4R8PC

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pC00
4KGCD 1HQ3B 2L5AA 4KGCB 1P3KC 2RVQD 3B0DB 3AZLA 1P3IB 4LD9A 3W96B 3R45B 4DRAA 5BS7C 5CPKD 4JJND 1KX3A 5F99D 3UT9A 4QLCD 3MNNA 5AV8D 4QLCB 2AROD 3X1TB 4Z66B 1M1AB 1F66C 2F8ND 3B6FC 2RVQC 1P3FA 3AZFC 1P3MC 5B1LB 1P3PA 4AWLB 3AZLD 5CPJC 3AZGA 2FJ7D 4LD9D 5B0YA 5BT1D 3AZMB 2YFVA 2FJ7B 1B67A 5GT0C 3X1SB 5GSUA 1KX5B 1TZYB 3MGRA 3UT9D 5AVCA 4XUJA 3MNND 4J8WA 4J8VA 3AZLC 3VH6A 3KXBA 4Z5TD 1P3FD 1P3BA 2YFWA 5GT3A 5B32D 5AVBA 1P3PD 5B32B 1EQZD 4H9PB 3W98C 1KX3C 4M6BA 3AZGD 1EQZB 4YM6A 3MGPB 5B0YD 3WA9A 3W99A 3REIA 3O62D 1P34A 5B2JA 3MGRD 3AZHC 4G91C 4XUJD 4CSRB 5B40D 5AVCD 1BH9A 1ID3D 1P3AD 1ID3B 5B40B 4YS3B 1TAFB 3LELD 4J8VD 3AYWB 3KWQD 5AV6B 3KXBD 3LELB 3REJB 3AZJC 3KWQB 5GT3D 5AVBD 3X1VA 1M18C 4WU9B 3LZ1B 5GSUC 3AZEB 3C1CA 3AV1C 1P3OC 5AV9A 4J8WC 3LZ0D 5BO0B 3WA9D 3LZ0B 3NQUB 4J8VC 4KUDD 3AZND 3KXBC 1P34D 3WKJD 2NQBD 5JRGC 1P3BC 5B31G 2NQBB 3REHA 2HIOA 1U35A 3W97C 4YM6C 4X23B 3A6NA 3V9RA 5B33B 3X1VD 2IO5C 3W99C 4WU8A 5E5AB 3REIC 1ZLAB 5DNMC 1JFIA 5B2JC 3C1BA 4R8PA 1ULYA 2CV5A 3B0BA 3AFAA 2BYMB 4H9RA 3AZKB 5B2IA 3REHD 1P3GB 1M19C 2HIOD 1U35D 5B0ZA 3C1CC 1P3LA 5B31A 5AV9C 3A6ND 4H9QB 4CAYA 3X1UC 3MGQA 1HQ3A 4WU8D 1KX4A 4KGCA 5AV5D 2NZDD 5AV5B 3RELC 1P3IA 1AOIB 4H9OB 1U35C 5B24D 4ZUXC 3W96A 3KUYC 3R45A 4R8PD 3MVDB 2CV5D 3A6NC 1N1JB 5CP6C 4WNNB 5B2ID 5DNND 3WTPC 4QLCA 4J8XB 1M1AA 3X1TA 4Z66A 5DNNB 2AROA 1P3LD 4NFTA 5B31D 4HGAB 3C1BC 4J8UC 3WAAD 3MGQD 1HQ3D 3LJAD 4G92B 5B1LA 3WAAB 3LJAB 3AFAC 1Q9CA 1P3ID 4DRBA 3AZMA 5AY8C 2FJ7A 3W96D 5B0ZC 3B0CW 3X1SA 1KX5A 1TZYA 1M1AD 3X1TD 4Z66D 1P3KB 1KX4C 2PYOD 3VH5W 4KGCC 4ZBJC 3B0DC 2PYOB 4Z5TA 3AN2B 3W96C 5B1LD 5B32A 4H9PA 5CPKC 1EQZA 4JJNC 5F99C 1F66B 4QLCC 3B6FB 3AZMD 3X1TC 3B0CT 5FUGB 5AV8C 2AROC 3X1SD 1KX5D 1TZYD 3O62A 4CSRA 3AZFB 1P3MB 3VH5T 5B40A 1ID3A 4YS3A 1TAFA 5CPJB 1P3AA 4AWLC 3AYWA 5AV6A 3LELA 5BNXB 3KWQA 2FJ7C 4LD9C 5GT0B 5BT1C 5JA4B 3AZEA 1KX5C 1TZYC 3MGPD 5BO0A 3UT9C 3B6GD 3MNNC 3LZ0A 3NQUA 3AV2B 3B6GB 5CHLB 4KUDA 3AZNA 4Z5TC 1P3FC 2NQBA 3WKJA 5BNVB 3W98B 2BYKB 5B32C 4YS3D 1KX3B 1P3PC 3AYWD 1EQZC 5AV6D 3REJD 5C3IC 3AZGC 4X23A 5B33A 5B0YC 4H9NB 4EO5C 4WU9D 5E5AA 3LZ1D 3AZHB 3AZIB 4G91B 3AZED 1ZLAA 3O62C 3MGRC 5AVCC 4XUJC 4WZSB 5B40C 1ID3C 4NE6A 1P3AC 3AZJB 3LELC 2BYMA 3KWQC 3AZKA 1M18B 5KDMB 4KHAB 1P3GA 3VH5A 5GT3C 5AVBC 4H9SA 3NQJA 4UUZA 3TU4D 3AV1B 1P3OB 3TU4B 1WWIA 4H9QA 4X23D 2JSSA 3LZ0C 5B33D 3WA9C 5E5AD 5JRGB 1ZLAD 4KUDC 3AZNC 1P34C 3WKJC 5AV5A 2NQBC 2HUEC 1AOIA 3W97B 2NZDA 4Z2MG 5B24A 4YM6B 3MVDA 3AZKD 5B1MD 2IO5B 4WNNA 1P3GD 5B1MB 5DNMB 3X1VC 5B2JB 5DNNA 1H3OB 4E44A 4E45A 3WAAA 3LJAA 1M19B 1P3GC 1AOID 1BH8B 4H9SC 3C1CB 3REHC 5AV9B 2HIOC 3MVDD 3X1UB 5CPID 4J8XD 1P3KA 5CPIB 1A7WA 4WU8C 3RELB 2PYOA 5AV5C 3MGSB 3REKD 4ZUXB 3KUYB 5GXQD 2NZDC 3REKB 3AN2A 5BS7A 5GXQB 5B24C 2CWEA 5CP6B 4R8PC 2CV5C 3WTPB 1S32D 3UTAD 1F66A 5B2IC 1S32B 3B6FA 1JFIB 5DNNC 3UTAB 4XZQB 4J8UB 3UTBD 1P3LC 5G49B 5B31C 3UTBB 1P3MA 3WAAC 3MGQC 1F1EA 1P3KD 1HQ3C 5CPJA 3LJAC 5BNXA 5AY8B 5B0ZB 3AN2D 1P3IC 4NE5A 5JA4A 4CAYB 1KX4B 1F66D 3B6FD 4ZBJB 3MGPA 3AV2A 1M1AC 4Z66C 2PYOC 3B6GA 3AZFD 1P3MD 3AN2C 5BNVA 1HTAA 3W98A 2BYKA 5CPKB 5CPJD 5B1LC 4JJNB 3KSYA 5F99B 3REJA 5AV8B 2AROB 2F8NK 2F8NB 1KU5A 5GT0D 3AZMC 4H9NA 3AZIA 3AZHA 4WU9A 3LZ1A 3X1SC 3AV2D 3AZJA 3AZLB 4LD9B 1M18A 4KHAA 5KDMA 3W98D 1KX3D 1R4VA 3AV1A 1P3OA 3TU4A 3UT9B 3MNNB 3MGPC 3AV2C 3B6GC 3AZID 5JRGA 3AZHD 4Z5TB 1P3FB 3W97A 1P3PB 3AZJD 5C3IB 4YS3C 3AZGB 3AYWC 1BFMA 5AV6C 3REJC 1WWSA 5B0YB 1M18D 2YFVB 4EO5B 5B1MA 5GSUD 5DNMA 3AZIC 3AV1D 3O62B 5GSUB 1P3OD 4J8WD 1H3OA 3LZ1C 3MGRB 4WU9C 3AZEC 5AVCB 4XUJB 4J8WB 3WTPE 1P3AB 4J8VB 5JRGD 3KXBB 1P3BD 1P3BB 1M19A 2YFWB 5GT3B 5AVBB 3W97D 1BH8A 4H9OA 3TU4C 4YM6D 3X1UA 3W99D 3WA9B 4X23C 1N1JA 3REID 5DNMD 3W99B 5B33C 5CPIA 5B2JD 3AZNB 4KUDB 3REIB 1P34B 4J8XA 3WKJB 3RELA 5E5AC 1ZLAC 2HUEB 3MGSA 1BH9B 4ZUXA 3KUYA 3REKA 4WV4B 5GXQA 5CP6A 1M19D 3WTPA 3AZKC 5B1MC 3X1VB 1S32A 3C1CD 3UTAA 5AV9D 4XZQA 4J8UA 5G49A 3X1UD 3UTBA 4NE3A 4Z2MH 2F8NG 3RELD 3MGSD 5AY8A 3NQJB 4UUZB 4ZUXD 3KUYD 3REHB 2HIOB 1U35B 1AOIC 5CP6D 3VH6W 3MVDC 3A6NB 3V9RB 3WTPD 4WU8B 5CPIC 4J8XC 4XZQD 5FUGA 3C1BD 4J8UD 3MGSC 2NZDB 3C1BB 4HGAC 3REKC 5B24B 5GXQC 3AZFA 3AFAD 4R8PB 5CPKA 4G92C 2CV5B 4JJNA 3AFAB 5F99A 4H9RB 5B2IB 2F8NH 5AY8D 1S32C 5AV8A 5B0ZD 5B32G 3UTAC 2F8NA 2LY8A 3VH6T 4XZQC 1P3LB 5B31B 5GT0A 1B6WA 3UTBC 1KX4D 3MGQB
chains in the Genus database with same CATH superfamily
4KGCD 1HQ3B 3A1KA 2L5AA 4KGCB 1P3KC 2RVQD 3B0DB 3AZLA 1P3IB 4LD9A 3W96B 3R45B 4DRAA 5BS7C 5CPKD 4JJND 1KX3A 5F99D 3UT9A 4QLCD 3MNNA 5AV8D 4QLCB 2AROD 3X1TB 4Z66B 1M1AB 1F66C 2F8ND 3B6FC 2RVQC 2ZY5A 1P3FA 3AZFC 1P3MC 5B1LB 1P3PA 4WJ3C 4AWLB 3AZLD 5CPJC 3AZGA 3EPKA 2FJ7D 4LD9D 5B0YA 5BT1D 3AZMB 2Y2PA 2YFVA 2FJ7B 1B67A 5GT0C 3X1SB 5GSUA 1KX5B 1TZYB 3MGRA 3UT9D 5AVCA 4XUJA 3MNND 4J8WA 4J8VA 3AZLC 3VH6A 3IP4C 2F2AC 3KXBA 3KFUG 2G5IC 4Z5TD 1P3FD 1P3BA 2YFWA 5GT3A 4UPKA 5B32D 5AVBA 3P5JB 1P3PD 5B32B 1EQZD 4H9PB 3W98C 1KX3C 4M6BA 3AZGD 1EQZB 4YM6A 2J8PA 3MGPB 5B0YD 3WA9A 3W99A 3REIA 3O62D 1P34A 5B2JA 3MGRD 3AZHC 4G91C 4XUJD 4CSRB 5B40D 5AVCD 1BH9A 1ID3D 1P3AD 1ID3B 5B40B 2DF4C 4YS3B 1TAFB 3LELD 4J8VD 3AYWB 3KWQD 5AV6B 3KXBD 3LELB 3REJB 3AZJC 3KWQB 5GT3D 5AVBD 3X1VA 1M18C 4WU9B 3LZ1B 5GSUC 3AZEB 3C1CA 3AV1C 1P3OC 5AV9A 4J8WC 3FDDA 3LZ0D 5BO0B 3WA9D 3H0LC 3NQUB 3LZ0B 4J8VC 4KUDD 3AZND 3KXBC 2Y2JA 1P34D 3WKJD 2NQBD 5JRGC 1P3BC 5B31G 2NQBB 3H0MC 3REHA 2DQNC 2HIOA 1U35A 3W97C 4YM6C 4X23B 3A6NA 3V9RA 5B33B 3X1VD 2IO5C 3W99C 4WU8A 5E5AB 3REIC 1ZLAB 5DNMC 1JFIA 5B2JC 3C1BA 4R8PA 1ULYA 2VQRA 2CV5A 3B0BA 3AFAA 2BYMB 2ZY2A 4H9RA 3AZKB 5B2IA 3REHD 1P3GB 1M19C 2HIOD 1U35D 5B0ZA 3C1CC 1P3LA 5B31A 5AV9C 3A6ND 4H9QB 4CAYA 3X1UC 3MGQA 1HQ3A 4WU8D 1KX4A 4KGCA 5AV5D 2Y2QA 2NZDD 5AV5B 3RELC 1P3IA 1AOIB 4H9OB 1U35C 5B24D 1W2EA 4ZUXC 3W96A 3KUYC 3R45A 4R8PD 3MVDB 2CV5D 3A6NC 1N1JB 5CP6C 2Y2IA 4WNNB 5B2ID 5DNND 3WTPC 4QLCA 4J8XB 1M1AA 3X1TA 4Z66A 5DNNB 2AROA 1P3LD 4NFTA 5B31D 4HGAB 3C1BC 4J8UC 3WAAD 3MGQD 1HQ3D 3LJAD 4G92B 5B1LA 3WAAB 3LJAB 3AFAC 1Q9CA 1P3ID 4DRBA 2XD5A 3AZMA 5AY8C 2FJ7A 3W96D 5B0ZC 3B0CW 3X1SA 1KX5A 1TZYA 1M1AD 3X1TD 4Z66D 1P3KB 3A1IA 1KX4C 3VH5W 2PYOD 4ZBJC 3EPJA 3B0DC 4KGCC 2PYOB 4Z5TA 3AN2B 3W96C 5B1LD 5B32A 2W8SA 4H9PA 3AL0C 5CPKC 1EQZA 4JJNC 5F99C 1F66B 4QLCC 3B6FB 3AZMD 3X1TC 3B0CT 5FUGB 5AV8C 2AROC 3X1SD 1KX5D 1TZYD 3O62A 4CSRA 3AZFB 1P3MB 3VH5T 5B40A 1ID3A 4YS3A 1TAFA 5CPJB 1P3AA 4AWLC 3AYWA 5AV6A 3LELA 5BNXB 3KWQA 2FJ7C 4LD9C 2Y2GA 5GT0B 5BT1C 5JA4B 3AZEA 1KX5C 1TZYC 3MGPD 5BO0A 3UT9C 3B6GD 3MNNC 3LZ0A 3NQUA 3AV2B 3B6GB 5CHLB 4KUDA 3AZNA 2Y2HA 4Z5TC 1P3FC 2NQBA 3WKJA 2UWXA 5BNVB 3W98B 2BYKB 5B32C 4YS3D 1KX3B 1P3PC 3AYWD 1Z2CB 5AV6D 1EQZC 3REJD 5C3IC 3AZGC 4X23A 5B33A 5B0YC 4H9NB 4EO5C 4WU9D 5E5AA 3LZ1D 3AZHB 3AZIB 4G91B 3AZED 1ZLAA 3EPHA 3O62C 3MGRC 5AVCC 4XUJC 4WZSB 5B40C 1ID3C 4NE6A 1P3AC 3AZJB 2XD1A 3LELC 2BYMA 3KWQC 3AZKA 1M18B 5KDMB 4KHAB 2ZM5A 1P3GA 3VH5A 5GT3C 5AVBC 4H9SA 3NQJA 4UUZA 3TU4D 3AV1B 1P3OB 2Y2LA 3TU4B 1WWIA 4H9QA 4X23D 2JSSA 3LZ0C 5B33D 3WA9C 5E5AD 5JRGB 1ZLAD 4KUDC 3AZNC 3F6TA 1P34C 3WKJC 5AV5A 2NQBC 2HUEC 1AOIA 3W97B 2NZDA 4DQYB 3EPLA 4Z2MG 5B24A 4YM6B 3MVDA 2JE5A 3AZKD 5B1MD 2IO5B 4WNNA 1P3GD 5B1MB 5DNMB 3X1VC 5B2JB 5DNNA 1H3OB 4E44A 4E45A 3WAAA 1PZRA 3LJAA 1M19B 1P3GC 1AOID 2Y2MA 1BH8B 4H9SC 3C1CB 3REHC 5AV9B 2HIOC 3MVDD 3X1UB 5CPID 4J8XD 1P3KA 5CPIB 1A7WA 4WU8C 3RELB 2PYOA 5AV5C 2ZY4A 3MGSB 3REKD 4ZUXB 3KUYB 5GXQD 2NZDC 3REKB 3AN2A 5BS7A 5GXQB 5B24C 2CWEA 5CP6B 4R8PC 2CV5C 3WTPB 1S32D 3UTAD 1F66A 5B2IC 1S32B 3B6FA 1JFIB 5DNNC 3UTAB 4XZQB 4J8UB 2ZY3A 3UTBD 1P3LC 5G49B 5B31C 3UTBB 1P3MA 2G5HC 3WAAC 3MGQC 1F1EA 1P3KD 1HQ3C 5CPJA 3LJAC 2FFFB 5BNXA 5AY8B 5B0ZB 3AN2D 1P3IC 4NE5A 2Y2KA 5JA4A 4CAYB 1KX4B 1F66D 3B6FD 4ZBJB 3MGPA 3AV2A 1M1AC 4Z66C 2PYOC 3B6GA 2JCHA 3AZFD 1T3UA 1P3MD 3AN2C 5BNVA 1HTAA 3EG5B 2BYKA 3W98A 5CPKB 5CPJD 5B1LC 4JJNB 3KSYA 5F99B 3REJA 5AV8B 2AROB 2F8NK 2F8NB 1KU5A 5GT0D 3AZMC 4H9NA 3AZIA 3AZHA 4WU9A 3LZ1A 3X1SC 3AV2D 3AZJA 3AZLB 4LD9B 1M18A 4KHAA 5KDMA 3W98D 1KX3D 1R4VA 3AV1A 1P3OA 3TU4A 3UT9B 3MNNB 3MGPC 3AV2C 3B6GC 3AZID 5JRGA 3AZHD 4Z5TB 1P3FB 3W97A 1P3PB 3AZJD 5C3IB 4YS3C 3AZGB 3AYWC 1BFMA 5AV6C 3REJC 1WWSA 5B0YB 1M18D 2YFVB 4EO5B 5B1MA 5GSUD 5DNMA 2BG1A 3AZIC 3AV1D 3O62B 5GSUB 1P3OD 4J8WD 1H3OA 3LZ1C 3MGRB 4WU9C 3AZEC 5AVCB 4XUJB 4J8WB 3WTPE 1P3AB 4J8VB 5JRGD 3KXBB 1P3BD 1P3BB 1M19A 2YFWB 5GT3B 5AVBB 3W97D 1BH8A 4H9OA 3TU4C 2Y2OA 4YM6D 3X1UA 3W99D 3WA9B 2Y2NA 4X23C 1N1JA 3REID 5DNMD 3W99B 5B33C 5CPIA 5B2JD 3AZNB 4KUDB 3REIB 1P34B 4J8XA 3WKJB 3RELA 5E5AC 2RIQA 1ZLAC 2HUEB 3MGSA 1BH9B 4ZUXA 3KUYA 3REKA 4WV4B 5GXQA 5CP6A 1M19D 3WTPA 3AZKC 5B1MC 3X1VB 1S32A 3C1CD 3UTAA 5AV9D 4XZQA 4J8UA 5G49A 3X1UD 3UTBA 4NE3A 4Z2MH 2F8NG 3RELD 3MGSD 5AY8A 3NQJB 4UUZB 4ZUXD 3KUYD 3REHB 2HIOB 1U35B 1AOIC 3H0RC 5CP6D 3VH6W 3MVDC 3A6NB 3V9RB 3WTPD 4WU8B 5CPIC 4J8XC 4XZQD 5FUGA 3C1BD 4J8UD 3MGSC 2NZDB 3C1BB 4HGAC 3REKC 5B24B 5GXQC 3AZFA 3AFAD 4R8PB 5CPKA 4G92C 2CV5B 4JJNA 3AFAB 5F99A 4H9RB 5B2IB 2F8NH 5AY8D 1S32C 5AV8A 5B0ZD 5B32G 3UTAC 2F8NA 2LY8A 3VH6T 4XZQC 1P3LB 5B31B 5GT0A 1B6WA 3UTBC 1KX4D 3MGQB
chains in the Genus database with same CATH topology
4KGCD 1HQ3B 3A1KA 2L5AA 4KGCB 1P3KC 2RVQD 3B0DB 3AZLA 1P3IB 4LD9A 3W96B 3R45B 4DRAA 5BS7C 5CPKD 4JJND 1KX3A 5F99D 3UT9A 4QLCD 3MNNA 5AV8D 4QLCB 2AROD 3X1TB 4Z66B 1M1AB 1F66C 2F8ND 3B6FC 2RVQC 2ZY5A 1P3FA 3AZFC 1P3MC 5B1LB 1P3PA 4WJ3C 4AWLB 3AZLD 5CPJC 3AZGA 3EPKA 2FJ7D 4LD9D 5B0YA 5BT1D 3AZMB 2Y2PA 2YFVA 2FJ7B 1B67A 5GT0C 3X1SB 5GSUA 1KX5B 1TZYB 3MGRA 3UT9D 5AVCA 4XUJA 3MNND 4J8WA 4J8VA 3AZLC 3VH6A 3IP4C 2F2AC 3KXBA 3KFUG 2G5IC 4Z5TD 1P3FD 1P3BA 2YFWA 5GT3A 4UPKA 5B32D 5AVBA 3P5JB 1P3PD 5B32B 1EQZD 4H9PB 3W98C 1KX3C 4M6BA 3AZGD 1EQZB 4YM6A 2J8PA 3MGPB 5B0YD 3WA9A 3W99A 3REIA 3O62D 1P34A 5B2JA 3MGRD 3AZHC 4G91C 4XUJD 4CSRB 5B40D 5AVCD 1BH9A 1ID3D 1P3AD 1ID3B 5B40B 2DF4C 4YS3B 1TAFB 3LELD 4J8VD 3AYWB 3KWQD 5AV6B 3KXBD 3LELB 3REJB 3AZJC 3KWQB 5GT3D 5AVBD 3X1VA 1M18C 4WU9B 3LZ1B 5GSUC 3AZEB 3C1CA 3AV1C 1P3OC 5AV9A 4J8WC 3FDDA 3LZ0D 5BO0B 3WA9D 3H0LC 3NQUB 3LZ0B 4J8VC 4KUDD 3AZND 3KXBC 2Y2JA 1P34D 3WKJD 2NQBD 5JRGC 1P3BC 5B31G 2NQBB 3H0MC 3REHA 2DQNC 2HIOA 1U35A 3W97C 4YM6C 4X23B 3A6NA 3V9RA 5B33B 3X1VD 2IO5C 3W99C 4WU8A 5E5AB 3REIC 1ZLAB 5DNMC 1JFIA 5B2JC 3C1BA 4R8PA 1ULYA 2VQRA 2CV5A 3B0BA 3AFAA 2BYMB 2ZY2A 4H9RA 3AZKB 5B2IA 3REHD 1P3GB 1M19C 2HIOD 1U35D 5B0ZA 3C1CC 1P3LA 5B31A 5AV9C 3A6ND 4H9QB 4CAYA 3X1UC 3MGQA 1HQ3A 4WU8D 1KX4A 4KGCA 5AV5D 2Y2QA 2NZDD 5AV5B 3RELC 1P3IA 1AOIB 4H9OB 1U35C 5B24D 1W2EA 4ZUXC 3W96A 3KUYC 3R45A 4R8PD 3MVDB 2CV5D 3A6NC 1N1JB 5CP6C 2Y2IA 4WNNB 5B2ID 5DNND 3WTPC 4QLCA 4J8XB 1M1AA 3X1TA 4Z66A 5DNNB 2AROA 1P3LD 4NFTA 5B31D 4HGAB 3C1BC 4J8UC 3WAAD 3MGQD 1HQ3D 3LJAD 4G92B 5B1LA 3WAAB 3LJAB 3AFAC 1Q9CA 1P3ID 4DRBA 2XD5A 3AZMA 5AY8C 2FJ7A 3W96D 5B0ZC 3B0CW 3X1SA 1KX5A 1TZYA 1M1AD 3X1TD 4Z66D 1P3KB 3A1IA 1KX4C 3VH5W 2PYOD 4ZBJC 3EPJA 3B0DC 4KGCC 2PYOB 4Z5TA 3AN2B 3W96C 5B1LD 5B32A 2W8SA 4H9PA 3AL0C 5CPKC 1EQZA 4JJNC 5F99C 1F66B 4QLCC 3B6FB 3AZMD 3X1TC 3B0CT 5FUGB 5AV8C 2AROC 3X1SD 1KX5D 1TZYD 3O62A 4CSRA 3AZFB 1P3MB 3VH5T 5B40A 1ID3A 4YS3A 1TAFA 5CPJB 1P3AA 4AWLC 3AYWA 5AV6A 3LELA 5BNXB 3KWQA 2FJ7C 4LD9C 2Y2GA 5GT0B 5BT1C 5JA4B 3AZEA 1KX5C 1TZYC 3MGPD 5BO0A 3UT9C 3B6GD 3MNNC 3LZ0A 3NQUA 3AV2B 3B6GB 5CHLB 4KUDA 3AZNA 2Y2HA 4Z5TC 1P3FC 2NQBA 3WKJA 2UWXA 5BNVB 3W98B 2BYKB 5B32C 4YS3D 1KX3B 1P3PC 3AYWD 1Z2CB 5AV6D 1EQZC 3REJD 5C3IC 3AZGC 4X23A 5B33A 5B0YC 4H9NB 4EO5C 4WU9D 5E5AA 3LZ1D 3AZHB 3AZIB 4G91B 3AZED 1ZLAA 3EPHA 3O62C 3MGRC 5AVCC 4XUJC 4WZSB 5B40C 1ID3C 4NE6A 1P3AC 3AZJB 2XD1A 3LELC 2BYMA 3KWQC 3AZKA 1M18B 5KDMB 4KHAB 2ZM5A 1P3GA 3VH5A 5GT3C 5AVBC 4H9SA 3NQJA 4UUZA 3TU4D 3AV1B 1P3OB 2Y2LA 3TU4B 1WWIA 4H9QA 4X23D 2JSSA 3LZ0C 5B33D 3WA9C 5E5AD 5JRGB 1ZLAD 4KUDC 3AZNC 3F6TA 1P34C 3WKJC 5AV5A 2NQBC 2HUEC 1AOIA 3W97B 2NZDA 4DQYB 3EPLA 4Z2MG 5B24A 4YM6B 3MVDA 2JE5A 3AZKD 5B1MD 2IO5B 4WNNA 1P3GD 5B1MB 5DNMB 3X1VC 5B2JB 5DNNA 1H3OB 4E44A 4E45A 3WAAA 1PZRA 3LJAA 1M19B 1P3GC 1AOID 2Y2MA 1BH8B 4H9SC 3C1CB 3REHC 5AV9B 2HIOC 3MVDD 3X1UB 5CPID 4J8XD 1P3KA 5CPIB 1A7WA 4WU8C 3RELB 2PYOA 5AV5C 2ZY4A 3MGSB 3REKD 4ZUXB 3KUYB 5GXQD 2NZDC 3REKB 3AN2A 5BS7A 5GXQB 5B24C 2CWEA 5CP6B 4R8PC 2CV5C 3WTPB 1S32D 3UTAD 1F66A 5B2IC 1S32B 3B6FA 1JFIB 5DNNC 3UTAB 4XZQB 4J8UB 2ZY3A 3UTBD 1P3LC 5G49B 5B31C 3UTBB 1P3MA 2G5HC 3WAAC 3MGQC 1F1EA 1P3KD 1HQ3C 5CPJA 3LJAC 2FFFB 5BNXA 5AY8B 5B0ZB 3AN2D 1P3IC 4NE5A 2Y2KA 5JA4A 4CAYB 1KX4B 1F66D 3B6FD 4ZBJB 3MGPA 3AV2A 1M1AC 4Z66C 2PYOC 3B6GA 2JCHA 3AZFD 1T3UA 1P3MD 3AN2C 5BNVA 1HTAA 3EG5B 2BYKA 3W98A 5CPKB 5CPJD 5B1LC 4JJNB 3KSYA 5F99B 3REJA 5AV8B 2AROB 2F8NK 2F8NB 1KU5A 5GT0D 3AZMC 4H9NA 3AZIA 3AZHA 4WU9A 3LZ1A 3X1SC 3AV2D 3AZJA 3AZLB 4LD9B 1M18A 4KHAA 5KDMA 3W98D 1KX3D 1R4VA 3AV1A 1P3OA 3TU4A 3UT9B 3MNNB 3MGPC 3AV2C 3B6GC 3AZID 5JRGA 3AZHD 4Z5TB 1P3FB 3W97A 1P3PB 3AZJD 5C3IB 4YS3C 3AZGB 3AYWC 1BFMA 5AV6C 3REJC 1WWSA 5B0YB 1M18D 2YFVB 4EO5B 5B1MA 5GSUD 5DNMA 2BG1A 3AZIC 3AV1D 3O62B 5GSUB 1P3OD 4J8WD 1H3OA 3LZ1C 3MGRB 4WU9C 3AZEC 5AVCB 4XUJB 4J8WB 3WTPE 1P3AB 4J8VB 5JRGD 3KXBB 1P3BD 1P3BB 1M19A 2YFWB 5GT3B 5AVBB 3W97D 1BH8A 4H9OA 3TU4C 2Y2OA 4YM6D 3X1UA 3W99D 3WA9B 2Y2NA 4X23C 1N1JA 3REID 5DNMD 3W99B 5B33C 5CPIA 5B2JD 3AZNB 4KUDB 3REIB 1P34B 4J8XA 3WKJB 3RELA 5E5AC 2RIQA 1ZLAC 2HUEB 3MGSA 1BH9B 4ZUXA 3KUYA 3REKA 4WV4B 5GXQA 5CP6A 1M19D 3WTPA 3AZKC 5B1MC 3X1VB 1S32A 3C1CD 3UTAA 5AV9D 4XZQA 4J8UA 5G49A 3X1UD 3UTBA 4NE3A 4Z2MH 2F8NG 3RELD 3MGSD 5AY8A 3NQJB 4UUZB 4ZUXD 3KUYD 3REHB 2HIOB 1U35B 1AOIC 3H0RC 5CP6D 3VH6W 3MVDC 3A6NB 3V9RB 3WTPD 4WU8B 5CPIC 4J8XC 4XZQD 5FUGA 3C1BD 4J8UD 3MGSC 2NZDB 3C1BB 4HGAC 3REKC 5B24B 5GXQC 3AZFA 3AFAD 4R8PB 5CPKA 4G92C 2CV5B 4JJNA 3AFAB 5F99A 4H9RB 5B2IB 2F8NH 5AY8D 1S32C 5AV8A 5B0ZD 5B32G 3UTAC 2F8NA 2LY8A 3VH6T 4XZQC 1P3LB 5B31B 5GT0A 1B6WA 3UTBC 1KX4D 3MGQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGC D;  1HQ3 B;  2L5A A;  4KGC B;  1P3K C;  2RVQ D;  3B0D B;  3AZL A;  1P3I B;  4LD9 A;  3W96 B;  3R45 B;  4DRA A;  5BS7 C;  5CPK D;  4JJN D;  1KX3 A;  5F99 D;  3UT9 A;  4QLC D;  3MNN A;  5AV8 D;  4QLC B;  2ARO D;  3X1T B;  4Z66 B;  1M1A B;  1F66 C;  2F8N D;  3B6F C;  2RVQ C;  1P3F A;  3AZF C;  1P3M C;  5B1L B;  1P3P A;  4AWL B;  3AZL D;  5CPJ C;  3AZG A;  2FJ7 D;  4LD9 D;  5B0Y A;  5BT1 D;  3AZM B;  2YFV A;  2FJ7 B;  1B67 A;  5GT0 C;  3X1S B;  5GSU A;  1KX5 B;  1TZY B;  3MGR A;  3UT9 D;  5AVC A;  4XUJ A;  3MNN D;  4J8W A;  4J8V A;  3AZL C;  3VH6 A;  3KXB A;  4Z5T D;  1P3F D;  1P3B A;  2YFW A;  5GT3 A;  5B32 D;  5AVB A;  1P3P D;  5B32 B;  1EQZ D;  4H9P B;  3W98 C;  1KX3 C;  4M6B A;  3AZG D;  1EQZ B;  4YM6 A;  3MGP B;  5B0Y D;  3WA9 A;  3W99 A;  3REI A;  3O62 D;  1P34 A;  5B2J A;  3MGR D;  3AZH C;  4G91 C;  4XUJ D;  4CSR B;  5B40 D;  5AVC D;  1BH9 A;  1ID3 D;  1P3A D;  1ID3 B;  5B40 B;  4YS3 B;  1TAF B;  3LEL D;  4J8V D;  3AYW B;  3KWQ D;  5AV6 B;  3KXB D;  3LEL B;  3REJ B;  3AZJ C;  3KWQ B;  5GT3 D;  5AVB D;  3X1V A;  1M18 C;  4WU9 B;  3LZ1 B;  5GSU C;  3AZE B;  3C1C A;  3AV1 C;  1P3O C;  5AV9 A;  4J8W C;  3LZ0 D;  5BO0 B;  3WA9 D;  3LZ0 B;  3NQU B;  4J8V C;  4KUD D;  3AZN D;  3KXB C;  1P34 D;  3WKJ D;  2NQB D;  5JRG C;  1P3B C;  5B31 G;  2NQB B;  3REH A;  2HIO A;  1U35 A;  3W97 C;  4YM6 C;  4X23 B;  3A6N A;  3V9R A;  5B33 B;  3X1V D;  2IO5 C;  3W99 C;  4WU8 A;  5E5A B;  3REI C;  1ZLA B;  5DNM C;  1JFI A;  5B2J C;  3C1B A;  4R8P A;  1ULY A;  2CV5 A;  3B0B A;  3AFA A;  2BYM B;  4H9R A;  3AZK B;  5B2I A;  3REH D;  1P3G B;  1M19 C;  2HIO D;  1U35 D;  5B0Z A;  3C1C C;  1P3L A;  5B31 A;  5AV9 C;  3A6N D;  4H9Q B;  4CAY A;  3X1U C;  3MGQ A;  1HQ3 A;  4WU8 D;  1KX4 A;  4KGC A;  5AV5 D;  2NZD D;  5AV5 B;  3REL C;  1P3I A;  1AOI B;  4H9O B;  1U35 C;  5B24 D;  4ZUX C;  3W96 A;  3KUY C;  3R45 A;  4R8P D;  3MVD B;  2CV5 D;  3A6N C;  1N1J B;  5CP6 C;  4WNN B;  5B2I D;  5DNN D;  3WTP C;  4QLC A;  4J8X B;  1M1A A;  3X1T A;  4Z66 A;  5DNN B;  2ARO A;  1P3L D;  4NFT A;  5B31 D;  4HGA B;  3C1B C;  4J8U C;  3WAA D;  3MGQ D;  1HQ3 D;  3LJA D;  4G92 B;  5B1L A;  3WAA B;  3LJA B;  3AFA C;  1Q9C A;  1P3I D;  4DRB A;  3AZM A;  5AY8 C;  2FJ7 A;  3W96 D;  5B0Z C;  3B0C W;  3X1S A;  1KX5 A;  1TZY A;  1M1A D;  3X1T D;  4Z66 D;  1P3K B;  1KX4 C;  2PYO D;  3VH5 W;  4KGC C;  4ZBJ C;  3B0D C;  2PYO B;  4Z5T A;  3AN2 B;  3W96 C;  5B1L D;  5B32 A;  4H9P A;  5CPK C;  1EQZ A;  4JJN C;  5F99 C;  1F66 B;  4QLC C;  3B6F B;  3AZM D;  3X1T C;  3B0C T;  5FUG B;  5AV8 C;  2ARO C;  3X1S D;  1KX5 D;  1TZY D;  3O62 A;  4CSR A;  3AZF B;  1P3M B;  3VH5 T;  5B40 A;  1ID3 A;  4YS3 A;  1TAF A;  5CPJ B;  1P3A A;  4AWL C;  3AYW A;  5AV6 A;  3LEL A;  5BNX B;  3KWQ A;  2FJ7 C;  4LD9 C;  5GT0 B;  5BT1 C;  5JA4 B;  3AZE A;  1KX5 C;  1TZY C;  3MGP D;  5BO0 A;  3UT9 C;  3B6G D;  3MNN C;  3LZ0 A;  3NQU A;  3AV2 B;  3B6G B;  5CHL B;  4KUD A;  3AZN A;  4Z5T C;  1P3F C;  2NQB A;  3WKJ A;  5BNV B;  3W98 B;  2BYK B;  5B32 C;  4YS3 D;  1KX3 B;  1P3P C;  3AYW D;  1EQZ C;  5AV6 D;  3REJ D;  5C3I C;  3AZG C;  4X23 A;  5B33 A;  5B0Y C;  4H9N B;  4EO5 C;  4WU9 D;  5E5A A;  3LZ1 D;  3AZH B;  3AZI B;  4G91 B;  3AZE D;  1ZLA A;  3O62 C;  3MGR C;  5AVC C;  4XUJ C;  4WZS B;  5B40 C;  1ID3 C;  4NE6 A;  1P3A C;  3AZJ B;  3LEL C;  2BYM A;  3KWQ C;  3AZK A;  1M18 B;  5KDM B;  4KHA B;  1P3G A;  3VH5 A;  5GT3 C;  5AVB C;  4H9S A;  3NQJ A;  4UUZ A;  3TU4 D;  3AV1 B;  1P3O B;  3TU4 B;  1WWI A;  4H9Q A;  4X23 D;  2JSS A;  3LZ0 C;  5B33 D;  3WA9 C;  5E5A D;  5JRG B;  1ZLA D;  4KUD C;  3AZN C;  1P34 C;  3WKJ C;  5AV5 A;  2NQB C;  2HUE C;  1AOI A;  3W97 B;  2NZD A;  4Z2M G;  5B24 A;  4YM6 B;  3MVD A;  3AZK D;  5B1M D;  2IO5 B;  4WNN A;  1P3G D;  5B1M B;  5DNM B;  3X1V C;  5B2J B;  5DNN A;  1H3O B;  4E44 A;  4E45 A;  3WAA A;  3LJA A;  1M19 B;  1P3G C;  1AOI D;  1BH8 B;  4H9S C;  3C1C B;  3REH C;  5AV9 B;  2HIO C;  3MVD D;  3X1U B;  5CPI D;  4J8X D;  1P3K A;  5CPI B;  1A7W A;  4WU8 C;  3REL B;  2PYO A;  5AV5 C;  3MGS B;  3REK D;  4ZUX B;  3KUY B;  5GXQ D;  2NZD C;  3REK B;  3AN2 A;  5BS7 A;  5GXQ B;  5B24 C;  2CWE A;  5CP6 B;  4R8P C;  2CV5 C;  3WTP B;  1S32 D;  3UTA D;  1F66 A;  5B2I C;  1S32 B;  3B6F A;  1JFI B;  5DNN C;  3UTA B;  4XZQ B;  4J8U B;  3UTB D;  1P3L C;  5G49 B;  5B31 C;  3UTB B;  1P3M A;  3WAA C;  3MGQ C;  1F1E A;  1P3K D;  1HQ3 C;  5CPJ A;  3LJA C;  5BNX A;  5AY8 B;  5B0Z B;  3AN2 D;  1P3I C;  4NE5 A;  5JA4 A;  4CAY B;  1KX4 B;  1F66 D;  3B6F D;  4ZBJ B;  3MGP A;  3AV2 A;  1M1A C;  4Z66 C;  2PYO C;  3B6G A;  3AZF D;  1P3M D;  3AN2 C;  5BNV A;  1HTA A;  3W98 A;  2BYK A;  5CPK B;  5CPJ D;  5B1L C;  4JJN B;  3KSY A;  5F99 B;  3REJ A;  5AV8 B;  2ARO B;  2F8N K;  2F8N B;  1KU5 A;  5GT0 D;  3AZM C;  4H9N A;  3AZI A;  3AZH A;  4WU9 A;  3LZ1 A;  3X1S C;  3AV2 D;  3AZJ A;  3AZL B;  4LD9 B;  1M18 A;  4KHA A;  5KDM A;  3W98 D;  1KX3 D;  1R4V A;  3AV1 A;  1P3O A;  3TU4 A;  3UT9 B;  3MNN B;  3MGP C;  3AV2 C;  3B6G C;  3AZI D;  5JRG A;  3AZH D;  4Z5T B;  1P3F B;  3W97 A;  1P3P B;  3AZJ D;  5C3I B;  4YS3 C;  3AZG B;  3AYW C;  1BFM A;  5AV6 C;  3REJ C;  1WWS A;  5B0Y B;  1M18 D;  2YFV B;  4EO5 B;  5B1M A;  5GSU D;  5DNM A;  3AZI C;  3AV1 D;  3O62 B;  5GSU B;  1P3O D;  4J8W D;  1H3O A;  3LZ1 C;  3MGR B;  4WU9 C;  3AZE C;  5AVC B;  4XUJ B;  4J8W B;  3WTP E;  1P3A B;  4J8V B;  5JRG D;  3KXB B;  1P3B D;  1P3B B;  1M19 A;  2YFW B;  5GT3 B;  5AVB B;  3W97 D;  1BH8 A;  4H9O A;  3TU4 C;  4YM6 D;  3X1U A;  3W99 D;  3WA9 B;  4X23 C;  1N1J A;  3REI D;  5DNM D;  3W99 B;  5B33 C;  5CPI A;  5B2J D;  3AZN B;  4KUD B;  3REI B;  1P34 B;  4J8X A;  3WKJ B;  3REL A;  5E5A C;  1ZLA C;  2HUE B;  3MGS A;  1BH9 B;  4ZUX A;  3KUY A;  3REK A;  4WV4 B;  5GXQ A;  5CP6 A;  1M19 D;  3WTP A;  3AZK C;  5B1M C;  3X1V B;  1S32 A;  3C1C D;  3UTA A;  5AV9 D;  4XZQ A;  4J8U A;  5G49 A;  3X1U D;  3UTB A;  4NE3 A;  4Z2M H;  2F8N G;  3REL D;  3MGS D;  5AY8 A;  3NQJ B;  4UUZ B;  4ZUX D;  3KUY D;  3REH B;  2HIO B;  1U35 B;  1AOI C;  5CP6 D;  3VH6 W;  3MVD C;  3A6N B;  3V9R B;  3WTP D;  4WU8 B;  5CPI C;  4J8X C;  4XZQ D;  5FUG A;  3C1B D;  4J8U D;  3MGS C;  2NZD B;  3C1B B;  4HGA C;  3REK C;  5B24 B;  5GXQ C;  3AZF A;  3AFA D;  4R8P B;  5CPK A;  4G92 C;  2CV5 B;  4JJN A;  3AFA B;  5F99 A;  4H9R B;  5B2I B;  2F8N H;  5AY8 D;  1S32 C;  5AV8 A;  5B0Z D;  5B32 G;  3UTA C;  2F8N A;  2LY8 A;  3VH6 T;  4XZQ C;  1P3L B;  5B31 B;  5GT0 A;  1B6W A;  3UTB C;  1KX4 D;  3MGQ B; 
#chains in the Genus database with same CATH topology
 4KGC D;  1HQ3 B;  3A1K A;  2L5A A;  4KGC B;  1P3K C;  2RVQ D;  3B0D B;  3AZL A;  1P3I B;  4LD9 A;  3W96 B;  3R45 B;  4DRA A;  5BS7 C;  5CPK D;  4JJN D;  1KX3 A;  5F99 D;  3UT9 A;  4QLC D;  3MNN A;  5AV8 D;  4QLC B;  2ARO D;  3X1T B;  4Z66 B;  1M1A B;  1F66 C;  2F8N D;  3B6F C;  2RVQ C;  2ZY5 A;  1P3F A;  3AZF C;  1P3M C;  5B1L B;  1P3P A;  4WJ3 C;  4AWL B;  3AZL D;  5CPJ C;  3AZG A;  3EPK A;  2FJ7 D;  4LD9 D;  5B0Y A;  5BT1 D;  3AZM B;  2Y2P A;  2YFV A;  2FJ7 B;  1B67 A;  5GT0 C;  3X1S B;  5GSU A;  1KX5 B;  1TZY B;  3MGR A;  3UT9 D;  5AVC A;  4XUJ A;  3MNN D;  4J8W A;  4J8V A;  3AZL C;  3VH6 A;  3IP4 C;  2F2A C;  3KXB A;  3KFU G;  2G5I C;  4Z5T D;  1P3F D;  1P3B A;  2YFW A;  5GT3 A;  4UPK A;  5B32 D;  5AVB A;  3P5J B;  1P3P D;  5B32 B;  1EQZ D;  4H9P B;  3W98 C;  1KX3 C;  4M6B A;  3AZG D;  1EQZ B;  4YM6 A;  2J8P A;  3MGP B;  5B0Y D;  3WA9 A;  3W99 A;  3REI A;  3O62 D;  1P34 A;  5B2J A;  3MGR D;  3AZH C;  4G91 C;  4XUJ D;  4CSR B;  5B40 D;  5AVC D;  1BH9 A;  1ID3 D;  1P3A D;  1ID3 B;  5B40 B;  2DF4 C;  4YS3 B;  1TAF B;  3LEL D;  4J8V D;  3AYW B;  3KWQ D;  5AV6 B;  3KXB D;  3LEL B;  3REJ B;  3AZJ C;  3KWQ B;  5GT3 D;  5AVB D;  3X1V A;  1M18 C;  4WU9 B;  3LZ1 B;  5GSU C;  3AZE B;  3C1C A;  3AV1 C;  1P3O C;  5AV9 A;  4J8W C;  3FDD A;  3LZ0 D;  5BO0 B;  3WA9 D;  3H0L C;  3NQU B;  3LZ0 B;  4J8V C;  4KUD D;  3AZN D;  3KXB C;  2Y2J A;  1P34 D;  3WKJ D;  2NQB D;  5JRG C;  1P3B C;  5B31 G;  2NQB B;  3H0M C;  3REH A;  2DQN C;  2HIO A;  1U35 A;  3W97 C;  4YM6 C;  4X23 B;  3A6N A;  3V9R A;  5B33 B;  3X1V D;  2IO5 C;  3W99 C;  4WU8 A;  5E5A B;  3REI C;  1ZLA B;  5DNM C;  1JFI A;  5B2J C;  3C1B A;  4R8P A;  1ULY A;  2VQR A;  2CV5 A;  3B0B A;  3AFA A;  2BYM B;  2ZY2 A;  4H9R A;  3AZK B;  5B2I A;  3REH D;  1P3G B;  1M19 C;  2HIO D;  1U35 D;  5B0Z A;  3C1C C;  1P3L A;  5B31 A;  5AV9 C;  3A6N D;  4H9Q B;  4CAY A;  3X1U C;  3MGQ A;  1HQ3 A;  4WU8 D;  1KX4 A;  4KGC A;  5AV5 D;  2Y2Q A;  2NZD D;  5AV5 B;  3REL C;  1P3I A;  1AOI B;  4H9O B;  1U35 C;  5B24 D;  1W2E A;  4ZUX C;  3W96 A;  3KUY C;  3R45 A;  4R8P D;  3MVD B;  2CV5 D;  3A6N C;  1N1J B;  5CP6 C;  2Y2I A;  4WNN B;  5B2I D;  5DNN D;  3WTP C;  4QLC A;  4J8X B;  1M1A A;  3X1T A;  4Z66 A;  5DNN B;  2ARO A;  1P3L D;  4NFT A;  5B31 D;  4HGA B;  3C1B C;  4J8U C;  3WAA D;  3MGQ D;  1HQ3 D;  3LJA D;  4G92 B;  5B1L A;  3WAA B;  3LJA B;  3AFA C;  1Q9C A;  1P3I D;  4DRB A;  2XD5 A;  3AZM A;  5AY8 C;  2FJ7 A;  3W96 D;  5B0Z C;  3B0C W;  3X1S A;  1KX5 A;  1TZY A;  1M1A D;  3X1T D;  4Z66 D;  1P3K B;  3A1I A;  1KX4 C;  3VH5 W;  2PYO D;  4ZBJ C;  3EPJ A;  3B0D C;  4KGC C;  2PYO B;  4Z5T A;  3AN2 B;  3W96 C;  5B1L D;  5B32 A;  2W8S A;  4H9P A;  3AL0 C;  5CPK C;  1EQZ A;  4JJN C;  5F99 C;  1F66 B;  4QLC C;  3B6F B;  3AZM D;  3X1T C;  3B0C T;  5FUG B;  5AV8 C;  2ARO C;  3X1S D;  1KX5 D;  1TZY D;  3O62 A;  4CSR A;  3AZF B;  1P3M B;  3VH5 T;  5B40 A;  1ID3 A;  4YS3 A;  1TAF A;  5CPJ B;  1P3A A;  4AWL C;  3AYW A;  5AV6 A;  3LEL A;  5BNX B;  3KWQ A;  2FJ7 C;  4LD9 C;  2Y2G A;  5GT0 B;  5BT1 C;  5JA4 B;  3AZE A;  1KX5 C;  1TZY C;  3MGP D;  5BO0 A;  3UT9 C;  3B6G D;  3MNN C;  3LZ0 A;  3NQU A;  3AV2 B;  3B6G B;  5CHL B;  4KUD A;  3AZN A;  2Y2H A;  4Z5T C;  1P3F C;  2NQB A;  3WKJ A;  2UWX A;  5BNV B;  3W98 B;  2BYK B;  5B32 C;  4YS3 D;  1KX3 B;  1P3P C;  3AYW D;  1Z2C B;  5AV6 D;  1EQZ C;  3REJ D;  5C3I C;  3AZG C;  4X23 A;  5B33 A;  5B0Y C;  4H9N B;  4EO5 C;  4WU9 D;  5E5A A;  3LZ1 D;  3AZH B;  3AZI B;  4G91 B;  3AZE D;  1ZLA A;  3EPH A;  3O62 C;  3MGR C;  5AVC C;  4XUJ C;  4WZS B;  5B40 C;  1ID3 C;  4NE6 A;  1P3A C;  3AZJ B;  2XD1 A;  3LEL C;  2BYM A;  3KWQ C;  3AZK A;  1M18 B;  5KDM B;  4KHA B;  2ZM5 A;  1P3G A;  3VH5 A;  5GT3 C;  5AVB C;  4H9S A;  3NQJ A;  4UUZ A;  3TU4 D;  3AV1 B;  1P3O B;  2Y2L A;  3TU4 B;  1WWI A;  4H9Q A;  4X23 D;  2JSS A;  3LZ0 C;  5B33 D;  3WA9 C;  5E5A D;  5JRG B;  1ZLA D;  4KUD C;  3AZN C;  3F6T A;  1P34 C;  3WKJ C;  5AV5 A;  2NQB C;  2HUE C;  1AOI A;  3W97 B;  2NZD A;  4DQY B;  3EPL A;  4Z2M G;  5B24 A;  4YM6 B;  3MVD A;  2JE5 A;  3AZK D;  5B1M D;  2IO5 B;  4WNN A;  1P3G D;  5B1M B;  5DNM B;  3X1V C;  5B2J B;  5DNN A;  1H3O B;  4E44 A;  4E45 A;  3WAA A;  1PZR A;  3LJA A;  1M19 B;  1P3G C;  1AOI D;  2Y2M A;  1BH8 B;  4H9S C;  3C1C B;  3REH C;  5AV9 B;  2HIO C;  3MVD D;  3X1U B;  5CPI D;  4J8X D;  1P3K A;  5CPI B;  1A7W A;  4WU8 C;  3REL B;  2PYO A;  5AV5 C;  2ZY4 A;  3MGS B;  3REK D;  4ZUX B;  3KUY B;  5GXQ D;  2NZD C;  3REK B;  3AN2 A;  5BS7 A;  5GXQ B;  5B24 C;  2CWE A;  5CP6 B;  4R8P C;  2CV5 C;  3WTP B;  1S32 D;  3UTA D;  1F66 A;  5B2I C;  1S32 B;  3B6F A;  1JFI B;  5DNN C;  3UTA B;  4XZQ B;  4J8U B;  2ZY3 A;  3UTB D;  1P3L C;  5G49 B;  5B31 C;  3UTB B;  1P3M A;  2G5H C;  3WAA C;  3MGQ C;  1F1E A;  1P3K D;  1HQ3 C;  5CPJ A;  3LJA C;  2FFF B;  5BNX A;  5AY8 B;  5B0Z B;  3AN2 D;  1P3I C;  4NE5 A;  2Y2K A;  5JA4 A;  4CAY B;  1KX4 B;  1F66 D;  3B6F D;  4ZBJ B;  3MGP A;  3AV2 A;  1M1A C;  4Z66 C;  2PYO C;  3B6G A;  2JCH A;  3AZF D;  1T3U A;  1P3M D;  3AN2 C;  5BNV A;  1HTA A;  3EG5 B;  2BYK A;  3W98 A;  5CPK B;  5CPJ D;  5B1L C;  4JJN B;  3KSY A;  5F99 B;  3REJ A;  5AV8 B;  2ARO B;  2F8N K;  2F8N B;  1KU5 A;  5GT0 D;  3AZM C;  4H9N A;  3AZI A;  3AZH A;  4WU9 A;  3LZ1 A;  3X1S C;  3AV2 D;  3AZJ A;  3AZL B;  4LD9 B;  1M18 A;  4KHA A;  5KDM A;  3W98 D;  1KX3 D;  1R4V A;  3AV1 A;  1P3O A;  3TU4 A;  3UT9 B;  3MNN B;  3MGP C;  3AV2 C;  3B6G C;  3AZI D;  5JRG A;  3AZH D;  4Z5T B;  1P3F B;  3W97 A;  1P3P B;  3AZJ D;  5C3I B;  4YS3 C;  3AZG B;  3AYW C;  1BFM A;  5AV6 C;  3REJ C;  1WWS A;  5B0Y B;  1M18 D;  2YFV B;  4EO5 B;  5B1M A;  5GSU D;  5DNM A;  2BG1 A;  3AZI C;  3AV1 D;  3O62 B;  5GSU B;  1P3O D;  4J8W D;  1H3O A;  3LZ1 C;  3MGR B;  4WU9 C;  3AZE C;  5AVC B;  4XUJ B;  4J8W B;  3WTP E;  1P3A B;  4J8V B;  5JRG D;  3KXB B;  1P3B D;  1P3B B;  1M19 A;  2YFW B;  5GT3 B;  5AVB B;  3W97 D;  1BH8 A;  4H9O A;  3TU4 C;  2Y2O A;  4YM6 D;  3X1U A;  3W99 D;  3WA9 B;  2Y2N A;  4X23 C;  1N1J A;  3REI D;  5DNM D;  3W99 B;  5B33 C;  5CPI A;  5B2J D;  3AZN B;  4KUD B;  3REI B;  1P34 B;  4J8X A;  3WKJ B;  3REL A;  5E5A C;  2RIQ A;  1ZLA C;  2HUE B;  3MGS A;  1BH9 B;  4ZUX A;  3KUY A;  3REK A;  4WV4 B;  5GXQ A;  5CP6 A;  1M19 D;  3WTP A;  3AZK C;  5B1M C;  3X1V B;  1S32 A;  3C1C D;  3UTA A;  5AV9 D;  4XZQ A;  4J8U A;  5G49 A;  3X1U D;  3UTB A;  4NE3 A;  4Z2M H;  2F8N G;  3REL D;  3MGS D;  5AY8 A;  3NQJ B;  4UUZ B;  4ZUX D;  3KUY D;  3REH B;  2HIO B;  1U35 B;  1AOI C;  3H0R C;  5CP6 D;  3VH6 W;  3MVD C;  3A6N B;  3V9R B;  3WTP D;  4WU8 B;  5CPI C;  4J8X C;  4XZQ D;  5FUG A;  3C1B D;  4J8U D;  3MGS C;  2NZD B;  3C1B B;  4HGA C;  3REK C;  5B24 B;  5GXQ C;  3AZF A;  3AFA D;  4R8P B;  5CPK A;  4G92 C;  2CV5 B;  4JJN A;  3AFA B;  5F99 A;  4H9R B;  5B2I B;  2F8N H;  5AY8 D;  1S32 C;  5AV8 A;  5B0Z D;  5B32 G;  3UTA C;  2F8N A;  2LY8 A;  3VH6 T;  4XZQ C;  1P3L B;  5B31 B;  5GT0 A;  1B6W A;  3UTB C;  1KX4 D;  3MGQ B; 
#chains in the Genus database with same CATH homology
 4KGC D;  1HQ3 B;  3A1K A;  2L5A A;  4KGC B;  1P3K C;  2RVQ D;  3B0D B;  3AZL A;  1P3I B;  4LD9 A;  3W96 B;  3R45 B;  4DRA A;  5BS7 C;  5CPK D;  4JJN D;  1KX3 A;  5F99 D;  3UT9 A;  4QLC D;  3MNN A;  5AV8 D;  4QLC B;  2ARO D;  3X1T B;  4Z66 B;  1M1A B;  1F66 C;  2F8N D;  3B6F C;  2RVQ C;  2ZY5 A;  1P3F A;  3AZF C;  1P3M C;  5B1L B;  1P3P A;  4WJ3 C;  4AWL B;  3AZL D;  5CPJ C;  3AZG A;  3EPK A;  2FJ7 D;  4LD9 D;  5B0Y A;  5BT1 D;  3AZM B;  2Y2P A;  2YFV A;  2FJ7 B;  1B67 A;  5GT0 C;  3X1S B;  5GSU A;  1KX5 B;  1TZY B;  3MGR A;  3UT9 D;  5AVC A;  4XUJ A;  3MNN D;  4J8W A;  4J8V A;  3AZL C;  3VH6 A;  3IP4 C;  2F2A C;  3KXB A;  3KFU G;  2G5I C;  4Z5T D;  1P3F D;  1P3B A;  2YFW A;  5GT3 A;  4UPK A;  5B32 D;  5AVB A;  3P5J B;  1P3P D;  5B32 B;  1EQZ D;  4H9P B;  3W98 C;  1KX3 C;  4M6B A;  3AZG D;  1EQZ B;  4YM6 A;  2J8P A;  3MGP B;  5B0Y D;  3WA9 A;  3W99 A;  3REI A;  3O62 D;  1P34 A;  5B2J A;  3MGR D;  3AZH C;  4G91 C;  4XUJ D;  4CSR B;  5B40 D;  5AVC D;  1BH9 A;  1ID3 D;  1P3A D;  1ID3 B;  5B40 B;  2DF4 C;  4YS3 B;  1TAF B;  3LEL D;  4J8V D;  3AYW B;  3KWQ D;  5AV6 B;  3KXB D;  3LEL B;  3REJ B;  3AZJ C;  3KWQ B;  5GT3 D;  5AVB D;  3X1V A;  1M18 C;  4WU9 B;  3LZ1 B;  5GSU C;  3AZE B;  3C1C A;  3AV1 C;  1P3O C;  5AV9 A;  4J8W C;  3FDD A;  3LZ0 D;  5BO0 B;  3WA9 D;  3H0L C;  3NQU B;  3LZ0 B;  4J8V C;  4KUD D;  3AZN D;  3KXB C;  2Y2J A;  1P34 D;  3WKJ D;  2NQB D;  5JRG C;  1P3B C;  5B31 G;  2NQB B;  3H0M C;  3REH A;  2DQN C;  2HIO A;  1U35 A;  3W97 C;  4YM6 C;  4X23 B;  3A6N A;  3V9R A;  5B33 B;  3X1V D;  2IO5 C;  3W99 C;  4WU8 A;  5E5A B;  3REI C;  1ZLA B;  5DNM C;  1JFI A;  5B2J C;  3C1B A;  4R8P A;  1ULY A;  2VQR A;  2CV5 A;  3B0B A;  3AFA A;  2BYM B;  2ZY2 A;  4H9R A;  3AZK B;  5B2I A;  3REH D;  1P3G B;  1M19 C;  2HIO D;  1U35 D;  5B0Z A;  3C1C C;  1P3L A;  5B31 A;  5AV9 C;  3A6N D;  4H9Q B;  4CAY A;  3X1U C;  3MGQ A;  1HQ3 A;  4WU8 D;  1KX4 A;  4KGC A;  5AV5 D;  2Y2Q A;  2NZD D;  5AV5 B;  3REL C;  1P3I A;  1AOI B;  4H9O B;  1U35 C;  5B24 D;  1W2E A;  4ZUX C;  3W96 A;  3KUY C;  3R45 A;  4R8P D;  3MVD B;  2CV5 D;  3A6N C;  1N1J B;  5CP6 C;  2Y2I A;  4WNN B;  5B2I D;  5DNN D;  3WTP C;  4QLC A;  4J8X B;  1M1A A;  3X1T A;  4Z66 A;  5DNN B;  2ARO A;  1P3L D;  4NFT A;  5B31 D;  4HGA B;  3C1B C;  4J8U C;  3WAA D;  3MGQ D;  1HQ3 D;  3LJA D;  4G92 B;  5B1L A;  3WAA B;  3LJA B;  3AFA C;  1Q9C A;  1P3I D;  4DRB A;  2XD5 A;  3AZM A;  5AY8 C;  2FJ7 A;  3W96 D;  5B0Z C;  3B0C W;  3X1S A;  1KX5 A;  1TZY A;  1M1A D;  3X1T D;  4Z66 D;  1P3K B;  3A1I A;  1KX4 C;  3VH5 W;  2PYO D;  4ZBJ C;  3EPJ A;  3B0D C;  4KGC C;  2PYO B;  4Z5T A;  3AN2 B;  3W96 C;  5B1L D;  5B32 A;  2W8S A;  4H9P A;  3AL0 C;  5CPK C;  1EQZ A;  4JJN C;  5F99 C;  1F66 B;  4QLC C;  3B6F B;  3AZM D;  3X1T C;  3B0C T;  5FUG B;  5AV8 C;  2ARO C;  3X1S D;  1KX5 D;  1TZY D;  3O62 A;  4CSR A;  3AZF B;  1P3M B;  3VH5 T;  5B40 A;  1ID3 A;  4YS3 A;  1TAF A;  5CPJ B;  1P3A A;  4AWL C;  3AYW A;  5AV6 A;  3LEL A;  5BNX B;  3KWQ A;  2FJ7 C;  4LD9 C;  2Y2G A;  5GT0 B;  5BT1 C;  5JA4 B;  3AZE A;  1KX5 C;  1TZY C;  3MGP D;  5BO0 A;  3UT9 C;  3B6G D;  3MNN C;  3LZ0 A;  3NQU A;  3AV2 B;  3B6G B;  5CHL B;  4KUD A;  3AZN A;  2Y2H A;  4Z5T C;  1P3F C;  2NQB A;  3WKJ A;  2UWX A;  5BNV B;  3W98 B;  2BYK B;  5B32 C;  4YS3 D;  1KX3 B;  1P3P C;  3AYW D;  1Z2C B;  5AV6 D;  1EQZ C;  3REJ D;  5C3I C;  3AZG C;  4X23 A;  5B33 A;  5B0Y C;  4H9N B;  4EO5 C;  4WU9 D;  5E5A A;  3LZ1 D;  3AZH B;  3AZI B;  4G91 B;  3AZE D;  1ZLA A;  3EPH A;  3O62 C;  3MGR C;  5AVC C;  4XUJ C;  4WZS B;  5B40 C;  1ID3 C;  4NE6 A;  1P3A C;  3AZJ B;  2XD1 A;  3LEL C;  2BYM A;  3KWQ C;  3AZK A;  1M18 B;  5KDM B;  4KHA B;  2ZM5 A;  1P3G A;  3VH5 A;  5GT3 C;  5AVB C;  4H9S A;  3NQJ A;  4UUZ A;  3TU4 D;  3AV1 B;  1P3O B;  2Y2L A;  3TU4 B;  1WWI A;  4H9Q A;  4X23 D;  2JSS A;  3LZ0 C;  5B33 D;  3WA9 C;  5E5A D;  5JRG B;  1ZLA D;  4KUD C;  3AZN C;  3F6T A;  1P34 C;  3WKJ C;  5AV5 A;  2NQB C;  2HUE C;  1AOI A;  3W97 B;  2NZD A;  4DQY B;  3EPL A;  4Z2M G;  5B24 A;  4YM6 B;  3MVD A;  2JE5 A;  3AZK D;  5B1M D;  2IO5 B;  4WNN A;  1P3G D;  5B1M B;  5DNM B;  3X1V C;  5B2J B;  5DNN A;  1H3O B;  4E44 A;  4E45 A;  3WAA A;  1PZR A;  3LJA A;  1M19 B;  1P3G C;  1AOI D;  2Y2M A;  1BH8 B;  4H9S C;  3C1C B;  3REH C;  5AV9 B;  2HIO C;  3MVD D;  3X1U B;  5CPI D;  4J8X D;  1P3K A;  5CPI B;  1A7W A;  4WU8 C;  3REL B;  2PYO A;  5AV5 C;  2ZY4 A;  3MGS B;  3REK D;  4ZUX B;  3KUY B;  5GXQ D;  2NZD C;  3REK B;  3AN2 A;  5BS7 A;  5GXQ B;  5B24 C;  2CWE A;  5CP6 B;  4R8P C;  2CV5 C;  3WTP B;  1S32 D;  3UTA D;  1F66 A;  5B2I C;  1S32 B;  3B6F A;  1JFI B;  5DNN C;  3UTA B;  4XZQ B;  4J8U B;  2ZY3 A;  3UTB D;  1P3L C;  5G49 B;  5B31 C;  3UTB B;  1P3M A;  2G5H C;  3WAA C;  3MGQ C;  1F1E A;  1P3K D;  1HQ3 C;  5CPJ A;  3LJA C;  2FFF B;  5BNX A;  5AY8 B;  5B0Z B;  3AN2 D;  1P3I C;  4NE5 A;  2Y2K A;  5JA4 A;  4CAY B;  1KX4 B;  1F66 D;  3B6F D;  4ZBJ B;  3MGP A;  3AV2 A;  1M1A C;  4Z66 C;  2PYO C;  3B6G A;  2JCH A;  3AZF D;  1T3U A;  1P3M D;  3AN2 C;  5BNV A;  1HTA A;  3EG5 B;  2BYK A;  3W98 A;  5CPK B;  5CPJ D;  5B1L C;  4JJN B;  3KSY A;  5F99 B;  3REJ A;  5AV8 B;  2ARO B;  2F8N K;  2F8N B;  1KU5 A;  5GT0 D;  3AZM C;  4H9N A;  3AZI A;  3AZH A;  4WU9 A;  3LZ1 A;  3X1S C;  3AV2 D;  3AZJ A;  3AZL B;  4LD9 B;  1M18 A;  4KHA A;  5KDM A;  3W98 D;  1KX3 D;  1R4V A;  3AV1 A;  1P3O A;  3TU4 A;  3UT9 B;  3MNN B;  3MGP C;  3AV2 C;  3B6G C;  3AZI D;  5JRG A;  3AZH D;  4Z5T B;  1P3F B;  3W97 A;  1P3P B;  3AZJ D;  5C3I B;  4YS3 C;  3AZG B;  3AYW C;  1BFM A;  5AV6 C;  3REJ C;  1WWS A;  5B0Y B;  1M18 D;  2YFV B;  4EO5 B;  5B1M A;  5GSU D;  5DNM A;  2BG1 A;  3AZI C;  3AV1 D;  3O62 B;  5GSU B;  1P3O D;  4J8W D;  1H3O A;  3LZ1 C;  3MGR B;  4WU9 C;  3AZE C;  5AVC B;  4XUJ B;  4J8W B;  3WTP E;  1P3A B;  4J8V B;  5JRG D;  3KXB B;  1P3B D;  1P3B B;  1M19 A;  2YFW B;  5GT3 B;  5AVB B;  3W97 D;  1BH8 A;  4H9O A;  3TU4 C;  2Y2O A;  4YM6 D;  3X1U A;  3W99 D;  3WA9 B;  2Y2N A;  4X23 C;  1N1J A;  3REI D;  5DNM D;  3W99 B;  5B33 C;  5CPI A;  5B2J D;  3AZN B;  4KUD B;  3REI B;  1P34 B;  4J8X A;  3WKJ B;  3REL A;  5E5A C;  2RIQ A;  1ZLA C;  2HUE B;  3MGS A;  1BH9 B;  4ZUX A;  3KUY A;  3REK A;  4WV4 B;  5GXQ A;  5CP6 A;  1M19 D;  3WTP A;  3AZK C;  5B1M C;  3X1V B;  1S32 A;  3C1C D;  3UTA A;  5AV9 D;  4XZQ A;  4J8U A;  5G49 A;  3X1U D;  3UTB A;  4NE3 A;  4Z2M H;  2F8N G;  3REL D;  3MGS D;  5AY8 A;  3NQJ B;  4UUZ B;  4ZUX D;  3KUY D;  3REH B;  2HIO B;  1U35 B;  1AOI C;  3H0R C;  5CP6 D;  3VH6 W;  3MVD C;  3A6N B;  3V9R B;  3WTP D;  4WU8 B;  5CPI C;  4J8X C;  4XZQ D;  5FUG A;  3C1B D;  4J8U D;  3MGS C;  2NZD B;  3C1B B;  4HGA C;  3REK C;  5B24 B;  5GXQ C;  3AZF A;  3AFA D;  4R8P B;  5CPK A;  4G92 C;  2CV5 B;  4JJN A;  3AFA B;  5F99 A;  4H9R B;  5B2I B;  2F8N H;  5AY8 D;  1S32 C;  5AV8 A;  5B0Z D;  5B32 G;  3UTA C;  2F8N A;  2LY8 A;  3VH6 T;  4XZQ C;  1P3L B;  5B31 B;  5GT0 A;  1B6W A;  3UTB C;  1KX4 D;  3MGQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...