4R8PC

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 29
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pC00
4ZUXB 5CPJC 3MGSB 3V9RB 1F66A 5GT3B 3C1CC 3B0DC 1JFIA 5B1LC 3AYWC 4G91C 3W97D 3MVDC 2YFWB 5CP6B 4J8VA 4H9PB 3AZID 3AV2B 3MGRC 1P3FC 3WTPA 3KSYA 5E5AD 5AY8C 3MGSA 3O62B 1P3KC 5AV5D 3C1CA 3W96A 4H9SC 1KX5C 3AYWA 3X1UA 3WKJB 3AZED 4WU9C 2BYMB 3REIB 1S32D 1P3LB 1M1AB 3X1SA 2FJ7A 3W96B 3AZHD 3W96C 3AZMD 5B2IA 5BT1C 1M1AC 3V9RA 4KGCC 3VH6A 3REIC 3KUYD 3R45B 3A6NB 3X1VB 1U35A 1S32B 1P3LA 2BYKA 2F8NK 4XZQB 2NZDB 3WKJD 2NQBC 3REHA 3REKA 3X1UD 4H9RB 2IO5B 1P3PD 5C3IC 1B6WA 1ZLAC 1ZLAB 4R8PA 5AV8C 1AOIC 1BFMA 1WWSA 5GT0B 5B2ID 3W99D 4J8WA 3UTAA 4YM6C 1P3AC 3A6ND 3X1VD 3W97B 2CV5D 4JJND 4LD9C 2RVQC 5F99A 3VH5W 5DNNB 5B32A 3AZGB 5CPKD 1P3PB 2AROC 3C1BD 5CPKB 1ZLAA 1EQZB 5CPJD 5B31D 3MGQD 2PYOC 5AVBC 4ZBJC 3REKD 5B1MB 3MNNC 3W99B 3LELA 3LZ0A 4Z66B 1P3AA 3AV1C 1KX3A 3WAAC 3AZKC 1M19C 4X23B 4WU8D 1HQ3C 4H9QA 4YS3D 1KX4D 5AV5C 5B40D 2F8NH 3W98B 2YFVA 3LELC 3W98D 5AV6A 2HUEC 3AZIB 1P3MC 1P3FB 3LJAD 3AZGA 4X23D 4WNNA 3AYWB 1M1AD 1TZYB 3REJA 3B6GC 5AV6C 3REID 3AV2D 5JA4A 5GSUA 3LZ0B 5B24B 1R4VA 4YS3A 1KX4A 5B31B 2CWEA 5JRGB 3TU4C 5B33C 1KU5A 4ZUXD 3AN2D 3REJC 4KUDD 5DNNC 1P34A 1U35B 5B0YD 4EO5B 4J8VC 4J8XB 3W97C 3MGRA 3WA9C 2HIOC 4H9SA 5BNXA 3X1SB 1KX5A 2FJ7B 1JFIB 3AZJD 3LZ1B 4DRBA 1TZYA 5B0YB 3NQUA 1TAFB 4NE5A 5JA4B 4YS3B 1N1JB 1KX4B 1B67A 5B32G 4KGCA 2F8NA 3WAAD 3AZMC 3W96D 5BNVA 3NQUB 3WTPC 3KXBD 4QLCD 5B1MD 1P3LC 1M18D 1KX3D 4J8WB 3WKJC 5B2JD 4G92B 4J8UB 5KDMB 3AZLC 1KX5B 3LJAC 4UUZB 5AV8A 1F1EA 4Z5TC 3AZNC 1AOIA 5E5AB 4WZSB 3LZ1C 4E45A 3REHD 4WV4B 3X1SC 2FJ7C 1F66D 5BO0B 5DNMD 5CP6C 4CAYB 1BH8A 4AWLC 2AROA 3AZLA 3VH6W 2RVQD 5GSUD 1U35C 5E5AA 1BH9B 3RELC 4XZQD 2NZDD 3REJB 3UTBB 3REJD 5BO0A 5JRGC 5AVBD 3LZ0C 3TU4B 3REKC 3UTAB 4H9NB 4CAYA 5AV6B 5B31A 5B24C 3WA9D 5CPKA 1HQ3A 4J8UA 1BH9A 1M19D 5AV5A 3C1CD 3MGQA 5B40C 4YM6A 3AZHA 1P3MB 3KWQD 5BS7A 3LELD 3MGRD 4WU8A 5AY8D 4J8UC 5AV5B 3O62D 4H9OB 4X23C 5B40A 1P3OC 3AV1A 3AZKB 1P3IB 3AZEC 4WU9D 2F8ND 3WAAA 3B6FB 1ID3B 1P3BD 4J8XA 5B1MC 3X1TD 3AZMB 3AFAA 5B33A 4ZBJB 3UTAD 5CPIC 4LD9B 3AZFB 4JJNA 4NFTA 4YM6B 5AV9C 5GSUB 1EQZD 3AZGC 4HGAC 4KHAB 3MGPC 3UT9B 3AFAC 1P34D 1N1JA 5KDMA 1F66B 4DRAA 4UUZA 5AV8B 1AOIB 3AZJC 4KUDA 5AV8D 3X1TA 1AOID 3MGPB 4J8VB 2IO5C 5JRGD 3UT9D 1ID3A 3X1VC 3A6NC 1P3GB 3AZMA 5DNNA 2LY8A 1EQZA 2PYOD 5GT3A 2JSSA 3MNND 5B1LD 1ID3C 3MVDD 4H9PA 1M1AA 1P3IC 1A7WA 1P3FD 2F8NB 4KGCD 1TZYC 4WU9B 1HQ3D 5G49A 1P3KD 3O62C 1P3KB 3LZ1A 3KUYC 4Z5TD 3AZND 4XUJD 2YFVB 3NQJA 4Z2MH 3REHC 1M18A 3AZIA 3X1UC 1P3BC 1P3GA 4WU9A 1H3OA 4WNNB 3RELA 4J8XD 1HQ3B 3AV1B 3NQJB 5B2IC 3MGQB 3WAAB 1ULYA 1P3AD 4Z66C 5DNMA 5B24A 3MNNB 4XZQA 2AROB 3UTBC 4E44A 5CPKC 2NZDA 3RELB 3AFAD 4H9RA 3MGQC 2NQBA 1P3PC 3VH6T 2F8NG 1P34B 1P3GD 5GXQC 4H9NA 3AZKA 4Z66A 1P3AB 5FUGB 1P3BB 5GT0C 2HIOD 5E5AC 4Z5TB 3AZNB 4X23A 5BNXB 3AZLB 2NQBB 3AFAB 1P3PA 4G92C 4KUDB 4HGAB 1P3OD 1P3MA 5B2JA 4R8PD 3KWQA 5AV9B 4WU8B 5B1MA 3AZFC 4J8WD 1S32C 1ID3D 1KX3B 3AV1D 3MNNA 5AVCC 2CV5A 4H9OA 5F99D 5B32D 3AZHC 3B6GD 5AV9A 4YS3C 1KX4C 5B31G 3MGPA 1S32A 1P3OB 5FUGA 2CV5B 1P3MD 3TU4D 5CHLB 5B33D 3AZJA 4KUDC 3B0CW 3WA9A 3LZ1D 2HIOB 5AY8B 3X1SD 2FJ7D 4XUJA 3MVDB 1F66C 5B1LB 5AV6D 3AV2C 4EO5C 3B0DB 4YM6D 4G91B 1H3OB 5GSUC 1U35D 5B33B 5GT3C 5AY8A 3MGSC 4ZUXC 3AN2C 5CPJB 1TAFA 3KXBA 3TU4A 3W99A 5DNMB 2YFWA 3B6GB 1P3ID 4NE6A 5B2IB 5GT0D 3AZKD 4AWLB 3C1BA 3O62A 5CPJA 4H9QB 3AN2A 3WTPD 3AYWD 3KXBC 1Q9CA 3R45A 3A6NA 3X1VA 3X1TB 1M18C 3AZIC 3X1UB 4XUJB 3MVDA 3B6FD 4Z2MG 1P3BA 2BYMA 3AZFD 3REHB 5B0ZD 1P3FA 4Z5TA 3AZNA 5B0ZB 3AZLD 3KUYB 5AVCD 1P3KA 5B40B 4NE3A 5B2JB 5BNVB 5CP6A 1P3IA 5DNMC 2L5AA 3WTPB 4QLCC 1P3LD 2PYOB 5B32B 5F99B 3KUYA 3UTBD 5BT1D 3REKB 3UTAC 3RELD 5JRGA 5G49B 3AN2B 3WKJA 4LD9A 5AV9D 5DNND 3REIA 4R8PB 1P3GC 5GXQD 5B0YC 3LJAA 4QLCA 4J8VD 3AZGD 3KWQB 5B24D 3VH5T 2PYOA 4KHAA 3UT9A 3VH5A 4M6BA 5CP6D 1BH8B 5C3IB 3AZJB 5BS7C 1ZLAD 3WA9B 3KWQC 3LJAB 5B0YA 3MGSD 4XZQC 4R8PC 3UTBA 2BYKB 2NZDC 3UT9C 4J8WC 2CV5C 1P3OA 3B0BA 3WTPE 1KX5D 4KGCB 3AZEA 5GXQA 5B32C 5F99C 5CPIB 5B31C 4CSRA 5GT0A 5AVBA 3AZHB 3W98A 4QLCB 5AVCB 3B6GA 3B6FC 1KX3C 3AZEB 5CPIA 1TZYD 5B2JC 5B0ZC 4WU8C 4CSRB 4J8UD 1M19A 3AZFA 2HUEB 4XUJC 3LELB 3W98C 3MGRB 3B0CT 5AVCA 1M18B 3AV2A 3MGPD 3KXBB 3B6FA 2NQBD 1P34C 3W97A 5B0ZA 3X1TC 1M19B 3C1CB 4J8XC 5GXQB 4ZUXA 1HTAA 2HIOA 5GT3D 3C1BB 3W99C 5CPID 4JJNB 5B1LA 5AVBB 3LZ0D 4Z66D 1WWIA 4JJNC 4LD9D 1EQZC 2AROD 3C1BC
chains in the Genus database with same CATH superfamily
4ZUXB 5CPJC 3MGSB 3V9RB 1F66A 5GT3B 3C1CC 3B0DC 1JFIA 2XD5A 5B1LC 3AYWC 4G91C 3W97D 3MVDC 2YFWB 5CP6B 4J8VA 4H9PB 3AZID 3AV2B 3MGRC 1P3FC 3WTPA 3KSYA 5E5AD 5AY8C 3MGSA 3O62B 1P3KC 5AV5D 3C1CA 3W96A 4H9SC 1KX5C 3AYWA 3X1UA 3WKJB 3AZED 4WU9C 1T3UA 2BYMB 3REIB 1S32D 1P3LB 3EPLA 1M1AB 3X1SA 2FJ7A 3W96B 3AZHD 3W96C 3AZMD 5B2IA 5BT1C 1M1AC 3V9RA 4KGCC 4DQYB 3H0RC 3VH6A 3REIC 3KUYD 3R45B 3A1KA 3A6NB 3X1VB 1U35A 1S32B 1P3LA 2BYKA 2F8NK 4XZQB 2NZDB 3WKJD 2NQBC 2ZY2A 3REHA 3REKA 3X1UD 4H9RB 2IO5B 1P3PD 5C3IC 1B6WA 3IP4C 1ZLAC 1ZLAB 4R8PA 5AV8C 1AOIC 1BFMA 1WWSA 5GT0B 5B2ID 3W99D 4J8WA 3UTAA 4YM6C 1P3AC 3A6ND 3X1VD 3W97B 2CV5D 4JJND 4LD9C 2RVQC 5F99A 3VH5W 5DNNB 5B32A 3AZGB 5CPKD 1P3PB 2AROC 3C1BD 5CPKB 1ZLAA 1EQZB 5CPJD 5B31D 3MGQD 2PYOC 5AVBC 4ZBJC 3REKD 5B1MB 3MNNC 3W99B 3LELA 3LZ0A 4Z66B 1P3AA 3AV1C 1KX3A 3WAAC 3AZKC 1M19C 4X23B 4WU8D 1HQ3C 4H9QA 1W2EA 4YS3D 1KX4D 5AV5C 2BG1A 5B40D 2Y2JA 2F8NH 3W98B 2YFVA 3LELC 3W98D 5AV6A 2HUEC 3AZIB 2Y2OA 1P3MC 1P3FB 3LJAD 3AZGA 4X23D 4WNNA 3A1IA 3FDDA 3AYWB 1M1AD 1TZYB 3REJA 3B6GC 5AV6C 3REID 3AV2D 5JA4A 5GSUA 3LZ0B 5B24B 1R4VA 4YS3A 2JCHA 5B31B 1KX4A 2CWEA 5JRGB 3TU4C 5B33C 1KU5A 4ZUXD 3AN2D 3REJC 4KUDD 5DNNC 1P34A 1U35B 5B0YD 4EO5B 4J8VC 4J8XB 3W97C 3MGRA 3WA9C 2HIOC 4H9SA 5BNXA 3X1SB 1KX5A 2FJ7B 1JFIB 3AZJD 3LZ1B 4WJ3C 2Y2QA 4DRBA 1TZYA 5B0YB 3NQUA 1TAFB 4NE5A 5JA4B 4YS3B 1N1JB 1KX4B 2DF4C 1B67A 5B32G 4KGCA 2F8NA 3WAAD 3AZMC 3W96D 5BNVA 3NQUB 3WTPC 3KXBD 4QLCD 5B1MD 1P3LC 1M18D 1KX3D 4J8WB 3WKJC 5B2JD 4G92B 4J8UB 5KDMB 3AZLC 1KX5B 3LJAC 4UUZB 5AV8A 1F1EA 4Z5TC 3AZNC 1AOIA 5E5AB 4WZSB 3LZ1C 4E45A 3REHD 4WV4B 3X1SC 2FJ7C 1F66D 5BO0B 5DNMD 5CP6C 4CAYB 1BH8A 4AWLC 2AROA 3AZLA 3VH6W 2RVQD 5GSUD 1U35C 5E5AA 1BH9B 3RELC 4XZQD 2NZDD 3REJB 3UTBB 3REJD 5BO0A 5JRGC 5AVBD 3LZ0C 3TU4B 3REKC 3UTAB 4H9NB 4CAYA 5AV6B 5B31A 2FFFB 5B24C 3WA9D 5CPKA 1HQ3A 4J8UA 1BH9A 1M19D 5AV5A 3C1CD 3MGQA 2Y2GA 5B40C 4YM6A 3AL0C 3AZHA 1P3MB 3KWQD 5BS7A 3LELD 3MGRD 4WU8A 5AY8D 4J8UC 5AV5B 3O62D 4H9OB 4X23C 5B40A 1P3OC 3AV1A 3AZKB 1P3IB 3AZEC 4WU9D 2F8ND 3WAAA 3B6FB 1ID3B 1P3BD 4J8XA 5B1MC 3X1TD 3AZMB 3AFAA 5B33A 4ZBJB 3UTAD 2ZY4A 5CPIC 4LD9B 3AZFB 4JJNA 4NFTA 4YM6B 5AV9C 5GSUB 2ZM5A 3AZGC 1EQZD 4HGAC 3KFUG 4KHAB 3MGPC 3UT9B 2G5IC 3AFAC 1P34D 1N1JA 5KDMA 1F66B 4DRAA 2VQRA 4UUZA 5AV8B 1AOIB 3AZJC 4KUDA 5AV8D 3X1TA 1AOID 3MGPB 4J8VB 2JE5A 2DQNC 2IO5C 5JRGD 3UT9D 1ID3A 3X1VC 3A6NC 1P3GB 3AZMA 5DNNA 2LY8A 3EG5B 1EQZA 2PYOD 5GT3A 2JSSA 3MNND 5B1LD 1ID3C 3MVDD 4H9PA 1M1AA 1P3IC 1A7WA 1P3FD 3F6TA 2F8NB 4KGCD 1TZYC 4WU9B 1HQ3D 5G49A 1P3KD 2Y2KA 3O62C 1P3KB 3LZ1A 3KUYC 4Z5TD 3AZND 4XUJD 2YFVB 3NQJA 4Z2MH 3REHC 1M18A 3AZIA 3X1UC 1P3BC 1PZRA 1P3GA 4WU9A 1H3OA 2G5HC 4WNNB 3RELA 4J8XD 1HQ3B 4UPKA 3AV1B 2W8SA 3NQJB 5B2IC 3MGQB 3WAAB 3H0LC 1ULYA 1P3AD 4Z66C 5DNMA 5B24A 3MNNB 4XZQA 2AROB 3UTBC 4E44A 5CPKC 2NZDA 2F2AC 2Y2MA 3RELB 3AFAD 4H9RA 3MGQC 2NQBA 1P3PC 3VH6T 2F8NG 1P34B 1P3GD 5GXQC 4H9NA 3AZKA 4Z66A 1P3AB 5FUGB 1P3BB 5GT0C 2HIOD 5E5AC 4Z5TB 3AZNB 4X23A 5BNXB 3AZLB 2NQBB 3AFAB 1P3PA 4G92C 4KUDB 4HGAB 1P3OD 1P3MA 5B2JA 4R8PD 3KWQA 5AV9B 4WU8B 5B1MA 3AZFC 4J8WD 1S32C 1ID3D 3EPKA 1KX3B 3AV1D 3MNNA 5AVCC 2CV5A 4H9OA 5F99D 5B32D 3AZHC 3B6GD 5AV9A 4YS3C 1KX4C 2Y2PA 5B31G 3MGPA 1S32A 1P3OB 5FUGA 2CV5B 1P3MD 3TU4D 5CHLB 5B33D 2Y2LA 2XD1A 2RIQA 3AZJA 4KUDC 3B0CW 3WA9A 3LZ1D 2HIOB 5AY8B 3X1SD 2FJ7D 4XUJA 3MVDB 1F66C 5B1LB 5AV6D 3AV2C 4EO5C 3B0DB 4YM6D 4G91B 1H3OB 5GSUC 1U35D 5B33B 5GT3C 5AY8A 3MGSC 4ZUXC 3AN2C 5CPJB 1TAFA 3KXBA 3TU4A 3W99A 5DNMB 2YFWA 3B6GB 1P3ID 2Y2IA 4NE6A 5B2IB 5GT0D 3AZKD 4AWLB 3C1BA 3O62A 5CPJA 4H9QB 3AN2A 3WTPD 3AYWD 3KXBC 1Q9CA 3R45A 3A6NA 3X1VA 3X1TB 1M18C 3AZIC 2ZY5A 3X1UB 4XUJB 3MVDA 3B6FD 4Z2MG 1P3BA 2BYMA 3AZFD 3REHB 5B0ZD 1P3FA 4Z5TA 3AZNA 5B0ZB 3AZLD 3KUYB 5AVCD 1P3KA 5B40B 4NE3A 5B2JB 5BNVB 5CP6A 1P3IA 2J8PA 2L5AA 3WTPB 5DNMC 4QLCC 1P3LD 2PYOB 5B32B 5F99B 3KUYA 3UTBD 5BT1D 3REKB 3UTAC 3RELD 5JRGA 5G49B 3AN2B 3WKJA 4LD9A 5AV9D 2UWXA 5DNND 3REIA 4R8PB 1P3GC 5GXQD 5B0YC 3LJAA 4QLCA 4J8VD 3AZGD 3KWQB 5B24D 3VH5T 2PYOA 4KHAA 3UT9A 3VH5A 4M6BA 5CP6D 2ZY3A 1BH8B 5C3IB 3AZJB 3P5JB 5BS7C 1ZLAD 3WA9B 3KWQC 3LJAB 5B0YA 3MGSD 4XZQC 4R8PC 3UTBA 2BYKB 2NZDC 2Y2NA 3UT9C 4J8WC 2CV5C 1P3OA 3B0BA 3WTPE 1KX5D 4KGCB 3AZEA 5GXQA 5B32C 5F99C 5CPIB 5B31C 3EPJA 4CSRA 5GT0A 5AVBA 3AZHB 3W98A 4QLCB 5AVCB 3B6GA 3B6FC 1KX3C 3AZEB 5CPIA 1TZYD 5B2JC 1Z2CB 5B0ZC 4WU8C 4CSRB 4J8UD 1M19A 3AZFA 3H0MC 2HUEB 4XUJC 3LELB 3W98C 3MGRB 3B0CT 5AVCA 1M18B 3AV2A 3MGPD 3KXBB 3B6FA 2NQBD 1P34C 3W97A 5B0ZA 3X1TC 1M19B 3C1CB 4J8XC 2Y2HA 5GXQB 4ZUXA 1HTAA 2HIOA 5GT3D 3C1BB 3W99C 5CPID 4JJNB 5B1LA 3EPHA 5AVBB 3LZ0D 4Z66D 1WWIA 4JJNC 4LD9D 1EQZC 2AROD 3C1BC
chains in the Genus database with same CATH topology
4ZUXB 5CPJC 3MGSB 3V9RB 1F66A 5GT3B 3C1CC 3B0DC 1JFIA 2XD5A 5B1LC 3AYWC 4G91C 3W97D 3MVDC 2YFWB 5CP6B 4J8VA 4H9PB 3AZID 3AV2B 3MGRC 1P3FC 3WTPA 3KSYA 5E5AD 5AY8C 3MGSA 3O62B 1P3KC 5AV5D 3C1CA 3W96A 4H9SC 1KX5C 3AYWA 3X1UA 3WKJB 3AZED 4WU9C 1T3UA 2BYMB 3REIB 1S32D 1P3LB 3EPLA 1M1AB 3X1SA 2FJ7A 3W96B 3AZHD 3W96C 3AZMD 5B2IA 5BT1C 1M1AC 3V9RA 4KGCC 4DQYB 3H0RC 3VH6A 3REIC 3KUYD 3R45B 3A1KA 3A6NB 3X1VB 1U35A 1S32B 1P3LA 2BYKA 2F8NK 4XZQB 2NZDB 3WKJD 2NQBC 2ZY2A 3REHA 3REKA 3X1UD 4H9RB 2IO5B 1P3PD 5C3IC 1B6WA 3IP4C 1ZLAC 1ZLAB 4R8PA 5AV8C 1AOIC 1BFMA 1WWSA 5GT0B 5B2ID 3W99D 4J8WA 3UTAA 4YM6C 1P3AC 3A6ND 3X1VD 3W97B 2CV5D 4JJND 4LD9C 2RVQC 5F99A 3VH5W 5DNNB 5B32A 3AZGB 5CPKD 1P3PB 2AROC 3C1BD 5CPKB 1ZLAA 1EQZB 5CPJD 5B31D 3MGQD 2PYOC 5AVBC 4ZBJC 3REKD 5B1MB 3MNNC 3W99B 3LELA 3LZ0A 4Z66B 1P3AA 3AV1C 1KX3A 3WAAC 3AZKC 1M19C 4X23B 4WU8D 1HQ3C 4H9QA 1W2EA 4YS3D 1KX4D 5AV5C 2BG1A 5B40D 2Y2JA 2F8NH 3W98B 2YFVA 3LELC 3W98D 5AV6A 2HUEC 3AZIB 2Y2OA 1P3MC 1P3FB 3LJAD 3AZGA 4X23D 4WNNA 3A1IA 3FDDA 3AYWB 1M1AD 1TZYB 3REJA 3B6GC 5AV6C 3REID 3AV2D 5JA4A 5GSUA 3LZ0B 5B24B 1R4VA 4YS3A 2JCHA 5B31B 1KX4A 2CWEA 5JRGB 3TU4C 5B33C 1KU5A 4ZUXD 3AN2D 3REJC 4KUDD 5DNNC 1P34A 1U35B 5B0YD 4EO5B 4J8VC 4J8XB 3W97C 3MGRA 3WA9C 2HIOC 4H9SA 5BNXA 3X1SB 1KX5A 2FJ7B 1JFIB 3AZJD 3LZ1B 4WJ3C 2Y2QA 4DRBA 1TZYA 5B0YB 3NQUA 1TAFB 4NE5A 5JA4B 4YS3B 1N1JB 1KX4B 2DF4C 1B67A 5B32G 4KGCA 2F8NA 3WAAD 3AZMC 3W96D 5BNVA 3NQUB 3WTPC 3KXBD 4QLCD 5B1MD 1P3LC 1M18D 1KX3D 4J8WB 3WKJC 5B2JD 4G92B 4J8UB 5KDMB 3AZLC 1KX5B 3LJAC 4UUZB 5AV8A 1F1EA 4Z5TC 3AZNC 1AOIA 5E5AB 4WZSB 3LZ1C 4E45A 3REHD 4WV4B 3X1SC 2FJ7C 1F66D 5BO0B 5DNMD 5CP6C 4CAYB 1BH8A 4AWLC 2AROA 3AZLA 3VH6W 2RVQD 5GSUD 1U35C 5E5AA 1BH9B 3RELC 4XZQD 2NZDD 3REJB 3UTBB 3REJD 5BO0A 5JRGC 5AVBD 3LZ0C 3TU4B 3REKC 3UTAB 4H9NB 4CAYA 5AV6B 5B31A 2FFFB 5B24C 3WA9D 5CPKA 1HQ3A 4J8UA 1BH9A 1M19D 5AV5A 3C1CD 3MGQA 2Y2GA 5B40C 4YM6A 3AL0C 3AZHA 1P3MB 3KWQD 5BS7A 3LELD 3MGRD 4WU8A 5AY8D 4J8UC 5AV5B 3O62D 4H9OB 4X23C 5B40A 1P3OC 3AV1A 3AZKB 1P3IB 3AZEC 4WU9D 2F8ND 3WAAA 3B6FB 1ID3B 1P3BD 4J8XA 5B1MC 3X1TD 3AZMB 3AFAA 5B33A 4ZBJB 3UTAD 2ZY4A 5CPIC 4LD9B 3AZFB 4JJNA 4NFTA 4YM6B 5AV9C 5GSUB 2ZM5A 3AZGC 1EQZD 4HGAC 3KFUG 4KHAB 3MGPC 3UT9B 2G5IC 3AFAC 1P34D 1N1JA 5KDMA 1F66B 4DRAA 2VQRA 4UUZA 5AV8B 1AOIB 3AZJC 4KUDA 5AV8D 3X1TA 1AOID 3MGPB 4J8VB 2JE5A 2DQNC 2IO5C 5JRGD 3UT9D 1ID3A 3X1VC 3A6NC 1P3GB 3AZMA 5DNNA 2LY8A 3EG5B 1EQZA 2PYOD 5GT3A 2JSSA 3MNND 5B1LD 1ID3C 3MVDD 4H9PA 1M1AA 1P3IC 1A7WA 1P3FD 3F6TA 2F8NB 4KGCD 1TZYC 4WU9B 1HQ3D 5G49A 1P3KD 2Y2KA 3O62C 1P3KB 3LZ1A 3KUYC 4Z5TD 3AZND 4XUJD 2YFVB 3NQJA 4Z2MH 3REHC 1M18A 3AZIA 3X1UC 1P3BC 1PZRA 1P3GA 4WU9A 1H3OA 2G5HC 4WNNB 3RELA 4J8XD 1HQ3B 4UPKA 3AV1B 2W8SA 3NQJB 5B2IC 3MGQB 3WAAB 3H0LC 1ULYA 1P3AD 4Z66C 5DNMA 5B24A 3MNNB 4XZQA 2AROB 3UTBC 4E44A 5CPKC 2NZDA 2F2AC 2Y2MA 3RELB 3AFAD 4H9RA 3MGQC 2NQBA 1P3PC 3VH6T 2F8NG 1P34B 1P3GD 5GXQC 4H9NA 3AZKA 4Z66A 1P3AB 5FUGB 1P3BB 5GT0C 2HIOD 5E5AC 4Z5TB 3AZNB 4X23A 5BNXB 3AZLB 2NQBB 3AFAB 1P3PA 4G92C 4KUDB 4HGAB 1P3OD 1P3MA 5B2JA 4R8PD 3KWQA 5AV9B 4WU8B 5B1MA 3AZFC 4J8WD 1S32C 1ID3D 3EPKA 1KX3B 3AV1D 3MNNA 5AVCC 2CV5A 4H9OA 5F99D 5B32D 3AZHC 3B6GD 5AV9A 4YS3C 1KX4C 2Y2PA 5B31G 3MGPA 1S32A 1P3OB 5FUGA 2CV5B 1P3MD 3TU4D 5CHLB 5B33D 2Y2LA 2XD1A 2RIQA 3AZJA 4KUDC 3B0CW 3WA9A 3LZ1D 2HIOB 5AY8B 3X1SD 2FJ7D 4XUJA 3MVDB 1F66C 5B1LB 5AV6D 3AV2C 4EO5C 3B0DB 4YM6D 4G91B 1H3OB 5GSUC 1U35D 5B33B 5GT3C 5AY8A 3MGSC 4ZUXC 3AN2C 5CPJB 1TAFA 3KXBA 3TU4A 3W99A 5DNMB 2YFWA 3B6GB 1P3ID 2Y2IA 4NE6A 5B2IB 5GT0D 3AZKD 4AWLB 3C1BA 3O62A 5CPJA 4H9QB 3AN2A 3WTPD 3AYWD 3KXBC 1Q9CA 3R45A 3A6NA 3X1VA 3X1TB 1M18C 3AZIC 2ZY5A 3X1UB 4XUJB 3MVDA 3B6FD 4Z2MG 1P3BA 2BYMA 3AZFD 3REHB 5B0ZD 1P3FA 4Z5TA 3AZNA 5B0ZB 3AZLD 3KUYB 5AVCD 1P3KA 5B40B 4NE3A 5B2JB 5BNVB 5CP6A 1P3IA 2J8PA 2L5AA 3WTPB 5DNMC 4QLCC 1P3LD 2PYOB 5B32B 5F99B 3KUYA 3UTBD 5BT1D 3REKB 3UTAC 3RELD 5JRGA 5G49B 3AN2B 3WKJA 4LD9A 5AV9D 2UWXA 5DNND 3REIA 4R8PB 1P3GC 5GXQD 5B0YC 3LJAA 4QLCA 4J8VD 3AZGD 3KWQB 5B24D 3VH5T 2PYOA 4KHAA 3UT9A 3VH5A 4M6BA 5CP6D 2ZY3A 1BH8B 5C3IB 3AZJB 3P5JB 5BS7C 1ZLAD 3WA9B 3KWQC 3LJAB 5B0YA 3MGSD 4XZQC 4R8PC 3UTBA 2BYKB 2NZDC 2Y2NA 3UT9C 4J8WC 2CV5C 1P3OA 3B0BA 3WTPE 1KX5D 4KGCB 3AZEA 5GXQA 5B32C 5F99C 5CPIB 5B31C 3EPJA 4CSRA 5GT0A 5AVBA 3AZHB 3W98A 4QLCB 5AVCB 3B6GA 3B6FC 1KX3C 3AZEB 5CPIA 1TZYD 5B2JC 1Z2CB 5B0ZC 4WU8C 4CSRB 4J8UD 1M19A 3AZFA 3H0MC 2HUEB 4XUJC 3LELB 3W98C 3MGRB 3B0CT 5AVCA 1M18B 3AV2A 3MGPD 3KXBB 3B6FA 2NQBD 1P34C 3W97A 5B0ZA 3X1TC 1M19B 3C1CB 4J8XC 2Y2HA 5GXQB 4ZUXA 1HTAA 2HIOA 5GT3D 3C1BB 3W99C 5CPID 4JJNB 5B1LA 3EPHA 5AVBB 3LZ0D 4Z66D 1WWIA 4JJNC 4LD9D 1EQZC 2AROD 3C1BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX B;  5CPJ C;  3MGS B;  3V9R B;  1F66 A;  5GT3 B;  3C1C C;  3B0D C;  1JFI A;  5B1L C;  3AYW C;  4G91 C;  3W97 D;  3MVD C;  2YFW B;  5CP6 B;  4J8V A;  4H9P B;  3AZI D;  3AV2 B;  3MGR C;  1P3F C;  3WTP A;  3KSY A;  5E5A D;  5AY8 C;  3MGS A;  3O62 B;  1P3K C;  5AV5 D;  3C1C A;  3W96 A;  4H9S C;  1KX5 C;  3AYW A;  3X1U A;  3WKJ B;  3AZE D;  4WU9 C;  2BYM B;  3REI B;  1S32 D;  1P3L B;  1M1A B;  3X1S A;  2FJ7 A;  3W96 B;  3AZH D;  3W96 C;  3AZM D;  5B2I A;  5BT1 C;  1M1A C;  3V9R A;  4KGC C;  3VH6 A;  3REI C;  3KUY D;  3R45 B;  3A6N B;  3X1V B;  1U35 A;  1S32 B;  1P3L A;  2BYK A;  2F8N K;  4XZQ B;  2NZD B;  3WKJ D;  2NQB C;  3REH A;  3REK A;  3X1U D;  4H9R B;  2IO5 B;  1P3P D;  5C3I C;  1B6W A;  1ZLA C;  1ZLA B;  4R8P A;  5AV8 C;  1AOI C;  1BFM A;  1WWS A;  5GT0 B;  5B2I D;  3W99 D;  4J8W A;  3UTA A;  4YM6 C;  1P3A C;  3A6N D;  3X1V D;  3W97 B;  2CV5 D;  4JJN D;  4LD9 C;  2RVQ C;  5F99 A;  3VH5 W;  5DNN B;  5B32 A;  3AZG B;  5CPK D;  1P3P B;  2ARO C;  3C1B D;  5CPK B;  1ZLA A;  1EQZ B;  5CPJ D;  5B31 D;  3MGQ D;  2PYO C;  5AVB C;  4ZBJ C;  3REK D;  5B1M B;  3MNN C;  3W99 B;  3LEL A;  3LZ0 A;  4Z66 B;  1P3A A;  3AV1 C;  1KX3 A;  3WAA C;  3AZK C;  1M19 C;  4X23 B;  4WU8 D;  1HQ3 C;  4H9Q A;  4YS3 D;  1KX4 D;  5AV5 C;  5B40 D;  2F8N H;  3W98 B;  2YFV A;  3LEL C;  3W98 D;  5AV6 A;  2HUE C;  3AZI B;  1P3M C;  1P3F B;  3LJA D;  3AZG A;  4X23 D;  4WNN A;  3AYW B;  1M1A D;  1TZY B;  3REJ A;  3B6G C;  5AV6 C;  3REI D;  3AV2 D;  5JA4 A;  5GSU A;  3LZ0 B;  5B24 B;  1R4V A;  4YS3 A;  1KX4 A;  5B31 B;  2CWE A;  5JRG B;  3TU4 C;  5B33 C;  1KU5 A;  4ZUX D;  3AN2 D;  3REJ C;  4KUD D;  5DNN C;  1P34 A;  1U35 B;  5B0Y D;  4EO5 B;  4J8V C;  4J8X B;  3W97 C;  3MGR A;  3WA9 C;  2HIO C;  4H9S A;  5BNX A;  3X1S B;  1KX5 A;  2FJ7 B;  1JFI B;  3AZJ D;  3LZ1 B;  4DRB A;  1TZY A;  5B0Y B;  3NQU A;  1TAF B;  4NE5 A;  5JA4 B;  4YS3 B;  1N1J B;  1KX4 B;  1B67 A;  5B32 G;  4KGC A;  2F8N A;  3WAA D;  3AZM C;  3W96 D;  5BNV A;  3NQU B;  3WTP C;  3KXB D;  4QLC D;  5B1M D;  1P3L C;  1M18 D;  1KX3 D;  4J8W B;  3WKJ C;  5B2J D;  4G92 B;  4J8U B;  5KDM B;  3AZL C;  1KX5 B;  3LJA C;  4UUZ B;  5AV8 A;  1F1E A;  4Z5T C;  3AZN C;  1AOI A;  5E5A B;  4WZS B;  3LZ1 C;  4E45 A;  3REH D;  4WV4 B;  3X1S C;  2FJ7 C;  1F66 D;  5BO0 B;  5DNM D;  5CP6 C;  4CAY B;  1BH8 A;  4AWL C;  2ARO A;  3AZL A;  3VH6 W;  2RVQ D;  5GSU D;  1U35 C;  5E5A A;  1BH9 B;  3REL C;  4XZQ D;  2NZD D;  3REJ B;  3UTB B;  3REJ D;  5BO0 A;  5JRG C;  5AVB D;  3LZ0 C;  3TU4 B;  3REK C;  3UTA B;  4H9N B;  4CAY A;  5AV6 B;  5B31 A;  5B24 C;  3WA9 D;  5CPK A;  1HQ3 A;  4J8U A;  1BH9 A;  1M19 D;  5AV5 A;  3C1C D;  3MGQ A;  5B40 C;  4YM6 A;  3AZH A;  1P3M B;  3KWQ D;  5BS7 A;  3LEL D;  3MGR D;  4WU8 A;  5AY8 D;  4J8U C;  5AV5 B;  3O62 D;  4H9O B;  4X23 C;  5B40 A;  1P3O C;  3AV1 A;  3AZK B;  1P3I B;  3AZE C;  4WU9 D;  2F8N D;  3WAA A;  3B6F B;  1ID3 B;  1P3B D;  4J8X A;  5B1M C;  3X1T D;  3AZM B;  3AFA A;  5B33 A;  4ZBJ B;  3UTA D;  5CPI C;  4LD9 B;  3AZF B;  4JJN A;  4NFT A;  4YM6 B;  5AV9 C;  5GSU B;  1EQZ D;  3AZG C;  4HGA C;  4KHA B;  3MGP C;  3UT9 B;  3AFA C;  1P34 D;  1N1J A;  5KDM A;  1F66 B;  4DRA A;  4UUZ A;  5AV8 B;  1AOI B;  3AZJ C;  4KUD A;  5AV8 D;  3X1T A;  1AOI D;  3MGP B;  4J8V B;  2IO5 C;  5JRG D;  3UT9 D;  1ID3 A;  3X1V C;  3A6N C;  1P3G B;  3AZM A;  5DNN A;  2LY8 A;  1EQZ A;  2PYO D;  5GT3 A;  2JSS A;  3MNN D;  5B1L D;  1ID3 C;  3MVD D;  4H9P A;  1M1A A;  1P3I C;  1A7W A;  1P3F D;  2F8N B;  4KGC D;  1TZY C;  4WU9 B;  1HQ3 D;  5G49 A;  1P3K D;  3O62 C;  1P3K B;  3LZ1 A;  3KUY C;  4Z5T D;  3AZN D;  4XUJ D;  2YFV B;  3NQJ A;  4Z2M H;  3REH C;  1M18 A;  3AZI A;  3X1U C;  1P3B C;  1P3G A;  4WU9 A;  1H3O A;  4WNN B;  3REL A;  4J8X D;  1HQ3 B;  3AV1 B;  3NQJ B;  5B2I C;  3MGQ B;  3WAA B;  1ULY A;  1P3A D;  4Z66 C;  5DNM A;  5B24 A;  3MNN B;  4XZQ A;  2ARO B;  3UTB C;  4E44 A;  5CPK C;  2NZD A;  3REL B;  3AFA D;  4H9R A;  3MGQ C;  2NQB A;  1P3P C;  3VH6 T;  2F8N G;  1P34 B;  1P3G D;  5GXQ C;  4H9N A;  3AZK A;  4Z66 A;  1P3A B;  5FUG B;  1P3B B;  5GT0 C;  2HIO D;  5E5A C;  4Z5T B;  3AZN B;  4X23 A;  5BNX B;  3AZL B;  2NQB B;  3AFA B;  1P3P A;  4G92 C;  4KUD B;  4HGA B;  1P3O D;  1P3M A;  5B2J A;  4R8P D;  3KWQ A;  5AV9 B;  4WU8 B;  5B1M A;  3AZF C;  4J8W D;  1S32 C;  1ID3 D;  1KX3 B;  3AV1 D;  3MNN A;  5AVC C;  2CV5 A;  4H9O A;  5F99 D;  5B32 D;  3AZH C;  3B6G D;  5AV9 A;  4YS3 C;  1KX4 C;  5B31 G;  3MGP A;  1S32 A;  1P3O B;  5FUG A;  2CV5 B;  1P3M D;  3TU4 D;  5CHL B;  5B33 D;  3AZJ A;  4KUD C;  3B0C W;  3WA9 A;  3LZ1 D;  2HIO B;  5AY8 B;  3X1S D;  2FJ7 D;  4XUJ A;  3MVD B;  1F66 C;  5B1L B;  5AV6 D;  3AV2 C;  4EO5 C;  3B0D B;  4YM6 D;  4G91 B;  1H3O B;  5GSU C;  1U35 D;  5B33 B;  5GT3 C;  5AY8 A;  3MGS C;  4ZUX C;  3AN2 C;  5CPJ B;  1TAF A;  3KXB A;  3TU4 A;  3W99 A;  5DNM B;  2YFW A;  3B6G B;  1P3I D;  4NE6 A;  5B2I B;  5GT0 D;  3AZK D;  4AWL B;  3C1B A;  3O62 A;  5CPJ A;  4H9Q B;  3AN2 A;  3WTP D;  3AYW D;  3KXB C;  1Q9C A;  3R45 A;  3A6N A;  3X1V A;  3X1T B;  1M18 C;  3AZI C;  3X1U B;  4XUJ B;  3MVD A;  3B6F D;  4Z2M G;  1P3B A;  2BYM A;  3AZF D;  3REH B;  5B0Z D;  1P3F A;  4Z5T A;  3AZN A;  5B0Z B;  3AZL D;  3KUY B;  5AVC D;  1P3K A;  5B40 B;  4NE3 A;  5B2J B;  5BNV B;  5CP6 A;  1P3I A;  5DNM C;  2L5A A;  3WTP B;  4QLC C;  1P3L D;  2PYO B;  5B32 B;  5F99 B;  3KUY A;  3UTB D;  5BT1 D;  3REK B;  3UTA C;  3REL D;  5JRG A;  5G49 B;  3AN2 B;  3WKJ A;  4LD9 A;  5AV9 D;  5DNN D;  3REI A;  4R8P B;  1P3G C;  5GXQ D;  5B0Y C;  3LJA A;  4QLC A;  4J8V D;  3AZG D;  3KWQ B;  5B24 D;  3VH5 T;  2PYO A;  4KHA A;  3UT9 A;  3VH5 A;  4M6B A;  5CP6 D;  1BH8 B;  5C3I B;  3AZJ B;  5BS7 C;  1ZLA D;  3WA9 B;  3KWQ C;  3LJA B;  5B0Y A;  3MGS D;  4XZQ C;  4R8P C;  3UTB A;  2BYK B;  2NZD C;  3UT9 C;  4J8W C;  2CV5 C;  1P3O A;  3B0B A;  3WTP E;  1KX5 D;  4KGC B;  3AZE A;  5GXQ A;  5B32 C;  5F99 C;  5CPI B;  5B31 C;  4CSR A;  5GT0 A;  5AVB A;  3AZH B;  3W98 A;  4QLC B;  5AVC B;  3B6G A;  3B6F C;  1KX3 C;  3AZE B;  5CPI A;  1TZY D;  5B2J C;  5B0Z C;  4WU8 C;  4CSR B;  4J8U D;  1M19 A;  3AZF A;  2HUE B;  4XUJ C;  3LEL B;  3W98 C;  3MGR B;  3B0C T;  5AVC A;  1M18 B;  3AV2 A;  3MGP D;  3KXB B;  3B6F A;  2NQB D;  1P34 C;  3W97 A;  5B0Z A;  3X1T C;  1M19 B;  3C1C B;  4J8X C;  5GXQ B;  4ZUX A;  1HTA A;  2HIO A;  5GT3 D;  3C1B B;  3W99 C;  5CPI D;  4JJN B;  5B1L A;  5AVB B;  3LZ0 D;  4Z66 D;  1WWI A;  4JJN C;  4LD9 D;  1EQZ C;  2ARO D;  3C1B C; 
#chains in the Genus database with same CATH topology
 4ZUX B;  5CPJ C;  3MGS B;  3V9R B;  1F66 A;  5GT3 B;  3C1C C;  3B0D C;  1JFI A;  2XD5 A;  5B1L C;  3AYW C;  4G91 C;  3W97 D;  3MVD C;  2YFW B;  5CP6 B;  4J8V A;  4H9P B;  3AZI D;  3AV2 B;  3MGR C;  1P3F C;  3WTP A;  3KSY A;  5E5A D;  5AY8 C;  3MGS A;  3O62 B;  1P3K C;  5AV5 D;  3C1C A;  3W96 A;  4H9S C;  1KX5 C;  3AYW A;  3X1U A;  3WKJ B;  3AZE D;  4WU9 C;  1T3U A;  2BYM B;  3REI B;  1S32 D;  1P3L B;  3EPL A;  1M1A B;  3X1S A;  2FJ7 A;  3W96 B;  3AZH D;  3W96 C;  3AZM D;  5B2I A;  5BT1 C;  1M1A C;  3V9R A;  4KGC C;  4DQY B;  3H0R C;  3VH6 A;  3REI C;  3KUY D;  3R45 B;  3A1K A;  3A6N B;  3X1V B;  1U35 A;  1S32 B;  1P3L A;  2BYK A;  2F8N K;  4XZQ B;  2NZD B;  3WKJ D;  2NQB C;  2ZY2 A;  3REH A;  3REK A;  3X1U D;  4H9R B;  2IO5 B;  1P3P D;  5C3I C;  1B6W A;  3IP4 C;  1ZLA C;  1ZLA B;  4R8P A;  5AV8 C;  1AOI C;  1BFM A;  1WWS A;  5GT0 B;  5B2I D;  3W99 D;  4J8W A;  3UTA A;  4YM6 C;  1P3A C;  3A6N D;  3X1V D;  3W97 B;  2CV5 D;  4JJN D;  4LD9 C;  2RVQ C;  5F99 A;  3VH5 W;  5DNN B;  5B32 A;  3AZG B;  5CPK D;  1P3P B;  2ARO C;  3C1B D;  5CPK B;  1ZLA A;  1EQZ B;  5CPJ D;  5B31 D;  3MGQ D;  2PYO C;  5AVB C;  4ZBJ C;  3REK D;  5B1M B;  3MNN C;  3W99 B;  3LEL A;  3LZ0 A;  4Z66 B;  1P3A A;  3AV1 C;  1KX3 A;  3WAA C;  3AZK C;  1M19 C;  4X23 B;  4WU8 D;  1HQ3 C;  4H9Q A;  1W2E A;  4YS3 D;  1KX4 D;  5AV5 C;  2BG1 A;  5B40 D;  2Y2J A;  2F8N H;  3W98 B;  2YFV A;  3LEL C;  3W98 D;  5AV6 A;  2HUE C;  3AZI B;  2Y2O A;  1P3M C;  1P3F B;  3LJA D;  3AZG A;  4X23 D;  4WNN A;  3A1I A;  3FDD A;  3AYW B;  1M1A D;  1TZY B;  3REJ A;  3B6G C;  5AV6 C;  3REI D;  3AV2 D;  5JA4 A;  5GSU A;  3LZ0 B;  5B24 B;  1R4V A;  4YS3 A;  2JCH A;  5B31 B;  1KX4 A;  2CWE A;  5JRG B;  3TU4 C;  5B33 C;  1KU5 A;  4ZUX D;  3AN2 D;  3REJ C;  4KUD D;  5DNN C;  1P34 A;  1U35 B;  5B0Y D;  4EO5 B;  4J8V C;  4J8X B;  3W97 C;  3MGR A;  3WA9 C;  2HIO C;  4H9S A;  5BNX A;  3X1S B;  1KX5 A;  2FJ7 B;  1JFI B;  3AZJ D;  3LZ1 B;  4WJ3 C;  2Y2Q A;  4DRB A;  1TZY A;  5B0Y B;  3NQU A;  1TAF B;  4NE5 A;  5JA4 B;  4YS3 B;  1N1J B;  1KX4 B;  2DF4 C;  1B67 A;  5B32 G;  4KGC A;  2F8N A;  3WAA D;  3AZM C;  3W96 D;  5BNV A;  3NQU B;  3WTP C;  3KXB D;  4QLC D;  5B1M D;  1P3L C;  1M18 D;  1KX3 D;  4J8W B;  3WKJ C;  5B2J D;  4G92 B;  4J8U B;  5KDM B;  3AZL C;  1KX5 B;  3LJA C;  4UUZ B;  5AV8 A;  1F1E A;  4Z5T C;  3AZN C;  1AOI A;  5E5A B;  4WZS B;  3LZ1 C;  4E45 A;  3REH D;  4WV4 B;  3X1S C;  2FJ7 C;  1F66 D;  5BO0 B;  5DNM D;  5CP6 C;  4CAY B;  1BH8 A;  4AWL C;  2ARO A;  3AZL A;  3VH6 W;  2RVQ D;  5GSU D;  1U35 C;  5E5A A;  1BH9 B;  3REL C;  4XZQ D;  2NZD D;  3REJ B;  3UTB B;  3REJ D;  5BO0 A;  5JRG C;  5AVB D;  3LZ0 C;  3TU4 B;  3REK C;  3UTA B;  4H9N B;  4CAY A;  5AV6 B;  5B31 A;  2FFF B;  5B24 C;  3WA9 D;  5CPK A;  1HQ3 A;  4J8U A;  1BH9 A;  1M19 D;  5AV5 A;  3C1C D;  3MGQ A;  2Y2G A;  5B40 C;  4YM6 A;  3AL0 C;  3AZH A;  1P3M B;  3KWQ D;  5BS7 A;  3LEL D;  3MGR D;  4WU8 A;  5AY8 D;  4J8U C;  5AV5 B;  3O62 D;  4H9O B;  4X23 C;  5B40 A;  1P3O C;  3AV1 A;  3AZK B;  1P3I B;  3AZE C;  4WU9 D;  2F8N D;  3WAA A;  3B6F B;  1ID3 B;  1P3B D;  4J8X A;  5B1M C;  3X1T D;  3AZM B;  3AFA A;  5B33 A;  4ZBJ B;  3UTA D;  2ZY4 A;  5CPI C;  4LD9 B;  3AZF B;  4JJN A;  4NFT A;  4YM6 B;  5AV9 C;  5GSU B;  2ZM5 A;  3AZG C;  1EQZ D;  4HGA C;  3KFU G;  4KHA B;  3MGP C;  3UT9 B;  2G5I C;  3AFA C;  1P34 D;  1N1J A;  5KDM A;  1F66 B;  4DRA A;  2VQR A;  4UUZ A;  5AV8 B;  1AOI B;  3AZJ C;  4KUD A;  5AV8 D;  3X1T A;  1AOI D;  3MGP B;  4J8V B;  2JE5 A;  2DQN C;  2IO5 C;  5JRG D;  3UT9 D;  1ID3 A;  3X1V C;  3A6N C;  1P3G B;  3AZM A;  5DNN A;  2LY8 A;  3EG5 B;  1EQZ A;  2PYO D;  5GT3 A;  2JSS A;  3MNN D;  5B1L D;  1ID3 C;  3MVD D;  4H9P A;  1M1A A;  1P3I C;  1A7W A;  1P3F D;  3F6T A;  2F8N B;  4KGC D;  1TZY C;  4WU9 B;  1HQ3 D;  5G49 A;  1P3K D;  2Y2K A;  3O62 C;  1P3K B;  3LZ1 A;  3KUY C;  4Z5T D;  3AZN D;  4XUJ D;  2YFV B;  3NQJ A;  4Z2M H;  3REH C;  1M18 A;  3AZI A;  3X1U C;  1P3B C;  1PZR A;  1P3G A;  4WU9 A;  1H3O A;  2G5H C;  4WNN B;  3REL A;  4J8X D;  1HQ3 B;  4UPK A;  3AV1 B;  2W8S A;  3NQJ B;  5B2I C;  3MGQ B;  3WAA B;  3H0L C;  1ULY A;  1P3A D;  4Z66 C;  5DNM A;  5B24 A;  3MNN B;  4XZQ A;  2ARO B;  3UTB C;  4E44 A;  5CPK C;  2NZD A;  2F2A C;  2Y2M A;  3REL B;  3AFA D;  4H9R A;  3MGQ C;  2NQB A;  1P3P C;  3VH6 T;  2F8N G;  1P34 B;  1P3G D;  5GXQ C;  4H9N A;  3AZK A;  4Z66 A;  1P3A B;  5FUG B;  1P3B B;  5GT0 C;  2HIO D;  5E5A C;  4Z5T B;  3AZN B;  4X23 A;  5BNX B;  3AZL B;  2NQB B;  3AFA B;  1P3P A;  4G92 C;  4KUD B;  4HGA B;  1P3O D;  1P3M A;  5B2J A;  4R8P D;  3KWQ A;  5AV9 B;  4WU8 B;  5B1M A;  3AZF C;  4J8W D;  1S32 C;  1ID3 D;  3EPK A;  1KX3 B;  3AV1 D;  3MNN A;  5AVC C;  2CV5 A;  4H9O A;  5F99 D;  5B32 D;  3AZH C;  3B6G D;  5AV9 A;  4YS3 C;  1KX4 C;  2Y2P A;  5B31 G;  3MGP A;  1S32 A;  1P3O B;  5FUG A;  2CV5 B;  1P3M D;  3TU4 D;  5CHL B;  5B33 D;  2Y2L A;  2XD1 A;  2RIQ A;  3AZJ A;  4KUD C;  3B0C W;  3WA9 A;  3LZ1 D;  2HIO B;  5AY8 B;  3X1S D;  2FJ7 D;  4XUJ A;  3MVD B;  1F66 C;  5B1L B;  5AV6 D;  3AV2 C;  4EO5 C;  3B0D B;  4YM6 D;  4G91 B;  1H3O B;  5GSU C;  1U35 D;  5B33 B;  5GT3 C;  5AY8 A;  3MGS C;  4ZUX C;  3AN2 C;  5CPJ B;  1TAF A;  3KXB A;  3TU4 A;  3W99 A;  5DNM B;  2YFW A;  3B6G B;  1P3I D;  2Y2I A;  4NE6 A;  5B2I B;  5GT0 D;  3AZK D;  4AWL B;  3C1B A;  3O62 A;  5CPJ A;  4H9Q B;  3AN2 A;  3WTP D;  3AYW D;  3KXB C;  1Q9C A;  3R45 A;  3A6N A;  3X1V A;  3X1T B;  1M18 C;  3AZI C;  2ZY5 A;  3X1U B;  4XUJ B;  3MVD A;  3B6F D;  4Z2M G;  1P3B A;  2BYM A;  3AZF D;  3REH B;  5B0Z D;  1P3F A;  4Z5T A;  3AZN A;  5B0Z B;  3AZL D;  3KUY B;  5AVC D;  1P3K A;  5B40 B;  4NE3 A;  5B2J B;  5BNV B;  5CP6 A;  1P3I A;  2J8P A;  2L5A A;  3WTP B;  5DNM C;  4QLC C;  1P3L D;  2PYO B;  5B32 B;  5F99 B;  3KUY A;  3UTB D;  5BT1 D;  3REK B;  3UTA C;  3REL D;  5JRG A;  5G49 B;  3AN2 B;  3WKJ A;  4LD9 A;  5AV9 D;  2UWX A;  5DNN D;  3REI A;  4R8P B;  1P3G C;  5GXQ D;  5B0Y C;  3LJA A;  4QLC A;  4J8V D;  3AZG D;  3KWQ B;  5B24 D;  3VH5 T;  2PYO A;  4KHA A;  3UT9 A;  3VH5 A;  4M6B A;  5CP6 D;  2ZY3 A;  1BH8 B;  5C3I B;  3AZJ B;  3P5J B;  5BS7 C;  1ZLA D;  3WA9 B;  3KWQ C;  3LJA B;  5B0Y A;  3MGS D;  4XZQ C;  4R8P C;  3UTB A;  2BYK B;  2NZD C;  2Y2N A;  3UT9 C;  4J8W C;  2CV5 C;  1P3O A;  3B0B A;  3WTP E;  1KX5 D;  4KGC B;  3AZE A;  5GXQ A;  5B32 C;  5F99 C;  5CPI B;  5B31 C;  3EPJ A;  4CSR A;  5GT0 A;  5AVB A;  3AZH B;  3W98 A;  4QLC B;  5AVC B;  3B6G A;  3B6F C;  1KX3 C;  3AZE B;  5CPI A;  1TZY D;  5B2J C;  1Z2C B;  5B0Z C;  4WU8 C;  4CSR B;  4J8U D;  1M19 A;  3AZF A;  3H0M C;  2HUE B;  4XUJ C;  3LEL B;  3W98 C;  3MGR B;  3B0C T;  5AVC A;  1M18 B;  3AV2 A;  3MGP D;  3KXB B;  3B6F A;  2NQB D;  1P34 C;  3W97 A;  5B0Z A;  3X1T C;  1M19 B;  3C1C B;  4J8X C;  2Y2H A;  5GXQ B;  4ZUX A;  1HTA A;  2HIO A;  5GT3 D;  3C1B B;  3W99 C;  5CPI D;  4JJN B;  5B1L A;  3EPH A;  5AVB B;  3LZ0 D;  4Z66 D;  1WWI A;  4JJN C;  4LD9 D;  1EQZ C;  2ARO D;  3C1B C; 
#chains in the Genus database with same CATH homology
 4ZUX B;  5CPJ C;  3MGS B;  3V9R B;  1F66 A;  5GT3 B;  3C1C C;  3B0D C;  1JFI A;  2XD5 A;  5B1L C;  3AYW C;  4G91 C;  3W97 D;  3MVD C;  2YFW B;  5CP6 B;  4J8V A;  4H9P B;  3AZI D;  3AV2 B;  3MGR C;  1P3F C;  3WTP A;  3KSY A;  5E5A D;  5AY8 C;  3MGS A;  3O62 B;  1P3K C;  5AV5 D;  3C1C A;  3W96 A;  4H9S C;  1KX5 C;  3AYW A;  3X1U A;  3WKJ B;  3AZE D;  4WU9 C;  1T3U A;  2BYM B;  3REI B;  1S32 D;  1P3L B;  3EPL A;  1M1A B;  3X1S A;  2FJ7 A;  3W96 B;  3AZH D;  3W96 C;  3AZM D;  5B2I A;  5BT1 C;  1M1A C;  3V9R A;  4KGC C;  4DQY B;  3H0R C;  3VH6 A;  3REI C;  3KUY D;  3R45 B;  3A1K A;  3A6N B;  3X1V B;  1U35 A;  1S32 B;  1P3L A;  2BYK A;  2F8N K;  4XZQ B;  2NZD B;  3WKJ D;  2NQB C;  2ZY2 A;  3REH A;  3REK A;  3X1U D;  4H9R B;  2IO5 B;  1P3P D;  5C3I C;  1B6W A;  3IP4 C;  1ZLA C;  1ZLA B;  4R8P A;  5AV8 C;  1AOI C;  1BFM A;  1WWS A;  5GT0 B;  5B2I D;  3W99 D;  4J8W A;  3UTA A;  4YM6 C;  1P3A C;  3A6N D;  3X1V D;  3W97 B;  2CV5 D;  4JJN D;  4LD9 C;  2RVQ C;  5F99 A;  3VH5 W;  5DNN B;  5B32 A;  3AZG B;  5CPK D;  1P3P B;  2ARO C;  3C1B D;  5CPK B;  1ZLA A;  1EQZ B;  5CPJ D;  5B31 D;  3MGQ D;  2PYO C;  5AVB C;  4ZBJ C;  3REK D;  5B1M B;  3MNN C;  3W99 B;  3LEL A;  3LZ0 A;  4Z66 B;  1P3A A;  3AV1 C;  1KX3 A;  3WAA C;  3AZK C;  1M19 C;  4X23 B;  4WU8 D;  1HQ3 C;  4H9Q A;  1W2E A;  4YS3 D;  1KX4 D;  5AV5 C;  2BG1 A;  5B40 D;  2Y2J A;  2F8N H;  3W98 B;  2YFV A;  3LEL C;  3W98 D;  5AV6 A;  2HUE C;  3AZI B;  2Y2O A;  1P3M C;  1P3F B;  3LJA D;  3AZG A;  4X23 D;  4WNN A;  3A1I A;  3FDD A;  3AYW B;  1M1A D;  1TZY B;  3REJ A;  3B6G C;  5AV6 C;  3REI D;  3AV2 D;  5JA4 A;  5GSU A;  3LZ0 B;  5B24 B;  1R4V A;  4YS3 A;  2JCH A;  5B31 B;  1KX4 A;  2CWE A;  5JRG B;  3TU4 C;  5B33 C;  1KU5 A;  4ZUX D;  3AN2 D;  3REJ C;  4KUD D;  5DNN C;  1P34 A;  1U35 B;  5B0Y D;  4EO5 B;  4J8V C;  4J8X B;  3W97 C;  3MGR A;  3WA9 C;  2HIO C;  4H9S A;  5BNX A;  3X1S B;  1KX5 A;  2FJ7 B;  1JFI B;  3AZJ D;  3LZ1 B;  4WJ3 C;  2Y2Q A;  4DRB A;  1TZY A;  5B0Y B;  3NQU A;  1TAF B;  4NE5 A;  5JA4 B;  4YS3 B;  1N1J B;  1KX4 B;  2DF4 C;  1B67 A;  5B32 G;  4KGC A;  2F8N A;  3WAA D;  3AZM C;  3W96 D;  5BNV A;  3NQU B;  3WTP C;  3KXB D;  4QLC D;  5B1M D;  1P3L C;  1M18 D;  1KX3 D;  4J8W B;  3WKJ C;  5B2J D;  4G92 B;  4J8U B;  5KDM B;  3AZL C;  1KX5 B;  3LJA C;  4UUZ B;  5AV8 A;  1F1E A;  4Z5T C;  3AZN C;  1AOI A;  5E5A B;  4WZS B;  3LZ1 C;  4E45 A;  3REH D;  4WV4 B;  3X1S C;  2FJ7 C;  1F66 D;  5BO0 B;  5DNM D;  5CP6 C;  4CAY B;  1BH8 A;  4AWL C;  2ARO A;  3AZL A;  3VH6 W;  2RVQ D;  5GSU D;  1U35 C;  5E5A A;  1BH9 B;  3REL C;  4XZQ D;  2NZD D;  3REJ B;  3UTB B;  3REJ D;  5BO0 A;  5JRG C;  5AVB D;  3LZ0 C;  3TU4 B;  3REK C;  3UTA B;  4H9N B;  4CAY A;  5AV6 B;  5B31 A;  2FFF B;  5B24 C;  3WA9 D;  5CPK A;  1HQ3 A;  4J8U A;  1BH9 A;  1M19 D;  5AV5 A;  3C1C D;  3MGQ A;  2Y2G A;  5B40 C;  4YM6 A;  3AL0 C;  3AZH A;  1P3M B;  3KWQ D;  5BS7 A;  3LEL D;  3MGR D;  4WU8 A;  5AY8 D;  4J8U C;  5AV5 B;  3O62 D;  4H9O B;  4X23 C;  5B40 A;  1P3O C;  3AV1 A;  3AZK B;  1P3I B;  3AZE C;  4WU9 D;  2F8N D;  3WAA A;  3B6F B;  1ID3 B;  1P3B D;  4J8X A;  5B1M C;  3X1T D;  3AZM B;  3AFA A;  5B33 A;  4ZBJ B;  3UTA D;  2ZY4 A;  5CPI C;  4LD9 B;  3AZF B;  4JJN A;  4NFT A;  4YM6 B;  5AV9 C;  5GSU B;  2ZM5 A;  3AZG C;  1EQZ D;  4HGA C;  3KFU G;  4KHA B;  3MGP C;  3UT9 B;  2G5I C;  3AFA C;  1P34 D;  1N1J A;  5KDM A;  1F66 B;  4DRA A;  2VQR A;  4UUZ A;  5AV8 B;  1AOI B;  3AZJ C;  4KUD A;  5AV8 D;  3X1T A;  1AOI D;  3MGP B;  4J8V B;  2JE5 A;  2DQN C;  2IO5 C;  5JRG D;  3UT9 D;  1ID3 A;  3X1V C;  3A6N C;  1P3G B;  3AZM A;  5DNN A;  2LY8 A;  3EG5 B;  1EQZ A;  2PYO D;  5GT3 A;  2JSS A;  3MNN D;  5B1L D;  1ID3 C;  3MVD D;  4H9P A;  1M1A A;  1P3I C;  1A7W A;  1P3F D;  3F6T A;  2F8N B;  4KGC D;  1TZY C;  4WU9 B;  1HQ3 D;  5G49 A;  1P3K D;  2Y2K A;  3O62 C;  1P3K B;  3LZ1 A;  3KUY C;  4Z5T D;  3AZN D;  4XUJ D;  2YFV B;  3NQJ A;  4Z2M H;  3REH C;  1M18 A;  3AZI A;  3X1U C;  1P3B C;  1PZR A;  1P3G A;  4WU9 A;  1H3O A;  2G5H C;  4WNN B;  3REL A;  4J8X D;  1HQ3 B;  4UPK A;  3AV1 B;  2W8S A;  3NQJ B;  5B2I C;  3MGQ B;  3WAA B;  3H0L C;  1ULY A;  1P3A D;  4Z66 C;  5DNM A;  5B24 A;  3MNN B;  4XZQ A;  2ARO B;  3UTB C;  4E44 A;  5CPK C;  2NZD A;  2F2A C;  2Y2M A;  3REL B;  3AFA D;  4H9R A;  3MGQ C;  2NQB A;  1P3P C;  3VH6 T;  2F8N G;  1P34 B;  1P3G D;  5GXQ C;  4H9N A;  3AZK A;  4Z66 A;  1P3A B;  5FUG B;  1P3B B;  5GT0 C;  2HIO D;  5E5A C;  4Z5T B;  3AZN B;  4X23 A;  5BNX B;  3AZL B;  2NQB B;  3AFA B;  1P3P A;  4G92 C;  4KUD B;  4HGA B;  1P3O D;  1P3M A;  5B2J A;  4R8P D;  3KWQ A;  5AV9 B;  4WU8 B;  5B1M A;  3AZF C;  4J8W D;  1S32 C;  1ID3 D;  3EPK A;  1KX3 B;  3AV1 D;  3MNN A;  5AVC C;  2CV5 A;  4H9O A;  5F99 D;  5B32 D;  3AZH C;  3B6G D;  5AV9 A;  4YS3 C;  1KX4 C;  2Y2P A;  5B31 G;  3MGP A;  1S32 A;  1P3O B;  5FUG A;  2CV5 B;  1P3M D;  3TU4 D;  5CHL B;  5B33 D;  2Y2L A;  2XD1 A;  2RIQ A;  3AZJ A;  4KUD C;  3B0C W;  3WA9 A;  3LZ1 D;  2HIO B;  5AY8 B;  3X1S D;  2FJ7 D;  4XUJ A;  3MVD B;  1F66 C;  5B1L B;  5AV6 D;  3AV2 C;  4EO5 C;  3B0D B;  4YM6 D;  4G91 B;  1H3O B;  5GSU C;  1U35 D;  5B33 B;  5GT3 C;  5AY8 A;  3MGS C;  4ZUX C;  3AN2 C;  5CPJ B;  1TAF A;  3KXB A;  3TU4 A;  3W99 A;  5DNM B;  2YFW A;  3B6G B;  1P3I D;  2Y2I A;  4NE6 A;  5B2I B;  5GT0 D;  3AZK D;  4AWL B;  3C1B A;  3O62 A;  5CPJ A;  4H9Q B;  3AN2 A;  3WTP D;  3AYW D;  3KXB C;  1Q9C A;  3R45 A;  3A6N A;  3X1V A;  3X1T B;  1M18 C;  3AZI C;  2ZY5 A;  3X1U B;  4XUJ B;  3MVD A;  3B6F D;  4Z2M G;  1P3B A;  2BYM A;  3AZF D;  3REH B;  5B0Z D;  1P3F A;  4Z5T A;  3AZN A;  5B0Z B;  3AZL D;  3KUY B;  5AVC D;  1P3K A;  5B40 B;  4NE3 A;  5B2J B;  5BNV B;  5CP6 A;  1P3I A;  2J8P A;  2L5A A;  3WTP B;  5DNM C;  4QLC C;  1P3L D;  2PYO B;  5B32 B;  5F99 B;  3KUY A;  3UTB D;  5BT1 D;  3REK B;  3UTA C;  3REL D;  5JRG A;  5G49 B;  3AN2 B;  3WKJ A;  4LD9 A;  5AV9 D;  2UWX A;  5DNN D;  3REI A;  4R8P B;  1P3G C;  5GXQ D;  5B0Y C;  3LJA A;  4QLC A;  4J8V D;  3AZG D;  3KWQ B;  5B24 D;  3VH5 T;  2PYO A;  4KHA A;  3UT9 A;  3VH5 A;  4M6B A;  5CP6 D;  2ZY3 A;  1BH8 B;  5C3I B;  3AZJ B;  3P5J B;  5BS7 C;  1ZLA D;  3WA9 B;  3KWQ C;  3LJA B;  5B0Y A;  3MGS D;  4XZQ C;  4R8P C;  3UTB A;  2BYK B;  2NZD C;  2Y2N A;  3UT9 C;  4J8W C;  2CV5 C;  1P3O A;  3B0B A;  3WTP E;  1KX5 D;  4KGC B;  3AZE A;  5GXQ A;  5B32 C;  5F99 C;  5CPI B;  5B31 C;  3EPJ A;  4CSR A;  5GT0 A;  5AVB A;  3AZH B;  3W98 A;  4QLC B;  5AVC B;  3B6G A;  3B6F C;  1KX3 C;  3AZE B;  5CPI A;  1TZY D;  5B2J C;  1Z2C B;  5B0Z C;  4WU8 C;  4CSR B;  4J8U D;  1M19 A;  3AZF A;  3H0M C;  2HUE B;  4XUJ C;  3LEL B;  3W98 C;  3MGR B;  3B0C T;  5AVC A;  1M18 B;  3AV2 A;  3MGP D;  3KXB B;  3B6F A;  2NQB D;  1P34 C;  3W97 A;  5B0Z A;  3X1T C;  1M19 B;  3C1C B;  4J8X C;  2Y2H A;  5GXQ B;  4ZUX A;  1HTA A;  2HIO A;  5GT3 D;  3C1B B;  3W99 C;  5CPI D;  4JJN B;  5B1L A;  3EPH A;  5AVB B;  3LZ0 D;  4Z66 D;  1WWI A;  4JJN C;  4LD9 D;  1EQZ C;  2ARO D;  3C1B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...