1P3KC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3kC00
3TU4C 4XZQC 1P3GC 4ZBJC 5JRGB 4HGAC 5G49B 3X1SC 5DNNC 2AROD 3AZGA 4QLCB 4WU9C 4KUDD 5GT3D 5AVBD 3W98A 3MGQD 1M18B 5C3IB 5AY8B 1M1AD 3RELA 3KXBA 3KUYA 4J8UC 1KX4B 4G92C 5B1LD 4Z66D 4G91B 1P3PD 3AZLD 3WTPD 3AZEA 3O62D 3KWQA 4H9OB 5B32D 3MNND 5GT0D 1HQ3B 5JA4A 3LJAB 2NQBC 1AOIA 3AZIA 4YM6D 3AV1C 4EO5C 3A6NB 3UTAA 5CPKC 1TZYA 3LZ1A 4J8WD 5DNMB 3X1UD 1P3IB 5BT1C 4KGCC 5GXQC 4JJND 4WU8A 2BYKA 3W96A 4NFTA 3X1TD 3MVDB 5CPIC 1P3KB 2AROB 3AZMD 4CAYB 4KHAA 1KU5A 3NQUA 1P3MB 1P3AD 5GT3B 5AVBB 4H9SC 3B0DB 5B2JD 3UT9B 3AV2D 5AVCC 1EQZC 5CPJA 1BH8B 4R8PA 2F8ND 4DRAA 5AV9D 1S32A 4Z66B 1P3PB 3REJD 4H9QA 3O62B 3AZJA 5B32B 3MNNB 5F99D 5GT0B 3AZFC 4LD9D 3V9RA 5B31C 5B40C 4YM6B 3VH5W 4J8WB 5B0ZD 1KX5C 4JJNB 4H9PB 5B1MC 5G49A 3TU4D 3X1TB 4XZQD 5E5AB 1P3GD 3AZMB 3R45A 4X23B 3X1SD 2LY8A 5DNND 3MGRC 3AZNC 3AN2A 3AV2B 3MGSA 1M18A 2F8NK 5AY8A 4WU9D 1KX4A 1ZLAC 3REJB 2RVQD 3B6GB 5F99B 5B24A 3LJAA 4J8XC 2NQBD 3A6NA 5B1LC 3C1CC 3KUYB 2NZDA 5DNMA 3AV1D 5B0ZB 5CPKD 3WKJC 5BT1D 5GSUC 4XZQB 3TU4B 4KGCD 5GXQD 2PYOC 2AROA 4ZBJB 4HGAB 3AZHD 4CAYA 3X1SB 5DNNB 5CPID 4J8VC 1ID3C 4KUDA 5GT3A 5AVBA 3MGQA 1N1JB 4WU9B 2YFVA 1M1AA 1BH8A 5AVCD 1BFMA 3AZKC 3W99C 5BNXB 2BYKB 4Z66A 4J8UB 3W96B 4G92B 1P3PA 3AZLA 3WTPA 3O62A 1P3AC 5B32A 5CHLB 3MNNA 5GT0A 3AZFD 3VH6T 4YM6A 3C1BC 5CPJB 1P34C 5B31D 4WNNA 2FJ7C 5B40D 4J8WA 5BS7C 3X1UA 4H9NA 4EO5B 3B6FC 4Z5TC 3LELD 4JJNA 4H9QB 4KGCB 3X1TA 3AZJB 5GXQB 3AZMA 5B1MD 1BH9B 5CP6C 2HIOC 5B2JA 3AV2A 3MGRD 3AZND 5B33C 5AV8C 2F8NA 1EQZB 5AV9A 1M19C 1ZLAD 3REJA 4Z2MG 3R45B 1P3BC 3B6GA 5B0YC 5F99A 3VH5A 1JFIA 3AN2B 4ZUXC 4LD9A 3MGSB 3UTBC 1KX3C 5B31B 4J8XD 5B40B 5B0ZA 2RVQC 3C1CD 1KX5B 3TU4A 4XZQA 1P3GA 3WKJD 5B1MB 5GSUD 5B24B 1F66C 3X1SA 5DNNA 2PYOD 1N1JA 4J8VD 4WU9A 1ID3D 2NZDB 1HTAA 5AV5C 3REIC 5BNXA 3AZKD 4J8UA 3W99D 3LZ0C 3AZHC 1ZLAB 2HUEC 1P3OA 5B2IC 5B31G 4AWLC 4KUDB 1P3FC 3MGQB 2YFVB 1M1AB 2NQBA 4J8XB 3C1BD 1P34D 3AYWC 3AV1A 3X1VC 5B1LB 3C1CB 5CPKA 2FJ7D 4NE3A 3AZLB 4Z5TD 3WTPB 3B6FD 1Q9CA 3WAAC 4KGCA 5GXQA 3WKJB 2L5AA 5GSUB 1BH9A 3WA9C 5CPIA 5CP6D 2HIOD 1ID3B 4WNNB 4H9SA 3X1UB 4H9NB 5AVCA 3LELC 5B33D 1EQZA 5AV8D 3AZKB 3W99B 3AFAC 2CV5C 1M19D 5JRGC 1P3BD 1P3AB 5B2JB 5B0YD 3AZFA 4QLCC 4ZUXD 5B31A 2F8NB 3UTBD 1KX3D 3B0CT 5B40A 3WTPE 3C1BB 1P34B 5C3IC 5AV9B 5B32G 3B6FB 4Z5TB 1KX5A 3REKC 5B1MA 1P3LC 5AV6C 1JFIB 4LD9B 3REHC 1F66D 3AZED 5CP6B 2BYMB 3MGRA 3AZNA 1HQ3C 5KDMA 4XUJC 3KSYA 5AV8B 1U35C 4YS3C 1P3GB 1P3IC 5AV5D 3LZ1D 1R4VA 3REID 1ZLAA 3LZ0D 3MGPC 3MVDC 4NE5A 1P3BB 1P3KC 2F8NG 5B0YB 5B2ID 1P3FD 1P3MC 4J8XA 3UTBB 1KX3B 3UT9C 4WV4B 5B1LA 3C1CA 5BO0B 3AYWD 3X1VD 4R8PD 4Z2MH 3WKJA 4DRBA 5GSUA 3WAAD 2PYOA 3WA9D 2NQBB 4J8VA 1ID3A 3AV1B 5CPKB 2JSSA 3W97C 3AZKA 3W99A 5AV5B 1F1EA 3LZ0B 3AZHB 3AFAD 2CV5D 5CPIB 5E5AC 5JRGD 1P3AA 4X23C 5B2IB 5AVCB 3C1BA 1P34A 4QLCD 2FJ7A 3AYWB 5BS7A 3X1VB 1P3OC 3B6FA 4H9RB 4Z5TA 1KX4D 3REKD 3AZGC 1P3LD 5AV6D 3AZFB 3WA9B 4NE6A 3VH6W 5CP6A 2BYMA 2HIOA 3REHD 3W98C 4WZSB 5B33A 1HQ3D 3RELC 4XUJD 5AV8A 3KXBC 4CSRA 3LELB 3KUYC 5FUGB 1M19A 1U35D 4YS3D 3AFAB 2CV5B 1P3ID 3AZEC 3KWQC 1P3BA 3MGPD 5B0YA 3MVDD 3MGRB 3AZNB 1P3KD 4ZUXA 1AOIC 1TAFA 5KDMB 3AZIC 3UTBA 1KX3A 3UTAC 1P3MD 1TZYC 3LZ1C 5BO0A 3UT9D 3NQJB 4WU8C 3W96C 3REKB 1P3LB 5AV6B 1F66A 3REHB 3B0BA 5CPJC 4R8PC 4XUJB 1S32C 3W97D 3VH5T 5AV5A 3REIA 1U35B 3LZ0A 3AZHA 4YS3B 2PYOB 3AZJC 3MGPB 2IO5C 5E5AD 4J8VB 5B2IA 1P3FA 4X23D 1WWSA 3AYWA 3X1VA 4H9RA 1P3OD 3WAAA 2F8NH 3WA9A 3AZGD 3B6GD 3AN2C 3MGSC 1M18C 5AY8C 2FJ7B 2YFWB 3W98D 3LELA 5BNVB 3RELD 1KX4C 3W97B 3KXBD 1H3OA 3KUYD 4G91C 5FUGA 3AFAA 2CV5A 5JRGA 2HIOB 5B24C 3KWQD 3LJAC 1B6WA 5B33B 4QLCA 1AOID 3AZID 3A6NC 4CSRB 2NZDC 5DNMC 3UTAD 3NQJA 1TZYD 1M19B 4UUZB 1P3OB 3VH6A 1WWIA 3REKA 2AROC 4WU8D 3W96D 4J8UD 1P3LA 2CWEA 5AV6A 3AZGB 4ZUXB 3REHA 1TAFB 4KUDC 5GT3C 4H9OA 5AVBC 3B0DC 3B0CW 3MGQC 4E44A 1HQ3A 1M1AC 3W98B 4XUJA 5CPJD 3RELB 3KXBB 4Z66C 1U35A 4YS3A 1S32D 3AZLC 1P3IA 3WTPC 1P3PC 3O62C 3MGPA 5B32C 3MNNC 3AZEB 1F66B 5GT0C 3MVDA 3KWQB 3AZJD 1P3KA 4YM6C 5JA4B 1AOIB 3AZIB 1P3MA 4J8WC 3UT9A 3X1UC 4M6BA 3UTAB 1TZYB 3LZ1B 3REIB 4JJNC 4E45A 2HUEB 1EQZD 3X1TC 4WU8B 3AZMC 1ULYA 1A7WA 4AWLB 1P3FB 4KHAB 5B2JC 3AV2C 3NQUB 1B67A 3AN2D 2YFWA 3MGSD 1M18D 5AY8D 5BNVA 5AV9C 3W97A 4R8PB 1S32B 3REJC 3WAAB 3B6GC 4H9PA 1KX5D 5F99C 5E5AA 4LD9C 2IO5B 4X23A 5B24D 3V9RB 3LJAD 5B0ZC 3A6ND 1H3OB 2NZDD 5DNMD 4UUZA
chains in the Genus database with same CATH superfamily
3TU4C 4XZQC 1P3GC 4ZBJC 5JRGB 4HGAC 5G49B 3X1SC 5DNNC 2AROD 3AZGA 4QLCB 4WU9C 4KUDD 5GT3D 5AVBD 3W98A 3MGQD 1M18B 5C3IB 5AY8B 3EG5B 1M1AD 3RELA 3KXBA 3KUYA 4J8UC 1KX4B 4G92C 5B1LD 4Z66D 4G91B 1P3PD 3AZLD 3WTPD 3AZEA 3O62D 3KWQA 4H9OB 5B32D 3MNND 5GT0D 1HQ3B 5JA4A 3LJAB 2NQBC 1AOIA 3AZIA 4YM6D 3AV1C 4EO5C 3A6NB 3UTAA 5CPKC 1TZYA 3LZ1A 4WJ3C 4J8WD 5DNMB 3X1UD 1P3IB 5BT1C 4KGCC 5GXQC 4JJND 4WU8A 2BYKA 4UPKA 4NFTA 3W96A 3H0LC 3X1TD 3MVDB 5CPIC 1P3KB 2AROB 3AZMD 4CAYB 4KHAA 1KU5A 3NQUA 1P3MB 1P3AD 5GT3B 5AVBB 4H9SC 3B0DB 5B2JD 3UT9B 3AV2D 5AVCC 1EQZC 5CPJA 1BH8B 4R8PA 2F8ND 4DRAA 5AV9D 1S32A 4Z66B 1P3PB 3REJD 4H9QA 3O62B 3AZJA 5B32B 3MNNB 5F99D 5GT0B 3AZFC 4LD9D 2DF4C 3V9RA 5B31C 5B40C 4YM6B 3VH5W 4J8WB 5B0ZD 1KX5C 4JJNB 4H9PB 5B1MC 5G49A 3TU4D 3X1TB 4XZQD 5E5AB 1P3GD 3AZMB 2ZY3A 3R45A 4X23B 3X1SD 2LY8A 5DNND 3MGRC 3AZNC 3AN2A 3AV2B 2UWXA 3MGSA 1M18A 5AY8A 2F8NK 4WU9D 1KX4A 1ZLAC 1W2EA 3REJB 2RVQD 1T3UA 3B6GB 5F99B 5B24A 3EPHA 3LJAA 4J8XC 2NQBD 3A6NA 5B1LC 3C1CC 3KUYB 2NZDA 5DNMA 3AV1D 5B0ZB 5CPKD 3WKJC 5BT1D 5GSUC 2JE5A 4XZQB 3TU4B 4KGCD 5GXQD 2PYOC 2AROA 4ZBJB 4HGAB 3AZHD 4CAYA 3X1SB 5DNNB 5CPID 4J8VC 1ID3C 4KUDA 5GT3A 5AVBA 3MGQA 1N1JB 4WU9B 2YFVA 1M1AA 1BH8A 5AVCD 1BFMA 3AZKC 3W99C 5BNXB 2BYKB 4Z66A 4J8UB 3W96B 4G92B 1P3PA 3AZLA 3WTPA 3O62A 1P3AC 5B32A 5CHLB 3MNNA 5GT0A 3AZFD 3VH6T 4YM6A 3C1BC 5CPJB 1P34C 5B31D 4WNNA 2FJ7C 5B40D 4J8WA 5BS7C 3X1UA 4H9NA 4EO5B 3B6FC 4Z5TC 3LELD 4JJNA 4H9QB 4KGCB 3X1TA 3AZJB 5GXQB 3AZMA 5B1MD 1BH9B 5CP6C 2HIOC 2Y2NA 5B2JA 3AV2A 3MGRD 3AZND 5B33C 2G5HC 5AV8C 2F8NA 1EQZB 5AV9A 3KFUG 4DQYB 1M19C 1ZLAD 3REJA 4Z2MG 3R45B 1P3BC 3B6GA 5B0YC 5F99A 3VH5A 1JFIA 3AN2B 4ZUXC 4LD9A 3MGSB 3UTBC 1KX3C 5B31B 4J8XD 5B40B 5B0ZA 2RVQC 3C1CD 1KX5B 3TU4A 4XZQA 1P3GA 3WKJD 5B1MB 5GSUD 5B24B 1F66C 3X1SA 5DNNA 2PYOD 1N1JA 4J8VD 4WU9A 1ID3D 2NZDB 1HTAA 5AV5C 3REIC 5BNXA 3AZKD 4J8UA 3W99D 3LZ0C 3AZHC 1ZLAB 2HUEC 1P3OA 5B2IC 5B31G 4AWLC 4KUDB 1P3FC 3MGQB 2YFVB 1M1AB 2NQBA 4J8XB 3C1BD 1P34D 3AYWC 3AV1A 3X1VC 5B1LB 3C1CB 5CPKA 2FJ7D 2F2AC 4NE3A 3AZLB 4Z5TD 3WTPB 3B6FD 1Q9CA 3WAAC 4KGCA 5GXQA 3WKJB 3A1IA 2L5AA 5GSUB 1BH9A 3WA9C 5CPIA 5CP6D 2HIOD 1ID3B 4WNNB 4H9SA 3X1UB 4H9NB 5AVCA 3LELC 5B33D 1EQZA 3H0MC 5AV8D 3AZKB 3W99B 3AFAC 2CV5C 1M19D 5JRGC 1P3BD 1P3AB 5B2JB 5B0YD 3AZFA 4QLCC 4ZUXD 5B31A 2F8NB 3UTBD 1KX3D 3B0CT 5B40A 3WTPE 3C1BB 1P34B 5C3IC 5AV9B 2ZM5A 5B32G 3B6FB 4Z5TB 1KX5A 2ZY4A 3REKC 5B1MA 1P3LC 5AV6C 1JFIB 4LD9B 3REHC 1F66D 3AZED 5CP6B 2BYMB 3MGRA 3AZNA 1HQ3C 2Y2KA 5KDMA 4XUJC 3KSYA 5AV8B 3F6TA 1U35C 4YS3C 1P3GB 1P3IC 5AV5D 3LZ1D 1R4VA 3REID 1ZLAA 3P5JB 3LZ0D 3MGPC 2Y2JA 3MVDC 4NE5A 1P3BB 1P3KC 2F8NG 5B0YB 5B2ID 1P3FD 1P3MC 4J8XA 3UTBB 1KX3B 3UT9C 4WV4B 5B1LA 3C1CA 5BO0B 3AYWD 3X1VD 2XD1A 2Y2GA 4R8PD 4Z2MH 3WKJA 2RIQA 4DRBA 5GSUA 3WAAD 2PYOA 2Y2OA 3WA9D 2NQBB 4J8VA 1ID3A 3AV1B 5CPKB 2JSSA 3W97C 2Y2IA 3AZKA 3W99A 5AV5B 1F1EA 3LZ0B 3AZHB 3AFAD 2CV5D 5CPIB 5E5AC 5JRGD 1P3AA 4X23C 5B2IB 5AVCB 3C1BA 1P34A 4QLCD 2FJ7A 1Z2CB 5BS7A 3H0RC 3AYWB 3X1VB 1P3OC 3B6FA 4H9RB 4Z5TA 1KX4D 3REKD 3EPKA 3AZGC 1P3LD 5AV6D 3AZFB 3WA9B 4NE6A 3VH6W 5CP6A 2BYMA 2HIOA 3EPJA 3REHD 3EPLA 3A1KA 3W98C 4WZSB 5B33A 1HQ3D 3RELC 4XUJD 5AV8A 3KXBC 4CSRA 3LELB 3KUYC 2Y2HA 5FUGB 1M19A 1U35D 4YS3D 3AFAB 2CV5B 1P3ID 3AZEC 3KWQC 1P3BA 3MGPD 2BG1A 5B0YA 2FFFB 3MVDD 3MGRB 3AZNB 1P3KD 2Y2PA 4ZUXA 1AOIC 1TAFA 5KDMB 3AZIC 3UTBA 1KX3A 2J8PA 2W8SA 3UTAC 1P3MD 1TZYC 3LZ1C 5BO0A 3UT9D 3NQJB 4WU8C 3W96C 3REKB 2Y2LA 3IP4C 1P3LB 5AV6B 1F66A 3REHB 3B0BA 5CPJC 4R8PC 4XUJB 1S32C 3W97D 3VH5T 5AV5A 3REIA 1U35B 3LZ0A 3AZHA 4YS3B 2PYOB 3AZJC 3MGPB 2JCHA 2IO5C 5E5AD 4J8VB 5B2IA 2G5IC 1P3FA 4X23D 2ZY5A 2VQRA 1WWSA 3AYWA 3X1VA 4H9RA 1P3OD 3WAAA 2F8NH 3WA9A 3AZGD 3B6GD 3AN2C 3MGSC 1M18C 5AY8C 2FJ7B 2YFWB 3W98D 3LELA 1PZRA 5BNVB 3RELD 1KX4C 3W97B 3KXBD 1H3OA 3KUYD 4G91C 5FUGA 3AFAA 2CV5A 5JRGA 2HIOB 5B24C 3KWQD 3LJAC 1B6WA 5B33B 4QLCA 1AOID 3AZID 3A6NC 4CSRB 2NZDC 5DNMC 3UTAD 3NQJA 1TZYD 1M19B 4UUZB 1P3OB 3VH6A 2DQNC 1WWIA 2Y2MA 3REKA 2AROC 4WU8D 3W96D 3FDDA 4J8UD 1P3LA 2CWEA 5AV6A 3AZGB 4ZUXB 3REHA 1TAFB 4KUDC 5GT3C 4H9OA 5AVBC 3B0DC 3B0CW 3MGQC 4E44A 1HQ3A 1M1AC 3W98B 4XUJA 5CPJD 3RELB 3KXBB 4Z66C 2Y2QA 1U35A 4YS3A 1S32D 3AZLC 1P3IA 3WTPC 1P3PC 3O62C 3MGPA 5B32C 3MNNC 3AZEB 1F66B 5GT0C 3MVDA 3KWQB 3AZJD 1P3KA 2XD5A 4YM6C 5JA4B 1AOIB 3AZIB 1P3MA 4J8WC 3UT9A 3X1UC 4M6BA 3UTAB 1TZYB 3LZ1B 3REIB 4JJNC 4E45A 2HUEB 1EQZD 3X1TC 4WU8B 3AZMC 1ULYA 1A7WA 4AWLB 2ZY2A 1P3FB 4KHAB 5B2JC 3AV2C 3NQUB 1B67A 3AN2D 2YFWA 3MGSD 1M18D 5AY8D 5BNVA 3AL0C 5AV9C 3W97A 4R8PB 1S32B 3REJC 3WAAB 3B6GC 4H9PA 1KX5D 5F99C 5E5AA 4LD9C 2IO5B 4X23A 5B24D 3V9RB 3LJAD 5B0ZC 3A6ND 1H3OB 2NZDD 5DNMD 4UUZA
chains in the Genus database with same CATH topology
3TU4C 4XZQC 1P3GC 4ZBJC 5JRGB 4HGAC 5G49B 3X1SC 5DNNC 2AROD 3AZGA 4QLCB 4WU9C 4KUDD 5GT3D 5AVBD 3W98A 3MGQD 1M18B 5C3IB 5AY8B 3EG5B 1M1AD 3RELA 3KXBA 3KUYA 4J8UC 1KX4B 4G92C 5B1LD 4Z66D 4G91B 1P3PD 3AZLD 3WTPD 3AZEA 3O62D 3KWQA 4H9OB 5B32D 3MNND 5GT0D 1HQ3B 5JA4A 3LJAB 2NQBC 1AOIA 3AZIA 4YM6D 3AV1C 4EO5C 3A6NB 3UTAA 5CPKC 1TZYA 3LZ1A 4WJ3C 4J8WD 5DNMB 3X1UD 1P3IB 5BT1C 4KGCC 5GXQC 4JJND 4WU8A 2BYKA 4UPKA 4NFTA 3W96A 3H0LC 3X1TD 3MVDB 5CPIC 1P3KB 2AROB 3AZMD 4CAYB 4KHAA 1KU5A 3NQUA 1P3MB 1P3AD 5GT3B 5AVBB 4H9SC 3B0DB 5B2JD 3UT9B 3AV2D 5AVCC 1EQZC 5CPJA 1BH8B 4R8PA 2F8ND 4DRAA 5AV9D 1S32A 4Z66B 1P3PB 3REJD 4H9QA 3O62B 3AZJA 5B32B 3MNNB 5F99D 5GT0B 3AZFC 4LD9D 2DF4C 3V9RA 5B31C 5B40C 4YM6B 3VH5W 4J8WB 5B0ZD 1KX5C 4JJNB 4H9PB 5B1MC 5G49A 3TU4D 3X1TB 4XZQD 5E5AB 1P3GD 3AZMB 2ZY3A 3R45A 4X23B 3X1SD 2LY8A 5DNND 3MGRC 3AZNC 3AN2A 3AV2B 2UWXA 3MGSA 1M18A 5AY8A 2F8NK 4WU9D 1KX4A 1ZLAC 1W2EA 3REJB 2RVQD 1T3UA 3B6GB 5F99B 5B24A 3EPHA 3LJAA 4J8XC 2NQBD 3A6NA 5B1LC 3C1CC 3KUYB 2NZDA 5DNMA 3AV1D 5B0ZB 5CPKD 3WKJC 5BT1D 5GSUC 2JE5A 4XZQB 3TU4B 4KGCD 5GXQD 2PYOC 2AROA 4ZBJB 4HGAB 3AZHD 4CAYA 3X1SB 5DNNB 5CPID 4J8VC 1ID3C 4KUDA 5GT3A 5AVBA 3MGQA 1N1JB 4WU9B 2YFVA 1M1AA 1BH8A 5AVCD 1BFMA 3AZKC 3W99C 5BNXB 2BYKB 4Z66A 4J8UB 3W96B 4G92B 1P3PA 3AZLA 3WTPA 3O62A 1P3AC 5B32A 5CHLB 3MNNA 5GT0A 3AZFD 3VH6T 4YM6A 3C1BC 5CPJB 1P34C 5B31D 4WNNA 2FJ7C 5B40D 4J8WA 5BS7C 3X1UA 4H9NA 4EO5B 3B6FC 4Z5TC 3LELD 4JJNA 4H9QB 4KGCB 3X1TA 3AZJB 5GXQB 3AZMA 5B1MD 1BH9B 5CP6C 2HIOC 2Y2NA 5B2JA 3AV2A 3MGRD 3AZND 5B33C 2G5HC 5AV8C 2F8NA 1EQZB 5AV9A 3KFUG 4DQYB 1M19C 1ZLAD 3REJA 4Z2MG 3R45B 1P3BC 3B6GA 5B0YC 5F99A 3VH5A 1JFIA 3AN2B 4ZUXC 4LD9A 3MGSB 3UTBC 1KX3C 5B31B 4J8XD 5B40B 5B0ZA 2RVQC 3C1CD 1KX5B 3TU4A 4XZQA 1P3GA 3WKJD 5B1MB 5GSUD 5B24B 1F66C 3X1SA 5DNNA 2PYOD 1N1JA 4J8VD 4WU9A 1ID3D 2NZDB 1HTAA 5AV5C 3REIC 5BNXA 3AZKD 4J8UA 3W99D 3LZ0C 3AZHC 1ZLAB 2HUEC 1P3OA 5B2IC 5B31G 4AWLC 4KUDB 1P3FC 3MGQB 2YFVB 1M1AB 2NQBA 4J8XB 3C1BD 1P34D 3AYWC 3AV1A 3X1VC 5B1LB 3C1CB 5CPKA 2FJ7D 2F2AC 4NE3A 3AZLB 4Z5TD 3WTPB 3B6FD 1Q9CA 3WAAC 4KGCA 5GXQA 3WKJB 3A1IA 2L5AA 5GSUB 1BH9A 3WA9C 5CPIA 5CP6D 2HIOD 1ID3B 4WNNB 4H9SA 3X1UB 4H9NB 5AVCA 3LELC 5B33D 1EQZA 3H0MC 5AV8D 3AZKB 3W99B 3AFAC 2CV5C 1M19D 5JRGC 1P3BD 1P3AB 5B2JB 5B0YD 3AZFA 4QLCC 4ZUXD 5B31A 2F8NB 3UTBD 1KX3D 3B0CT 5B40A 3WTPE 3C1BB 1P34B 5C3IC 5AV9B 2ZM5A 5B32G 3B6FB 4Z5TB 1KX5A 2ZY4A 3REKC 5B1MA 1P3LC 5AV6C 1JFIB 4LD9B 3REHC 1F66D 3AZED 5CP6B 2BYMB 3MGRA 3AZNA 1HQ3C 2Y2KA 5KDMA 4XUJC 3KSYA 5AV8B 3F6TA 1U35C 4YS3C 1P3GB 1P3IC 5AV5D 3LZ1D 1R4VA 3REID 1ZLAA 3P5JB 3LZ0D 3MGPC 2Y2JA 3MVDC 4NE5A 1P3BB 1P3KC 2F8NG 5B0YB 5B2ID 1P3FD 1P3MC 4J8XA 3UTBB 1KX3B 3UT9C 4WV4B 5B1LA 3C1CA 5BO0B 3AYWD 3X1VD 2XD1A 2Y2GA 4R8PD 4Z2MH 3WKJA 2RIQA 4DRBA 5GSUA 3WAAD 2PYOA 2Y2OA 3WA9D 2NQBB 4J8VA 1ID3A 3AV1B 5CPKB 2JSSA 3W97C 2Y2IA 3AZKA 3W99A 5AV5B 1F1EA 3LZ0B 3AZHB 3AFAD 2CV5D 5CPIB 5E5AC 5JRGD 1P3AA 4X23C 5B2IB 5AVCB 3C1BA 1P34A 4QLCD 2FJ7A 1Z2CB 5BS7A 3H0RC 3AYWB 3X1VB 1P3OC 3B6FA 4H9RB 4Z5TA 1KX4D 3REKD 3EPKA 3AZGC 1P3LD 5AV6D 3AZFB 3WA9B 4NE6A 3VH6W 5CP6A 2BYMA 2HIOA 3EPJA 3REHD 3EPLA 3A1KA 3W98C 4WZSB 5B33A 1HQ3D 3RELC 4XUJD 5AV8A 3KXBC 4CSRA 3LELB 3KUYC 2Y2HA 5FUGB 1M19A 1U35D 4YS3D 3AFAB 2CV5B 1P3ID 3AZEC 3KWQC 1P3BA 3MGPD 2BG1A 5B0YA 2FFFB 3MVDD 3MGRB 3AZNB 1P3KD 2Y2PA 4ZUXA 1AOIC 1TAFA 5KDMB 3AZIC 3UTBA 1KX3A 2J8PA 2W8SA 3UTAC 1P3MD 1TZYC 3LZ1C 5BO0A 3UT9D 3NQJB 4WU8C 3W96C 3REKB 2Y2LA 3IP4C 1P3LB 5AV6B 1F66A 3REHB 3B0BA 5CPJC 4R8PC 4XUJB 1S32C 3W97D 3VH5T 5AV5A 3REIA 1U35B 3LZ0A 3AZHA 4YS3B 2PYOB 3AZJC 3MGPB 2JCHA 2IO5C 5E5AD 4J8VB 5B2IA 2G5IC 1P3FA 4X23D 2ZY5A 2VQRA 1WWSA 3AYWA 3X1VA 4H9RA 1P3OD 3WAAA 2F8NH 3WA9A 3AZGD 3B6GD 3AN2C 3MGSC 1M18C 5AY8C 2FJ7B 2YFWB 3W98D 3LELA 1PZRA 5BNVB 3RELD 1KX4C 3W97B 3KXBD 1H3OA 3KUYD 4G91C 5FUGA 3AFAA 2CV5A 5JRGA 2HIOB 5B24C 3KWQD 3LJAC 1B6WA 5B33B 4QLCA 1AOID 3AZID 3A6NC 4CSRB 2NZDC 5DNMC 3UTAD 3NQJA 1TZYD 1M19B 4UUZB 1P3OB 3VH6A 2DQNC 1WWIA 2Y2MA 3REKA 2AROC 4WU8D 3W96D 3FDDA 4J8UD 1P3LA 2CWEA 5AV6A 3AZGB 4ZUXB 3REHA 1TAFB 4KUDC 5GT3C 4H9OA 5AVBC 3B0DC 3B0CW 3MGQC 4E44A 1HQ3A 1M1AC 3W98B 4XUJA 5CPJD 3RELB 3KXBB 4Z66C 2Y2QA 1U35A 4YS3A 1S32D 3AZLC 1P3IA 3WTPC 1P3PC 3O62C 3MGPA 5B32C 3MNNC 3AZEB 1F66B 5GT0C 3MVDA 3KWQB 3AZJD 1P3KA 2XD5A 4YM6C 5JA4B 1AOIB 3AZIB 1P3MA 4J8WC 3UT9A 3X1UC 4M6BA 3UTAB 1TZYB 3LZ1B 3REIB 4JJNC 4E45A 2HUEB 1EQZD 3X1TC 4WU8B 3AZMC 1ULYA 1A7WA 4AWLB 2ZY2A 1P3FB 4KHAB 5B2JC 3AV2C 3NQUB 1B67A 3AN2D 2YFWA 3MGSD 1M18D 5AY8D 5BNVA 3AL0C 5AV9C 3W97A 4R8PB 1S32B 3REJC 3WAAB 3B6GC 4H9PA 1KX5D 5F99C 5E5AA 4LD9C 2IO5B 4X23A 5B24D 3V9RB 3LJAD 5B0ZC 3A6ND 1H3OB 2NZDD 5DNMD 4UUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TU4 C;  4XZQ C;  1P3G C;  4ZBJ C;  5JRG B;  4HGA C;  5G49 B;  3X1S C;  5DNN C;  2ARO D;  3AZG A;  4QLC B;  4WU9 C;  4KUD D;  5GT3 D;  5AVB D;  3W98 A;  3MGQ D;  1M18 B;  5C3I B;  5AY8 B;  1M1A D;  3REL A;  3KXB A;  3KUY A;  4J8U C;  1KX4 B;  4G92 C;  5B1L D;  4Z66 D;  4G91 B;  1P3P D;  3AZL D;  3WTP D;  3AZE A;  3O62 D;  3KWQ A;  4H9O B;  5B32 D;  3MNN D;  5GT0 D;  1HQ3 B;  5JA4 A;  3LJA B;  2NQB C;  1AOI A;  3AZI A;  4YM6 D;  3AV1 C;  4EO5 C;  3A6N B;  3UTA A;  5CPK C;  1TZY A;  3LZ1 A;  4J8W D;  5DNM B;  3X1U D;  1P3I B;  5BT1 C;  4KGC C;  5GXQ C;  4JJN D;  4WU8 A;  2BYK A;  3W96 A;  4NFT A;  3X1T D;  3MVD B;  5CPI C;  1P3K B;  2ARO B;  3AZM D;  4CAY B;  4KHA A;  1KU5 A;  3NQU A;  1P3M B;  1P3A D;  5GT3 B;  5AVB B;  4H9S C;  3B0D B;  5B2J D;  3UT9 B;  3AV2 D;  5AVC C;  1EQZ C;  5CPJ A;  1BH8 B;  4R8P A;  2F8N D;  4DRA A;  5AV9 D;  1S32 A;  4Z66 B;  1P3P B;  3REJ D;  4H9Q A;  3O62 B;  3AZJ A;  5B32 B;  3MNN B;  5F99 D;  5GT0 B;  3AZF C;  4LD9 D;  3V9R A;  5B31 C;  5B40 C;  4YM6 B;  3VH5 W;  4J8W B;  5B0Z D;  1KX5 C;  4JJN B;  4H9P B;  5B1M C;  5G49 A;  3TU4 D;  3X1T B;  4XZQ D;  5E5A B;  1P3G D;  3AZM B;  3R45 A;  4X23 B;  3X1S D;  2LY8 A;  5DNN D;  3MGR C;  3AZN C;  3AN2 A;  3AV2 B;  3MGS A;  1M18 A;  2F8N K;  5AY8 A;  4WU9 D;  1KX4 A;  1ZLA C;  3REJ B;  2RVQ D;  3B6G B;  5F99 B;  5B24 A;  3LJA A;  4J8X C;  2NQB D;  3A6N A;  5B1L C;  3C1C C;  3KUY B;  2NZD A;  5DNM A;  3AV1 D;  5B0Z B;  5CPK D;  3WKJ C;  5BT1 D;  5GSU C;  4XZQ B;  3TU4 B;  4KGC D;  5GXQ D;  2PYO C;  2ARO A;  4ZBJ B;  4HGA B;  3AZH D;  4CAY A;  3X1S B;  5DNN B;  5CPI D;  4J8V C;  1ID3 C;  4KUD A;  5GT3 A;  5AVB A;  3MGQ A;  1N1J B;  4WU9 B;  2YFV A;  1M1A A;  1BH8 A;  5AVC D;  1BFM A;  3AZK C;  3W99 C;  5BNX B;  2BYK B;  4Z66 A;  4J8U B;  3W96 B;  4G92 B;  1P3P A;  3AZL A;  3WTP A;  3O62 A;  1P3A C;  5B32 A;  5CHL B;  3MNN A;  5GT0 A;  3AZF D;  3VH6 T;  4YM6 A;  3C1B C;  5CPJ B;  1P34 C;  5B31 D;  4WNN A;  2FJ7 C;  5B40 D;  4J8W A;  5BS7 C;  3X1U A;  4H9N A;  4EO5 B;  3B6F C;  4Z5T C;  3LEL D;  4JJN A;  4H9Q B;  4KGC B;  3X1T A;  3AZJ B;  5GXQ B;  3AZM A;  5B1M D;  1BH9 B;  5CP6 C;  2HIO C;  5B2J A;  3AV2 A;  3MGR D;  3AZN D;  5B33 C;  5AV8 C;  2F8N A;  1EQZ B;  5AV9 A;  1M19 C;  1ZLA D;  3REJ A;  4Z2M G;  3R45 B;  1P3B C;  3B6G A;  5B0Y C;  5F99 A;  3VH5 A;  1JFI A;  3AN2 B;  4ZUX C;  4LD9 A;  3MGS B;  3UTB C;  1KX3 C;  5B31 B;  4J8X D;  5B40 B;  5B0Z A;  2RVQ C;  3C1C D;  1KX5 B;  3TU4 A;  4XZQ A;  1P3G A;  3WKJ D;  5B1M B;  5GSU D;  5B24 B;  1F66 C;  3X1S A;  5DNN A;  2PYO D;  1N1J A;  4J8V D;  4WU9 A;  1ID3 D;  2NZD B;  1HTA A;  5AV5 C;  3REI C;  5BNX A;  3AZK D;  4J8U A;  3W99 D;  3LZ0 C;  3AZH C;  1ZLA B;  2HUE C;  1P3O A;  5B2I C;  5B31 G;  4AWL C;  4KUD B;  1P3F C;  3MGQ B;  2YFV B;  1M1A B;  2NQB A;  4J8X B;  3C1B D;  1P34 D;  3AYW C;  3AV1 A;  3X1V C;  5B1L B;  3C1C B;  5CPK A;  2FJ7 D;  4NE3 A;  3AZL B;  4Z5T D;  3WTP B;  3B6F D;  1Q9C A;  3WAA C;  4KGC A;  5GXQ A;  3WKJ B;  2L5A A;  5GSU B;  1BH9 A;  3WA9 C;  5CPI A;  5CP6 D;  2HIO D;  1ID3 B;  4WNN B;  4H9S A;  3X1U B;  4H9N B;  5AVC A;  3LEL C;  5B33 D;  1EQZ A;  5AV8 D;  3AZK B;  3W99 B;  3AFA C;  2CV5 C;  1M19 D;  5JRG C;  1P3B D;  1P3A B;  5B2J B;  5B0Y D;  3AZF A;  4QLC C;  4ZUX D;  5B31 A;  2F8N B;  3UTB D;  1KX3 D;  3B0C T;  5B40 A;  3WTP E;  3C1B B;  1P34 B;  5C3I C;  5AV9 B;  5B32 G;  3B6F B;  4Z5T B;  1KX5 A;  3REK C;  5B1M A;  1P3L C;  5AV6 C;  1JFI B;  4LD9 B;  3REH C;  1F66 D;  3AZE D;  5CP6 B;  2BYM B;  3MGR A;  3AZN A;  1HQ3 C;  5KDM A;  4XUJ C;  3KSY A;  5AV8 B;  1U35 C;  4YS3 C;  1P3G B;  1P3I C;  5AV5 D;  3LZ1 D;  1R4V A;  3REI D;  1ZLA A;  3LZ0 D;  3MGP C;  3MVD C;  4NE5 A;  1P3B B;  1P3K C;  2F8N G;  5B0Y B;  5B2I D;  1P3F D;  1P3M C;  4J8X A;  3UTB B;  1KX3 B;  3UT9 C;  4WV4 B;  5B1L A;  3C1C A;  5BO0 B;  3AYW D;  3X1V D;  4R8P D;  4Z2M H;  3WKJ A;  4DRB A;  5GSU A;  3WAA D;  2PYO A;  3WA9 D;  2NQB B;  4J8V A;  1ID3 A;  3AV1 B;  5CPK B;  2JSS A;  3W97 C;  3AZK A;  3W99 A;  5AV5 B;  1F1E A;  3LZ0 B;  3AZH B;  3AFA D;  2CV5 D;  5CPI B;  5E5A C;  5JRG D;  1P3A A;  4X23 C;  5B2I B;  5AVC B;  3C1B A;  1P34 A;  4QLC D;  2FJ7 A;  3AYW B;  5BS7 A;  3X1V B;  1P3O C;  3B6F A;  4H9R B;  4Z5T A;  1KX4 D;  3REK D;  3AZG C;  1P3L D;  5AV6 D;  3AZF B;  3WA9 B;  4NE6 A;  3VH6 W;  5CP6 A;  2BYM A;  2HIO A;  3REH D;  3W98 C;  4WZS B;  5B33 A;  1HQ3 D;  3REL C;  4XUJ D;  5AV8 A;  3KXB C;  4CSR A;  3LEL B;  3KUY C;  5FUG B;  1M19 A;  1U35 D;  4YS3 D;  3AFA B;  2CV5 B;  1P3I D;  3AZE C;  3KWQ C;  1P3B A;  3MGP D;  5B0Y A;  3MVD D;  3MGR B;  3AZN B;  1P3K D;  4ZUX A;  1AOI C;  1TAF A;  5KDM B;  3AZI C;  3UTB A;  1KX3 A;  3UTA C;  1P3M D;  1TZY C;  3LZ1 C;  5BO0 A;  3UT9 D;  3NQJ B;  4WU8 C;  3W96 C;  3REK B;  1P3L B;  5AV6 B;  1F66 A;  3REH B;  3B0B A;  5CPJ C;  4R8P C;  4XUJ B;  1S32 C;  3W97 D;  3VH5 T;  5AV5 A;  3REI A;  1U35 B;  3LZ0 A;  3AZH A;  4YS3 B;  2PYO B;  3AZJ C;  3MGP B;  2IO5 C;  5E5A D;  4J8V B;  5B2I A;  1P3F A;  4X23 D;  1WWS A;  3AYW A;  3X1V A;  4H9R A;  1P3O D;  3WAA A;  2F8N H;  3WA9 A;  3AZG D;  3B6G D;  3AN2 C;  3MGS C;  1M18 C;  5AY8 C;  2FJ7 B;  2YFW B;  3W98 D;  3LEL A;  5BNV B;  3REL D;  1KX4 C;  3W97 B;  3KXB D;  1H3O A;  3KUY D;  4G91 C;  5FUG A;  3AFA A;  2CV5 A;  5JRG A;  2HIO B;  5B24 C;  3KWQ D;  3LJA C;  1B6W A;  5B33 B;  4QLC A;  1AOI D;  3AZI D;  3A6N C;  4CSR B;  2NZD C;  5DNM C;  3UTA D;  3NQJ A;  1TZY D;  1M19 B;  4UUZ B;  1P3O B;  3VH6 A;  1WWI A;  3REK A;  2ARO C;  4WU8 D;  3W96 D;  4J8U D;  1P3L A;  2CWE A;  5AV6 A;  3AZG B;  4ZUX B;  3REH A;  1TAF B;  4KUD C;  5GT3 C;  4H9O A;  5AVB C;  3B0D C;  3B0C W;  3MGQ C;  4E44 A;  1HQ3 A;  1M1A C;  3W98 B;  4XUJ A;  5CPJ D;  3REL B;  3KXB B;  4Z66 C;  1U35 A;  4YS3 A;  1S32 D;  3AZL C;  1P3I A;  3WTP C;  1P3P C;  3O62 C;  3MGP A;  5B32 C;  3MNN C;  3AZE B;  1F66 B;  5GT0 C;  3MVD A;  3KWQ B;  3AZJ D;  1P3K A;  4YM6 C;  5JA4 B;  1AOI B;  3AZI B;  1P3M A;  4J8W C;  3UT9 A;  3X1U C;  4M6B A;  3UTA B;  1TZY B;  3LZ1 B;  3REI B;  4JJN C;  4E45 A;  2HUE B;  1EQZ D;  3X1T C;  4WU8 B;  3AZM C;  1ULY A;  1A7W A;  4AWL B;  1P3F B;  4KHA B;  5B2J C;  3AV2 C;  3NQU B;  1B67 A;  3AN2 D;  2YFW A;  3MGS D;  1M18 D;  5AY8 D;  5BNV A;  5AV9 C;  3W97 A;  4R8P B;  1S32 B;  3REJ C;  3WAA B;  3B6G C;  4H9P A;  1KX5 D;  5F99 C;  5E5A A;  4LD9 C;  2IO5 B;  4X23 A;  5B24 D;  3V9R B;  3LJA D;  5B0Z C;  3A6N D;  1H3O B;  2NZD D;  5DNM D;  4UUZ A; 
#chains in the Genus database with same CATH topology
 3TU4 C;  4XZQ C;  1P3G C;  4ZBJ C;  5JRG B;  4HGA C;  5G49 B;  3X1S C;  5DNN C;  2ARO D;  3AZG A;  4QLC B;  4WU9 C;  4KUD D;  5GT3 D;  5AVB D;  3W98 A;  3MGQ D;  1M18 B;  5C3I B;  5AY8 B;  3EG5 B;  1M1A D;  3REL A;  3KXB A;  3KUY A;  4J8U C;  1KX4 B;  4G92 C;  5B1L D;  4Z66 D;  4G91 B;  1P3P D;  3AZL D;  3WTP D;  3AZE A;  3O62 D;  3KWQ A;  4H9O B;  5B32 D;  3MNN D;  5GT0 D;  1HQ3 B;  5JA4 A;  3LJA B;  2NQB C;  1AOI A;  3AZI A;  4YM6 D;  3AV1 C;  4EO5 C;  3A6N B;  3UTA A;  5CPK C;  1TZY A;  3LZ1 A;  4WJ3 C;  4J8W D;  5DNM B;  3X1U D;  1P3I B;  5BT1 C;  4KGC C;  5GXQ C;  4JJN D;  4WU8 A;  2BYK A;  4UPK A;  4NFT A;  3W96 A;  3H0L C;  3X1T D;  3MVD B;  5CPI C;  1P3K B;  2ARO B;  3AZM D;  4CAY B;  4KHA A;  1KU5 A;  3NQU A;  1P3M B;  1P3A D;  5GT3 B;  5AVB B;  4H9S C;  3B0D B;  5B2J D;  3UT9 B;  3AV2 D;  5AVC C;  1EQZ C;  5CPJ A;  1BH8 B;  4R8P A;  2F8N D;  4DRA A;  5AV9 D;  1S32 A;  4Z66 B;  1P3P B;  3REJ D;  4H9Q A;  3O62 B;  3AZJ A;  5B32 B;  3MNN B;  5F99 D;  5GT0 B;  3AZF C;  4LD9 D;  2DF4 C;  3V9R A;  5B31 C;  5B40 C;  4YM6 B;  3VH5 W;  4J8W B;  5B0Z D;  1KX5 C;  4JJN B;  4H9P B;  5B1M C;  5G49 A;  3TU4 D;  3X1T B;  4XZQ D;  5E5A B;  1P3G D;  3AZM B;  2ZY3 A;  3R45 A;  4X23 B;  3X1S D;  2LY8 A;  5DNN D;  3MGR C;  3AZN C;  3AN2 A;  3AV2 B;  2UWX A;  3MGS A;  1M18 A;  5AY8 A;  2F8N K;  4WU9 D;  1KX4 A;  1ZLA C;  1W2E A;  3REJ B;  2RVQ D;  1T3U A;  3B6G B;  5F99 B;  5B24 A;  3EPH A;  3LJA A;  4J8X C;  2NQB D;  3A6N A;  5B1L C;  3C1C C;  3KUY B;  2NZD A;  5DNM A;  3AV1 D;  5B0Z B;  5CPK D;  3WKJ C;  5BT1 D;  5GSU C;  2JE5 A;  4XZQ B;  3TU4 B;  4KGC D;  5GXQ D;  2PYO C;  2ARO A;  4ZBJ B;  4HGA B;  3AZH D;  4CAY A;  3X1S B;  5DNN B;  5CPI D;  4J8V C;  1ID3 C;  4KUD A;  5GT3 A;  5AVB A;  3MGQ A;  1N1J B;  4WU9 B;  2YFV A;  1M1A A;  1BH8 A;  5AVC D;  1BFM A;  3AZK C;  3W99 C;  5BNX B;  2BYK B;  4Z66 A;  4J8U B;  3W96 B;  4G92 B;  1P3P A;  3AZL A;  3WTP A;  3O62 A;  1P3A C;  5B32 A;  5CHL B;  3MNN A;  5GT0 A;  3AZF D;  3VH6 T;  4YM6 A;  3C1B C;  5CPJ B;  1P34 C;  5B31 D;  4WNN A;  2FJ7 C;  5B40 D;  4J8W A;  5BS7 C;  3X1U A;  4H9N A;  4EO5 B;  3B6F C;  4Z5T C;  3LEL D;  4JJN A;  4H9Q B;  4KGC B;  3X1T A;  3AZJ B;  5GXQ B;  3AZM A;  5B1M D;  1BH9 B;  5CP6 C;  2HIO C;  2Y2N A;  5B2J A;  3AV2 A;  3MGR D;  3AZN D;  5B33 C;  2G5H C;  5AV8 C;  2F8N A;  1EQZ B;  5AV9 A;  3KFU G;  4DQY B;  1M19 C;  1ZLA D;  3REJ A;  4Z2M G;  3R45 B;  1P3B C;  3B6G A;  5B0Y C;  5F99 A;  3VH5 A;  1JFI A;  3AN2 B;  4ZUX C;  4LD9 A;  3MGS B;  3UTB C;  1KX3 C;  5B31 B;  4J8X D;  5B40 B;  5B0Z A;  2RVQ C;  3C1C D;  1KX5 B;  3TU4 A;  4XZQ A;  1P3G A;  3WKJ D;  5B1M B;  5GSU D;  5B24 B;  1F66 C;  3X1S A;  5DNN A;  2PYO D;  1N1J A;  4J8V D;  4WU9 A;  1ID3 D;  2NZD B;  1HTA A;  5AV5 C;  3REI C;  5BNX A;  3AZK D;  4J8U A;  3W99 D;  3LZ0 C;  3AZH C;  1ZLA B;  2HUE C;  1P3O A;  5B2I C;  5B31 G;  4AWL C;  4KUD B;  1P3F C;  3MGQ B;  2YFV B;  1M1A B;  2NQB A;  4J8X B;  3C1B D;  1P34 D;  3AYW C;  3AV1 A;  3X1V C;  5B1L B;  3C1C B;  5CPK A;  2FJ7 D;  2F2A C;  4NE3 A;  3AZL B;  4Z5T D;  3WTP B;  3B6F D;  1Q9C A;  3WAA C;  4KGC A;  5GXQ A;  3WKJ B;  3A1I A;  2L5A A;  5GSU B;  1BH9 A;  3WA9 C;  5CPI A;  5CP6 D;  2HIO D;  1ID3 B;  4WNN B;  4H9S A;  3X1U B;  4H9N B;  5AVC A;  3LEL C;  5B33 D;  1EQZ A;  3H0M C;  5AV8 D;  3AZK B;  3W99 B;  3AFA C;  2CV5 C;  1M19 D;  5JRG C;  1P3B D;  1P3A B;  5B2J B;  5B0Y D;  3AZF A;  4QLC C;  4ZUX D;  5B31 A;  2F8N B;  3UTB D;  1KX3 D;  3B0C T;  5B40 A;  3WTP E;  3C1B B;  1P34 B;  5C3I C;  5AV9 B;  2ZM5 A;  5B32 G;  3B6F B;  4Z5T B;  1KX5 A;  2ZY4 A;  3REK C;  5B1M A;  1P3L C;  5AV6 C;  1JFI B;  4LD9 B;  3REH C;  1F66 D;  3AZE D;  5CP6 B;  2BYM B;  3MGR A;  3AZN A;  1HQ3 C;  2Y2K A;  5KDM A;  4XUJ C;  3KSY A;  5AV8 B;  3F6T A;  1U35 C;  4YS3 C;  1P3G B;  1P3I C;  5AV5 D;  3LZ1 D;  1R4V A;  3REI D;  1ZLA A;  3P5J B;  3LZ0 D;  3MGP C;  2Y2J A;  3MVD C;  4NE5 A;  1P3B B;  1P3K C;  2F8N G;  5B0Y B;  5B2I D;  1P3F D;  1P3M C;  4J8X A;  3UTB B;  1KX3 B;  3UT9 C;  4WV4 B;  5B1L A;  3C1C A;  5BO0 B;  3AYW D;  3X1V D;  2XD1 A;  2Y2G A;  4R8P D;  4Z2M H;  3WKJ A;  2RIQ A;  4DRB A;  5GSU A;  3WAA D;  2PYO A;  2Y2O A;  3WA9 D;  2NQB B;  4J8V A;  1ID3 A;  3AV1 B;  5CPK B;  2JSS A;  3W97 C;  2Y2I A;  3AZK A;  3W99 A;  5AV5 B;  1F1E A;  3LZ0 B;  3AZH B;  3AFA D;  2CV5 D;  5CPI B;  5E5A C;  5JRG D;  1P3A A;  4X23 C;  5B2I B;  5AVC B;  3C1B A;  1P34 A;  4QLC D;  2FJ7 A;  1Z2C B;  5BS7 A;  3H0R C;  3AYW B;  3X1V B;  1P3O C;  3B6F A;  4H9R B;  4Z5T A;  1KX4 D;  3REK D;  3EPK A;  3AZG C;  1P3L D;  5AV6 D;  3AZF B;  3WA9 B;  4NE6 A;  3VH6 W;  5CP6 A;  2BYM A;  2HIO A;  3EPJ A;  3REH D;  3EPL A;  3A1K A;  3W98 C;  4WZS B;  5B33 A;  1HQ3 D;  3REL C;  4XUJ D;  5AV8 A;  3KXB C;  4CSR A;  3LEL B;  3KUY C;  2Y2H A;  5FUG B;  1M19 A;  1U35 D;  4YS3 D;  3AFA B;  2CV5 B;  1P3I D;  3AZE C;  3KWQ C;  1P3B A;  3MGP D;  2BG1 A;  5B0Y A;  2FFF B;  3MVD D;  3MGR B;  3AZN B;  1P3K D;  2Y2P A;  4ZUX A;  1AOI C;  1TAF A;  5KDM B;  3AZI C;  3UTB A;  1KX3 A;  2J8P A;  2W8S A;  3UTA C;  1P3M D;  1TZY C;  3LZ1 C;  5BO0 A;  3UT9 D;  3NQJ B;  4WU8 C;  3W96 C;  3REK B;  2Y2L A;  3IP4 C;  1P3L B;  5AV6 B;  1F66 A;  3REH B;  3B0B A;  5CPJ C;  4R8P C;  4XUJ B;  1S32 C;  3W97 D;  3VH5 T;  5AV5 A;  3REI A;  1U35 B;  3LZ0 A;  3AZH A;  4YS3 B;  2PYO B;  3AZJ C;  3MGP B;  2JCH A;  2IO5 C;  5E5A D;  4J8V B;  5B2I A;  2G5I C;  1P3F A;  4X23 D;  2ZY5 A;  2VQR A;  1WWS A;  3AYW A;  3X1V A;  4H9R A;  1P3O D;  3WAA A;  2F8N H;  3WA9 A;  3AZG D;  3B6G D;  3AN2 C;  3MGS C;  1M18 C;  5AY8 C;  2FJ7 B;  2YFW B;  3W98 D;  3LEL A;  1PZR A;  5BNV B;  3REL D;  1KX4 C;  3W97 B;  3KXB D;  1H3O A;  3KUY D;  4G91 C;  5FUG A;  3AFA A;  2CV5 A;  5JRG A;  2HIO B;  5B24 C;  3KWQ D;  3LJA C;  1B6W A;  5B33 B;  4QLC A;  1AOI D;  3AZI D;  3A6N C;  4CSR B;  2NZD C;  5DNM C;  3UTA D;  3NQJ A;  1TZY D;  1M19 B;  4UUZ B;  1P3O B;  3VH6 A;  2DQN C;  1WWI A;  2Y2M A;  3REK A;  2ARO C;  4WU8 D;  3W96 D;  3FDD A;  4J8U D;  1P3L A;  2CWE A;  5AV6 A;  3AZG B;  4ZUX B;  3REH A;  1TAF B;  4KUD C;  5GT3 C;  4H9O A;  5AVB C;  3B0D C;  3B0C W;  3MGQ C;  4E44 A;  1HQ3 A;  1M1A C;  3W98 B;  4XUJ A;  5CPJ D;  3REL B;  3KXB B;  4Z66 C;  2Y2Q A;  1U35 A;  4YS3 A;  1S32 D;  3AZL C;  1P3I A;  3WTP C;  1P3P C;  3O62 C;  3MGP A;  5B32 C;  3MNN C;  3AZE B;  1F66 B;  5GT0 C;  3MVD A;  3KWQ B;  3AZJ D;  1P3K A;  2XD5 A;  4YM6 C;  5JA4 B;  1AOI B;  3AZI B;  1P3M A;  4J8W C;  3UT9 A;  3X1U C;  4M6B A;  3UTA B;  1TZY B;  3LZ1 B;  3REI B;  4JJN C;  4E45 A;  2HUE B;  1EQZ D;  3X1T C;  4WU8 B;  3AZM C;  1ULY A;  1A7W A;  4AWL B;  2ZY2 A;  1P3F B;  4KHA B;  5B2J C;  3AV2 C;  3NQU B;  1B67 A;  3AN2 D;  2YFW A;  3MGS D;  1M18 D;  5AY8 D;  5BNV A;  3AL0 C;  5AV9 C;  3W97 A;  4R8P B;  1S32 B;  3REJ C;  3WAA B;  3B6G C;  4H9P A;  1KX5 D;  5F99 C;  5E5A A;  4LD9 C;  2IO5 B;  4X23 A;  5B24 D;  3V9R B;  3LJA D;  5B0Z C;  3A6N D;  1H3O B;  2NZD D;  5DNM D;  4UUZ A; 
#chains in the Genus database with same CATH homology
 3TU4 C;  4XZQ C;  1P3G C;  4ZBJ C;  5JRG B;  4HGA C;  5G49 B;  3X1S C;  5DNN C;  2ARO D;  3AZG A;  4QLC B;  4WU9 C;  4KUD D;  5GT3 D;  5AVB D;  3W98 A;  3MGQ D;  1M18 B;  5C3I B;  5AY8 B;  3EG5 B;  1M1A D;  3REL A;  3KXB A;  3KUY A;  4J8U C;  1KX4 B;  4G92 C;  5B1L D;  4Z66 D;  4G91 B;  1P3P D;  3AZL D;  3WTP D;  3AZE A;  3O62 D;  3KWQ A;  4H9O B;  5B32 D;  3MNN D;  5GT0 D;  1HQ3 B;  5JA4 A;  3LJA B;  2NQB C;  1AOI A;  3AZI A;  4YM6 D;  3AV1 C;  4EO5 C;  3A6N B;  3UTA A;  5CPK C;  1TZY A;  3LZ1 A;  4WJ3 C;  4J8W D;  5DNM B;  3X1U D;  1P3I B;  5BT1 C;  4KGC C;  5GXQ C;  4JJN D;  4WU8 A;  2BYK A;  4UPK A;  4NFT A;  3W96 A;  3H0L C;  3X1T D;  3MVD B;  5CPI C;  1P3K B;  2ARO B;  3AZM D;  4CAY B;  4KHA A;  1KU5 A;  3NQU A;  1P3M B;  1P3A D;  5GT3 B;  5AVB B;  4H9S C;  3B0D B;  5B2J D;  3UT9 B;  3AV2 D;  5AVC C;  1EQZ C;  5CPJ A;  1BH8 B;  4R8P A;  2F8N D;  4DRA A;  5AV9 D;  1S32 A;  4Z66 B;  1P3P B;  3REJ D;  4H9Q A;  3O62 B;  3AZJ A;  5B32 B;  3MNN B;  5F99 D;  5GT0 B;  3AZF C;  4LD9 D;  2DF4 C;  3V9R A;  5B31 C;  5B40 C;  4YM6 B;  3VH5 W;  4J8W B;  5B0Z D;  1KX5 C;  4JJN B;  4H9P B;  5B1M C;  5G49 A;  3TU4 D;  3X1T B;  4XZQ D;  5E5A B;  1P3G D;  3AZM B;  2ZY3 A;  3R45 A;  4X23 B;  3X1S D;  2LY8 A;  5DNN D;  3MGR C;  3AZN C;  3AN2 A;  3AV2 B;  2UWX A;  3MGS A;  1M18 A;  5AY8 A;  2F8N K;  4WU9 D;  1KX4 A;  1ZLA C;  1W2E A;  3REJ B;  2RVQ D;  1T3U A;  3B6G B;  5F99 B;  5B24 A;  3EPH A;  3LJA A;  4J8X C;  2NQB D;  3A6N A;  5B1L C;  3C1C C;  3KUY B;  2NZD A;  5DNM A;  3AV1 D;  5B0Z B;  5CPK D;  3WKJ C;  5BT1 D;  5GSU C;  2JE5 A;  4XZQ B;  3TU4 B;  4KGC D;  5GXQ D;  2PYO C;  2ARO A;  4ZBJ B;  4HGA B;  3AZH D;  4CAY A;  3X1S B;  5DNN B;  5CPI D;  4J8V C;  1ID3 C;  4KUD A;  5GT3 A;  5AVB A;  3MGQ A;  1N1J B;  4WU9 B;  2YFV A;  1M1A A;  1BH8 A;  5AVC D;  1BFM A;  3AZK C;  3W99 C;  5BNX B;  2BYK B;  4Z66 A;  4J8U B;  3W96 B;  4G92 B;  1P3P A;  3AZL A;  3WTP A;  3O62 A;  1P3A C;  5B32 A;  5CHL B;  3MNN A;  5GT0 A;  3AZF D;  3VH6 T;  4YM6 A;  3C1B C;  5CPJ B;  1P34 C;  5B31 D;  4WNN A;  2FJ7 C;  5B40 D;  4J8W A;  5BS7 C;  3X1U A;  4H9N A;  4EO5 B;  3B6F C;  4Z5T C;  3LEL D;  4JJN A;  4H9Q B;  4KGC B;  3X1T A;  3AZJ B;  5GXQ B;  3AZM A;  5B1M D;  1BH9 B;  5CP6 C;  2HIO C;  2Y2N A;  5B2J A;  3AV2 A;  3MGR D;  3AZN D;  5B33 C;  2G5H C;  5AV8 C;  2F8N A;  1EQZ B;  5AV9 A;  3KFU G;  4DQY B;  1M19 C;  1ZLA D;  3REJ A;  4Z2M G;  3R45 B;  1P3B C;  3B6G A;  5B0Y C;  5F99 A;  3VH5 A;  1JFI A;  3AN2 B;  4ZUX C;  4LD9 A;  3MGS B;  3UTB C;  1KX3 C;  5B31 B;  4J8X D;  5B40 B;  5B0Z A;  2RVQ C;  3C1C D;  1KX5 B;  3TU4 A;  4XZQ A;  1P3G A;  3WKJ D;  5B1M B;  5GSU D;  5B24 B;  1F66 C;  3X1S A;  5DNN A;  2PYO D;  1N1J A;  4J8V D;  4WU9 A;  1ID3 D;  2NZD B;  1HTA A;  5AV5 C;  3REI C;  5BNX A;  3AZK D;  4J8U A;  3W99 D;  3LZ0 C;  3AZH C;  1ZLA B;  2HUE C;  1P3O A;  5B2I C;  5B31 G;  4AWL C;  4KUD B;  1P3F C;  3MGQ B;  2YFV B;  1M1A B;  2NQB A;  4J8X B;  3C1B D;  1P34 D;  3AYW C;  3AV1 A;  3X1V C;  5B1L B;  3C1C B;  5CPK A;  2FJ7 D;  2F2A C;  4NE3 A;  3AZL B;  4Z5T D;  3WTP B;  3B6F D;  1Q9C A;  3WAA C;  4KGC A;  5GXQ A;  3WKJ B;  3A1I A;  2L5A A;  5GSU B;  1BH9 A;  3WA9 C;  5CPI A;  5CP6 D;  2HIO D;  1ID3 B;  4WNN B;  4H9S A;  3X1U B;  4H9N B;  5AVC A;  3LEL C;  5B33 D;  1EQZ A;  3H0M C;  5AV8 D;  3AZK B;  3W99 B;  3AFA C;  2CV5 C;  1M19 D;  5JRG C;  1P3B D;  1P3A B;  5B2J B;  5B0Y D;  3AZF A;  4QLC C;  4ZUX D;  5B31 A;  2F8N B;  3UTB D;  1KX3 D;  3B0C T;  5B40 A;  3WTP E;  3C1B B;  1P34 B;  5C3I C;  5AV9 B;  2ZM5 A;  5B32 G;  3B6F B;  4Z5T B;  1KX5 A;  2ZY4 A;  3REK C;  5B1M A;  1P3L C;  5AV6 C;  1JFI B;  4LD9 B;  3REH C;  1F66 D;  3AZE D;  5CP6 B;  2BYM B;  3MGR A;  3AZN A;  1HQ3 C;  2Y2K A;  5KDM A;  4XUJ C;  3KSY A;  5AV8 B;  3F6T A;  1U35 C;  4YS3 C;  1P3G B;  1P3I C;  5AV5 D;  3LZ1 D;  1R4V A;  3REI D;  1ZLA A;  3P5J B;  3LZ0 D;  3MGP C;  2Y2J A;  3MVD C;  4NE5 A;  1P3B B;  1P3K C;  2F8N G;  5B0Y B;  5B2I D;  1P3F D;  1P3M C;  4J8X A;  3UTB B;  1KX3 B;  3UT9 C;  4WV4 B;  5B1L A;  3C1C A;  5BO0 B;  3AYW D;  3X1V D;  2XD1 A;  2Y2G A;  4R8P D;  4Z2M H;  3WKJ A;  2RIQ A;  4DRB A;  5GSU A;  3WAA D;  2PYO A;  2Y2O A;  3WA9 D;  2NQB B;  4J8V A;  1ID3 A;  3AV1 B;  5CPK B;  2JSS A;  3W97 C;  2Y2I A;  3AZK A;  3W99 A;  5AV5 B;  1F1E A;  3LZ0 B;  3AZH B;  3AFA D;  2CV5 D;  5CPI B;  5E5A C;  5JRG D;  1P3A A;  4X23 C;  5B2I B;  5AVC B;  3C1B A;  1P34 A;  4QLC D;  2FJ7 A;  1Z2C B;  5BS7 A;  3H0R C;  3AYW B;  3X1V B;  1P3O C;  3B6F A;  4H9R B;  4Z5T A;  1KX4 D;  3REK D;  3EPK A;  3AZG C;  1P3L D;  5AV6 D;  3AZF B;  3WA9 B;  4NE6 A;  3VH6 W;  5CP6 A;  2BYM A;  2HIO A;  3EPJ A;  3REH D;  3EPL A;  3A1K A;  3W98 C;  4WZS B;  5B33 A;  1HQ3 D;  3REL C;  4XUJ D;  5AV8 A;  3KXB C;  4CSR A;  3LEL B;  3KUY C;  2Y2H A;  5FUG B;  1M19 A;  1U35 D;  4YS3 D;  3AFA B;  2CV5 B;  1P3I D;  3AZE C;  3KWQ C;  1P3B A;  3MGP D;  2BG1 A;  5B0Y A;  2FFF B;  3MVD D;  3MGR B;  3AZN B;  1P3K D;  2Y2P A;  4ZUX A;  1AOI C;  1TAF A;  5KDM B;  3AZI C;  3UTB A;  1KX3 A;  2J8P A;  2W8S A;  3UTA C;  1P3M D;  1TZY C;  3LZ1 C;  5BO0 A;  3UT9 D;  3NQJ B;  4WU8 C;  3W96 C;  3REK B;  2Y2L A;  3IP4 C;  1P3L B;  5AV6 B;  1F66 A;  3REH B;  3B0B A;  5CPJ C;  4R8P C;  4XUJ B;  1S32 C;  3W97 D;  3VH5 T;  5AV5 A;  3REI A;  1U35 B;  3LZ0 A;  3AZH A;  4YS3 B;  2PYO B;  3AZJ C;  3MGP B;  2JCH A;  2IO5 C;  5E5A D;  4J8V B;  5B2I A;  2G5I C;  1P3F A;  4X23 D;  2ZY5 A;  2VQR A;  1WWS A;  3AYW A;  3X1V A;  4H9R A;  1P3O D;  3WAA A;  2F8N H;  3WA9 A;  3AZG D;  3B6G D;  3AN2 C;  3MGS C;  1M18 C;  5AY8 C;  2FJ7 B;  2YFW B;  3W98 D;  3LEL A;  1PZR A;  5BNV B;  3REL D;  1KX4 C;  3W97 B;  3KXB D;  1H3O A;  3KUY D;  4G91 C;  5FUG A;  3AFA A;  2CV5 A;  5JRG A;  2HIO B;  5B24 C;  3KWQ D;  3LJA C;  1B6W A;  5B33 B;  4QLC A;  1AOI D;  3AZI D;  3A6N C;  4CSR B;  2NZD C;  5DNM C;  3UTA D;  3NQJ A;  1TZY D;  1M19 B;  4UUZ B;  1P3O B;  3VH6 A;  2DQN C;  1WWI A;  2Y2M A;  3REK A;  2ARO C;  4WU8 D;  3W96 D;  3FDD A;  4J8U D;  1P3L A;  2CWE A;  5AV6 A;  3AZG B;  4ZUX B;  3REH A;  1TAF B;  4KUD C;  5GT3 C;  4H9O A;  5AVB C;  3B0D C;  3B0C W;  3MGQ C;  4E44 A;  1HQ3 A;  1M1A C;  3W98 B;  4XUJ A;  5CPJ D;  3REL B;  3KXB B;  4Z66 C;  2Y2Q A;  1U35 A;  4YS3 A;  1S32 D;  3AZL C;  1P3I A;  3WTP C;  1P3P C;  3O62 C;  3MGP A;  5B32 C;  3MNN C;  3AZE B;  1F66 B;  5GT0 C;  3MVD A;  3KWQ B;  3AZJ D;  1P3K A;  2XD5 A;  4YM6 C;  5JA4 B;  1AOI B;  3AZI B;  1P3M A;  4J8W C;  3UT9 A;  3X1U C;  4M6B A;  3UTA B;  1TZY B;  3LZ1 B;  3REI B;  4JJN C;  4E45 A;  2HUE B;  1EQZ D;  3X1T C;  4WU8 B;  3AZM C;  1ULY A;  1A7W A;  4AWL B;  2ZY2 A;  1P3F B;  4KHA B;  5B2J C;  3AV2 C;  3NQU B;  1B67 A;  3AN2 D;  2YFW A;  3MGS D;  1M18 D;  5AY8 D;  5BNV A;  3AL0 C;  5AV9 C;  3W97 A;  4R8P B;  1S32 B;  3REJ C;  3WAA B;  3B6G C;  4H9P A;  1KX5 D;  5F99 C;  5E5A A;  4LD9 C;  2IO5 B;  4X23 A;  5B24 D;  3V9R B;  3LJA D;  5B0Z C;  3A6N D;  1H3O B;  2NZD D;  5DNM D;  4UUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...