4R8PC

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
total genus 29
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pC00
5B2JB 3W99B 3AZFA 1P3OC 4ZBJC 1KX5B 3X1VD 4G92C 4X23A 3O62B 1M1AC 3AYWC 5B40B 2LY8A 1BFMA 1P34A 1P3MA 5B1MC 1KX4D 3AZHB 3X1VB 3AZLD 4WNNA 5F99A 1P3FC 3AZNC 4LD9C 1EQZD 4NE5A 3AZFB 2AROC 3AZKC 4DRBA 2CV5B 5AV8C 3UTAC 5B0YC 2PYOD 5G49A 3VH5T 1P3ID 5CP6B 1KX3D 5GT0D 5B24A 1HQ3B 4WZSB 1EQZB 3WAAB 1P3GD 5B33A 5AV6D 1H3OA 1U35B 3REHD 5CPJA 5DNNC 1Q9CA 3AZMC 1M18A 3X1UA 3MNND 5B24B 3REID 3KWQC 3B6GD 5B0ZD 5BS7A 5DNMC 3REJA 3WKJA 5CPKD 4J8UC 3VH6W 4UUZB 3AV1C 5B2IA 4Z66B 3REIB 3AN2A 3REKA 1P3KD 4HGAC 3LJAA 3X1SC 3B6FB 3MGSA 3WKJB 5JRGD 3C1CA 4WU9A 3B0DC 2BYMA 5GSUD 4R8PC 3UT9A 1A7WA 3MGPC 4KUDC 1P3KB 4JJNA 4KGCD 1WWIA 5JRGB 3TU4D 5B1MD 5AV5C 4H9NB 3LJAB 1F66D 5GSUB 3MGSB 1P3FD 1S32D 3AZND 3AZEA 1N1JB 3R45A 3AZKD 3NQJB 5AV8D 3UT9B 2FJ7B 1P3LC 4KGCB 2BYKB 4ZUXC 5AY8C 1AOIC 3RELA 3W98A 1F66B 3MGRD 1R4VA 1S32B 2F8NH 1P3PC 4Z5TC 3AZJD 3AV2C 3R45B 3B0CT 2YFWB 3MGRB 4J8XB 5AVCA 3VH5W 3RELB 3W98B 1P3AD 4J8VD 3WA9A 3AFAA 2HIOA 4QLCB 4YS3D 3AZJB 4XUJD 5DNMD 3AZID 1P3AB 5BNVB 3O62C 2YFVA 5B31C 4J8VB 3X1TB 4YS3B 3WA9B 2HIOB 4EO5B 4J8WB 3UTBA 2NZDD 3AZFC 2F8NA 3MVDA 3WTPE 3AZGD 1JFIB 4R8PD 4X23C 1TZYD 3MGPD 1M19A 5B32B 2NQBB 1P34C 1P3MC 2NZDB 5GXQD 5BO0A 3KXBD 3V9RA 3WTPA 4NE6A 1ZLAD 3AZGB 3UTBB 5F99C 5B2JA 3KUYB 3W99A 1BH9B 5E5AA 3MVDB 4XZQC 2F8NB 5B31G 1P3BD 1KX5A 1BH8B 1P3LD 5GXQB 3LZ0B 1ZLAB 5B40A 4M6BA 5B24C 2HUEC 3V9RB 5AV9D 5B33C 3AZHA 1P3BB 3X1VA 1P3PD 4NE3A 5E5AB 4Z5TD 3AV2D 2CV5A 3W97D 5GT3D 3A6NB 5CPJC 5FUGA 2CWEA 1M18C 5JA4A 5AV9B 3X1UC 3LELB 5CP6A 3LZ1D 3AZLA 1EQZA 1HQ3A 3WAAA 4Z2MG 3REJC 1ID3D 4H9RA 2PYOA 4H9PB 5GT3B 3W96D 3B0CW 1P3IA 3LZ1B 5B2IC 5B31D 5FUGB 4WU8D 1U35A 5GT0A 1KX3A 5JA4B 5AVBD 1KX4B 3AN2C 1ID3B 5B1LD 1HTAA 3C1BD 5CPID 1P3GA 3REKC 5C3IB 3AZLB 5AV6A 3MGSC 1F1EA 4H9RB 3C1CC 2PYOB 4WU9C 3REHA 4WU8B 4UUZA 5AVBB 3UT9C 1P3IB 3MNNA 4X23D 1KX3B 4JJNC 5GT0B 4Z66A 3REIA 1P3GB 5B0ZA 1P34D 5BT1C 3MGQC 5CPKA 5AV6B 3B6FA 4G91B 2IO5B 3VH5A 3AZEC 1KU5A 3REHB 4XZQD 3MNNB 3RELC 4H9OB 1P3KA 3W98C 3B6GB 5B0ZB 4YM6D 5JRGA 5CPKB 4H9NA 5B33D 5GSUA 1N1JA 1P3OD 3NQJA 5AVCC 2FJ7A 4KGCA 2BYKA 4YM6B 1M1AD 3TU4A 3AYWD 3WA9C 3AFAC 2HIOC 1F66A 4EO5C 1P3FA 1S32A 5KDMB 1P3OB 3REJD 4ZBJB 4LD9D 4G92B 1M1AB 2AROD 3UTAD 2YFWA 5B0YD 3MGRA 4J8XA 3TU4B 5B1MB 3AN2D 5BNXB 4QLCA 1P3FB 3AZNB 3AZJA 3UTBC 2AROB 3AZKB 5AV8B 3MVDC 3C1CD 3UTAB 4E45A 5B0YB 4WU9D 3LELD 1P3AA 5BNVA 4J8VA 1M19C 3B0BA 4JJND 3X1TA 4YS3A 2RVQC 5DNND 4XUJA 3AZMD 3WTPC 5BT1D 4H9QA 3MGQD 4J8WA 4NFTA 5B2JC 3KWQD 3AZIA 3W99C 5E5AC 3AZED 4J8UD 1KX5C 5B32G 5DNNB 1JFIA 3AV1D 5B32A 2NQBA 5B40C 4XUJB 1TAFB 5DNMB 2NZDA 4H9QB 3AZHC 2F8NG 3AZGA 3X1SD 3X1VC 3AZIB 3KUYA 3AV1B 1BH9A 1TZYA 2CV5C 1BH8A 5AVCD 5GXQA 3LZ0A 3KXBA 4KUDD 1ZLAA 2JSSA 4HGAB 5CP6C 5C3IC 3X1SB 3AFAD 3AZLC 4E44A 1EQZC 1HQ3C 3WAAC 5AV5D 1P3BA 3B0DB 2PYOC 4R8PB 1TZYB 3MGPB 4KUDB 1P3IC 1U35C 1KX3C 3A6NA 5GT0C 3KXBB 4ZUXD 5AY8D 4H9SA 5AV9A 3VH6A 3LELA 1AOID 3NQUA 5AV6C 4Z5TA 3W97A 3REHC 4H9PA 5GT3A 1P3LB 3LZ1A 1M19D 4Z66C 3REIC 5B0ZC 1KX4A 1ID3A 5CPKC 3NQUB 1P3PB 3B6FC 3WTPD 3W96A 4Z5TB 3AV2B 5BS7C 3WKJC 5B2JD 3W99D 3W97B 4KHAB 4WU8A 5AVBA 5B1LA 3C1BA 5CPIA 3O62D 1P3KC 5B40D 5JRGC 3LJAC 3W96B 3AZHD 5GSUC 3AZFD 5B31B 2CV5D 2FJ7C 4KGCC 5B1LB 3C1BB 5CPIB 3TU4C 4H9OA 4AWLB 1F66C 5CP6D 3B6GA 1S32C 1P3MD 1HQ3D 3WAAD 4XZQA 5F99D 4X23B 4DRAA 4CAYA 3MGRC 4J8XC 4WV4B 1U35D 4YM6A 1P34B 1P3MB 4WNNB 4QLCC 5F99B 3AZJC 5B24D 5KDMA 1P3OA 4XZQB 5G49B 1M1AA 1P3AC 4J8VC 3AYWA 4CAYB 1B67A 5CPJD 3X1TC 4YS3C 2HUEB 4XUJC 4Z66D 1M18D 5B1MA 2F8NK 3X1UD 5BNXA 5B33B 4J8WC 1B6WA 3AZNA 3B6FD 4LD9A 3AZIC 1H3OB 2AROA 3WKJD 3AZKA 5AV8A 3UTAA 5B0YA 5CPJB 1M18B 3AYWB 3X1UB 5B32C 5B2ID 2NQBC 3REJB 2NZDC 3REKD 3AZGC 3LJAD 4LD9B 3KSYA 1ULYA 3MGSD 3KUYC 1TZYC 5B2IB 5DNNA 3UT9D 3AZMA 3AN2B 2FJ7D 5GXQC 3KXBC 3LZ0C 3REKB 1ZLAC 3MGQA 1TAFA 3KWQA 5DNMA 3C1CB 4J8UA 4WU9B 1P3BC 2BYMB 3AV1A 4JJNB 3A6NC 3AZMB 4J8XD 4H9SC 5AV9C 3LELC 3MGQB 3RELD 3W98D 3X1SA 3KWQB 4QLCD 3AZEB 4J8UB 3W97C 5GT3C 4R8PA 3MGPA 4KUDA 3LZ1C 3X1TD 1KX4C 1ID3C 5CHLB 5AV5A 3WA9D 2HIOD 3W96C 4J8WD 4WU8C 5AVCB 5AVBC 4CSRA 1P3LA 4ZUXA 5AY8A 5B1LC 5CPIC 3C1BC 1AOIA 3AFAB 4AWLC 5B32D 2NQBD 1P3GC 5AV5B 1P3PA 4G91C 2IO5C 3VH6T 3AV2A 3UTBD 3KUYD 2YFVB 4KHAA 3MVDD 2F8ND 4CSRB 4ZUXB 5AY8B 3MNNC 1AOIB 3LZ0D 4Z2MH 3B6GC 2RVQD 1WWSA 2L5AA 5E5AD 3O62A 5B31A 1M19B 1KX5D 3A6ND 4YM6C 5BO0B 3WTPB
chains in the Genus database with same CATH superfamily
5B2JB 3W99B 2Y2GA 3AZFA 1P3OC 3P5JB 4ZBJC 1KX5B 3X1VD 4G92C 4X23A 3O62B 1M1AC 3AYWC 5B40B 2LY8A 1BFMA 1P34A 1P3MA 5B1MC 1KX4D 3AZHB 3X1VB 3AZLD 4WNNA 5F99A 1P3FC 3AZNC 4LD9C 1EQZD 4NE5A 2ZY3A 2AROC 3AZFB 3AZKC 4DRBA 2CV5B 5AV8C 3UTAC 5B0YC 2PYOD 5G49A 2Y2QA 3VH5T 1P3ID 5CP6B 1KX3D 2JE5A 5GT0D 5B24A 1HQ3B 4WZSB 1EQZB 3WAAB 3H0LC 1P3GD 5B33A 5AV6D 1H3OA 4UPKA 3EPHA 1U35B 3REHD 5CPJA 5DNNC 1Q9CA 3AZMC 1M18A 3X1UA 3MNND 3IP4C 5B24B 3REID 3KWQC 3B6GD 5B0ZD 5BS7A 5DNMC 3REJA 3WKJA 5CPKD 4J8UC 3VH6W 4UUZB 3AV1C 2ZY4A 2DQNC 5B2IA 4Z66B 3REIB 3AN2A 3REKA 1P3KD 4HGAC 3LJAA 3X1SC 3B6FB 3MGSA 3WKJB 5JRGD 3C1CA 4WU9A 3B0DC 2BYMA 5GSUD 4R8PC 3UT9A 1A7WA 3MGPC 4KUDC 1P3KB 4JJNA 4KGCD 1WWIA 5JRGB 3TU4D 5B1MD 5AV5C 4H9NB 3LJAB 3EPJA 1F66D 5GSUB 3MGSB 1P3FD 1S32D 3AZND 3AZEA 1N1JB 3R45A 3AZKD 3NQJB 5AV8D 3UT9B 2FJ7B 1P3LC 4KGCB 2BYKB 4ZUXC 5AY8C 1AOIC 3RELA 3W98A 1F66B 3MGRD 1R4VA 1S32B 2F8NH 1P3PC 1W2EA 3A1IA 3FDDA 4Z5TC 3AZJD 3AV2C 3R45B 3B0CT 2YFWB 3MGRB 4J8XB 5AVCA 3VH5W 3RELB 3W98B 1P3AD 4J8VD 3WA9A 3AFAA 2HIOA 4QLCB 4YS3D 3AZJB 2VQRA 4XUJD 5DNMD 3AZID 1P3AB 5BNVB 2FFFB 2YFVA 5B31C 3O62C 4J8VB 3X1TB 4YS3B 3WA9B 2HIOB 4EO5B 4J8WB 3UTBA 2NZDD 3AZFC 2F8NA 3MVDA 3WTPE 3AZGD 3H0MC 1JFIB 4R8PD 4X23C 1TZYD 3MGPD 1M19A 5B32B 2NQBB 1P34C 1P3MC 2NZDB 5GXQD 5BO0A 3KXBD 2J8PA 3V9RA 4NE6A 3WTPA 1ZLAD 3AZGB 3UTBB 5F99C 5B2JA 3KUYB 3W99A 1BH9B 5E5AA 3MVDB 4XZQC 2F8NB 5B31G 1P3BD 1KX5A 1BH8B 1P3LD 5GXQB 3LZ0B 1ZLAB 5B40A 4M6BA 5B24C 2HUEC 2Y2IA 3V9RB 5AV9D 2Y2LA 5B33C 3AZHA 1P3BB 3X1VA 1P3PD 4NE3A 5E5AB 4Z5TD 3AV2D 2CV5A 3W97D 5GT3D 3A6NB 5CPJC 5FUGA 2CWEA 1M18C 5JA4A 2Y2KA 5AV9B 3X1UC 3LELB 5CP6A 3LZ1D 3AZLA 1EQZA 1HQ3A 3WAAA 3F6TA 4Z2MG 3REJC 1ID3D 4H9RA 2PYOA 4H9PB 5GT3B 3W96D 3B0CW 1P3IA 3LZ1B 5B2IC 5B31D 5FUGB 4WU8D 1U35A 5GT0A 1KX3A 5JA4B 5AVBD 1KX4B 3AN2C 1ID3B 5B1LD 1HTAA 2XD5A 3C1BD 5CPID 3REKC 5C3IB 3AZLB 1P3GA 5AV6A 3MGSC 1F1EA 4H9RB 3C1CC 2PYOB 4WU9C 3REHA 4WU8B 4UUZA 5AVBB 3UT9C 1P3IB 3MNNA 4X23D 1KX3B 4JJNC 5GT0B 4Z66A 3REIA 1P3GB 5B0ZA 1P34D 5BT1C 3MGQC 5CPKA 5AV6B 3B6FA 4G91B 2IO5B 3VH5A 3AZEC 1KU5A 2DF4C 3REHB 4XZQD 1T3UA 3MNNB 3RELC 4H9OB 1P3KA 3W98C 2Y2PA 3B6GB 5B0ZB 4YM6D 5JRGA 5CPKB 4H9NA 5B33D 5GSUA 1N1JA 1P3OD 3NQJA 2UWXA 5AVCC 2FJ7A 4KGCA 2BYKA 4YM6B 1M1AD 3TU4A 3AYWD 3WA9C 3AFAC 2HIOC 1F66A 4EO5C 1P3FA 1S32A 5KDMB 1P3OB 3REJD 4ZBJB 4LD9D 4G92B 1M1AB 2AROD 3UTAD 2YFWA 5B0YD 3MGRA 4J8XA 3TU4B 5B1MB 3AN2D 5BNXB 4QLCA 1P3FB 3AZNB 3AZJA 3UTBC 2AROB 3AZKB 5AV8B 3MVDC 3C1CD 3UTAB 4E45A 5B0YB 4WU9D 3LELD 1P3AA 5BNVA 4J8VA 3A1KA 1M19C 3B0BA 4JJND 3X1TA 4YS3A 2RVQC 5DNND 4XUJA 3AZMD 3WTPC 5BT1D 4H9QA 3MGQD 4J8WA 4NFTA 5B2JC 3KWQD 3AZIA 3W99C 5E5AC 3AZED 4J8UD 1KX5C 1Z2CB 5B32G 5DNNB 1JFIA 3AV1D 4WJ3C 5B32A 2NQBA 5B40C 4XUJB 1TAFB 5DNMB 2NZDA 4H9QB 3AZHC 2F8NG 3AZGA 3X1SD 3X1VC 3AZIB 3KUYA 3AV1B 1BH9A 1TZYA 2CV5C 2F2AC 1BH8A 5AVCD 5GXQA 3LZ0A 3KXBA 4KUDD 1ZLAA 2JSSA 4HGAB 5CP6C 5C3IC 3X1SB 3AFAD 3AZLC 3EG5B 4E44A 1HQ3C 3WAAC 1EQZC 5AV5D 1P3BA 3B0DB 2PYOC 4R8PB 1TZYB 3MGPB 4KUDB 1P3IC 1U35C 1KX3C 3A6NA 5GT0C 3KXBB 4ZUXD 5AY8D 4H9SA 5AV9A 3VH6A 3LELA 1AOID 3NQUA 5AV6C 4Z5TA 1PZRA 3W97A 3REHC 4H9PA 5GT3A 1P3LB 3LZ1A 1M19D 4Z66C 3REIC 5B0ZC 1KX4A 1ID3A 5CPKC 3NQUB 1P3PB 3B6FC 3WTPD 3W96A 4Z5TB 3AV2B 5BS7C 3WKJC 5B2JD 3W99D 3W97B 4KHAB 4WU8A 5AVBA 5B1LA 3C1BA 5CPIA 3O62D 1P3KC 2JCHA 5B40D 5JRGC 3LJAC 3W96B 3AZHD 5GSUC 3AZFD 5B31B 2CV5D 4DQYB 2FJ7C 4KGCC 5B1LB 3C1BB 5CPIB 3TU4C 4H9OA 4AWLB 1F66C 5CP6D 3B6GA 1S32C 1P3MD 1HQ3D 3WAAD 4XZQA 5F99D 4X23B 4DRAA 4CAYA 3MGRC 4J8XC 4WV4B 1U35D 4YM6A 1P34B 1P3MB 2BG1A 4WNNB 4QLCC 5F99B 2ZM5A 3AZJC 5B24D 5KDMA 1P3OA 4XZQB 3AL0C 5G49B 1M1AA 2Y2OA 1P3AC 4J8VC 3AYWA 4CAYB 2G5IC 1B67A 5CPJD 3X1TC 4YS3C 2HUEB 4XUJC 4Z66D 1M18D 5B1MA 2F8NK 3X1UD 5BNXA 5B33B 4J8WC 1B6WA 3AZNA 3B6FD 4LD9A 3AZIC 1H3OB 2AROA 2Y2NA 3AZKA 3WKJD 5AV8A 3UTAA 5B0YA 5CPJB 1M18B 3AYWB 3X1UB 5B32C 5B2ID 2NQBC 3REJB 2NZDC 3REKD 3AZGC 3LJAD 4LD9B 3KSYA 1ULYA 3MGSD 3KUYC 3H0RC 2ZY2A 1TZYC 5B2IB 5DNNA 3UT9D 3AZMA 3AN2B 2FJ7D 5GXQC 3KXBC 3LZ0C 3REKB 1ZLAC 3MGQA 1TAFA 3KWQA 5DNMA 3C1CB 4J8UA 4WU9B 1P3BC 2BYMB 3AV1A 2ZY5A 2Y2MA 4JJNB 3A6NC 3AZMB 4J8XD 4H9SC 5AV9C 3LELC 3MGQB 3RELD 3W98D 3X1SA 3KWQB 4QLCD 3AZEB 4J8UB 3W97C 5GT3C 4R8PA 3MGPA 4KUDA 3LZ1C 3X1TD 1KX4C 2Y2JA 1ID3C 5CHLB 5AV5A 3WA9D 2HIOD 3W96C 4J8WD 3EPLA 4WU8C 5AVCB 5AVBC 4CSRA 1P3LA 4ZUXA 5AY8A 5B1LC 5CPIC 3C1BC 1AOIA 3AFAB 4AWLC 5B32D 2NQBD 1P3GC 5AV5B 1P3PA 4G91C 2IO5C 3VH6T 3AV2A 3UTBD 2RIQA 3KUYD 2YFVB 2XD1A 4KHAA 2W8SA 3MVDD 2F8ND 4CSRB 4ZUXB 5AY8B 3MNNC 1AOIB 3LZ0D 4Z2MH 3B6GC 2RVQD 3KFUG 1WWSA 2G5HC 2L5AA 5E5AD 3O62A 5B31A 1M19B 1KX5D 2Y2HA 3A6ND 4YM6C 3EPKA 5BO0B 3WTPB
chains in the Genus database with same CATH topology
5B2JB 3W99B 2Y2GA 3AZFA 1P3OC 3P5JB 4ZBJC 1KX5B 3X1VD 4G92C 4X23A 3O62B 1M1AC 3AYWC 5B40B 2LY8A 1BFMA 1P34A 1P3MA 5B1MC 1KX4D 3AZHB 3X1VB 3AZLD 4WNNA 5F99A 1P3FC 3AZNC 4LD9C 1EQZD 4NE5A 2ZY3A 2AROC 3AZFB 3AZKC 4DRBA 2CV5B 5AV8C 3UTAC 5B0YC 2PYOD 5G49A 2Y2QA 3VH5T 1P3ID 5CP6B 1KX3D 2JE5A 5GT0D 5B24A 1HQ3B 4WZSB 1EQZB 3WAAB 3H0LC 1P3GD 5B33A 5AV6D 1H3OA 4UPKA 3EPHA 1U35B 3REHD 5CPJA 5DNNC 1Q9CA 3AZMC 1M18A 3X1UA 3MNND 3IP4C 5B24B 3REID 3KWQC 3B6GD 5B0ZD 5BS7A 5DNMC 3REJA 3WKJA 5CPKD 4J8UC 3VH6W 4UUZB 3AV1C 2ZY4A 2DQNC 5B2IA 4Z66B 3REIB 3AN2A 3REKA 1P3KD 4HGAC 3LJAA 3X1SC 3B6FB 3MGSA 3WKJB 5JRGD 3C1CA 4WU9A 3B0DC 2BYMA 5GSUD 4R8PC 3UT9A 1A7WA 3MGPC 4KUDC 1P3KB 4JJNA 4KGCD 1WWIA 5JRGB 3TU4D 5B1MD 5AV5C 4H9NB 3LJAB 3EPJA 1F66D 5GSUB 3MGSB 1P3FD 1S32D 3AZND 3AZEA 1N1JB 3R45A 3AZKD 3NQJB 5AV8D 3UT9B 2FJ7B 1P3LC 4KGCB 2BYKB 4ZUXC 5AY8C 1AOIC 3RELA 3W98A 1F66B 3MGRD 1R4VA 1S32B 2F8NH 1P3PC 1W2EA 3A1IA 3FDDA 4Z5TC 3AZJD 3AV2C 3R45B 3B0CT 2YFWB 3MGRB 4J8XB 5AVCA 3VH5W 3RELB 3W98B 1P3AD 4J8VD 3WA9A 3AFAA 2HIOA 4QLCB 4YS3D 3AZJB 2VQRA 4XUJD 5DNMD 3AZID 1P3AB 5BNVB 2FFFB 2YFVA 5B31C 3O62C 4J8VB 3X1TB 4YS3B 3WA9B 2HIOB 4EO5B 4J8WB 3UTBA 2NZDD 3AZFC 2F8NA 3MVDA 3WTPE 3AZGD 3H0MC 1JFIB 4R8PD 4X23C 1TZYD 3MGPD 1M19A 5B32B 2NQBB 1P34C 1P3MC 2NZDB 5GXQD 5BO0A 3KXBD 2J8PA 3V9RA 4NE6A 3WTPA 1ZLAD 3AZGB 3UTBB 5F99C 5B2JA 3KUYB 3W99A 1BH9B 5E5AA 3MVDB 4XZQC 2F8NB 5B31G 1P3BD 1KX5A 1BH8B 1P3LD 5GXQB 3LZ0B 1ZLAB 5B40A 4M6BA 5B24C 2HUEC 2Y2IA 3V9RB 5AV9D 2Y2LA 5B33C 3AZHA 1P3BB 3X1VA 1P3PD 4NE3A 5E5AB 4Z5TD 3AV2D 2CV5A 3W97D 5GT3D 3A6NB 5CPJC 5FUGA 2CWEA 1M18C 5JA4A 2Y2KA 5AV9B 3X1UC 3LELB 5CP6A 3LZ1D 3AZLA 1EQZA 1HQ3A 3WAAA 3F6TA 4Z2MG 3REJC 1ID3D 4H9RA 2PYOA 4H9PB 5GT3B 3W96D 3B0CW 1P3IA 3LZ1B 5B2IC 5B31D 5FUGB 4WU8D 1U35A 5GT0A 1KX3A 5JA4B 5AVBD 1KX4B 3AN2C 1ID3B 5B1LD 1HTAA 2XD5A 3C1BD 5CPID 3REKC 5C3IB 3AZLB 1P3GA 5AV6A 3MGSC 1F1EA 4H9RB 3C1CC 2PYOB 4WU9C 3REHA 4WU8B 4UUZA 5AVBB 3UT9C 1P3IB 3MNNA 4X23D 1KX3B 4JJNC 5GT0B 4Z66A 3REIA 1P3GB 5B0ZA 1P34D 5BT1C 3MGQC 5CPKA 5AV6B 3B6FA 4G91B 2IO5B 3VH5A 3AZEC 1KU5A 2DF4C 3REHB 4XZQD 1T3UA 3MNNB 3RELC 4H9OB 1P3KA 3W98C 2Y2PA 3B6GB 5B0ZB 4YM6D 5JRGA 5CPKB 4H9NA 5B33D 5GSUA 1N1JA 1P3OD 3NQJA 2UWXA 5AVCC 2FJ7A 4KGCA 2BYKA 4YM6B 1M1AD 3TU4A 3AYWD 3WA9C 3AFAC 2HIOC 1F66A 4EO5C 1P3FA 1S32A 5KDMB 1P3OB 3REJD 4ZBJB 4LD9D 4G92B 1M1AB 2AROD 3UTAD 2YFWA 5B0YD 3MGRA 4J8XA 3TU4B 5B1MB 3AN2D 5BNXB 4QLCA 1P3FB 3AZNB 3AZJA 3UTBC 2AROB 3AZKB 5AV8B 3MVDC 3C1CD 3UTAB 4E45A 5B0YB 4WU9D 3LELD 1P3AA 5BNVA 4J8VA 3A1KA 1M19C 3B0BA 4JJND 3X1TA 4YS3A 2RVQC 5DNND 4XUJA 3AZMD 3WTPC 5BT1D 4H9QA 3MGQD 4J8WA 4NFTA 5B2JC 3KWQD 3AZIA 3W99C 5E5AC 3AZED 4J8UD 1KX5C 1Z2CB 5B32G 5DNNB 1JFIA 3AV1D 4WJ3C 5B32A 2NQBA 5B40C 4XUJB 1TAFB 5DNMB 2NZDA 4H9QB 3AZHC 2F8NG 3AZGA 3X1SD 3X1VC 3AZIB 3KUYA 3AV1B 1BH9A 1TZYA 2CV5C 2F2AC 1BH8A 5AVCD 5GXQA 3LZ0A 3KXBA 4KUDD 1ZLAA 2JSSA 4HGAB 5CP6C 5C3IC 3X1SB 3AFAD 3AZLC 3EG5B 4E44A 1HQ3C 3WAAC 1EQZC 5AV5D 1P3BA 3B0DB 2PYOC 4R8PB 1TZYB 3MGPB 4KUDB 1P3IC 1U35C 1KX3C 3A6NA 5GT0C 3KXBB 4ZUXD 5AY8D 4H9SA 5AV9A 3VH6A 3LELA 1AOID 3NQUA 5AV6C 4Z5TA 1PZRA 3W97A 3REHC 4H9PA 5GT3A 1P3LB 3LZ1A 1M19D 4Z66C 3REIC 5B0ZC 1KX4A 1ID3A 5CPKC 3NQUB 1P3PB 3B6FC 3WTPD 3W96A 4Z5TB 3AV2B 5BS7C 3WKJC 5B2JD 3W99D 3W97B 4KHAB 4WU8A 5AVBA 5B1LA 3C1BA 5CPIA 3O62D 1P3KC 2JCHA 5B40D 5JRGC 3LJAC 3W96B 3AZHD 5GSUC 3AZFD 5B31B 2CV5D 4DQYB 2FJ7C 4KGCC 5B1LB 3C1BB 5CPIB 3TU4C 4H9OA 4AWLB 1F66C 5CP6D 3B6GA 1S32C 1P3MD 1HQ3D 3WAAD 4XZQA 5F99D 4X23B 4DRAA 4CAYA 3MGRC 4J8XC 4WV4B 1U35D 4YM6A 1P34B 1P3MB 2BG1A 4WNNB 4QLCC 5F99B 2ZM5A 3AZJC 5B24D 5KDMA 1P3OA 4XZQB 3AL0C 5G49B 1M1AA 2Y2OA 1P3AC 4J8VC 3AYWA 4CAYB 2G5IC 1B67A 5CPJD 3X1TC 4YS3C 2HUEB 4XUJC 4Z66D 1M18D 5B1MA 2F8NK 3X1UD 5BNXA 5B33B 4J8WC 1B6WA 3AZNA 3B6FD 4LD9A 3AZIC 1H3OB 2AROA 2Y2NA 3AZKA 3WKJD 5AV8A 3UTAA 5B0YA 5CPJB 1M18B 3AYWB 3X1UB 5B32C 5B2ID 2NQBC 3REJB 2NZDC 3REKD 3AZGC 3LJAD 4LD9B 3KSYA 1ULYA 3MGSD 3KUYC 3H0RC 2ZY2A 1TZYC 5B2IB 5DNNA 3UT9D 3AZMA 3AN2B 2FJ7D 5GXQC 3KXBC 3LZ0C 3REKB 1ZLAC 3MGQA 1TAFA 3KWQA 5DNMA 3C1CB 4J8UA 4WU9B 1P3BC 2BYMB 3AV1A 2ZY5A 2Y2MA 4JJNB 3A6NC 3AZMB 4J8XD 4H9SC 5AV9C 3LELC 3MGQB 3RELD 3W98D 3X1SA 3KWQB 4QLCD 3AZEB 4J8UB 3W97C 5GT3C 4R8PA 3MGPA 4KUDA 3LZ1C 3X1TD 1KX4C 2Y2JA 1ID3C 5CHLB 5AV5A 3WA9D 2HIOD 3W96C 4J8WD 3EPLA 4WU8C 5AVCB 5AVBC 4CSRA 1P3LA 4ZUXA 5AY8A 5B1LC 5CPIC 3C1BC 1AOIA 3AFAB 4AWLC 5B32D 2NQBD 1P3GC 5AV5B 1P3PA 4G91C 2IO5C 3VH6T 3AV2A 3UTBD 2RIQA 3KUYD 2YFVB 2XD1A 4KHAA 2W8SA 3MVDD 2F8ND 4CSRB 4ZUXB 5AY8B 3MNNC 1AOIB 3LZ0D 4Z2MH 3B6GC 2RVQD 3KFUG 1WWSA 2G5HC 2L5AA 5E5AD 3O62A 5B31A 1M19B 1KX5D 2Y2HA 3A6ND 4YM6C 3EPKA 5BO0B 3WTPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2J B;  3W99 B;  3AZF A;  1P3O C;  4ZBJ C;  1KX5 B;  3X1V D;  4G92 C;  4X23 A;  3O62 B;  1M1A C;  3AYW C;  5B40 B;  2LY8 A;  1BFM A;  1P34 A;  1P3M A;  5B1M C;  1KX4 D;  3AZH B;  3X1V B;  3AZL D;  4WNN A;  5F99 A;  1P3F C;  3AZN C;  4LD9 C;  1EQZ D;  4NE5 A;  3AZF B;  2ARO C;  3AZK C;  4DRB A;  2CV5 B;  5AV8 C;  3UTA C;  5B0Y C;  2PYO D;  5G49 A;  3VH5 T;  1P3I D;  5CP6 B;  1KX3 D;  5GT0 D;  5B24 A;  1HQ3 B;  4WZS B;  1EQZ B;  3WAA B;  1P3G D;  5B33 A;  5AV6 D;  1H3O A;  1U35 B;  3REH D;  5CPJ A;  5DNN C;  1Q9C A;  3AZM C;  1M18 A;  3X1U A;  3MNN D;  5B24 B;  3REI D;  3KWQ C;  3B6G D;  5B0Z D;  5BS7 A;  5DNM C;  3REJ A;  3WKJ A;  5CPK D;  4J8U C;  3VH6 W;  4UUZ B;  3AV1 C;  5B2I A;  4Z66 B;  3REI B;  3AN2 A;  3REK A;  1P3K D;  4HGA C;  3LJA A;  3X1S C;  3B6F B;  3MGS A;  3WKJ B;  5JRG D;  3C1C A;  4WU9 A;  3B0D C;  2BYM A;  5GSU D;  4R8P C;  3UT9 A;  1A7W A;  3MGP C;  4KUD C;  1P3K B;  4JJN A;  4KGC D;  1WWI A;  5JRG B;  3TU4 D;  5B1M D;  5AV5 C;  4H9N B;  3LJA B;  1F66 D;  5GSU B;  3MGS B;  1P3F D;  1S32 D;  3AZN D;  3AZE A;  1N1J B;  3R45 A;  3AZK D;  3NQJ B;  5AV8 D;  3UT9 B;  2FJ7 B;  1P3L C;  4KGC B;  2BYK B;  4ZUX C;  5AY8 C;  1AOI C;  3REL A;  3W98 A;  1F66 B;  3MGR D;  1R4V A;  1S32 B;  2F8N H;  1P3P C;  4Z5T C;  3AZJ D;  3AV2 C;  3R45 B;  3B0C T;  2YFW B;  3MGR B;  4J8X B;  5AVC A;  3VH5 W;  3REL B;  3W98 B;  1P3A D;  4J8V D;  3WA9 A;  3AFA A;  2HIO A;  4QLC B;  4YS3 D;  3AZJ B;  4XUJ D;  5DNM D;  3AZI D;  1P3A B;  5BNV B;  3O62 C;  2YFV A;  5B31 C;  4J8V B;  3X1T B;  4YS3 B;  3WA9 B;  2HIO B;  4EO5 B;  4J8W B;  3UTB A;  2NZD D;  3AZF C;  2F8N A;  3MVD A;  3WTP E;  3AZG D;  1JFI B;  4R8P D;  4X23 C;  1TZY D;  3MGP D;  1M19 A;  5B32 B;  2NQB B;  1P34 C;  1P3M C;  2NZD B;  5GXQ D;  5BO0 A;  3KXB D;  3V9R A;  3WTP A;  4NE6 A;  1ZLA D;  3AZG B;  3UTB B;  5F99 C;  5B2J A;  3KUY B;  3W99 A;  1BH9 B;  5E5A A;  3MVD B;  4XZQ C;  2F8N B;  5B31 G;  1P3B D;  1KX5 A;  1BH8 B;  1P3L D;  5GXQ B;  3LZ0 B;  1ZLA B;  5B40 A;  4M6B A;  5B24 C;  2HUE C;  3V9R B;  5AV9 D;  5B33 C;  3AZH A;  1P3B B;  3X1V A;  1P3P D;  4NE3 A;  5E5A B;  4Z5T D;  3AV2 D;  2CV5 A;  3W97 D;  5GT3 D;  3A6N B;  5CPJ C;  5FUG A;  2CWE A;  1M18 C;  5JA4 A;  5AV9 B;  3X1U C;  3LEL B;  5CP6 A;  3LZ1 D;  3AZL A;  1EQZ A;  1HQ3 A;  3WAA A;  4Z2M G;  3REJ C;  1ID3 D;  4H9R A;  2PYO A;  4H9P B;  5GT3 B;  3W96 D;  3B0C W;  1P3I A;  3LZ1 B;  5B2I C;  5B31 D;  5FUG B;  4WU8 D;  1U35 A;  5GT0 A;  1KX3 A;  5JA4 B;  5AVB D;  1KX4 B;  3AN2 C;  1ID3 B;  5B1L D;  1HTA A;  3C1B D;  5CPI D;  1P3G A;  3REK C;  5C3I B;  3AZL B;  5AV6 A;  3MGS C;  1F1E A;  4H9R B;  3C1C C;  2PYO B;  4WU9 C;  3REH A;  4WU8 B;  4UUZ A;  5AVB B;  3UT9 C;  1P3I B;  3MNN A;  4X23 D;  1KX3 B;  4JJN C;  5GT0 B;  4Z66 A;  3REI A;  1P3G B;  5B0Z A;  1P34 D;  5BT1 C;  3MGQ C;  5CPK A;  5AV6 B;  3B6F A;  4G91 B;  2IO5 B;  3VH5 A;  3AZE C;  1KU5 A;  3REH B;  4XZQ D;  3MNN B;  3REL C;  4H9O B;  1P3K A;  3W98 C;  3B6G B;  5B0Z B;  4YM6 D;  5JRG A;  5CPK B;  4H9N A;  5B33 D;  5GSU A;  1N1J A;  1P3O D;  3NQJ A;  5AVC C;  2FJ7 A;  4KGC A;  2BYK A;  4YM6 B;  1M1A D;  3TU4 A;  3AYW D;  3WA9 C;  3AFA C;  2HIO C;  1F66 A;  4EO5 C;  1P3F A;  1S32 A;  5KDM B;  1P3O B;  3REJ D;  4ZBJ B;  4LD9 D;  4G92 B;  1M1A B;  2ARO D;  3UTA D;  2YFW A;  5B0Y D;  3MGR A;  4J8X A;  3TU4 B;  5B1M B;  3AN2 D;  5BNX B;  4QLC A;  1P3F B;  3AZN B;  3AZJ A;  3UTB C;  2ARO B;  3AZK B;  5AV8 B;  3MVD C;  3C1C D;  3UTA B;  4E45 A;  5B0Y B;  4WU9 D;  3LEL D;  1P3A A;  5BNV A;  4J8V A;  1M19 C;  3B0B A;  4JJN D;  3X1T A;  4YS3 A;  2RVQ C;  5DNN D;  4XUJ A;  3AZM D;  3WTP C;  5BT1 D;  4H9Q A;  3MGQ D;  4J8W A;  4NFT A;  5B2J C;  3KWQ D;  3AZI A;  3W99 C;  5E5A C;  3AZE D;  4J8U D;  1KX5 C;  5B32 G;  5DNN B;  1JFI A;  3AV1 D;  5B32 A;  2NQB A;  5B40 C;  4XUJ B;  1TAF B;  5DNM B;  2NZD A;  4H9Q B;  3AZH C;  2F8N G;  3AZG A;  3X1S D;  3X1V C;  3AZI B;  3KUY A;  3AV1 B;  1BH9 A;  1TZY A;  2CV5 C;  1BH8 A;  5AVC D;  5GXQ A;  3LZ0 A;  3KXB A;  4KUD D;  1ZLA A;  2JSS A;  4HGA B;  5CP6 C;  5C3I C;  3X1S B;  3AFA D;  3AZL C;  4E44 A;  1EQZ C;  1HQ3 C;  3WAA C;  5AV5 D;  1P3B A;  3B0D B;  2PYO C;  4R8P B;  1TZY B;  3MGP B;  4KUD B;  1P3I C;  1U35 C;  1KX3 C;  3A6N A;  5GT0 C;  3KXB B;  4ZUX D;  5AY8 D;  4H9S A;  5AV9 A;  3VH6 A;  3LEL A;  1AOI D;  3NQU A;  5AV6 C;  4Z5T A;  3W97 A;  3REH C;  4H9P A;  5GT3 A;  1P3L B;  3LZ1 A;  1M19 D;  4Z66 C;  3REI C;  5B0Z C;  1KX4 A;  1ID3 A;  5CPK C;  3NQU B;  1P3P B;  3B6F C;  3WTP D;  3W96 A;  4Z5T B;  3AV2 B;  5BS7 C;  3WKJ C;  5B2J D;  3W99 D;  3W97 B;  4KHA B;  4WU8 A;  5AVB A;  5B1L A;  3C1B A;  5CPI A;  3O62 D;  1P3K C;  5B40 D;  5JRG C;  3LJA C;  3W96 B;  3AZH D;  5GSU C;  3AZF D;  5B31 B;  2CV5 D;  2FJ7 C;  4KGC C;  5B1L B;  3C1B B;  5CPI B;  3TU4 C;  4H9O A;  4AWL B;  1F66 C;  5CP6 D;  3B6G A;  1S32 C;  1P3M D;  1HQ3 D;  3WAA D;  4XZQ A;  5F99 D;  4X23 B;  4DRA A;  4CAY A;  3MGR C;  4J8X C;  4WV4 B;  1U35 D;  4YM6 A;  1P34 B;  1P3M B;  4WNN B;  4QLC C;  5F99 B;  3AZJ C;  5B24 D;  5KDM A;  1P3O A;  4XZQ B;  5G49 B;  1M1A A;  1P3A C;  4J8V C;  3AYW A;  4CAY B;  1B67 A;  5CPJ D;  3X1T C;  4YS3 C;  2HUE B;  4XUJ C;  4Z66 D;  1M18 D;  5B1M A;  2F8N K;  3X1U D;  5BNX A;  5B33 B;  4J8W C;  1B6W A;  3AZN A;  3B6F D;  4LD9 A;  3AZI C;  1H3O B;  2ARO A;  3WKJ D;  3AZK A;  5AV8 A;  3UTA A;  5B0Y A;  5CPJ B;  1M18 B;  3AYW B;  3X1U B;  5B32 C;  5B2I D;  2NQB C;  3REJ B;  2NZD C;  3REK D;  3AZG C;  3LJA D;  4LD9 B;  3KSY A;  1ULY A;  3MGS D;  3KUY C;  1TZY C;  5B2I B;  5DNN A;  3UT9 D;  3AZM A;  3AN2 B;  2FJ7 D;  5GXQ C;  3KXB C;  3LZ0 C;  3REK B;  1ZLA C;  3MGQ A;  1TAF A;  3KWQ A;  5DNM A;  3C1C B;  4J8U A;  4WU9 B;  1P3B C;  2BYM B;  3AV1 A;  4JJN B;  3A6N C;  3AZM B;  4J8X D;  4H9S C;  5AV9 C;  3LEL C;  3MGQ B;  3REL D;  3W98 D;  3X1S A;  3KWQ B;  4QLC D;  3AZE B;  4J8U B;  3W97 C;  5GT3 C;  4R8P A;  3MGP A;  4KUD A;  3LZ1 C;  3X1T D;  1KX4 C;  1ID3 C;  5CHL B;  5AV5 A;  3WA9 D;  2HIO D;  3W96 C;  4J8W D;  4WU8 C;  5AVC B;  5AVB C;  4CSR A;  1P3L A;  4ZUX A;  5AY8 A;  5B1L C;  5CPI C;  3C1B C;  1AOI A;  3AFA B;  4AWL C;  5B32 D;  2NQB D;  1P3G C;  5AV5 B;  1P3P A;  4G91 C;  2IO5 C;  3VH6 T;  3AV2 A;  3UTB D;  3KUY D;  2YFV B;  4KHA A;  3MVD D;  2F8N D;  4CSR B;  4ZUX B;  5AY8 B;  3MNN C;  1AOI B;  3LZ0 D;  4Z2M H;  3B6G C;  2RVQ D;  1WWS A;  2L5A A;  5E5A D;  3O62 A;  5B31 A;  1M19 B;  1KX5 D;  3A6N D;  4YM6 C;  5BO0 B;  3WTP B; 
#chains in the Genus database with same CATH topology
 5B2J B;  3W99 B;  2Y2G A;  3AZF A;  1P3O C;  3P5J B;  4ZBJ C;  1KX5 B;  3X1V D;  4G92 C;  4X23 A;  3O62 B;  1M1A C;  3AYW C;  5B40 B;  2LY8 A;  1BFM A;  1P34 A;  1P3M A;  5B1M C;  1KX4 D;  3AZH B;  3X1V B;  3AZL D;  4WNN A;  5F99 A;  1P3F C;  3AZN C;  4LD9 C;  1EQZ D;  4NE5 A;  2ZY3 A;  2ARO C;  3AZF B;  3AZK C;  4DRB A;  2CV5 B;  5AV8 C;  3UTA C;  5B0Y C;  2PYO D;  5G49 A;  2Y2Q A;  3VH5 T;  1P3I D;  5CP6 B;  1KX3 D;  2JE5 A;  5GT0 D;  5B24 A;  1HQ3 B;  4WZS B;  1EQZ B;  3WAA B;  3H0L C;  1P3G D;  5B33 A;  5AV6 D;  1H3O A;  4UPK A;  3EPH A;  1U35 B;  3REH D;  5CPJ A;  5DNN C;  1Q9C A;  3AZM C;  1M18 A;  3X1U A;  3MNN D;  3IP4 C;  5B24 B;  3REI D;  3KWQ C;  3B6G D;  5B0Z D;  5BS7 A;  5DNM C;  3REJ A;  3WKJ A;  5CPK D;  4J8U C;  3VH6 W;  4UUZ B;  3AV1 C;  2ZY4 A;  2DQN C;  5B2I A;  4Z66 B;  3REI B;  3AN2 A;  3REK A;  1P3K D;  4HGA C;  3LJA A;  3X1S C;  3B6F B;  3MGS A;  3WKJ B;  5JRG D;  3C1C A;  4WU9 A;  3B0D C;  2BYM A;  5GSU D;  4R8P C;  3UT9 A;  1A7W A;  3MGP C;  4KUD C;  1P3K B;  4JJN A;  4KGC D;  1WWI A;  5JRG B;  3TU4 D;  5B1M D;  5AV5 C;  4H9N B;  3LJA B;  3EPJ A;  1F66 D;  5GSU B;  3MGS B;  1P3F D;  1S32 D;  3AZN D;  3AZE A;  1N1J B;  3R45 A;  3AZK D;  3NQJ B;  5AV8 D;  3UT9 B;  2FJ7 B;  1P3L C;  4KGC B;  2BYK B;  4ZUX C;  5AY8 C;  1AOI C;  3REL A;  3W98 A;  1F66 B;  3MGR D;  1R4V A;  1S32 B;  2F8N H;  1P3P C;  1W2E A;  3A1I A;  3FDD A;  4Z5T C;  3AZJ D;  3AV2 C;  3R45 B;  3B0C T;  2YFW B;  3MGR B;  4J8X B;  5AVC A;  3VH5 W;  3REL B;  3W98 B;  1P3A D;  4J8V D;  3WA9 A;  3AFA A;  2HIO A;  4QLC B;  4YS3 D;  3AZJ B;  2VQR A;  4XUJ D;  5DNM D;  3AZI D;  1P3A B;  5BNV B;  2FFF B;  2YFV A;  5B31 C;  3O62 C;  4J8V B;  3X1T B;  4YS3 B;  3WA9 B;  2HIO B;  4EO5 B;  4J8W B;  3UTB A;  2NZD D;  3AZF C;  2F8N A;  3MVD A;  3WTP E;  3AZG D;  3H0M C;  1JFI B;  4R8P D;  4X23 C;  1TZY D;  3MGP D;  1M19 A;  5B32 B;  2NQB B;  1P34 C;  1P3M C;  2NZD B;  5GXQ D;  5BO0 A;  3KXB D;  2J8P A;  3V9R A;  4NE6 A;  3WTP A;  1ZLA D;  3AZG B;  3UTB B;  5F99 C;  5B2J A;  3KUY B;  3W99 A;  1BH9 B;  5E5A A;  3MVD B;  4XZQ C;  2F8N B;  5B31 G;  1P3B D;  1KX5 A;  1BH8 B;  1P3L D;  5GXQ B;  3LZ0 B;  1ZLA B;  5B40 A;  4M6B A;  5B24 C;  2HUE C;  2Y2I A;  3V9R B;  5AV9 D;  2Y2L A;  5B33 C;  3AZH A;  1P3B B;  3X1V A;  1P3P D;  4NE3 A;  5E5A B;  4Z5T D;  3AV2 D;  2CV5 A;  3W97 D;  5GT3 D;  3A6N B;  5CPJ C;  5FUG A;  2CWE A;  1M18 C;  5JA4 A;  2Y2K A;  5AV9 B;  3X1U C;  3LEL B;  5CP6 A;  3LZ1 D;  3AZL A;  1EQZ A;  1HQ3 A;  3WAA A;  3F6T A;  4Z2M G;  3REJ C;  1ID3 D;  4H9R A;  2PYO A;  4H9P B;  5GT3 B;  3W96 D;  3B0C W;  1P3I A;  3LZ1 B;  5B2I C;  5B31 D;  5FUG B;  4WU8 D;  1U35 A;  5GT0 A;  1KX3 A;  5JA4 B;  5AVB D;  1KX4 B;  3AN2 C;  1ID3 B;  5B1L D;  1HTA A;  2XD5 A;  3C1B D;  5CPI D;  3REK C;  5C3I B;  3AZL B;  1P3G A;  5AV6 A;  3MGS C;  1F1E A;  4H9R B;  3C1C C;  2PYO B;  4WU9 C;  3REH A;  4WU8 B;  4UUZ A;  5AVB B;  3UT9 C;  1P3I B;  3MNN A;  4X23 D;  1KX3 B;  4JJN C;  5GT0 B;  4Z66 A;  3REI A;  1P3G B;  5B0Z A;  1P34 D;  5BT1 C;  3MGQ C;  5CPK A;  5AV6 B;  3B6F A;  4G91 B;  2IO5 B;  3VH5 A;  3AZE C;  1KU5 A;  2DF4 C;  3REH B;  4XZQ D;  1T3U A;  3MNN B;  3REL C;  4H9O B;  1P3K A;  3W98 C;  2Y2P A;  3B6G B;  5B0Z B;  4YM6 D;  5JRG A;  5CPK B;  4H9N A;  5B33 D;  5GSU A;  1N1J A;  1P3O D;  3NQJ A;  2UWX A;  5AVC C;  2FJ7 A;  4KGC A;  2BYK A;  4YM6 B;  1M1A D;  3TU4 A;  3AYW D;  3WA9 C;  3AFA C;  2HIO C;  1F66 A;  4EO5 C;  1P3F A;  1S32 A;  5KDM B;  1P3O B;  3REJ D;  4ZBJ B;  4LD9 D;  4G92 B;  1M1A B;  2ARO D;  3UTA D;  2YFW A;  5B0Y D;  3MGR A;  4J8X A;  3TU4 B;  5B1M B;  3AN2 D;  5BNX B;  4QLC A;  1P3F B;  3AZN B;  3AZJ A;  3UTB C;  2ARO B;  3AZK B;  5AV8 B;  3MVD C;  3C1C D;  3UTA B;  4E45 A;  5B0Y B;  4WU9 D;  3LEL D;  1P3A A;  5BNV A;  4J8V A;  3A1K A;  1M19 C;  3B0B A;  4JJN D;  3X1T A;  4YS3 A;  2RVQ C;  5DNN D;  4XUJ A;  3AZM D;  3WTP C;  5BT1 D;  4H9Q A;  3MGQ D;  4J8W A;  4NFT A;  5B2J C;  3KWQ D;  3AZI A;  3W99 C;  5E5A C;  3AZE D;  4J8U D;  1KX5 C;  1Z2C B;  5B32 G;  5DNN B;  1JFI A;  3AV1 D;  4WJ3 C;  5B32 A;  2NQB A;  5B40 C;  4XUJ B;  1TAF B;  5DNM B;  2NZD A;  4H9Q B;  3AZH C;  2F8N G;  3AZG A;  3X1S D;  3X1V C;  3AZI B;  3KUY A;  3AV1 B;  1BH9 A;  1TZY A;  2CV5 C;  2F2A C;  1BH8 A;  5AVC D;  5GXQ A;  3LZ0 A;  3KXB A;  4KUD D;  1ZLA A;  2JSS A;  4HGA B;  5CP6 C;  5C3I C;  3X1S B;  3AFA D;  3AZL C;  3EG5 B;  4E44 A;  1HQ3 C;  3WAA C;  1EQZ C;  5AV5 D;  1P3B A;  3B0D B;  2PYO C;  4R8P B;  1TZY B;  3MGP B;  4KUD B;  1P3I C;  1U35 C;  1KX3 C;  3A6N A;  5GT0 C;  3KXB B;  4ZUX D;  5AY8 D;  4H9S A;  5AV9 A;  3VH6 A;  3LEL A;  1AOI D;  3NQU A;  5AV6 C;  4Z5T A;  1PZR A;  3W97 A;  3REH C;  4H9P A;  5GT3 A;  1P3L B;  3LZ1 A;  1M19 D;  4Z66 C;  3REI C;  5B0Z C;  1KX4 A;  1ID3 A;  5CPK C;  3NQU B;  1P3P B;  3B6F C;  3WTP D;  3W96 A;  4Z5T B;  3AV2 B;  5BS7 C;  3WKJ C;  5B2J D;  3W99 D;  3W97 B;  4KHA B;  4WU8 A;  5AVB A;  5B1L A;  3C1B A;  5CPI A;  3O62 D;  1P3K C;  2JCH A;  5B40 D;  5JRG C;  3LJA C;  3W96 B;  3AZH D;  5GSU C;  3AZF D;  5B31 B;  2CV5 D;  4DQY B;  2FJ7 C;  4KGC C;  5B1L B;  3C1B B;  5CPI B;  3TU4 C;  4H9O A;  4AWL B;  1F66 C;  5CP6 D;  3B6G A;  1S32 C;  1P3M D;  1HQ3 D;  3WAA D;  4XZQ A;  5F99 D;  4X23 B;  4DRA A;  4CAY A;  3MGR C;  4J8X C;  4WV4 B;  1U35 D;  4YM6 A;  1P34 B;  1P3M B;  2BG1 A;  4WNN B;  4QLC C;  5F99 B;  2ZM5 A;  3AZJ C;  5B24 D;  5KDM A;  1P3O A;  4XZQ B;  3AL0 C;  5G49 B;  1M1A A;  2Y2O A;  1P3A C;  4J8V C;  3AYW A;  4CAY B;  2G5I C;  1B67 A;  5CPJ D;  3X1T C;  4YS3 C;  2HUE B;  4XUJ C;  4Z66 D;  1M18 D;  5B1M A;  2F8N K;  3X1U D;  5BNX A;  5B33 B;  4J8W C;  1B6W A;  3AZN A;  3B6F D;  4LD9 A;  3AZI C;  1H3O B;  2ARO A;  2Y2N A;  3AZK A;  3WKJ D;  5AV8 A;  3UTA A;  5B0Y A;  5CPJ B;  1M18 B;  3AYW B;  3X1U B;  5B32 C;  5B2I D;  2NQB C;  3REJ B;  2NZD C;  3REK D;  3AZG C;  3LJA D;  4LD9 B;  3KSY A;  1ULY A;  3MGS D;  3KUY C;  3H0R C;  2ZY2 A;  1TZY C;  5B2I B;  5DNN A;  3UT9 D;  3AZM A;  3AN2 B;  2FJ7 D;  5GXQ C;  3KXB C;  3LZ0 C;  3REK B;  1ZLA C;  3MGQ A;  1TAF A;  3KWQ A;  5DNM A;  3C1C B;  4J8U A;  4WU9 B;  1P3B C;  2BYM B;  3AV1 A;  2ZY5 A;  2Y2M A;  4JJN B;  3A6N C;  3AZM B;  4J8X D;  4H9S C;  5AV9 C;  3LEL C;  3MGQ B;  3REL D;  3W98 D;  3X1S A;  3KWQ B;  4QLC D;  3AZE B;  4J8U B;  3W97 C;  5GT3 C;  4R8P A;  3MGP A;  4KUD A;  3LZ1 C;  3X1T D;  1KX4 C;  2Y2J A;  1ID3 C;  5CHL B;  5AV5 A;  3WA9 D;  2HIO D;  3W96 C;  4J8W D;  3EPL A;  4WU8 C;  5AVC B;  5AVB C;  4CSR A;  1P3L A;  4ZUX A;  5AY8 A;  5B1L C;  5CPI C;  3C1B C;  1AOI A;  3AFA B;  4AWL C;  5B32 D;  2NQB D;  1P3G C;  5AV5 B;  1P3P A;  4G91 C;  2IO5 C;  3VH6 T;  3AV2 A;  3UTB D;  2RIQ A;  3KUY D;  2YFV B;  2XD1 A;  4KHA A;  2W8S A;  3MVD D;  2F8N D;  4CSR B;  4ZUX B;  5AY8 B;  3MNN C;  1AOI B;  3LZ0 D;  4Z2M H;  3B6G C;  2RVQ D;  3KFU G;  1WWS A;  2G5H C;  2L5A A;  5E5A D;  3O62 A;  5B31 A;  1M19 B;  1KX5 D;  2Y2H A;  3A6N D;  4YM6 C;  3EPK A;  5BO0 B;  3WTP B; 
#chains in the Genus database with same CATH homology
 5B2J B;  3W99 B;  2Y2G A;  3AZF A;  1P3O C;  3P5J B;  4ZBJ C;  1KX5 B;  3X1V D;  4G92 C;  4X23 A;  3O62 B;  1M1A C;  3AYW C;  5B40 B;  2LY8 A;  1BFM A;  1P34 A;  1P3M A;  5B1M C;  1KX4 D;  3AZH B;  3X1V B;  3AZL D;  4WNN A;  5F99 A;  1P3F C;  3AZN C;  4LD9 C;  1EQZ D;  4NE5 A;  2ZY3 A;  2ARO C;  3AZF B;  3AZK C;  4DRB A;  2CV5 B;  5AV8 C;  3UTA C;  5B0Y C;  2PYO D;  5G49 A;  2Y2Q A;  3VH5 T;  1P3I D;  5CP6 B;  1KX3 D;  2JE5 A;  5GT0 D;  5B24 A;  1HQ3 B;  4WZS B;  1EQZ B;  3WAA B;  3H0L C;  1P3G D;  5B33 A;  5AV6 D;  1H3O A;  4UPK A;  3EPH A;  1U35 B;  3REH D;  5CPJ A;  5DNN C;  1Q9C A;  3AZM C;  1M18 A;  3X1U A;  3MNN D;  3IP4 C;  5B24 B;  3REI D;  3KWQ C;  3B6G D;  5B0Z D;  5BS7 A;  5DNM C;  3REJ A;  3WKJ A;  5CPK D;  4J8U C;  3VH6 W;  4UUZ B;  3AV1 C;  2ZY4 A;  2DQN C;  5B2I A;  4Z66 B;  3REI B;  3AN2 A;  3REK A;  1P3K D;  4HGA C;  3LJA A;  3X1S C;  3B6F B;  3MGS A;  3WKJ B;  5JRG D;  3C1C A;  4WU9 A;  3B0D C;  2BYM A;  5GSU D;  4R8P C;  3UT9 A;  1A7W A;  3MGP C;  4KUD C;  1P3K B;  4JJN A;  4KGC D;  1WWI A;  5JRG B;  3TU4 D;  5B1M D;  5AV5 C;  4H9N B;  3LJA B;  3EPJ A;  1F66 D;  5GSU B;  3MGS B;  1P3F D;  1S32 D;  3AZN D;  3AZE A;  1N1J B;  3R45 A;  3AZK D;  3NQJ B;  5AV8 D;  3UT9 B;  2FJ7 B;  1P3L C;  4KGC B;  2BYK B;  4ZUX C;  5AY8 C;  1AOI C;  3REL A;  3W98 A;  1F66 B;  3MGR D;  1R4V A;  1S32 B;  2F8N H;  1P3P C;  1W2E A;  3A1I A;  3FDD A;  4Z5T C;  3AZJ D;  3AV2 C;  3R45 B;  3B0C T;  2YFW B;  3MGR B;  4J8X B;  5AVC A;  3VH5 W;  3REL B;  3W98 B;  1P3A D;  4J8V D;  3WA9 A;  3AFA A;  2HIO A;  4QLC B;  4YS3 D;  3AZJ B;  2VQR A;  4XUJ D;  5DNM D;  3AZI D;  1P3A B;  5BNV B;  2FFF B;  2YFV A;  5B31 C;  3O62 C;  4J8V B;  3X1T B;  4YS3 B;  3WA9 B;  2HIO B;  4EO5 B;  4J8W B;  3UTB A;  2NZD D;  3AZF C;  2F8N A;  3MVD A;  3WTP E;  3AZG D;  3H0M C;  1JFI B;  4R8P D;  4X23 C;  1TZY D;  3MGP D;  1M19 A;  5B32 B;  2NQB B;  1P34 C;  1P3M C;  2NZD B;  5GXQ D;  5BO0 A;  3KXB D;  2J8P A;  3V9R A;  4NE6 A;  3WTP A;  1ZLA D;  3AZG B;  3UTB B;  5F99 C;  5B2J A;  3KUY B;  3W99 A;  1BH9 B;  5E5A A;  3MVD B;  4XZQ C;  2F8N B;  5B31 G;  1P3B D;  1KX5 A;  1BH8 B;  1P3L D;  5GXQ B;  3LZ0 B;  1ZLA B;  5B40 A;  4M6B A;  5B24 C;  2HUE C;  2Y2I A;  3V9R B;  5AV9 D;  2Y2L A;  5B33 C;  3AZH A;  1P3B B;  3X1V A;  1P3P D;  4NE3 A;  5E5A B;  4Z5T D;  3AV2 D;  2CV5 A;  3W97 D;  5GT3 D;  3A6N B;  5CPJ C;  5FUG A;  2CWE A;  1M18 C;  5JA4 A;  2Y2K A;  5AV9 B;  3X1U C;  3LEL B;  5CP6 A;  3LZ1 D;  3AZL A;  1EQZ A;  1HQ3 A;  3WAA A;  3F6T A;  4Z2M G;  3REJ C;  1ID3 D;  4H9R A;  2PYO A;  4H9P B;  5GT3 B;  3W96 D;  3B0C W;  1P3I A;  3LZ1 B;  5B2I C;  5B31 D;  5FUG B;  4WU8 D;  1U35 A;  5GT0 A;  1KX3 A;  5JA4 B;  5AVB D;  1KX4 B;  3AN2 C;  1ID3 B;  5B1L D;  1HTA A;  2XD5 A;  3C1B D;  5CPI D;  3REK C;  5C3I B;  3AZL B;  1P3G A;  5AV6 A;  3MGS C;  1F1E A;  4H9R B;  3C1C C;  2PYO B;  4WU9 C;  3REH A;  4WU8 B;  4UUZ A;  5AVB B;  3UT9 C;  1P3I B;  3MNN A;  4X23 D;  1KX3 B;  4JJN C;  5GT0 B;  4Z66 A;  3REI A;  1P3G B;  5B0Z A;  1P34 D;  5BT1 C;  3MGQ C;  5CPK A;  5AV6 B;  3B6F A;  4G91 B;  2IO5 B;  3VH5 A;  3AZE C;  1KU5 A;  2DF4 C;  3REH B;  4XZQ D;  1T3U A;  3MNN B;  3REL C;  4H9O B;  1P3K A;  3W98 C;  2Y2P A;  3B6G B;  5B0Z B;  4YM6 D;  5JRG A;  5CPK B;  4H9N A;  5B33 D;  5GSU A;  1N1J A;  1P3O D;  3NQJ A;  2UWX A;  5AVC C;  2FJ7 A;  4KGC A;  2BYK A;  4YM6 B;  1M1A D;  3TU4 A;  3AYW D;  3WA9 C;  3AFA C;  2HIO C;  1F66 A;  4EO5 C;  1P3F A;  1S32 A;  5KDM B;  1P3O B;  3REJ D;  4ZBJ B;  4LD9 D;  4G92 B;  1M1A B;  2ARO D;  3UTA D;  2YFW A;  5B0Y D;  3MGR A;  4J8X A;  3TU4 B;  5B1M B;  3AN2 D;  5BNX B;  4QLC A;  1P3F B;  3AZN B;  3AZJ A;  3UTB C;  2ARO B;  3AZK B;  5AV8 B;  3MVD C;  3C1C D;  3UTA B;  4E45 A;  5B0Y B;  4WU9 D;  3LEL D;  1P3A A;  5BNV A;  4J8V A;  3A1K A;  1M19 C;  3B0B A;  4JJN D;  3X1T A;  4YS3 A;  2RVQ C;  5DNN D;  4XUJ A;  3AZM D;  3WTP C;  5BT1 D;  4H9Q A;  3MGQ D;  4J8W A;  4NFT A;  5B2J C;  3KWQ D;  3AZI A;  3W99 C;  5E5A C;  3AZE D;  4J8U D;  1KX5 C;  1Z2C B;  5B32 G;  5DNN B;  1JFI A;  3AV1 D;  4WJ3 C;  5B32 A;  2NQB A;  5B40 C;  4XUJ B;  1TAF B;  5DNM B;  2NZD A;  4H9Q B;  3AZH C;  2F8N G;  3AZG A;  3X1S D;  3X1V C;  3AZI B;  3KUY A;  3AV1 B;  1BH9 A;  1TZY A;  2CV5 C;  2F2A C;  1BH8 A;  5AVC D;  5GXQ A;  3LZ0 A;  3KXB A;  4KUD D;  1ZLA A;  2JSS A;  4HGA B;  5CP6 C;  5C3I C;  3X1S B;  3AFA D;  3AZL C;  3EG5 B;  4E44 A;  1HQ3 C;  3WAA C;  1EQZ C;  5AV5 D;  1P3B A;  3B0D B;  2PYO C;  4R8P B;  1TZY B;  3MGP B;  4KUD B;  1P3I C;  1U35 C;  1KX3 C;  3A6N A;  5GT0 C;  3KXB B;  4ZUX D;  5AY8 D;  4H9S A;  5AV9 A;  3VH6 A;  3LEL A;  1AOI D;  3NQU A;  5AV6 C;  4Z5T A;  1PZR A;  3W97 A;  3REH C;  4H9P A;  5GT3 A;  1P3L B;  3LZ1 A;  1M19 D;  4Z66 C;  3REI C;  5B0Z C;  1KX4 A;  1ID3 A;  5CPK C;  3NQU B;  1P3P B;  3B6F C;  3WTP D;  3W96 A;  4Z5T B;  3AV2 B;  5BS7 C;  3WKJ C;  5B2J D;  3W99 D;  3W97 B;  4KHA B;  4WU8 A;  5AVB A;  5B1L A;  3C1B A;  5CPI A;  3O62 D;  1P3K C;  2JCH A;  5B40 D;  5JRG C;  3LJA C;  3W96 B;  3AZH D;  5GSU C;  3AZF D;  5B31 B;  2CV5 D;  4DQY B;  2FJ7 C;  4KGC C;  5B1L B;  3C1B B;  5CPI B;  3TU4 C;  4H9O A;  4AWL B;  1F66 C;  5CP6 D;  3B6G A;  1S32 C;  1P3M D;  1HQ3 D;  3WAA D;  4XZQ A;  5F99 D;  4X23 B;  4DRA A;  4CAY A;  3MGR C;  4J8X C;  4WV4 B;  1U35 D;  4YM6 A;  1P34 B;  1P3M B;  2BG1 A;  4WNN B;  4QLC C;  5F99 B;  2ZM5 A;  3AZJ C;  5B24 D;  5KDM A;  1P3O A;  4XZQ B;  3AL0 C;  5G49 B;  1M1A A;  2Y2O A;  1P3A C;  4J8V C;  3AYW A;  4CAY B;  2G5I C;  1B67 A;  5CPJ D;  3X1T C;  4YS3 C;  2HUE B;  4XUJ C;  4Z66 D;  1M18 D;  5B1M A;  2F8N K;  3X1U D;  5BNX A;  5B33 B;  4J8W C;  1B6W A;  3AZN A;  3B6F D;  4LD9 A;  3AZI C;  1H3O B;  2ARO A;  2Y2N A;  3AZK A;  3WKJ D;  5AV8 A;  3UTA A;  5B0Y A;  5CPJ B;  1M18 B;  3AYW B;  3X1U B;  5B32 C;  5B2I D;  2NQB C;  3REJ B;  2NZD C;  3REK D;  3AZG C;  3LJA D;  4LD9 B;  3KSY A;  1ULY A;  3MGS D;  3KUY C;  3H0R C;  2ZY2 A;  1TZY C;  5B2I B;  5DNN A;  3UT9 D;  3AZM A;  3AN2 B;  2FJ7 D;  5GXQ C;  3KXB C;  3LZ0 C;  3REK B;  1ZLA C;  3MGQ A;  1TAF A;  3KWQ A;  5DNM A;  3C1C B;  4J8U A;  4WU9 B;  1P3B C;  2BYM B;  3AV1 A;  2ZY5 A;  2Y2M A;  4JJN B;  3A6N C;  3AZM B;  4J8X D;  4H9S C;  5AV9 C;  3LEL C;  3MGQ B;  3REL D;  3W98 D;  3X1S A;  3KWQ B;  4QLC D;  3AZE B;  4J8U B;  3W97 C;  5GT3 C;  4R8P A;  3MGP A;  4KUD A;  3LZ1 C;  3X1T D;  1KX4 C;  2Y2J A;  1ID3 C;  5CHL B;  5AV5 A;  3WA9 D;  2HIO D;  3W96 C;  4J8W D;  3EPL A;  4WU8 C;  5AVC B;  5AVB C;  4CSR A;  1P3L A;  4ZUX A;  5AY8 A;  5B1L C;  5CPI C;  3C1B C;  1AOI A;  3AFA B;  4AWL C;  5B32 D;  2NQB D;  1P3G C;  5AV5 B;  1P3P A;  4G91 C;  2IO5 C;  3VH6 T;  3AV2 A;  3UTB D;  2RIQ A;  3KUY D;  2YFV B;  2XD1 A;  4KHA A;  2W8S A;  3MVD D;  2F8N D;  4CSR B;  4ZUX B;  5AY8 B;  3MNN C;  1AOI B;  3LZ0 D;  4Z2M H;  3B6G C;  2RVQ D;  3KFU G;  1WWS A;  2G5H C;  2L5A A;  5E5A D;  3O62 A;  5B31 A;  1M19 B;  1KX5 D;  2Y2H A;  3A6N D;  4YM6 C;  3EPK A;  5BO0 B;  3WTP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...