 2BYMA 3B6FC 3B6GA 4J8XB 5CPIB 5B31G 3A6NC 4NE5A 2YFVB 3NQJB 5CPKD 3AZKC 3KWQD 3B0DB 3KUYD 4YS3C 3MGQC 3KUYB 5B2JC 5B0ZD 5AV9D 3AZKA 4KGCB 5GT0C 5F99C 5CPKC 5B1MA 4J8UD 2CV5A 5CPID 5BNXA 1HQ3C 5GSUD 2NZDD 3AZIB 3UTBB 4J8VC 2HUEB 4YS3D 2YFWB 3MGQD 3AZKB 4ZUXB 1JFIB 5E5AC 5DNND 3LZ0B 1P3MB 1EQZB 3X1SC 3AV1B 4WNNB 5DNMD 1P3MD 1P3KB 1R4VA 1P3ID 5B0ZA 3AZKD 3REHC 3REIC 1U35C 3AZEB 3MGRD 3W97B 3LZ1A 5AVCB 3MVDC 3AFAD 1KX4C 2FJ7C 1P3GA 3X1VC 2PYOD 3REJA 1KX4A 1KU5A 4J8UB 4H9PB 5FUGA 3B0CW 2RVQD 1H3OB 1BFMA 5GXQD 4XZQB 3WAAD 3W97A 5B40C 4WU8B 1S32C 2F8NH 2CV5B 2FJ7B 4AWLC 2PYOB 3A6NB 1P3BA 5JRGC 3NQUB 2F8NB 4R8PD 3W97D 1M18B 3REHB 3MNNC 3W98A 5E5AA 5B40D 3X1UC 1P3IB 1KX3C 1EQZA 3X1UA 3B6GB 3X1SB 2PYOA 5AV8B 1EQZC 3C1BC 1WWSA 5B40B 2NQBA 5KDMB 3AZMB 4KGCA 5AV5C 4NE3A 1TZYC 3AZID 5AV5A 3REJB 2FJ7D 3WTPD 1KX4B 5C3IC 4H9RA 1TAFA 4KUDC 4WU8D 4H9SA 5CHLB 5B40A 3W97C 3REID 3AZEC 5KDMA 3REIB 4H9SC 3C1CD 3WA9C 1B6WA 3AYWB 3UTAD 3RELD 3AV1C 1AOIA 4J8XD 5B2IC 3AFAB 1ID3B 4H9OB 1AOIC 3AZJC 5AV9A 5B2IA 5GXQA 3WAAA 1U35D 1KX3A 5AV9C 5B31A 3AZNB 1P3PC 5F99A 5GT0A 2AROA 2BYKA 5DNMB 1P3PA 3TU4D 4CAYA
chains in the Genus database with same CATH superfamily
3X1TB 2Y2OA 3MGRC 4E45A 3VH6A 5B31D 3MGRA 3LJAC 3AZND 3WKJA 4KGCC 3MGQB 4XZQA 3KUYC 3LJAD 1BH8A 3AZHA 4YS3B 1M19D 5DNMC 5B32B 1P34A 5DNMA 5GSUB 1P34C 4J8XA 2NZDB 4WZSB 5CPIC 3LELA 3RELB 4XUJC 4CSRB 4J8XC 3V9RA 2YFVA 1N1JA 4XUJA 3C1CB 3WTPE 5B0ZB 3REKB 3REIA 5CPJD 5CP6A 4UPKA 4Z66C 3LZ1C 1P3AC 4Z66A 3WTPB 3LELD 4Z5TD 3X1VA 3AZIA 1N1JB 5AVCD 4X23D 2ZY3A 5B31C 1M19A 1H3OA 3AZED 3AZHD 2AROC 2Y2GA 3KXBD 3UT9A 1KX5D 1TZYB 1ULYA 5CPKA 5B1MC 2AROB 2BYKB 3UT9C 5AV8D 4JJNC 3AV2A 3AV1D 4CAYB 3B6GD 1P3PD 5DNNB 1EQZD 3P5JB 4DRBA 3AZLD 3W98D 2ZY4A 3W96D 3LZ1B 3UTBD 3X1UB 5BT1D 3X1SA 4DQYB 2G5IC 3C1CC 3H0MC 5JRGB 1ID3A 4XUJB 3C1CA 5B0YC 2IO5C 3AN2B 2NQBC 4ZBJB 1M1AA 1JFIA 2RVQC 1M1AC 2FJ7A 5JA4B 3AV2D 3X1TA 4J8WD 1S32D 3X1TC 3MGRB 1Z2CB 5B1LB 2NQBD 3AZEA 4YM6B 1M1AB 5AVCA 1S32A 1P3KD 3W99C 5BNVA 1P3GB 1P3OD 3X1VD 1AOIB 2HIOB 2DF4C 3AZGB 3W99A 4KHAA 3AFAC 3AZJB 5B2IB 5AVBB 3REKA 2YFWA 3WAAC 5GXQC 1P3FA 3W98C 3LZ0C 3WA9B 5B32G 3VH5W 3AZFD 2BYMB 3AYWC 1P3BD 3LZ0A 5BNVB 4Z5TC 4H9RB 2LY8A 3MVDD 4H9QA 1HQ3B 4WV4B 1P34D 1Q9CA 5CPJC 1P3LB 3LJAA 3WKJC 3KUYA 3AZHC 3KWQB 5AY8A 3UT9B 5B1MB 5CPKB 2JE5A 1P3GD 3LELC 4Z2MH 2AROD 2Y2HA 5FUGB 5AY8D 4G91B 4M6BA 1P3LA 1A7WA 5GT3A 3O62B 5CP6B 1KX3B 4H9NA 2DQNC 4X23B 1P3AB 4Z66B 3TU4C 2HIOA 3AZGA 4WNNA 1M18C 3MGPA 1TAFB 2Y2KA 2F8NA 2Y2LA 1P3FC 1M18A 1P3FD 1M19C 5GT3B 4NE6A 3O62A 3REKD 3MGSB 4WU9B 1PZRA 1HQ3D 5GSUC 5B32A 4XUJD 3EPLA 1P34B 2NZDC 3VH5T 2G5HC 3MGPD 5AV6B 5GSUA 5B32C 2NZDA 4WU8C 2BG1A 4EO5C 4JJNA 4G92C 4G92B 5B2JD 5B33D 4QLCD 3KWQC 5AY8C 5GT3D 5AVBD 4NFTA 3MGSA 3KWQA 4WU9A 3WKJD 1BH9B 1B67A 3AZJD 1P3PB 3B0BA 3X1TD 1P3OC 4E44A 3TU4B 2ZY5A 1P3KC 3NQJA 1ID3C 5B24A 1M1AD 3KXBB 1KX3D 5G49B 5CP6C 5E5AB 3FDDA 4R8PA 4H9NB 1P3AA 4R8PC 2HIOC 3AZGC 4ZUXC 3AV2B 3LELB 3RELA 4J8VB 3UTBA 3AZIC 3AZFA 1ZLAB 4KUDB 1T3UA 3VH6W 3UTBC 5B0YD 3AZMA 2L5AA 3AZLA 4WU8A 5GT0B 3A1IA 5B24D 5F99B 3C1BD 3KFUG 5B2JB 5AV6A 3AZLC 5AV5B 3W99D 3R45A 3REJD 3AV2C 5AV6C 4LD9D 5AV5D 3B0DC 3AZFB 3C1BB 1ZLAA 1KX5A 3MGSC 4WU9C 1M19B 5AVBA 4WU9D 3MGSD 3AN2A 5B0YB 3W98B 1P3FB 3KXBC 4QLCA 1P3IA 5AVBC 4X23A 5B33A 1ZLAD 3VH5A 3B6FB 3AYWA 4QLCC 1P3IC 4JJND 1P3OB 4CSRA 3VH6T 5DNNA 1KX5B 5E5AD 2Y2PA 5B1LA 4G91C 5BS7C 5CP6D 5B0YA 5CPJA 5AY8B 5B1LC 4ZUXA 1ID3D 2XD5A 1S32B 1F66B 5BT1C 4JJNB 4EO5B 3UTAB 3KSYA 4J8VA 2Y2QA 3B0CT 5B1MD 4J8UC 3WKJB 5CPJB 1P3LC 5GT3C 4ZBJC 2F8NK 3AL0C 2F2AC 3MVDB 5AVCC 2Y2IA 1F1EA 1KX4D 4LD9B 5AV8A 1WWIA 3TU4A 2JSSA 3V9RB 3AFAA 3MGPB 3MGPC 5F99D 5B24B 5GT0D 3LZ1D 3KXBA 1U35A 3REKC 3O62C 4YM6A 1P3MC 3MVDA 3B6FA 4J8VD 1P3MA 1AOID 1P3GC 5DNNC 4Z5TA 2UWXA 3A6NA 4Z66D 2HUEC 1F66D 4UUZB 2F8NG 3UTAC 3MGQA 2JCHA 3O62D 3AZHB 5B1LD 4YS3A 1M18D 1F66C 2F8ND 1F66A 3A6ND 4Z5TB 2CV5D 4J8UA 3WTPC 3AYWD 1P3BC 3B6FD 4H9OA 4H9QB 2Y2MA 5AV9B 3AZNC 4KGCD 5G49A 3MNNA 5GXQB 4XZQD 3WAAB 1P3LD 3H0LC 3AZNA 4QLCB 5B33B 4LD9A 3RELC 3W99B 5AV6D 1P3BB 3AZFC 4HGAB 3WA9D 5BO0B 1HTAA 4YM6C 3W96B 3REHA 3AZMD 1BH8B 5B2ID 3AZLB 1BH9A 1TZYA 4KUDD 3REJC 5JA4A 2W8SA 3UTAA 3LZ0D 4H9PA 1ZLAC 1TZYD 4UUZA 4ZUXD 3W96A 5BO0A 2NQBB 2IO5B 3AN2C 4R8PB 4J8WB 3WTPA 3AV1A 1P3OA 3B6GC 4KHAB 1P3KA 5JRGA 3NQUA 3AZJA 5B24C 3UT9D 5BS7A 3MNNB 3AN2D 3MNND 4J8WC 4LD9C 4Z2MG 5JRGD 5B2JA 4J8WA 3R45B 5C3IB 2PYOC 4AWLB 5BNXB 2ZY2A 2CV5C 3X1UD 2J8PA 3C1BA 1HQ3A 5B32D 3LJAB 4XZQC 3AZMC 5B31B 2HIOD 3AZGD 2FFFB 5CPIA 3X1VB 3X1SD 5AV8C 3W96C 1P3AD 4HGAC 4KUDA 1KX5C 2VQRA 4DRAA 4YM6D 1U35B 3REHD 5B0ZC 3WA9A 2CWEA 4X23C 5B33C 2BYMA 3B6FC 2ZM5A 3B6GA 4J8XB 3EPHA 3F6TA 5CPIB 5B31G 3A6NC 4NE5A 2YFVB 3NQJB 5CPKD 3H0RC 3AZKC 3KWQD 3B0DB 3KUYD 4YS3C 3MGQC 3KUYB 5B2JC 5B0ZD 5AV9D 3AZKA 4KGCB 5GT0C 5F99C 5CPKC 5B1MA 4J8UD 2CV5A 5CPID 5BNXA 1HQ3C 5GSUD 2NZDD 3AZIB 3UTBB 4J8VC 2HUEB 2Y2JA 4YS3D 2YFWB 3MGQD 3AZKB 4ZUXB 1JFIB 5E5AC 5DNND 3LZ0B 1P3MB 1EQZB 2Y2NA 3X1SC 3AV1B 4WNNB 5DNMD 1P3MD 1P3KB 1R4VA 3EG5B 1P3ID 5B0ZA 3AZKD 3REHC 3REIC 1U35C 3AZEB 3MGRD 3W97B 3LZ1A 3A1KA 5AVCB 3MVDC 3AFAD 1KX4C 2FJ7C 1P3GA 3X1VC 2PYOD 3REJA 1KX4A 1KU5A 4J8UB 4H9PB 5FUGA 3B0CW 2RVQD 1H3OB 1BFMA 5GXQD 4XZQB 3WAAD 3W97A 5B40C 4WU8B 1S32C 2F8NH 2CV5B 2FJ7B 4AWLC 2PYOB 3A6NB 1P3BA 5JRGC 3NQUB 2F8NB 4R8PD 3W97D 1M18B 3REHB 3MNNC 3W98A 5E5AA 5B40D 3X1UC 1P3IB 1KX3C 1EQZA 3X1UA 3B6GB 3X1SB 2PYOA 2XD1A 5AV8B 1EQZC 2RIQA 3C1BC 1WWSA 5B40B 2NQBA 5KDMB 3AZMB 4KGCA 5AV5C 4NE3A 3EPJA 1TZYC 3AZID 5AV5A 3REJB 2FJ7D 3WTPD 1KX4B 5C3IC 4H9RA 1TAFA 4KUDC 4WU8D 4H9SA 5CHLB 5B40A 3W97C 3REID 3AZEC 5KDMA 3REIB 4H9SC 3C1CD 3WA9C 1B6WA 3EPKA 3AYWB 3UTAD 3RELD 3AV1C 1AOIA 4J8XD 5B2IC 3AFAB 4WJ3C 1ID3B 4H9OB 1AOIC 3AZJC 5AV9A 5B2IA 1W2EA 5GXQA 3WAAA 1U35D 3IP4C 1KX3A 5AV9C 5B31A 3AZNB 1P3PC 5F99A 5GT0A 2AROA 2BYKA 5DNMB 1P3PA 3TU4D 4CAYA
chains in the Genus database with same CATH topology
3X1TB 2Y2OA 3MGRC 4E45A 3VH6A 5B31D 3MGRA 3LJAC 3AZND 3WKJA 4KGCC 3MGQB 4XZQA 3KUYC 3LJAD 1BH8A 3AZHA 4YS3B 1M19D 5DNMC 5B32B 1P34A 5DNMA 5GSUB 1P34C 4J8XA 2NZDB 4WZSB 5CPIC 3LELA 3RELB 4XUJC 4CSRB 4J8XC 3V9RA 2YFVA 1N1JA 4XUJA 3C1CB 3WTPE 5B0ZB 3REKB 3REIA 5CPJD 5CP6A 4UPKA 4Z66C 3LZ1C 1P3AC 4Z66A 3WTPB 3LELD 4Z5TD 3X1VA 3AZIA 1N1JB 5AVCD 4X23D 2ZY3A 5B31C 1M19A 1H3OA 3AZED 3AZHD 2AROC 2Y2GA 3KXBD 3UT9A 1KX5D 1TZYB 1ULYA 5CPKA 5B1MC 2AROB 2BYKB 3UT9C 5AV8D 4JJNC 3AV2A 3AV1D 4CAYB 3B6GD 1P3PD 5DNNB 1EQZD 3P5JB 4DRBA 3AZLD 3W98D 2ZY4A 3W96D 3LZ1B 3UTBD 3X1UB 5BT1D 3X1SA 4DQYB 2G5IC 3C1CC 3H0MC 5JRGB 1ID3A 4XUJB 3C1CA 5B0YC 2IO5C 3AN2B 2NQBC 4ZBJB 1M1AA 1JFIA 2RVQC 1M1AC 2FJ7A 5JA4B 3AV2D 3X1TA 4J8WD 1S32D 3X1TC 3MGRB 1Z2CB 5B1LB 2NQBD 3AZEA 4YM6B 1M1AB 5AVCA 1S32A 1P3KD 3W99C 5BNVA 1P3GB 1P3OD 3X1VD 1AOIB 2HIOB 2DF4C 3AZGB 3W99A 4KHAA 3AFAC 3AZJB 5B2IB 5AVBB 3REKA 2YFWA 3WAAC 5GXQC 1P3FA 3W98C 3LZ0C 3WA9B 5B32G 3VH5W 3AZFD 2BYMB 3AYWC 1P3BD 3LZ0A 5BNVB 4Z5TC 4H9RB 2LY8A 3MVDD 4H9QA 1HQ3B 4WV4B 1P34D 1Q9CA 5CPJC 1P3LB 3LJAA 3WKJC 3KUYA 3AZHC 3KWQB 5AY8A 3UT9B 5B1MB 5CPKB 2JE5A 1P3GD 3LELC 4Z2MH 2AROD 2Y2HA 5FUGB 5AY8D 4G91B 4M6BA 1P3LA 1A7WA 5GT3A 3O62B 5CP6B 1KX3B 4H9NA 2DQNC 4X23B 1P3AB 4Z66B 3TU4C 2HIOA 3AZGA 4WNNA 1M18C 3MGPA 1TAFB 2Y2KA 2F8NA 2Y2LA 1P3FC 1M18A 1P3FD 1M19C 5GT3B 4NE6A 3O62A 3REKD 3MGSB 4WU9B 1PZRA 1HQ3D 5GSUC 5B32A 4XUJD 3EPLA 1P34B 2NZDC 3VH5T 2G5HC 3MGPD 5AV6B 5GSUA 5B32C 2NZDA 4WU8C 2BG1A 4EO5C 4JJNA 4G92C 4G92B 5B2JD 5B33D 4QLCD 3KWQC 5AY8C 5GT3D 5AVBD 4NFTA 3MGSA 3KWQA 4WU9A 3WKJD 1BH9B 1B67A 3AZJD 1P3PB 3B0BA 3X1TD 1P3OC 4E44A 3TU4B 2ZY5A 1P3KC 3NQJA 1ID3C 5B24A 1M1AD 3KXBB 1KX3D 5G49B 5CP6C 5E5AB 3FDDA 4R8PA 4H9NB 1P3AA 4R8PC 2HIOC 3AZGC 4ZUXC 3AV2B 3LELB 3RELA 4J8VB 3UTBA 3AZIC 3AZFA 1ZLAB 4KUDB 1T3UA 3VH6W 3UTBC 5B0YD 3AZMA 2L5AA 3AZLA 4WU8A 5GT0B 3A1IA 5B24D 5F99B 3C1BD 3KFUG 5B2JB 5AV6A 3AZLC 5AV5B 3W99D 3R45A 3REJD 3AV2C 5AV6C 4LD9D 5AV5D 3B0DC 3AZFB 3C1BB 1ZLAA 1KX5A 3MGSC 4WU9C 1M19B 5AVBA 4WU9D 3MGSD 3AN2A 5B0YB 3W98B 1P3FB 3KXBC 4QLCA 1P3IA 5AVBC 4X23A 5B33A 1ZLAD 3VH5A 3B6FB 3AYWA 4QLCC 1P3IC 4JJND 1P3OB 4CSRA 3VH6T 5DNNA 1KX5B 5E5AD 2Y2PA 5B1LA 4G91C 5BS7C 5CP6D 5B0YA 5CPJA 5AY8B 5B1LC 4ZUXA 1ID3D 2XD5A 1S32B 1F66B 5BT1C 4JJNB 4EO5B 3UTAB 3KSYA 4J8VA 2Y2QA 3B0CT 5B1MD 4J8UC 3WKJB 5CPJB 1P3LC 5GT3C 4ZBJC 2F8NK 3AL0C 2F2AC 3MVDB 5AVCC 2Y2IA 1F1EA 1KX4D 4LD9B 5AV8A 1WWIA 3TU4A 2JSSA 3V9RB 3AFAA 3MGPB 3MGPC 5F99D 5B24B 5GT0D 3LZ1D 3KXBA 1U35A 3REKC 3O62C 4YM6A 1P3MC 3MVDA 3B6FA 4J8VD 1P3MA 1AOID 1P3GC 5DNNC 4Z5TA 2UWXA 3A6NA 4Z66D 2HUEC 1F66D 4UUZB 2F8NG 3UTAC 3MGQA 2JCHA 3O62D 3AZHB 5B1LD 4YS3A 1M18D 1F66C 2F8ND 1F66A 3A6ND 4Z5TB 2CV5D 4J8UA 3WTPC 3AYWD 1P3BC 3B6FD 4H9OA 4H9QB 2Y2MA 5AV9B 3AZNC 4KGCD 5G49A 3MNNA 5GXQB 4XZQD 3WAAB 1P3LD 3H0LC 3AZNA 4QLCB 5B33B 4LD9A 3RELC 3W99B 5AV6D 1P3BB 3AZFC 4HGAB 3WA9D 5BO0B 1HTAA 4YM6C 3W96B 3REHA 3AZMD 1BH8B 5B2ID 3AZLB 1BH9A 1TZYA 4KUDD 3REJC 5JA4A 2W8SA 3UTAA 3LZ0D 4H9PA 1ZLAC 1TZYD 4UUZA 4ZUXD 3W96A 5BO0A 2NQBB 2IO5B 3AN2C 4R8PB 4J8WB 3WTPA 3AV1A 1P3OA 3B6GC 4KHAB 1P3KA 5JRGA 3NQUA 3AZJA 5B24C 3UT9D 5BS7A 3MNNB 3AN2D 3MNND 4J8WC 4LD9C 4Z2MG 5JRGD 5B2JA 4J8WA 3R45B 5C3IB 2PYOC 4AWLB 5BNXB 2ZY2A 2CV5C 3X1UD 2J8PA 3C1BA 1HQ3A 5B32D 3LJAB 4XZQC 3AZMC 5B31B 2HIOD 3AZGD 2FFFB 5CPIA 3X1VB 3X1SD 5AV8C 3W96C 1P3AD 4HGAC 4KUDA 1KX5C 2VQRA 4DRAA 4YM6D 1U35B 3REHD 5B0ZC 3WA9A 2CWEA 4X23C 5B33C 2BYMA 3B6FC 2ZM5A 3B6GA 4J8XB 3EPHA 3F6TA 5CPIB 5B31G 3A6NC 4NE5A 2YFVB 3NQJB 5CPKD 3H0RC 3AZKC 3KWQD 3B0DB 3KUYD 4YS3C 3MGQC 3KUYB 5B2JC 5B0ZD 5AV9D 3AZKA 4KGCB 5GT0C 5F99C 5CPKC 5B1MA 4J8UD 2CV5A 5CPID 5BNXA 1HQ3C 5GSUD 2NZDD 3AZIB 3UTBB 4J8VC 2HUEB 2Y2JA 4YS3D 2YFWB 3MGQD 3AZKB 4ZUXB 1JFIB 5E5AC 5DNND 3LZ0B 1P3MB 1EQZB 2Y2NA 3X1SC 3AV1B 4WNNB 5DNMD 1P3MD 1P3KB 1R4VA 3EG5B 1P3ID 5B0ZA 3AZKD 3REHC 3REIC 1U35C 3AZEB 3MGRD 3W97B 3LZ1A 3A1KA 5AVCB 3MVDC 3AFAD 1KX4C 2FJ7C 1P3GA 3X1VC 2PYOD 3REJA 1KX4A 1KU5A 4J8UB 4H9PB 5FUGA 3B0CW 2RVQD 1H3OB 1BFMA 5GXQD 4XZQB 3WAAD 3W97A 5B40C 4WU8B 1S32C 2F8NH 2CV5B 2FJ7B 4AWLC 2PYOB 3A6NB 1P3BA 5JRGC 3NQUB 2F8NB 4R8PD 3W97D 1M18B 3REHB 3MNNC 3W98A 5E5AA 5B40D 3X1UC 1P3IB 1KX3C 1EQZA 3X1UA 3B6GB 3X1SB 2PYOA 2XD1A 5AV8B 1EQZC 2RIQA 3C1BC 1WWSA 5B40B 2NQBA 5KDMB 3AZMB 4KGCA 5AV5C 4NE3A 3EPJA 1TZYC 3AZID 5AV5A 3REJB 2FJ7D 3WTPD 1KX4B 5C3IC 4H9RA 1TAFA 4KUDC 4WU8D 4H9SA 5CHLB 5B40A 3W97C 3REID 3AZEC 5KDMA 3REIB 4H9SC 3C1CD 3WA9C 1B6WA 3EPKA 3AYWB 3UTAD 3RELD 3AV1C 1AOIA 4J8XD 5B2IC 3AFAB 4WJ3C 1ID3B 4H9OB 1AOIC 3AZJC 5AV9A 5B2IA 1W2EA 5GXQA 3WAAA 1U35D 3IP4C 1KX3A 5AV9C 5B31A 3AZNB 1P3PC 5F99A 5GT0A 2AROA 2BYKA 5DNMB 1P3PA 3TU4D 4CAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T B;  3MGR C;  4E45 A;  3VH6 A;  5B31 D;  3MGR A;  3LJA C;  3AZN D;  3WKJ A;  4KGC C;  3MGQ B;  4XZQ A;  3KUY C;  3LJA D;  1BH8 A;  3AZH A;  4YS3 B;  1M19 D;  5DNM C;  5B32 B;  1P34 A;  5DNM A;  5GSU B;  1P34 C;  4J8X A;  2NZD B;  4WZS B;  5CPI C;  3LEL A;  3REL B;  4XUJ C;  4CSR B;  4J8X C;  3V9R A;  2YFV A;  1N1J A;  4XUJ A;  3C1C B;  3WTP E;  5B0Z B;  3REK B;  3REI A;  5CPJ D;  5CP6 A;  4Z66 C;  3LZ1 C;  1P3A C;  4Z66 A;  3WTP B;  3LEL D;  4Z5T D;  3X1V A;  3AZI A;  1N1J B;  5AVC D;  4X23 D;  5B31 C;  1M19 A;  1H3O A;  3AZE D;  3AZH D;  2ARO C;  3KXB D;  3UT9 A;  1KX5 D;  1TZY B;  1ULY A;  5CPK A;  5B1M C;  2ARO B;  2BYK B;  3UT9 C;  5AV8 D;  4JJN C;  3AV2 A;  3AV1 D;  4CAY B;  3B6G D;  1P3P D;  5DNN B;  1EQZ D;  4DRB A;  3AZL D;  3W98 D;  3W96 D;  3LZ1 B;  3UTB D;  3X1U B;  5BT1 D;  3X1S A;  3C1C C;  5JRG B;  1ID3 A;  4XUJ B;  3C1C A;  5B0Y C;  2IO5 C;  3AN2 B;  2NQB C;  4ZBJ B;  1M1A A;  1JFI A;  2RVQ C;  1M1A C;  2FJ7 A;  5JA4 B;  3AV2 D;  3X1T A;  4J8W D;  1S32 D;  3X1T C;  3MGR B;  5B1L B;  2NQB D;  3AZE A;  4YM6 B;  1M1A B;  5AVC A;  1S32 A;  1P3K D;  3W99 C;  5BNV A;  1P3G B;  1P3O D;  3X1V D;  1AOI B;  2HIO B;  3AZG B;  3W99 A;  4KHA A;  3AFA C;  3AZJ B;  5B2I B;  5AVB B;  3REK A;  2YFW A;  3WAA C;  5GXQ C;  1P3F A;  3W98 C;  3LZ0 C;  3WA9 B;  5B32 G;  3VH5 W;  3AZF D;  2BYM B;  3AYW C;  1P3B D;  3LZ0 A;  5BNV B;  4Z5T C;  4H9R B;  2LY8 A;  3MVD D;  4H9Q A;  1HQ3 B;  4WV4 B;  1P34 D;  1Q9C A;  5CPJ C;  1P3L B;  3LJA A;  3WKJ C;  3KUY A;  3AZH C;  3KWQ B;  5AY8 A;  3UT9 B;  5B1M B;  5CPK B;  1P3G D;  3LEL C;  4Z2M H;  2ARO D;  5FUG B;  5AY8 D;  4G91 B;  4M6B A;  1P3L A;  1A7W A;  5GT3 A;  3O62 B;  5CP6 B;  1KX3 B;  4H9N A;  4X23 B;  1P3A B;  4Z66 B;  3TU4 C;  2HIO A;  3AZG A;  4WNN A;  1M18 C;  3MGP A;  1TAF B;  2F8N A;  1P3F C;  1M18 A;  1P3F D;  1M19 C;  5GT3 B;  4NE6 A;  3O62 A;  3REK D;  3MGS B;  4WU9 B;  1HQ3 D;  5GSU C;  5B32 A;  4XUJ D;  1P34 B;  2NZD C;  3VH5 T;  3MGP D;  5AV6 B;  5GSU A;  5B32 C;  2NZD A;  4WU8 C;  4EO5 C;  4JJN A;  4G92 C;  4G92 B;  5B2J D;  5B33 D;  4QLC D;  3KWQ C;  5AY8 C;  5GT3 D;  5AVB D;  4NFT A;  3MGS A;  3KWQ A;  4WU9 A;  3WKJ D;  1BH9 B;  1B67 A;  3AZJ D;  1P3P B;  3B0B A;  3X1T D;  1P3O C;  4E44 A;  3TU4 B;  1P3K C;  3NQJ A;  1ID3 C;  5B24 A;  1M1A D;  3KXB B;  1KX3 D;  5G49 B;  5CP6 C;  5E5A B;  4R8P A;  4H9N B;  1P3A A;  4R8P C;  2HIO C;  3AZG C;  4ZUX C;  3AV2 B;  3LEL B;  3REL A;  4J8V B;  3UTB A;  3AZI C;  3AZF A;  1ZLA B;  4KUD B;  3VH6 W;  3UTB C;  5B0Y D;  3AZM A;  2L5A A;  3AZL A;  4WU8 A;  5GT0 B;  5B24 D;  5F99 B;  3C1B D;  5B2J B;  5AV6 A;  3AZL C;  5AV5 B;  3W99 D;  3R45 A;  3REJ D;  3AV2 C;  5AV6 C;  4LD9 D;  5AV5 D;  3B0D C;  3AZF B;  3C1B B;  1ZLA A;  1KX5 A;  3MGS C;  4WU9 C;  1M19 B;  5AVB A;  4WU9 D;  3MGS D;  3AN2 A;  5B0Y B;  3W98 B;  1P3F B;  3KXB C;  4QLC A;  1P3I A;  5AVB C;  4X23 A;  5B33 A;  1ZLA D;  3VH5 A;  3B6F B;  3AYW A;  4QLC C;  1P3I C;  4JJN D;  1P3O B;  4CSR A;  3VH6 T;  5DNN A;  1KX5 B;  5E5A D;  5BS7 C;  5B1L A;  4G91 C;  5CP6 D;  5CPJ A;  5B0Y A;  5AY8 B;  5B1L C;  4ZUX A;  1ID3 D;  1S32 B;  1F66 B;  5BT1 C;  4JJN B;  4EO5 B;  3UTA B;  3KSY A;  4J8V A;  3B0C T;  5B1M D;  4J8U C;  3WKJ B;  5CPJ B;  1P3L C;  5GT3 C;  4ZBJ C;  2F8N K;  3MVD B;  5AVC C;  1F1E A;  1KX4 D;  4LD9 B;  5AV8 A;  1WWI A;  3TU4 A;  2JSS A;  3V9R B;  3AFA A;  3MGP B;  3MGP C;  5F99 D;  5B24 B;  5GT0 D;  3LZ1 D;  3KXB A;  1U35 A;  3REK C;  3O62 C;  4YM6 A;  1P3M C;  3MVD A;  3B6F A;  4J8V D;  1P3M A;  1AOI D;  1P3G C;  5DNN C;  4Z5T A;  3A6N A;  4Z66 D;  2HUE C;  1F66 D;  4UUZ B;  2F8N G;  3UTA C;  3MGQ A;  3O62 D;  3AZH B;  4YS3 A;  5B1L D;  1M18 D;  1F66 C;  2F8N D;  1F66 A;  3A6N D;  4Z5T B;  2CV5 D;  4J8U A;  3WTP C;  3AYW D;  1P3B C;  3B6F D;  4H9O A;  4H9Q B;  5AV9 B;  3AZN C;  4KGC D;  5G49 A;  3MNN A;  5GXQ B;  4XZQ D;  3WAA B;  1P3L D;  3AZN A;  4QLC B;  5B33 B;  4LD9 A;  3REL C;  3W99 B;  5AV6 D;  1P3B B;  3AZF C;  4HGA B;  3WA9 D;  5BO0 B;  1HTA A;  4YM6 C;  3W96 B;  3REH A;  3AZM D;  1BH8 B;  5B2I D;  3AZL B;  1BH9 A;  1TZY A;  4KUD D;  3REJ C;  5JA4 A;  3UTA A;  3LZ0 D;  4H9P A;  1ZLA C;  1TZY D;  4UUZ A;  4ZUX D;  3W96 A;  5BO0 A;  2NQB B;  2IO5 B;  3AN2 C;  4R8P B;  4J8W B;  3WTP A;  3AV1 A;  1P3O A;  3B6G C;  4KHA B;  1P3K A;  5JRG A;  3NQU A;  3AZJ A;  5B24 C;  3UT9 D;  5BS7 A;  3MNN B;  3AN2 D;  3MNN D;  4J8W C;  4LD9 C;  4Z2M G;  5JRG D;  5B2J A;  4J8W A;  3R45 B;  5C3I B;  2PYO C;  4AWL B;  5BNX B;  2CV5 C;  3X1U D;  3C1B A;  1HQ3 A;  5B32 D;  3LJA B;  4XZQ C;  3AZM C;  5B31 B;  2HIO D;  3AZG D;  5CPI A;  3X1V B;  3X1S D;  5AV8 C;  3W96 C;  1P3A D;  4HGA C;  4KUD A;  1KX5 C;  4DRA A;  4YM6 D;  1U35 B;  3REH D;  5B0Z C;  3WA9 A;  2CWE A;  4X23 C;  5B33 C;  2BYM A;  3B6F C;  3B6G A;  4J8X B;  5CPI B;  5B31 G;  3A6N C;  4NE5 A;  2YFV B;  3NQJ B;  5CPK D;  3AZK C;  3KWQ D;  3B0D B;  3KUY D;  4YS3 C;  3MGQ C;  3KUY B;  5B2J C;  5B0Z D;  5AV9 D;  3AZK A;  4KGC B;  5GT0 C;  5F99 C;  5CPK C;  5B1M A;  4J8U D;  2CV5 A;  5CPI D;  5BNX A;  1HQ3 C;  5GSU D;  2NZD D;  3AZI B;  3UTB B;  4J8V C;  2HUE B;  4YS3 D;  2YFW B;  3MGQ D;  3AZK B;  4ZUX B;  1JFI B;  5E5A C;  5DNN D;  3LZ0 B;  1P3M B;  1EQZ B;  3X1S C;  3AV1 B;  4WNN B;  5DNM D;  1P3M D;  1P3K B;  1R4V A;  1P3I D;  5B0Z A;  3AZK D;  3REH C;  3REI C;  1U35 C;  3AZE B;  3MGR D;  3W97 B;  3LZ1 A;  5AVC B;  3MVD C;  3AFA D;  1KX4 C;  2FJ7 C;  1P3G A;  3X1V C;  2PYO D;  3REJ A;  1KX4 A;  1KU5 A;  4J8U B;  4H9P B;  5FUG A;  3B0C W;  2RVQ D;  1H3O B;  1BFM A;  5GXQ D;  4XZQ B;  3WAA D;  3W97 A;  5B40 C;  4WU8 B;  1S32 C;  2F8N H;  2CV5 B;  2FJ7 B;  4AWL C;  2PYO B;  3A6N B;  1P3B A;  5JRG C;  3NQU B;  2F8N B;  4R8P D;  3W97 D;  1M18 B;  3REH B;  3MNN C;  3W98 A;  5E5A A;  5B40 D;  3X1U C;  1P3I B;  1KX3 C;  1EQZ A;  3X1U A;  3B6G B;  3X1S B;  2PYO A;  5AV8 B;  1EQZ C;  3C1B C;  1WWS A;  5B40 B;  2NQB A;  5KDM B;  3AZM B;  4KGC A;  5AV5 C;  4NE3 A;  1TZY C;  3AZI D;  5AV5 A;  3REJ B;  2FJ7 D;  3WTP D;  1KX4 B;  5C3I C;  4H9R A;  1TAF A;  4KUD C;  4WU8 D;  4H9S A;  5CHL B;  5B40 A;  3W97 C;  3REI D;  3AZE C;  5KDM A;  3REI B;  4H9S C;  3C1C D;  3WA9 C;  1B6W A;  3AYW B;  3UTA D;  3REL D;  3AV1 C;  1AOI A;  4J8X D;  5B2I C;  3AFA B;  1ID3 B;  4H9O B;  1AOI C;  3AZJ C;  5AV9 A;  5B2I A;  5GXQ A;  3WAA A;  1U35 D;  1KX3 A;  5AV9 C;  5B31 A;  3AZN B;  1P3P C;  5F99 A;  5GT0 A;  2ARO A;  2BYK A;  5DNM B;  1P3P A;  3TU4 D;  4CAY A; 
#chains in the Genus database with same CATH topology
 3X1T B;  2Y2O A;  3MGR C;  4E45 A;  3VH6 A;  5B31 D;  3MGR A;  3LJA C;  3AZN D;  3WKJ A;  4KGC C;  3MGQ B;  4XZQ A;  3KUY C;  3LJA D;  1BH8 A;  3AZH A;  4YS3 B;  1M19 D;  5DNM C;  5B32 B;  1P34 A;  5DNM A;  5GSU B;  1P34 C;  4J8X A;  2NZD B;  4WZS B;  5CPI C;  3LEL A;  3REL B;  4XUJ C;  4CSR B;  4J8X C;  3V9R A;  2YFV A;  1N1J A;  4XUJ A;  3C1C B;  3WTP E;  5B0Z B;  3REK B;  3REI A;  5CPJ D;  5CP6 A;  4UPK A;  4Z66 C;  3LZ1 C;  1P3A C;  4Z66 A;  3WTP B;  3LEL D;  4Z5T D;  3X1V A;  3AZI A;  1N1J B;  5AVC D;  4X23 D;  2ZY3 A;  5B31 C;  1M19 A;  1H3O A;  3AZE D;  3AZH D;  2ARO C;  2Y2G A;  3KXB D;  3UT9 A;  1KX5 D;  1TZY B;  1ULY A;  5CPK A;  5B1M C;  2ARO B;  2BYK B;  3UT9 C;  5AV8 D;  4JJN C;  3AV2 A;  3AV1 D;  4CAY B;  3B6G D;  1P3P D;  5DNN B;  1EQZ D;  3P5J B;  4DRB A;  3AZL D;  3W98 D;  2ZY4 A;  3W96 D;  3LZ1 B;  3UTB D;  3X1U B;  5BT1 D;  3X1S A;  4DQY B;  2G5I C;  3C1C C;  3H0M C;  5JRG B;  1ID3 A;  4XUJ B;  3C1C A;  5B0Y C;  2IO5 C;  3AN2 B;  2NQB C;  4ZBJ B;  1M1A A;  1JFI A;  2RVQ C;  1M1A C;  2FJ7 A;  5JA4 B;  3AV2 D;  3X1T A;  4J8W D;  1S32 D;  3X1T C;  3MGR B;  1Z2C B;  5B1L B;  2NQB D;  3AZE A;  4YM6 B;  1M1A B;  5AVC A;  1S32 A;  1P3K D;  3W99 C;  5BNV A;  1P3G B;  1P3O D;  3X1V D;  1AOI B;  2HIO B;  2DF4 C;  3AZG B;  3W99 A;  4KHA A;  3AFA C;  3AZJ B;  5B2I B;  5AVB B;  3REK A;  2YFW A;  3WAA C;  5GXQ C;  1P3F A;  3W98 C;  3LZ0 C;  3WA9 B;  5B32 G;  3VH5 W;  3AZF D;  2BYM B;  3AYW C;  1P3B D;  3LZ0 A;  5BNV B;  4Z5T C;  4H9R B;  2LY8 A;  3MVD D;  4H9Q A;  1HQ3 B;  4WV4 B;  1P34 D;  1Q9C A;  5CPJ C;  1P3L B;  3LJA A;  3WKJ C;  3KUY A;  3AZH C;  3KWQ B;  5AY8 A;  3UT9 B;  5B1M B;  5CPK B;  2JE5 A;  1P3G D;  3LEL C;  4Z2M H;  2ARO D;  2Y2H A;  5FUG B;  5AY8 D;  4G91 B;  4M6B A;  1P3L A;  1A7W A;  5GT3 A;  3O62 B;  5CP6 B;  1KX3 B;  4H9N A;  2DQN C;  4X23 B;  1P3A B;  4Z66 B;  3TU4 C;  2HIO A;  3AZG A;  4WNN A;  1M18 C;  3MGP A;  1TAF B;  2Y2K A;  2F8N A;  2Y2L A;  1P3F C;  1M18 A;  1P3F D;  1M19 C;  5GT3 B;  4NE6 A;  3O62 A;  3REK D;  3MGS B;  4WU9 B;  1PZR A;  1HQ3 D;  5GSU C;  5B32 A;  4XUJ D;  3EPL A;  1P34 B;  2NZD C;  3VH5 T;  2G5H C;  3MGP D;  5AV6 B;  5GSU A;  5B32 C;  2NZD A;  4WU8 C;  2BG1 A;  4EO5 C;  4JJN A;  4G92 C;  4G92 B;  5B2J D;  5B33 D;  4QLC D;  3KWQ C;  5AY8 C;  5GT3 D;  5AVB D;  4NFT A;  3MGS A;  3KWQ A;  4WU9 A;  3WKJ D;  1BH9 B;  1B67 A;  3AZJ D;  1P3P B;  3B0B A;  3X1T D;  1P3O C;  4E44 A;  3TU4 B;  2ZY5 A;  1P3K C;  3NQJ A;  1ID3 C;  5B24 A;  1M1A D;  3KXB B;  1KX3 D;  5G49 B;  5CP6 C;  5E5A B;  3FDD A;  4R8P A;  4H9N B;  1P3A A;  4R8P C;  2HIO C;  3AZG C;  4ZUX C;  3AV2 B;  3LEL B;  3REL A;  4J8V B;  3UTB A;  3AZI C;  3AZF A;  1ZLA B;  4KUD B;  1T3U A;  3VH6 W;  3UTB C;  5B0Y D;  3AZM A;  2L5A A;  3AZL A;  4WU8 A;  5GT0 B;  3A1I A;  5B24 D;  5F99 B;  3C1B D;  3KFU G;  5B2J B;  5AV6 A;  3AZL C;  5AV5 B;  3W99 D;  3R45 A;  3REJ D;  3AV2 C;  5AV6 C;  4LD9 D;  5AV5 D;  3B0D C;  3AZF B;  3C1B B;  1ZLA A;  1KX5 A;  3MGS C;  4WU9 C;  1M19 B;  5AVB A;  4WU9 D;  3MGS D;  3AN2 A;  5B0Y B;  3W98 B;  1P3F B;  3KXB C;  4QLC A;  1P3I A;  5AVB C;  4X23 A;  5B33 A;  1ZLA D;  3VH5 A;  3B6F B;  3AYW A;  4QLC C;  1P3I C;  4JJN D;  1P3O B;  4CSR A;  3VH6 T;  5DNN A;  1KX5 B;  5E5A D;  2Y2P A;  5B1L A;  4G91 C;  5BS7 C;  5CP6 D;  5B0Y A;  5CPJ A;  5AY8 B;  5B1L C;  4ZUX A;  1ID3 D;  2XD5 A;  1S32 B;  1F66 B;  5BT1 C;  4JJN B;  4EO5 B;  3UTA B;  3KSY A;  4J8V A;  2Y2Q A;  3B0C T;  5B1M D;  4J8U C;  3WKJ B;  5CPJ B;  1P3L C;  5GT3 C;  4ZBJ C;  2F8N K;  3AL0 C;  2F2A C;  3MVD B;  5AVC C;  2Y2I A;  1F1E A;  1KX4 D;  4LD9 B;  5AV8 A;  1WWI A;  3TU4 A;  2JSS A;  3V9R B;  3AFA A;  3MGP B;  3MGP C;  5F99 D;  5B24 B;  5GT0 D;  3LZ1 D;  3KXB A;  1U35 A;  3REK C;  3O62 C;  4YM6 A;  1P3M C;  3MVD A;  3B6F A;  4J8V D;  1P3M A;  1AOI D;  1P3G C;  5DNN C;  4Z5T A;  2UWX A;  3A6N A;  4Z66 D;  2HUE C;  1F66 D;  4UUZ B;  2F8N G;  3UTA C;  3MGQ A;  2JCH A;  3O62 D;  3AZH B;  5B1L D;  4YS3 A;  1M18 D;  1F66 C;  2F8N D;  1F66 A;  3A6N D;  4Z5T B;  2CV5 D;  4J8U A;  3WTP C;  3AYW D;  1P3B C;  3B6F D;  4H9O A;  4H9Q B;  2Y2M A;  5AV9 B;  3AZN C;  4KGC D;  5G49 A;  3MNN A;  5GXQ B;  4XZQ D;  3WAA B;  1P3L D;  3H0L C;  3AZN A;  4QLC B;  5B33 B;  4LD9 A;  3REL C;  3W99 B;  5AV6 D;  1P3B B;  3AZF C;  4HGA B;  3WA9 D;  5BO0 B;  1HTA A;  4YM6 C;  3W96 B;  3REH A;  3AZM D;  1BH8 B;  5B2I D;  3AZL B;  1BH9 A;  1TZY A;  4KUD D;  3REJ C;  5JA4 A;  2W8S A;  3UTA A;  3LZ0 D;  4H9P A;  1ZLA C;  1TZY D;  4UUZ A;  4ZUX D;  3W96 A;  5BO0 A;  2NQB B;  2IO5 B;  3AN2 C;  4R8P B;  4J8W B;  3WTP A;  3AV1 A;  1P3O A;  3B6G C;  4KHA B;  1P3K A;  5JRG A;  3NQU A;  3AZJ A;  5B24 C;  3UT9 D;  5BS7 A;  3MNN B;  3AN2 D;  3MNN D;  4J8W C;  4LD9 C;  4Z2M G;  5JRG D;  5B2J A;  4J8W A;  3R45 B;  5C3I B;  2PYO C;  4AWL B;  5BNX B;  2ZY2 A;  2CV5 C;  3X1U D;  2J8P A;  3C1B A;  1HQ3 A;  5B32 D;  3LJA B;  4XZQ C;  3AZM C;  5B31 B;  2HIO D;  3AZG D;  2FFF B;  5CPI A;  3X1V B;  3X1S D;  5AV8 C;  3W96 C;  1P3A D;  4HGA C;  4KUD A;  1KX5 C;  2VQR A;  4DRA A;  4YM6 D;  1U35 B;  3REH D;  5B0Z C;  3WA9 A;  2CWE A;  4X23 C;  5B33 C;  2BYM A;  3B6F C;  2ZM5 A;  3B6G A;  4J8X B;  3EPH A;  3F6T A;  5CPI B;  5B31 G;  3A6N C;  4NE5 A;  2YFV B;  3NQJ B;  5CPK D;  3H0R C;  3AZK C;  3KWQ D;  3B0D B;  3KUY D;  4YS3 C;  3MGQ C;  3KUY B;  5B2J C;  5B0Z D;  5AV9 D;  3AZK A;  4KGC B;  5GT0 C;  5F99 C;  5CPK C;  5B1M A;  4J8U D;  2CV5 A;  5CPI D;  5BNX A;  1HQ3 C;  5GSU D;  2NZD D;  3AZI B;  3UTB B;  4J8V C;  2HUE B;  2Y2J A;  4YS3 D;  2YFW B;  3MGQ D;  3AZK B;  4ZUX B;  1JFI B;  5E5A C;  5DNN D;  3LZ0 B;  1P3M B;  1EQZ B;  2Y2N A;  3X1S C;  3AV1 B;  4WNN B;  5DNM D;  1P3M D;  1P3K B;  1R4V A;  3EG5 B;  1P3I D;  5B0Z A;  3AZK D;  3REH C;  3REI C;  1U35 C;  3AZE B;  3MGR D;  3W97 B;  3LZ1 A;  3A1K A;  5AVC B;  3MVD C;  3AFA D;  1KX4 C;  2FJ7 C;  1P3G A;  3X1V C;  2PYO D;  3REJ A;  1KX4 A;  1KU5 A;  4J8U B;  4H9P B;  5FUG A;  3B0C W;  2RVQ D;  1H3O B;  1BFM A;  5GXQ D;  4XZQ B;  3WAA D;  3W97 A;  5B40 C;  4WU8 B;  1S32 C;  2F8N H;  2CV5 B;  2FJ7 B;  4AWL C;  2PYO B;  3A6N B;  1P3B A;  5JRG C;  3NQU B;  2F8N B;  4R8P D;  3W97 D;  1M18 B;  3REH B;  3MNN C;  3W98 A;  5E5A A;  5B40 D;  3X1U C;  1P3I B;  1KX3 C;  1EQZ A;  3X1U A;  3B6G B;  3X1S B;  2PYO A;  2XD1 A;  5AV8 B;  1EQZ C;  2RIQ A;  3C1B C;  1WWS A;  5B40 B;  2NQB A;  5KDM B;  3AZM B;  4KGC A;  5AV5 C;  4NE3 A;  3EPJ A;  1TZY C;  3AZI D;  5AV5 A;  3REJ B;  2FJ7 D;  3WTP D;  1KX4 B;  5C3I C;  4H9R A;  1TAF A;  4KUD C;  4WU8 D;  4H9S A;  5CHL B;  5B40 A;  3W97 C;  3REI D;  3AZE C;  5KDM A;  3REI B;  4H9S C;  3C1C D;  3WA9 C;  1B6W A;  3EPK A;  3AYW B;  3UTA D;  3REL D;  3AV1 C;  1AOI A;  4J8X D;  5B2I C;  3AFA B;  4WJ3 C;  1ID3 B;  4H9O B;  1AOI C;  3AZJ C;  5AV9 A;  5B2I A;  1W2E A;  5GXQ A;  3WAA A;  1U35 D;  3IP4 C;  1KX3 A;  5AV9 C;  5B31 A;  3AZN B;  1P3P C;  5F99 A;  5GT0 A;  2ARO A;  2BYK A;  5DNM B;  1P3P A;  3TU4 D;  4CAY A; 
#chains in the Genus database with same CATH homology
 3X1T B;  2Y2O A;  3MGR C;  4E45 A;  3VH6 A;  5B31 D;  3MGR A;  3LJA C;  3AZN D;  3WKJ A;  4KGC C;  3MGQ B;  4XZQ A;  3KUY C;  3LJA D;  1BH8 A;  3AZH A;  4YS3 B;  1M19 D;  5DNM C;  5B32 B;  1P34 A;  5DNM A;  5GSU B;  1P34 C;  4J8X A;  2NZD B;  4WZS B;  5CPI C;  3LEL A;  3REL B;  4XUJ C;  4CSR B;  4J8X C;  3V9R A;  2YFV A;  1N1J A;  4XUJ A;  3C1C B;  3WTP E;  5B0Z B;  3REK B;  3REI A;  5CPJ D;  5CP6 A;  4UPK A;  4Z66 C;  3LZ1 C;  1P3A C;  4Z66 A;  3WTP B;  3LEL D;  4Z5T D;  3X1V A;  3AZI A;  1N1J B;  5AVC D;  4X23 D;  2ZY3 A;  5B31 C;  1M19 A;  1H3O A;  3AZE D;  3AZH D;  2ARO C;  2Y2G A;  3KXB D;  3UT9 A;  1KX5 D;  1TZY B;  1ULY A;  5CPK A;  5B1M C;  2ARO B;  2BYK B;  3UT9 C;  5AV8 D;  4JJN C;  3AV2 A;  3AV1 D;  4CAY B;  3B6G D;  1P3P D;  5DNN B;  1EQZ D;  3P5J B;  4DRB A;  3AZL D;  3W98 D;  2ZY4 A;  3W96 D;  3LZ1 B;  3UTB D;  3X1U B;  5BT1 D;  3X1S A;  4DQY B;  2G5I C;  3C1C C;  3H0M C;  5JRG B;  1ID3 A;  4XUJ B;  3C1C A;  5B0Y C;  2IO5 C;  3AN2 B;  2NQB C;  4ZBJ B;  1M1A A;  1JFI A;  2RVQ C;  1M1A C;  2FJ7 A;  5JA4 B;  3AV2 D;  3X1T A;  4J8W D;  1S32 D;  3X1T C;  3MGR B;  1Z2C B;  5B1L B;  2NQB D;  3AZE A;  4YM6 B;  1M1A B;  5AVC A;  1S32 A;  1P3K D;  3W99 C;  5BNV A;  1P3G B;  1P3O D;  3X1V D;  1AOI B;  2HIO B;  2DF4 C;  3AZG B;  3W99 A;  4KHA A;  3AFA C;  3AZJ B;  5B2I B;  5AVB B;  3REK A;  2YFW A;  3WAA C;  5GXQ C;  1P3F A;  3W98 C;  3LZ0 C;  3WA9 B;  5B32 G;  3VH5 W;  3AZF D;  2BYM B;  3AYW C;  1P3B D;  3LZ0 A;  5BNV B;  4Z5T C;  4H9R B;  2LY8 A;  3MVD D;  4H9Q A;  1HQ3 B;  4WV4 B;  1P34 D;  1Q9C A;  5CPJ C;  1P3L B;  3LJA A;  3WKJ C;  3KUY A;  3AZH C;  3KWQ B;  5AY8 A;  3UT9 B;  5B1M B;  5CPK B;  2JE5 A;  1P3G D;  3LEL C;  4Z2M H;  2ARO D;  2Y2H A;  5FUG B;  5AY8 D;  4G91 B;  4M6B A;  1P3L A;  1A7W A;  5GT3 A;  3O62 B;  5CP6 B;  1KX3 B;  4H9N A;  2DQN C;  4X23 B;  1P3A B;  4Z66 B;  3TU4 C;  2HIO A;  3AZG A;  4WNN A;  1M18 C;  3MGP A;  1TAF B;  2Y2K A;  2F8N A;  2Y2L A;  1P3F C;  1M18 A;  1P3F D;  1M19 C;  5GT3 B;  4NE6 A;  3O62 A;  3REK D;  3MGS B;  4WU9 B;  1PZR A;  1HQ3 D;  5GSU C;  5B32 A;  4XUJ D;  3EPL A;  1P34 B;  2NZD C;  3VH5 T;  2G5H C;  3MGP D;  5AV6 B;  5GSU A;  5B32 C;  2NZD A;  4WU8 C;  2BG1 A;  4EO5 C;  4JJN A;  4G92 C;  4G92 B;  5B2J D;  5B33 D;  4QLC D;  3KWQ C;  5AY8 C;  5GT3 D;  5AVB D;  4NFT A;  3MGS A;  3KWQ A;  4WU9 A;  3WKJ D;  1BH9 B;  1B67 A;  3AZJ D;  1P3P B;  3B0B A;  3X1T D;  1P3O C;  4E44 A;  3TU4 B;  2ZY5 A;  1P3K C;  3NQJ A;  1ID3 C;  5B24 A;  1M1A D;  3KXB B;  1KX3 D;  5G49 B;  5CP6 C;  5E5A B;  3FDD A;  4R8P A;  4H9N B;  1P3A A;  4R8P C;  2HIO C;  3AZG C;  4ZUX C;  3AV2 B;  3LEL B;  3REL A;  4J8V B;  3UTB A;  3AZI C;  3AZF A;  1ZLA B;  4KUD B;  1T3U A;  3VH6 W;  3UTB C;  5B0Y D;  3AZM A;  2L5A A;  3AZL A;  4WU8 A;  5GT0 B;  3A1I A;  5B24 D;  5F99 B;  3C1B D;  3KFU G;  5B2J B;  5AV6 A;  3AZL C;  5AV5 B;  3W99 D;  3R45 A;  3REJ D;  3AV2 C;  5AV6 C;  4LD9 D;  5AV5 D;  3B0D C;  3AZF B;  3C1B B;  1ZLA A;  1KX5 A;  3MGS C;  4WU9 C;  1M19 B;  5AVB A;  4WU9 D;  3MGS D;  3AN2 A;  5B0Y B;  3W98 B;  1P3F B;  3KXB C;  4QLC A;  1P3I A;  5AVB C;  4X23 A;  5B33 A;  1ZLA D;  3VH5 A;  3B6F B;  3AYW A;  4QLC C;  1P3I C;  4JJN D;  1P3O B;  4CSR A;  3VH6 T;  5DNN A;  1KX5 B;  5E5A D;  2Y2P A;  5B1L A;  4G91 C;  5BS7 C;  5CP6 D;  5B0Y A;  5CPJ A;  5AY8 B;  5B1L C;  4ZUX A;  1ID3 D;  2XD5 A;  1S32 B;  1F66 B;  5BT1 C;  4JJN B;  4EO5 B;  3UTA B;  3KSY A;  4J8V A;  2Y2Q A;  3B0C T;  5B1M D;  4J8U C;  3WKJ B;  5CPJ B;  1P3L C;  5GT3 C;  4ZBJ C;  2F8N K;  3AL0 C;  2F2A C;  3MVD B;  5AVC C;  2Y2I A;  1F1E A;  1KX4 D;  4LD9 B;  5AV8 A;  1WWI A;  3TU4 A;  2JSS A;  3V9R B;  3AFA A;  3MGP B;  3MGP C;  5F99 D;  5B24 B;  5GT0 D;  3LZ1 D;  3KXB A;  1U35 A;  3REK C;  3O62 C;  4YM6 A;  1P3M C;  3MVD A;  3B6F A;  4J8V D;  1P3M A;  1AOI D;  1P3G C;  5DNN C;  4Z5T A;  2UWX A;  3A6N A;  4Z66 D;  2HUE C;  1F66 D;  4UUZ B;  2F8N G;  3UTA C;  3MGQ A;  2JCH A;  3O62 D;  3AZH B;  5B1L D;  4YS3 A;  1M18 D;  1F66 C;  2F8N D;  1F66 A;  3A6N D;  4Z5T B;  2CV5 D;  4J8U A;  3WTP C;  3AYW D;  1P3B C;  3B6F D;  4H9O A;  4H9Q B;  2Y2M A;  5AV9 B;  3AZN C;  4KGC D;  5G49 A;  3MNN A;  5GXQ B;  4XZQ D;  3WAA B;  1P3L D;  3H0L C;  3AZN A;  4QLC B;  5B33 B;  4LD9 A;  3REL C;  3W99 B;  5AV6 D;  1P3B B;  3AZF C;  4HGA B;  3WA9 D;  5BO0 B;  1HTA A;  4YM6 C;  3W96 B;  3REH A;  3AZM D;  1BH8 B;  5B2I D;  3AZL B;  1BH9 A;  1TZY A;  4KUD D;  3REJ C;  5JA4 A;  2W8S A;  3UTA A;  3LZ0 D;  4H9P A;  1ZLA C;  1TZY D;  4UUZ A;  4ZUX D;  3W96 A;  5BO0 A;  2NQB B;  2IO5 B;  3AN2 C;  4R8P B;  4J8W B;  3WTP A;  3AV1 A;  1P3O A;  3B6G C;  4KHA B;  1P3K A;  5JRG A;  3NQU A;  3AZJ A;  5B24 C;  3UT9 D;  5BS7 A;  3MNN B;  3AN2 D;  3MNN D;  4J8W C;  4LD9 C;  4Z2M G;  5JRG D;  5B2J A;  4J8W A;  3R45 B;  5C3I B;  2PYO C;  4AWL B;  5BNX B;  2ZY2 A;  2CV5 C;  3X1U D;  2J8P A;  3C1B A;  1HQ3 A;  5B32 D;  3LJA B;  4XZQ C;  3AZM C;  5B31 B;  2HIO D;  3AZG D;  2FFF B;  5CPI A;  3X1V B;  3X1S D;  5AV8 C;  3W96 C;  1P3A D;  4HGA C;  4KUD A;  1KX5 C;  2VQR A;  4DRA A;  4YM6 D;  1U35 B;  3REH D;  5B0Z C;  3WA9 A;  2CWE A;  4X23 C;  5B33 C;  2BYM A;  3B6F C;  2ZM5 A;  3B6G A;  4J8X B;  3EPH A;  3F6T A;  5CPI B;  5B31 G;  3A6N C;  4NE5 A;  2YFV B;  3NQJ B;  5CPK D;  3H0R C;  3AZK C;  3KWQ D;  3B0D B;  3KUY D;  4YS3 C;  3MGQ C;  3KUY B;  5B2J C;  5B0Z D;  5AV9 D;  3AZK A;  4KGC B;  5GT0 C;  5F99 C;  5CPK C;  5B1M A;  4J8U D;  2CV5 A;  5CPI D;  5BNX A;  1HQ3 C;  5GSU D;  2NZD D;  3AZI B;  3UTB B;  4J8V C;  2HUE B;  2Y2J A;  4YS3 D;  2YFW B;  3MGQ D;  3AZK B;  4ZUX B;  1JFI B;  5E5A C;  5DNN D;  3LZ0 B;  1P3M B;  1EQZ B;  2Y2N A;  3X1S C;  3AV1 B;  4WNN B;  5DNM D;  1P3M D;  1P3K B;  1R4V A;  3EG5 B;  1P3I D;  5B0Z A;  3AZK D;  3REH C;  3REI C;  1U35 C;  3AZE B;  3MGR D;  3W97 B;  3LZ1 A;  3A1K A;  5AVC B;  3MVD C;  3AFA D;  1KX4 C;  2FJ7 C;  1P3G A;  3X1V C;  2PYO D;  3REJ A;  1KX4 A;  1KU5 A;  4J8U B;  4H9P B;  5FUG A;  3B0C W;  2RVQ D;  1H3O B;  1BFM A;  5GXQ D;  4XZQ B;  3WAA D;  3W97 A;  5B40 C;  4WU8 B;  1S32 C;  2F8N H;  2CV5 B;  2FJ7 B;  4AWL C;  2PYO B;  3A6N B;  1P3B A;  5JRG C;  3NQU B;  2F8N B;  4R8P D;  3W97 D;  1M18 B;  3REH B;  3MNN C;  3W98 A;  5E5A A;  5B40 D;  3X1U C;  1P3I B;  1KX3 C;  1EQZ A;  3X1U A;  3B6G B;  3X1S B;  2PYO A;  2XD1 A;  5AV8 B;  1EQZ C;  2RIQ A;  3C1B C;  1WWS A;  5B40 B;  2NQB A;  5KDM B;  3AZM B;  4KGC A;  5AV5 C;  4NE3 A;  3EPJ A;  1TZY C;  3AZI D;  5AV5 A;  3REJ B;  2FJ7 D;  3WTP D;  1KX4 B;  5C3I C;  4H9R A;  1TAF A;  4KUD C;  4WU8 D;  4H9S A;  5CHL B;  5B40 A;  3W97 C;  3REI D;  3AZE C;  5KDM A;  3REI B;  4H9S C;  3C1C D;  3WA9 C;  1B6W A;  3EPK A;  3AYW B;  3UTA D;  3REL D;  3AV1 C;  1AOI A;  4J8X D;  5B2I C;  3AFA B;  4WJ3 C;  1ID3 B;  4H9O B;  1AOI C;  3AZJ C;  5AV9 A;  5B2I A;  1W2E A;  5GXQ A;  3WAA A;  1U35 D;  3IP4 C;  1KX3 A;  5AV9 C;  5B31 A;  3AZN B;  1P3P C;  5F99 A;  5GT0 A;  2ARO A;  2BYK A;  5DNM B;  1P3P A;  3TU4 D;  4CAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...