4R8PC

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pC00
5B1LA 3X1VA 5CPID 3REHB 5CP6B 3NQJA 1F66D 1EQZD 1EQZC 1P3GD 3B6FB 3LJAA 3W99C 4H9NB 5AV8B 4KGCD 3MGRD 3C1BD 5F99C 3MGRC 3C1BC 2NZDA 4H9RB 3MVDD 1KX3D 4KUDC 1KX3C 5CPIA 2RVQD 5B24D 5E5AC 4E44A 5B24C 4XUJB 2F8NG 1HTAA 4G91B 5GXQB 1F66A 2FJ7D 1ID3D 5B2JC 3AZED 1EQZA 4E45A 2FJ7C 1N1JA 1ID3C 3AZEC 4X23B 1P3GA 5B0YC 3NQUA 5B32G 1WWSA 4KGCA 5B1MB 3MGRA 3C1BA 4WNNB 3V9RB 3AZJC 3MVDA 4J8WD 2F8NH 1KX3A 4J8WC 1KX4C 4ZUXB 5B24A 4G92B 3AV2B 3LZ1C 3A6ND 2FJ7A 1ID3A 3AZEA 5JRGD 3KUYB 1P3IB 3O62B 3WAAC 5DNND 5AV9B 2F8NB 3MNNB 1P3BD 3LELD 1S32D 4DRAA 1HQ3B 4J8WA 3REKD 3REJC 1P3OD 3LZ0B 3C1CD 3AZHC 1P3PD 3AZID 3AN2D 1P3PC 3AZIC 5CHLB 3A6NA 3AN2C 2AROC 5GT0D 4H9OA 5BO0B 5JRGA 3AFAD 1M1AB 5GT0C 3AFAC 5CPKB 5FUGA 3TU4B 1P3LC 3MGPB 5DNNA 3RELC 1ZLAC 5AVBD 2PYOB 3WA9D 4R8PD 1P3BA 5AVBC 3LELA 5GSUD 1S32A 4R8PC 3X1VB 3WA9C 5GSUC 3NQJB 3UT9D 2YFVA 3REKA 1P3OA 5AV5B 3C1CA 3AZKD 1P3PA 3AZIA 3AN2A 2YFWA 1P3FC 4EO5C 5GT0A 3AFAA 1P34D 4XZQC 2NZDB 5AVBA 1BH8A 4Z2MG 4R8PA 5B31G 4J8UC 3WA9A 2F8NK 5GSUA 5CPIB 1M18D 3UTBB 1M18C 3UT9A 4H9PB 1F66B 3VH5A 4J8XB 3AZKA 5B2ID 4WU8C 1BH9B 3REIB 2L5AA 1P3GB 5B40B 5GT3D 1KX5C 4KGCB 1WWIA 4Z2MH 4WV4B 1P34A 2NQBC 4J8VC 3MVDB 3KXBB 4YS3C 5AV6C 3O62C 2CV5D 1P3KD 3VH6W 2CWEA 1P3KC 1M18A 1JFIA 3X1TD 1P3AB 5B33D 5B33C 5BT1C 5B2IA 1TAFA 5B31B 5B32C 5AVCD 3AYWD 3AV1D 3WKJD 5AVCC 5GT3A 3X1SC 3WKJC 1H3OB 5B0ZD 4WU9B 3AZLB 2HIOB 3B6GC 2CV5A 3KSYA 1P3KA 4Z66C 5BNXA 4LD9B 3X1TA 3A6NB 5B33A 5JRGB 4QLCC 4YM6D 5FUGB 3W99D 5AVCA 4YM6C 3B0DB 5AV5C 3AYWA 3AV1A 3WKJA 2HUEB 3AZFD 5B0ZA 3UTAC 3AZFC 2BYKA 5F99D 3MGSA 3LELB 1P3BB 1S32B 3W96B 3W97D 4HGAB 3W97C 1AOIC 2YFVB 3REKB 4NE3A 3KWQC 1P3OB 4KUDD 5E5AD 4UUZA 3AZGC 2YFWB 5B2JD 4CSRB 3VH6T 5B0YD 4YM6A 3AZNB 3W99A 3AZFA 5C3IB 3MGQD 1KU5A 5F99A 4Z5TB 3MGQC 3W97A 3AZJD 3WTPC 3UT9B 1KX4D 4KUDA 1P3MB 3AZKB 1M19D 5E5AA 3W98D 3LZ1D 1M19C 3W98C 4CAYA 5B2JA 3X1UD 4AWLC 3X1UC 5B0YA 1P34B 5AY8D 5AY8C 3WAAD 5G49A 3R45A 3MGQA 2IO5C 3AZJA 1JFIB 1U35B 1TZYC 4JJNB 4H9QA 5DNMC 3REJD 1KX4A 5CPJC 3AZHD 5B2IB 3AZMD 1M19A 3W98A 3AZMC 3LZ1A 2AROD 3X1UA 3REHD 5GT3B 5BNVA 4ZBJB 5CP6D 3REHC 5CP6C 4WZSB 5AY8A 1P3LD 3WAAA 1ZLAD 3RELD 2CV5B 3B6FC 4H9SC 5B1LB 1A7WA 5AV8C 3X1TB 3REJA 3AZHA 5KDMA 3AZMA 3MGPA 1B67A 3LJAB 3AYWB 3AV1B 2AROA 1P3FD 3REHA 5B0ZB 5CP6A 4XUJD 3MGSB 4XZQD 4XUJC 5GXQC 4G91C 1P3LA 1ZLAA 3RELA 4J8UD 4H9SA 3AZNC 4X23C 1BFMA 5C3IC 4UUZB 4Z5TC 5B1MC 1EQZB 4WU8D 4H9RA 1N1JB 3W99B 3NQUB 1P3FA 2BYMA 1KX5D 4ZUXD 4ZUXC 4G92C 4XUJA 5F99B 3AV2D 4XZQA 4J8VD 2NQBD 3MGRB 3C1BB 3AV2C 3KUYD 4YS3D 5AV6D 3O62D 3KUYC 4J8UA 1P3IC 1KX3B 4NFTA 5AV9D 2F8ND 5E5AB 5B24B 5AV9C 4CAYB 3MNNC 2FJ7B 4WNNA 5BT1D 3V9RA 1ID3B 4WU8A 3AZEB 5B32D 5B0YB 1HQ3C 3B0BA 5G49B 3X1SD 3LZ0C 3R45B 4ZUXA 1KX5A 3AV2A 2NQBA 4J8VA 3KUYA 3AZJB 3B6GD 3O62A 5AV6A 4YS3A 1M1AC 4J8WB 1KX4B 5CPKC 4Z66D 3TU4C 5AV9A 2F8NA 3MGPC 2PYOC 3VH6A 3X1VC 5BNVB 4QLCD 4H9OB 5B32A 5AV5D 3WAAB 3X1SA 3UTAD 5DNNB 3B6GA 1AOID 3REJB 3KWQD 4Z66A 3C1CB 3AZHB 4KHAA 1P3PB 3AZIB 3AN2B 2NZDC 3AZGD 2AROB 4DRBA 5CPIC 4QLCA 5GT0B 3AFAB 3UTBD 3UTBC 5AV5A 4J8XD 1P3LB 1F66C 1ZLAB 3RELB 4J8XC 3REID 3UTAA 5B40D 5AVBB 3REIC 1BH8B 1P3GC 4R8PB 5B40C 3WA9B 5GSUB 3WTPD 1AOIA 4KGCC 3KWQA 3KXBD 3MVDC 3KXBC 3AZGA 1P3FB 2BYMB 4EO5B 3UTBA 2RVQC 1P3AD 4H9PA 4XZQB 1P3AC 4J8XA 1BH9A 2JSSA 4J8UB 5B31D 5B40A 3REIA 5B31C 1M18B 1TZYD 3WTPA 5JA4A 5DNMD 4WU9D 3AZLD 4WU9C 2HIOD 5CPJD 5BS7C 3AZLC 2HIOC 4WU8B 3KXBA 1TAFB 1KX5B 4LD9D 4LD9C 1P3AA 2NQBB 4J8VB 3A6NC 5JRGC 5AV6B 5B31A 4YS3B 3B6FD 1P3KB 3B0DC 1TZYA 1H3OA 5AV8D 5BNXB 2HUEC 4WU9A 5DNMA 5DNNC 3W96D 1F1EA 5BS7A 3AZLA 2HIOA 3W96C 5B33B 3LELC 5CPJA 1S32C 1P3BC 5B32B 4HGAC 3REKC 5AVCB 1P3OC 3C1CC 3X1SB 3WKJB 4LD9A 2BYKB 5GXQD 3B6GB 3AZND 4X23D 3B6FA 4Z66B 4H9NA 5AV8A 4KHAB 3W96A 4Z5TD 5B1MD 4M6BA 3VH5W 4QLCB 4NE5A 4YM6B 3UT9C 1P3MD 3B0CW 1P3MC 3AZKC 3UTAB 3AZFB 5GXQA 4CSRA 3W97B 1P3ID 1AOIB 3AZNA 4X23A 3KWQB 1P34C 4NE6A 4KUDB 3AZGB 4Z5TA 3MNND 5B1MA 5B2JB 1U35D 4JJND 1HQ3D 1U35C 4JJNC 1P3MA 3LZ0D 1B6WA 5B2IC 3MGQB 2LY8A 1P3IA 3WTPB 5GT3C 5JA4B 1M1AD 4ZBJC 5CPKD 4H9QB 3TU4D 1ULYA 3MGPD 1M19B 2PYOD 3W98B 1R4VA 5B1LD 3MNNA 3LZ1B 2CV5C 5B1LC 3X1VD 4AWLB 1U35A 3X1UB 4JJNA 1HQ3A 3X1TC 5AY8B 3LZ0A 1Q9CA 3VH5T 3LJAD 2IO5B 3LJAC 3WTPE 3AYWC 3AV1C 1TZYB 1M1AA 5BO0A 5DNMB 3B0CT 5B0ZC 3MGSD 5CPKA 5CPJB 3MGSC 3TU4A 5KDMB 3AZMB 2NZDD 2PYOA
chains in the Genus database with same CATH superfamily
5B1LA 3X1VA 5CPID 3REHB 5CP6B 3NQJA 1F66D 1EQZD 1EQZC 1P3GD 3B6FB 3LJAA 3W99C 2Y2OA 4H9NB 3H0LC 5AV8B 4KGCD 2ZY2A 3MGRD 5F99C 3C1BD 3MGRC 3C1BC 2NZDA 4H9RB 3MVDD 1KX3D 4KUDC 1KX3C 5CPIA 2RVQD 5B24D 5E5AC 4E44A 5B24C 4XUJB 2F8NG 1HTAA 1W2EA 4G91B 5GXQB 1F66A 1ID3D 5B2JC 3AZED 1EQZA 4E45A 2FJ7C 1N1JA 1ID3C 3AZEC 4X23B 1P3GA 5B0YC 3NQUA 5B32G 1WWSA 4KGCA 5B1MB 3MGRA 3C1BA 3IP4C 4WNNB 3V9RB 3AZJC 3MVDA 4J8WD 2F8NH 1KX3A 4J8WC 1KX4C 2XD5A 2BG1A 4ZUXB 5B24A 4G92B 3AV2B 3LZ1C 3A6ND 2FJ7A 1ID3A 3AZEA 5JRGD 3KUYB 1P3IB 3O62B 3KFUG 3WAAC 5DNND 5AV9B 2F8NB 3MNNB 1P3BD 3LELD 1S32D 4DRAA 2XD1A 1HQ3B 4J8WA 3AL0C 3REKD 3REJC 1P3OD 3LZ0B 3C1CD 2F2AC 3AZHC 1P3PD 3AZID 3AN2D 1P3PC 3AZIC 5CHLB 3A6NA 3AN2C 2AROC 5GT0D 4H9OA 5BO0B 5JRGA 3AFAD 1M1AB 5GT0C 3AFAC 5CPKB 5FUGA 3TU4B 1P3LC 3MGPB 5DNNA 3RELC 1ZLAC 5AVBD 2PYOB 3WA9D 4R8PD 1P3BA 5AVBC 3LELA 5GSUD 1S32A 4R8PC 3X1VB 3WA9C 2J8PA 5GSUC 2UWXA 3NQJB 2ZY4A 3UT9D 2YFVA 3REKA 1P3OA 5AV5B 3C1CA 3AZKD 1P3PA 3AZIA 3AN2A 2YFWA 1P3FC 4EO5C 5GT0A 3AFAA 1P34D 2VQRA 4XZQC 2NZDB 5AVBA 1BH8A 4Z2MG 4R8PA 5B31G 4J8UC 3WA9A 2F8NK 5GSUA 5CPIB 3EPLA 1M18D 3UTBB 1M18C 3UT9A 4H9PB 1F66B 3VH5A 4J8XB 3AZKA 3A1KA 5B2ID 4WU8C 1BH9B 3REIB 2L5AA 1P3GB 3H0MC 5B40B 2G5IC 5GT3D 1KX5C 4KGCB 1WWIA 4Z2MH 4WV4B 1P34A 2W8SA 2NQBC 4J8VC 3MVDB 3KXBB 4YS3C 5AV6C 3O62C 2CV5D 1P3KD 2JE5A 3VH6W 2CWEA 1P3KC 1M18A 1JFIA 3X1TD 1P3AB 5B33D 5B33C 5BT1C 5B2IA 1TAFA 5B31B 5B32C 5AVCD 3AYWD 3AV1D 3WKJD 5AVCC 5GT3A 3X1SC 3WKJC 1H3OB 5B0ZD 4WU9B 3AZLB 2FJ7D 2HIOB 3B6GC 2CV5A 3KSYA 1P3KA 4Z66C 5BNXA 4LD9B 3X1TA 3A6NB 5B33A 5JRGB 4QLCC 4YM6D 5FUGB 3W99D 5AVCA 4YM6C 3B0DB 5AV5C 3AYWA 3AV1A 3WKJA 2HUEB 3AZFD 5B0ZA 3UTAC 3AZFC 2BYKA 5F99D 3MGSA 3LELB 1P3BB 1S32B 3W96B 3W97D 4HGAB 3W97C 1AOIC 2YFVB 3REKB 4NE3A 3KWQC 3EPJA 1P3OB 4KUDD 5E5AD 2Y2PA 4UUZA 3AZGC 4WJ3C 2YFWB 5B2JD 4CSRB 3VH6T 5B0YD 4YM6A 3AZNB 3W99A 3AZFA 5C3IB 3MGQD 1KU5A 2DQNC 5F99A 4Z5TB 3MGQC 3W97A 3AZJD 3WTPC 3UT9B 1KX4D 4KUDA 1P3MB 3AZKB 1M19D 5E5AA 3W98D 3LZ1D 1M19C 3W98C 4CAYA 5B2JA 3X1UD 4AWLC 3X1UC 5B0YA 1P34B 5AY8D 5AY8C 3WAAD 5G49A 3R45A 3MGQA 4UPKA 2IO5C 3AZJA 1JFIB 1U35B 1TZYC 2RIQA 4JJNB 4H9QA 2Y2QA 5DNMC 3REJD 1KX4A 5CPJC 3AZHD 5B2IB 3AZMD 1M19A 3W98A 3AZMC 3LZ1A 2AROD 3X1UA 3REHD 5GT3B 5BNVA 4ZBJB 5CP6D 3REHC 5CP6C 4WZSB 5AY8A 1P3LD 3WAAA 1ZLAD 3RELD 2CV5B 3B6FC 4H9SC 5B1LB 2ZY3A 1A7WA 5AV8C 3X1TB 3REJA 3AZHA 5KDMA 3AZMA 3MGPA 1B67A 3LJAB 3AYWB 3AV1B 2AROA 1P3FD 3REHA 5B0ZB 5CP6A 4XUJD 3MGSB 4XZQD 4XUJC 5GXQC 4G91C 1P3LA 1ZLAA 3RELA 4J8UD 4H9SA 3AZNC 4X23C 1BFMA 5C3IC 4UUZB 4Z5TC 5B1MC 1EQZB 4WU8D 4H9RA 1N1JB 3W99B 2Y2HA 3NQUB 1P3FA 2BYMA 1KX5D 4ZUXD 4ZUXC 4G92C 4XUJA 5F99B 3AV2D 4XZQA 4J8VD 2NQBD 3MGRB 3C1BB 3AV2C 3KUYD 2ZM5A 2Y2LA 4YS3D 3FDDA 5AV6D 3O62D 3KUYC 4J8UA 1P3IC 1KX3B 4NFTA 5AV9D 2F8ND 5E5AB 5B24B 5AV9C 4CAYB 3MNNC 2FJ7B 4WNNA 5BT1D 3V9RA 1ID3B 4WU8A 3AZEB 5B32D 5B0YB 1HQ3C 1Z2CB 3B0BA 5G49B 3X1SD 2Y2KA 4ZUXA 3R45B 3LZ0C 1KX5A 3AV2A 2NQBA 4J8VA 3KUYA 3AZJB 3B6GD 3O62A 5AV6A 4YS3A 1M1AC 4J8WB 1KX4B 5CPKC 4Z66D 3TU4C 5AV9A 2F8NA 3MGPC 2PYOC 2Y2IA 3VH6A 3X1VC 5BNVB 4QLCD 4H9OB 5B32A 3EG5B 5AV5D 2JCHA 3WAAB 3X1SA 3UTAD 3EPKA 5DNNB 3B6GA 1AOID 3REJB 3KWQD 4Z66A 3C1CB 3AZHB 4KHAA 1P3PB 3AZIB 3AN2B 2NZDC 3AZGD 2AROB 4DRBA 5CPIC 4QLCA 5GT0B 3AFAB 3UTBD 2DF4C 3UTBC 5AV5A 4J8XD 1P3LB 1F66C 1ZLAB 3RELB 4J8XC 3REID 3UTAA 5B40D 5AVBB 3REIC 1BH8B 1P3GC 4R8PB 5B40C 3WA9B 5GSUB 3WTPD 1AOIA 4KGCC 3KWQA 3KXBD 3MVDC 3KXBC 3AZGA 1P3FB 2BYMB 4EO5B 3UTBA 2RVQC 1P3AD 4H9PA 4XZQB 1P3AC 4J8XA 1BH9A 2JSSA 4J8UB 5B31D 5B40A 3REIA 3A1IA 5B31C 4DQYB 1M18B 1TZYD 3WTPA 5JA4A 5DNMD 4WU9D 3AZLD 4WU9C 2HIOD 5CPJD 5BS7C 3EPHA 3AZLC 2HIOC 4WU8B 3KXBA 1TAFB 1KX5B 4LD9D 4LD9C 1P3AA 2NQBB 4J8VB 3A6NC 5JRGC 5AV6B 5B31A 4YS3B 3B6FD 1P3KB 3B0DC 1TZYA 1H3OA 5AV8D 5BNXB 2HUEC 4WU9A 5DNMA 5DNNC 3W96D 1F1EA 5BS7A 3AZLA 2HIOA 3W96C 5B33B 3LELC 5CPJA 1S32C 1P3BC 5B32B 4HGAC 1PZRA 3REKC 5AVCB 1P3OC 3C1CC 3X1SB 3WKJB 4LD9A 2BYKB 5GXQD 3B6GB 3AZND 2ZY5A 4X23D 3B6FA 4Z66B 4H9NA 5AV8A 4KHAB 3W96A 4Z5TD 5B1MD 4M6BA 3VH5W 2Y2MA 4QLCB 4NE5A 4YM6B 3UT9C 1P3MD 3B0CW 1P3MC 3AZKC 3UTAB 3AZFB 5GXQA 3F6TA 4CSRA 1T3UA 1P3ID 2Y2JA 1AOIB 3W97B 3AZNA 2FFFB 4X23A 3KWQB 1P34C 4NE6A 4KUDB 3AZGB 4Z5TA 3MNND 5B1MA 5B2JB 2Y2NA 1U35D 4JJND 1HQ3D 1U35C 4JJNC 1P3MA 3P5JB 3LZ0D 1B6WA 5B2IC 3MGQB 2LY8A 1P3IA 3WTPB 5GT3C 5JA4B 1M1AD 4ZBJC 5CPKD 4H9QB 3TU4D 1ULYA 3MGPD 1M19B 2PYOD 3W98B 1R4VA 5B1LD 3MNNA 3LZ1B 2CV5C 5B1LC 3X1VD 4AWLB 1U35A 3X1UB 4JJNA 1HQ3A 3X1TC 5AY8B 3LZ0A 1Q9CA 3VH5T 3LJAD 2IO5B 3LJAC 3WTPE 3AYWC 3AV1C 1TZYB 1M1AA 5BO0A 5DNMB 3B0CT 5B0ZC 3MGSD 2Y2GA 5CPKA 5CPJB 3MGSC 3TU4A 3H0RC 5KDMB 3AZMB 2NZDD 2G5HC 2PYOA
chains in the Genus database with same CATH topology
5B1LA 3X1VA 5CPID 3REHB 5CP6B 3NQJA 1F66D 1EQZD 1EQZC 1P3GD 3B6FB 3LJAA 3W99C 2Y2OA 4H9NB 3H0LC 5AV8B 4KGCD 2ZY2A 3MGRD 5F99C 3C1BD 3MGRC 3C1BC 2NZDA 4H9RB 3MVDD 1KX3D 4KUDC 1KX3C 5CPIA 2RVQD 5B24D 5E5AC 4E44A 5B24C 4XUJB 2F8NG 1HTAA 1W2EA 4G91B 5GXQB 1F66A 1ID3D 5B2JC 3AZED 1EQZA 4E45A 2FJ7C 1N1JA 1ID3C 3AZEC 4X23B 1P3GA 5B0YC 3NQUA 5B32G 1WWSA 4KGCA 5B1MB 3MGRA 3C1BA 3IP4C 4WNNB 3V9RB 3AZJC 3MVDA 4J8WD 2F8NH 1KX3A 4J8WC 1KX4C 2XD5A 2BG1A 4ZUXB 5B24A 4G92B 3AV2B 3LZ1C 3A6ND 2FJ7A 1ID3A 3AZEA 5JRGD 3KUYB 1P3IB 3O62B 3KFUG 3WAAC 5DNND 5AV9B 2F8NB 3MNNB 1P3BD 3LELD 1S32D 4DRAA 2XD1A 1HQ3B 4J8WA 3AL0C 3REKD 3REJC 1P3OD 3LZ0B 3C1CD 2F2AC 3AZHC 1P3PD 3AZID 3AN2D 1P3PC 3AZIC 5CHLB 3A6NA 3AN2C 2AROC 5GT0D 4H9OA 5BO0B 5JRGA 3AFAD 1M1AB 5GT0C 3AFAC 5CPKB 5FUGA 3TU4B 1P3LC 3MGPB 5DNNA 3RELC 1ZLAC 5AVBD 2PYOB 3WA9D 4R8PD 1P3BA 5AVBC 3LELA 5GSUD 1S32A 4R8PC 3X1VB 3WA9C 2J8PA 5GSUC 2UWXA 3NQJB 2ZY4A 3UT9D 2YFVA 3REKA 1P3OA 5AV5B 3C1CA 3AZKD 1P3PA 3AZIA 3AN2A 2YFWA 1P3FC 4EO5C 5GT0A 3AFAA 1P34D 2VQRA 4XZQC 2NZDB 5AVBA 1BH8A 4Z2MG 4R8PA 5B31G 4J8UC 3WA9A 2F8NK 5GSUA 5CPIB 3EPLA 1M18D 3UTBB 1M18C 3UT9A 4H9PB 1F66B 3VH5A 4J8XB 3AZKA 3A1KA 5B2ID 4WU8C 1BH9B 3REIB 2L5AA 1P3GB 3H0MC 5B40B 2G5IC 5GT3D 1KX5C 4KGCB 1WWIA 4Z2MH 4WV4B 1P34A 2W8SA 2NQBC 4J8VC 3MVDB 3KXBB 4YS3C 5AV6C 3O62C 2CV5D 1P3KD 2JE5A 3VH6W 2CWEA 1P3KC 1M18A 1JFIA 3X1TD 1P3AB 5B33D 5B33C 5BT1C 5B2IA 1TAFA 5B31B 5B32C 5AVCD 3AYWD 3AV1D 3WKJD 5AVCC 5GT3A 3X1SC 3WKJC 1H3OB 5B0ZD 4WU9B 3AZLB 2FJ7D 2HIOB 3B6GC 2CV5A 3KSYA 1P3KA 4Z66C 5BNXA 4LD9B 3X1TA 3A6NB 5B33A 5JRGB 4QLCC 4YM6D 5FUGB 3W99D 5AVCA 4YM6C 3B0DB 5AV5C 3AYWA 3AV1A 3WKJA 2HUEB 3AZFD 5B0ZA 3UTAC 3AZFC 2BYKA 5F99D 3MGSA 3LELB 1P3BB 1S32B 3W96B 3W97D 4HGAB 3W97C 1AOIC 2YFVB 3REKB 4NE3A 3KWQC 3EPJA 1P3OB 4KUDD 5E5AD 2Y2PA 4UUZA 3AZGC 4WJ3C 2YFWB 5B2JD 4CSRB 3VH6T 5B0YD 4YM6A 3AZNB 3W99A 3AZFA 5C3IB 3MGQD 1KU5A 2DQNC 5F99A 4Z5TB 3MGQC 3W97A 3AZJD 3WTPC 3UT9B 1KX4D 4KUDA 1P3MB 3AZKB 1M19D 5E5AA 3W98D 3LZ1D 1M19C 3W98C 4CAYA 5B2JA 3X1UD 4AWLC 3X1UC 5B0YA 1P34B 5AY8D 5AY8C 3WAAD 5G49A 3R45A 3MGQA 4UPKA 2IO5C 3AZJA 1JFIB 1U35B 1TZYC 2RIQA 4JJNB 4H9QA 2Y2QA 5DNMC 3REJD 1KX4A 5CPJC 3AZHD 5B2IB 3AZMD 1M19A 3W98A 3AZMC 3LZ1A 2AROD 3X1UA 3REHD 5GT3B 5BNVA 4ZBJB 5CP6D 3REHC 5CP6C 4WZSB 5AY8A 1P3LD 3WAAA 1ZLAD 3RELD 2CV5B 3B6FC 4H9SC 5B1LB 2ZY3A 1A7WA 5AV8C 3X1TB 3REJA 3AZHA 5KDMA 3AZMA 3MGPA 1B67A 3LJAB 3AYWB 3AV1B 2AROA 1P3FD 3REHA 5B0ZB 5CP6A 4XUJD 3MGSB 4XZQD 4XUJC 5GXQC 4G91C 1P3LA 1ZLAA 3RELA 4J8UD 4H9SA 3AZNC 4X23C 1BFMA 5C3IC 4UUZB 4Z5TC 5B1MC 1EQZB 4WU8D 4H9RA 1N1JB 3W99B 2Y2HA 3NQUB 1P3FA 2BYMA 1KX5D 4ZUXD 4ZUXC 4G92C 4XUJA 5F99B 3AV2D 4XZQA 4J8VD 2NQBD 3MGRB 3C1BB 3AV2C 3KUYD 2ZM5A 2Y2LA 4YS3D 3FDDA 5AV6D 3O62D 3KUYC 4J8UA 1P3IC 1KX3B 4NFTA 5AV9D 2F8ND 5E5AB 5B24B 5AV9C 4CAYB 3MNNC 2FJ7B 4WNNA 5BT1D 3V9RA 1ID3B 4WU8A 3AZEB 5B32D 5B0YB 1HQ3C 1Z2CB 3B0BA 5G49B 3X1SD 2Y2KA 4ZUXA 3R45B 3LZ0C 1KX5A 3AV2A 2NQBA 4J8VA 3KUYA 3AZJB 3B6GD 3O62A 5AV6A 4YS3A 1M1AC 4J8WB 1KX4B 5CPKC 4Z66D 3TU4C 5AV9A 2F8NA 3MGPC 2PYOC 2Y2IA 3VH6A 3X1VC 5BNVB 4QLCD 4H9OB 5B32A 3EG5B 5AV5D 2JCHA 3WAAB 3X1SA 3UTAD 3EPKA 5DNNB 3B6GA 1AOID 3REJB 3KWQD 4Z66A 3C1CB 3AZHB 4KHAA 1P3PB 3AZIB 3AN2B 2NZDC 3AZGD 2AROB 4DRBA 5CPIC 4QLCA 5GT0B 3AFAB 3UTBD 2DF4C 3UTBC 5AV5A 4J8XD 1P3LB 1F66C 1ZLAB 3RELB 4J8XC 3REID 3UTAA 5B40D 5AVBB 3REIC 1BH8B 1P3GC 4R8PB 5B40C 3WA9B 5GSUB 3WTPD 1AOIA 4KGCC 3KWQA 3KXBD 3MVDC 3KXBC 3AZGA 1P3FB 2BYMB 4EO5B 3UTBA 2RVQC 1P3AD 4H9PA 4XZQB 1P3AC 4J8XA 1BH9A 2JSSA 4J8UB 5B31D 5B40A 3REIA 3A1IA 5B31C 4DQYB 1M18B 1TZYD 3WTPA 5JA4A 5DNMD 4WU9D 3AZLD 4WU9C 2HIOD 5CPJD 5BS7C 3EPHA 3AZLC 2HIOC 4WU8B 3KXBA 1TAFB 1KX5B 4LD9D 4LD9C 1P3AA 2NQBB 4J8VB 3A6NC 5JRGC 5AV6B 5B31A 4YS3B 3B6FD 1P3KB 3B0DC 1TZYA 1H3OA 5AV8D 5BNXB 2HUEC 4WU9A 5DNMA 5DNNC 3W96D 1F1EA 5BS7A 3AZLA 2HIOA 3W96C 5B33B 3LELC 5CPJA 1S32C 1P3BC 5B32B 4HGAC 1PZRA 3REKC 5AVCB 1P3OC 3C1CC 3X1SB 3WKJB 4LD9A 2BYKB 5GXQD 3B6GB 3AZND 2ZY5A 4X23D 3B6FA 4Z66B 4H9NA 5AV8A 4KHAB 3W96A 4Z5TD 5B1MD 4M6BA 3VH5W 2Y2MA 4QLCB 4NE5A 4YM6B 3UT9C 1P3MD 3B0CW 1P3MC 3AZKC 3UTAB 3AZFB 5GXQA 3F6TA 4CSRA 1T3UA 1P3ID 2Y2JA 1AOIB 3W97B 3AZNA 2FFFB 4X23A 3KWQB 1P34C 4NE6A 4KUDB 3AZGB 4Z5TA 3MNND 5B1MA 5B2JB 2Y2NA 1U35D 4JJND 1HQ3D 1U35C 4JJNC 1P3MA 3P5JB 3LZ0D 1B6WA 5B2IC 3MGQB 2LY8A 1P3IA 3WTPB 5GT3C 5JA4B 1M1AD 4ZBJC 5CPKD 4H9QB 3TU4D 1ULYA 3MGPD 1M19B 2PYOD 3W98B 1R4VA 5B1LD 3MNNA 3LZ1B 2CV5C 5B1LC 3X1VD 4AWLB 1U35A 3X1UB 4JJNA 1HQ3A 3X1TC 5AY8B 3LZ0A 1Q9CA 3VH5T 3LJAD 2IO5B 3LJAC 3WTPE 3AYWC 3AV1C 1TZYB 1M1AA 5BO0A 5DNMB 3B0CT 5B0ZC 3MGSD 2Y2GA 5CPKA 5CPJB 3MGSC 3TU4A 3H0RC 5KDMB 3AZMB 2NZDD 2G5HC 2PYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L A;  3X1V A;  5CPI D;  3REH B;  5CP6 B;  3NQJ A;  1F66 D;  1EQZ D;  1EQZ C;  1P3G D;  3B6F B;  3LJA A;  3W99 C;  4H9N B;  5AV8 B;  4KGC D;  3MGR D;  3C1B D;  5F99 C;  3MGR C;  3C1B C;  2NZD A;  4H9R B;  3MVD D;  1KX3 D;  4KUD C;  1KX3 C;  5CPI A;  2RVQ D;  5B24 D;  5E5A C;  4E44 A;  5B24 C;  4XUJ B;  2F8N G;  1HTA A;  4G91 B;  5GXQ B;  1F66 A;  2FJ7 D;  1ID3 D;  5B2J C;  3AZE D;  1EQZ A;  4E45 A;  2FJ7 C;  1N1J A;  1ID3 C;  3AZE C;  4X23 B;  1P3G A;  5B0Y C;  3NQU A;  5B32 G;  1WWS A;  4KGC A;  5B1M B;  3MGR A;  3C1B A;  4WNN B;  3V9R B;  3AZJ C;  3MVD A;  4J8W D;  2F8N H;  1KX3 A;  4J8W C;  1KX4 C;  4ZUX B;  5B24 A;  4G92 B;  3AV2 B;  3LZ1 C;  3A6N D;  2FJ7 A;  1ID3 A;  3AZE A;  5JRG D;  3KUY B;  1P3I B;  3O62 B;  3WAA C;  5DNN D;  5AV9 B;  2F8N B;  3MNN B;  1P3B D;  3LEL D;  1S32 D;  4DRA A;  1HQ3 B;  4J8W A;  3REK D;  3REJ C;  1P3O D;  3LZ0 B;  3C1C D;  3AZH C;  1P3P D;  3AZI D;  3AN2 D;  1P3P C;  3AZI C;  5CHL B;  3A6N A;  3AN2 C;  2ARO C;  5GT0 D;  4H9O A;  5BO0 B;  5JRG A;  3AFA D;  1M1A B;  5GT0 C;  3AFA C;  5CPK B;  5FUG A;  3TU4 B;  1P3L C;  3MGP B;  5DNN A;  3REL C;  1ZLA C;  5AVB D;  2PYO B;  3WA9 D;  4R8P D;  1P3B A;  5AVB C;  3LEL A;  5GSU D;  1S32 A;  4R8P C;  3X1V B;  3WA9 C;  5GSU C;  3NQJ B;  3UT9 D;  2YFV A;  3REK A;  1P3O A;  5AV5 B;  3C1C A;  3AZK D;  1P3P A;  3AZI A;  3AN2 A;  2YFW A;  1P3F C;  4EO5 C;  5GT0 A;  3AFA A;  1P34 D;  4XZQ C;  2NZD B;  5AVB A;  1BH8 A;  4Z2M G;  4R8P A;  5B31 G;  4J8U C;  3WA9 A;  2F8N K;  5GSU A;  5CPI B;  1M18 D;  3UTB B;  1M18 C;  3UT9 A;  4H9P B;  1F66 B;  3VH5 A;  4J8X B;  3AZK A;  5B2I D;  4WU8 C;  1BH9 B;  3REI B;  2L5A A;  1P3G B;  5B40 B;  5GT3 D;  1KX5 C;  4KGC B;  1WWI A;  4Z2M H;  4WV4 B;  1P34 A;  2NQB C;  4J8V C;  3MVD B;  3KXB B;  4YS3 C;  5AV6 C;  3O62 C;  2CV5 D;  1P3K D;  3VH6 W;  2CWE A;  1P3K C;  1M18 A;  1JFI A;  3X1T D;  1P3A B;  5B33 D;  5B33 C;  5BT1 C;  5B2I A;  1TAF A;  5B31 B;  5B32 C;  5AVC D;  3AYW D;  3AV1 D;  3WKJ D;  5AVC C;  5GT3 A;  3X1S C;  3WKJ C;  1H3O B;  5B0Z D;  4WU9 B;  3AZL B;  2HIO B;  3B6G C;  2CV5 A;  3KSY A;  1P3K A;  4Z66 C;  5BNX A;  4LD9 B;  3X1T A;  3A6N B;  5B33 A;  5JRG B;  4QLC C;  4YM6 D;  5FUG B;  3W99 D;  5AVC A;  4YM6 C;  3B0D B;  5AV5 C;  3AYW A;  3AV1 A;  3WKJ A;  2HUE B;  3AZF D;  5B0Z A;  3UTA C;  3AZF C;  2BYK A;  5F99 D;  3MGS A;  3LEL B;  1P3B B;  1S32 B;  3W96 B;  3W97 D;  4HGA B;  3W97 C;  1AOI C;  2YFV B;  3REK B;  4NE3 A;  3KWQ C;  1P3O B;  4KUD D;  5E5A D;  4UUZ A;  3AZG C;  2YFW B;  5B2J D;  4CSR B;  3VH6 T;  5B0Y D;  4YM6 A;  3AZN B;  3W99 A;  3AZF A;  5C3I B;  3MGQ D;  1KU5 A;  5F99 A;  4Z5T B;  3MGQ C;  3W97 A;  3AZJ D;  3WTP C;  3UT9 B;  1KX4 D;  4KUD A;  1P3M B;  3AZK B;  1M19 D;  5E5A A;  3W98 D;  3LZ1 D;  1M19 C;  3W98 C;  4CAY A;  5B2J A;  3X1U D;  4AWL C;  3X1U C;  5B0Y A;  1P34 B;  5AY8 D;  5AY8 C;  3WAA D;  5G49 A;  3R45 A;  3MGQ A;  2IO5 C;  3AZJ A;  1JFI B;  1U35 B;  1TZY C;  4JJN B;  4H9Q A;  5DNM C;  3REJ D;  1KX4 A;  5CPJ C;  3AZH D;  5B2I B;  3AZM D;  1M19 A;  3W98 A;  3AZM C;  3LZ1 A;  2ARO D;  3X1U A;  3REH D;  5GT3 B;  5BNV A;  4ZBJ B;  5CP6 D;  3REH C;  5CP6 C;  4WZS B;  5AY8 A;  1P3L D;  3WAA A;  1ZLA D;  3REL D;  2CV5 B;  3B6F C;  4H9S C;  5B1L B;  1A7W A;  5AV8 C;  3X1T B;  3REJ A;  3AZH A;  5KDM A;  3AZM A;  3MGP A;  1B67 A;  3LJA B;  3AYW B;  3AV1 B;  2ARO A;  1P3F D;  3REH A;  5B0Z B;  5CP6 A;  4XUJ D;  3MGS B;  4XZQ D;  4XUJ C;  5GXQ C;  4G91 C;  1P3L A;  1ZLA A;  3REL A;  4J8U D;  4H9S A;  3AZN C;  4X23 C;  1BFM A;  5C3I C;  4UUZ B;  4Z5T C;  5B1M C;  1EQZ B;  4WU8 D;  4H9R A;  1N1J B;  3W99 B;  3NQU B;  1P3F A;  2BYM A;  1KX5 D;  4ZUX D;  4ZUX C;  4G92 C;  4XUJ A;  5F99 B;  3AV2 D;  4XZQ A;  4J8V D;  2NQB D;  3MGR B;  3C1B B;  3AV2 C;  3KUY D;  4YS3 D;  5AV6 D;  3O62 D;  3KUY C;  4J8U A;  1P3I C;  1KX3 B;  4NFT A;  5AV9 D;  2F8N D;  5E5A B;  5B24 B;  5AV9 C;  4CAY B;  3MNN C;  2FJ7 B;  4WNN A;  5BT1 D;  3V9R A;  1ID3 B;  4WU8 A;  3AZE B;  5B32 D;  5B0Y B;  1HQ3 C;  3B0B A;  5G49 B;  3X1S D;  3LZ0 C;  3R45 B;  4ZUX A;  1KX5 A;  3AV2 A;  2NQB A;  4J8V A;  3KUY A;  3AZJ B;  3B6G D;  3O62 A;  5AV6 A;  4YS3 A;  1M1A C;  4J8W B;  1KX4 B;  5CPK C;  4Z66 D;  3TU4 C;  5AV9 A;  2F8N A;  3MGP C;  2PYO C;  3VH6 A;  3X1V C;  5BNV B;  4QLC D;  4H9O B;  5B32 A;  5AV5 D;  3WAA B;  3X1S A;  3UTA D;  5DNN B;  3B6G A;  1AOI D;  3REJ B;  3KWQ D;  4Z66 A;  3C1C B;  3AZH B;  4KHA A;  1P3P B;  3AZI B;  3AN2 B;  2NZD C;  3AZG D;  2ARO B;  4DRB A;  5CPI C;  4QLC A;  5GT0 B;  3AFA B;  3UTB D;  3UTB C;  5AV5 A;  4J8X D;  1P3L B;  1F66 C;  1ZLA B;  3REL B;  4J8X C;  3REI D;  3UTA A;  5B40 D;  5AVB B;  3REI C;  1BH8 B;  1P3G C;  4R8P B;  5B40 C;  3WA9 B;  5GSU B;  3WTP D;  1AOI A;  4KGC C;  3KWQ A;  3KXB D;  3MVD C;  3KXB C;  3AZG A;  1P3F B;  2BYM B;  4EO5 B;  3UTB A;  2RVQ C;  1P3A D;  4H9P A;  4XZQ B;  1P3A C;  4J8X A;  1BH9 A;  2JSS A;  4J8U B;  5B31 D;  5B40 A;  3REI A;  5B31 C;  1M18 B;  1TZY D;  3WTP A;  5JA4 A;  5DNM D;  4WU9 D;  3AZL D;  4WU9 C;  2HIO D;  5CPJ D;  5BS7 C;  3AZL C;  2HIO C;  4WU8 B;  3KXB A;  1TAF B;  1KX5 B;  4LD9 D;  4LD9 C;  1P3A A;  2NQB B;  4J8V B;  3A6N C;  5JRG C;  5AV6 B;  5B31 A;  4YS3 B;  3B6F D;  1P3K B;  3B0D C;  1TZY A;  1H3O A;  5AV8 D;  5BNX B;  2HUE C;  4WU9 A;  5DNM A;  5DNN C;  3W96 D;  1F1E A;  5BS7 A;  3AZL A;  2HIO A;  3W96 C;  5B33 B;  3LEL C;  5CPJ A;  1S32 C;  1P3B C;  5B32 B;  4HGA C;  3REK C;  5AVC B;  1P3O C;  3C1C C;  3X1S B;  3WKJ B;  4LD9 A;  2BYK B;  5GXQ D;  3B6G B;  3AZN D;  4X23 D;  3B6F A;  4Z66 B;  4H9N A;  5AV8 A;  4KHA B;  3W96 A;  4Z5T D;  5B1M D;  4M6B A;  3VH5 W;  4QLC B;  4NE5 A;  4YM6 B;  3UT9 C;  1P3M D;  3B0C W;  1P3M C;  3AZK C;  3UTA B;  3AZF B;  5GXQ A;  4CSR A;  3W97 B;  1P3I D;  1AOI B;  3AZN A;  4X23 A;  3KWQ B;  1P34 C;  4NE6 A;  4KUD B;  3AZG B;  4Z5T A;  3MNN D;  5B1M A;  5B2J B;  1U35 D;  4JJN D;  1HQ3 D;  1U35 C;  4JJN C;  1P3M A;  3LZ0 D;  1B6W A;  5B2I C;  3MGQ B;  2LY8 A;  1P3I A;  3WTP B;  5GT3 C;  5JA4 B;  1M1A D;  4ZBJ C;  5CPK D;  4H9Q B;  3TU4 D;  1ULY A;  3MGP D;  1M19 B;  2PYO D;  3W98 B;  1R4V A;  5B1L D;  3MNN A;  3LZ1 B;  2CV5 C;  5B1L C;  3X1V D;  4AWL B;  1U35 A;  3X1U B;  4JJN A;  1HQ3 A;  3X1T C;  5AY8 B;  3LZ0 A;  1Q9C A;  3VH5 T;  3LJA D;  2IO5 B;  3LJA C;  3WTP E;  3AYW C;  3AV1 C;  1TZY B;  1M1A A;  5BO0 A;  5DNM B;  3B0C T;  5B0Z C;  3MGS D;  5CPK A;  5CPJ B;  3MGS C;  3TU4 A;  5KDM B;  3AZM B;  2NZD D;  2PYO A; 
#chains in the Genus database with same CATH topology
 5B1L A;  3X1V A;  5CPI D;  3REH B;  5CP6 B;  3NQJ A;  1F66 D;  1EQZ D;  1EQZ C;  1P3G D;  3B6F B;  3LJA A;  3W99 C;  2Y2O A;  4H9N B;  3H0L C;  5AV8 B;  4KGC D;  2ZY2 A;  3MGR D;  5F99 C;  3C1B D;  3MGR C;  3C1B C;  2NZD A;  4H9R B;  3MVD D;  1KX3 D;  4KUD C;  1KX3 C;  5CPI A;  2RVQ D;  5B24 D;  5E5A C;  4E44 A;  5B24 C;  4XUJ B;  2F8N G;  1HTA A;  1W2E A;  4G91 B;  5GXQ B;  1F66 A;  1ID3 D;  5B2J C;  3AZE D;  1EQZ A;  4E45 A;  2FJ7 C;  1N1J A;  1ID3 C;  3AZE C;  4X23 B;  1P3G A;  5B0Y C;  3NQU A;  5B32 G;  1WWS A;  4KGC A;  5B1M B;  3MGR A;  3C1B A;  3IP4 C;  4WNN B;  3V9R B;  3AZJ C;  3MVD A;  4J8W D;  2F8N H;  1KX3 A;  4J8W C;  1KX4 C;  2XD5 A;  2BG1 A;  4ZUX B;  5B24 A;  4G92 B;  3AV2 B;  3LZ1 C;  3A6N D;  2FJ7 A;  1ID3 A;  3AZE A;  5JRG D;  3KUY B;  1P3I B;  3O62 B;  3KFU G;  3WAA C;  5DNN D;  5AV9 B;  2F8N B;  3MNN B;  1P3B D;  3LEL D;  1S32 D;  4DRA A;  2XD1 A;  1HQ3 B;  4J8W A;  3AL0 C;  3REK D;  3REJ C;  1P3O D;  3LZ0 B;  3C1C D;  2F2A C;  3AZH C;  1P3P D;  3AZI D;  3AN2 D;  1P3P C;  3AZI C;  5CHL B;  3A6N A;  3AN2 C;  2ARO C;  5GT0 D;  4H9O A;  5BO0 B;  5JRG A;  3AFA D;  1M1A B;  5GT0 C;  3AFA C;  5CPK B;  5FUG A;  3TU4 B;  1P3L C;  3MGP B;  5DNN A;  3REL C;  1ZLA C;  5AVB D;  2PYO B;  3WA9 D;  4R8P D;  1P3B A;  5AVB C;  3LEL A;  5GSU D;  1S32 A;  4R8P C;  3X1V B;  3WA9 C;  2J8P A;  5GSU C;  2UWX A;  3NQJ B;  2ZY4 A;  3UT9 D;  2YFV A;  3REK A;  1P3O A;  5AV5 B;  3C1C A;  3AZK D;  1P3P A;  3AZI A;  3AN2 A;  2YFW A;  1P3F C;  4EO5 C;  5GT0 A;  3AFA A;  1P34 D;  2VQR A;  4XZQ C;  2NZD B;  5AVB A;  1BH8 A;  4Z2M G;  4R8P A;  5B31 G;  4J8U C;  3WA9 A;  2F8N K;  5GSU A;  5CPI B;  3EPL A;  1M18 D;  3UTB B;  1M18 C;  3UT9 A;  4H9P B;  1F66 B;  3VH5 A;  4J8X B;  3AZK A;  3A1K A;  5B2I D;  4WU8 C;  1BH9 B;  3REI B;  2L5A A;  1P3G B;  3H0M C;  5B40 B;  2G5I C;  5GT3 D;  1KX5 C;  4KGC B;  1WWI A;  4Z2M H;  4WV4 B;  1P34 A;  2W8S A;  2NQB C;  4J8V C;  3MVD B;  3KXB B;  4YS3 C;  5AV6 C;  3O62 C;  2CV5 D;  1P3K D;  2JE5 A;  3VH6 W;  2CWE A;  1P3K C;  1M18 A;  1JFI A;  3X1T D;  1P3A B;  5B33 D;  5B33 C;  5BT1 C;  5B2I A;  1TAF A;  5B31 B;  5B32 C;  5AVC D;  3AYW D;  3AV1 D;  3WKJ D;  5AVC C;  5GT3 A;  3X1S C;  3WKJ C;  1H3O B;  5B0Z D;  4WU9 B;  3AZL B;  2FJ7 D;  2HIO B;  3B6G C;  2CV5 A;  3KSY A;  1P3K A;  4Z66 C;  5BNX A;  4LD9 B;  3X1T A;  3A6N B;  5B33 A;  5JRG B;  4QLC C;  4YM6 D;  5FUG B;  3W99 D;  5AVC A;  4YM6 C;  3B0D B;  5AV5 C;  3AYW A;  3AV1 A;  3WKJ A;  2HUE B;  3AZF D;  5B0Z A;  3UTA C;  3AZF C;  2BYK A;  5F99 D;  3MGS A;  3LEL B;  1P3B B;  1S32 B;  3W96 B;  3W97 D;  4HGA B;  3W97 C;  1AOI C;  2YFV B;  3REK B;  4NE3 A;  3KWQ C;  3EPJ A;  1P3O B;  4KUD D;  5E5A D;  2Y2P A;  4UUZ A;  3AZG C;  4WJ3 C;  2YFW B;  5B2J D;  4CSR B;  3VH6 T;  5B0Y D;  4YM6 A;  3AZN B;  3W99 A;  3AZF A;  5C3I B;  3MGQ D;  1KU5 A;  2DQN C;  5F99 A;  4Z5T B;  3MGQ C;  3W97 A;  3AZJ D;  3WTP C;  3UT9 B;  1KX4 D;  4KUD A;  1P3M B;  3AZK B;  1M19 D;  5E5A A;  3W98 D;  3LZ1 D;  1M19 C;  3W98 C;  4CAY A;  5B2J A;  3X1U D;  4AWL C;  3X1U C;  5B0Y A;  1P34 B;  5AY8 D;  5AY8 C;  3WAA D;  5G49 A;  3R45 A;  3MGQ A;  4UPK A;  2IO5 C;  3AZJ A;  1JFI B;  1U35 B;  1TZY C;  2RIQ A;  4JJN B;  4H9Q A;  2Y2Q A;  5DNM C;  3REJ D;  1KX4 A;  5CPJ C;  3AZH D;  5B2I B;  3AZM D;  1M19 A;  3W98 A;  3AZM C;  3LZ1 A;  2ARO D;  3X1U A;  3REH D;  5GT3 B;  5BNV A;  4ZBJ B;  5CP6 D;  3REH C;  5CP6 C;  4WZS B;  5AY8 A;  1P3L D;  3WAA A;  1ZLA D;  3REL D;  2CV5 B;  3B6F C;  4H9S C;  5B1L B;  2ZY3 A;  1A7W A;  5AV8 C;  3X1T B;  3REJ A;  3AZH A;  5KDM A;  3AZM A;  3MGP A;  1B67 A;  3LJA B;  3AYW B;  3AV1 B;  2ARO A;  1P3F D;  3REH A;  5B0Z B;  5CP6 A;  4XUJ D;  3MGS B;  4XZQ D;  4XUJ C;  5GXQ C;  4G91 C;  1P3L A;  1ZLA A;  3REL A;  4J8U D;  4H9S A;  3AZN C;  4X23 C;  1BFM A;  5C3I C;  4UUZ B;  4Z5T C;  5B1M C;  1EQZ B;  4WU8 D;  4H9R A;  1N1J B;  3W99 B;  2Y2H A;  3NQU B;  1P3F A;  2BYM A;  1KX5 D;  4ZUX D;  4ZUX C;  4G92 C;  4XUJ A;  5F99 B;  3AV2 D;  4XZQ A;  4J8V D;  2NQB D;  3MGR B;  3C1B B;  3AV2 C;  3KUY D;  2ZM5 A;  2Y2L A;  4YS3 D;  3FDD A;  5AV6 D;  3O62 D;  3KUY C;  4J8U A;  1P3I C;  1KX3 B;  4NFT A;  5AV9 D;  2F8N D;  5E5A B;  5B24 B;  5AV9 C;  4CAY B;  3MNN C;  2FJ7 B;  4WNN A;  5BT1 D;  3V9R A;  1ID3 B;  4WU8 A;  3AZE B;  5B32 D;  5B0Y B;  1HQ3 C;  1Z2C B;  3B0B A;  5G49 B;  3X1S D;  2Y2K A;  4ZUX A;  3R45 B;  3LZ0 C;  1KX5 A;  3AV2 A;  2NQB A;  4J8V A;  3KUY A;  3AZJ B;  3B6G D;  3O62 A;  5AV6 A;  4YS3 A;  1M1A C;  4J8W B;  1KX4 B;  5CPK C;  4Z66 D;  3TU4 C;  5AV9 A;  2F8N A;  3MGP C;  2PYO C;  2Y2I A;  3VH6 A;  3X1V C;  5BNV B;  4QLC D;  4H9O B;  5B32 A;  3EG5 B;  5AV5 D;  2JCH A;  3WAA B;  3X1S A;  3UTA D;  3EPK A;  5DNN B;  3B6G A;  1AOI D;  3REJ B;  3KWQ D;  4Z66 A;  3C1C B;  3AZH B;  4KHA A;  1P3P B;  3AZI B;  3AN2 B;  2NZD C;  3AZG D;  2ARO B;  4DRB A;  5CPI C;  4QLC A;  5GT0 B;  3AFA B;  3UTB D;  2DF4 C;  3UTB C;  5AV5 A;  4J8X D;  1P3L B;  1F66 C;  1ZLA B;  3REL B;  4J8X C;  3REI D;  3UTA A;  5B40 D;  5AVB B;  3REI C;  1BH8 B;  1P3G C;  4R8P B;  5B40 C;  3WA9 B;  5GSU B;  3WTP D;  1AOI A;  4KGC C;  3KWQ A;  3KXB D;  3MVD C;  3KXB C;  3AZG A;  1P3F B;  2BYM B;  4EO5 B;  3UTB A;  2RVQ C;  1P3A D;  4H9P A;  4XZQ B;  1P3A C;  4J8X A;  1BH9 A;  2JSS A;  4J8U B;  5B31 D;  5B40 A;  3REI A;  3A1I A;  5B31 C;  4DQY B;  1M18 B;  1TZY D;  3WTP A;  5JA4 A;  5DNM D;  4WU9 D;  3AZL D;  4WU9 C;  2HIO D;  5CPJ D;  5BS7 C;  3EPH A;  3AZL C;  2HIO C;  4WU8 B;  3KXB A;  1TAF B;  1KX5 B;  4LD9 D;  4LD9 C;  1P3A A;  2NQB B;  4J8V B;  3A6N C;  5JRG C;  5AV6 B;  5B31 A;  4YS3 B;  3B6F D;  1P3K B;  3B0D C;  1TZY A;  1H3O A;  5AV8 D;  5BNX B;  2HUE C;  4WU9 A;  5DNM A;  5DNN C;  3W96 D;  1F1E A;  5BS7 A;  3AZL A;  2HIO A;  3W96 C;  5B33 B;  3LEL C;  5CPJ A;  1S32 C;  1P3B C;  5B32 B;  4HGA C;  1PZR A;  3REK C;  5AVC B;  1P3O C;  3C1C C;  3X1S B;  3WKJ B;  4LD9 A;  2BYK B;  5GXQ D;  3B6G B;  3AZN D;  2ZY5 A;  4X23 D;  3B6F A;  4Z66 B;  4H9N A;  5AV8 A;  4KHA B;  3W96 A;  4Z5T D;  5B1M D;  4M6B A;  3VH5 W;  2Y2M A;  4QLC B;  4NE5 A;  4YM6 B;  3UT9 C;  1P3M D;  3B0C W;  1P3M C;  3AZK C;  3UTA B;  3AZF B;  5GXQ A;  3F6T A;  4CSR A;  1T3U A;  1P3I D;  2Y2J A;  1AOI B;  3W97 B;  3AZN A;  2FFF B;  4X23 A;  3KWQ B;  1P34 C;  4NE6 A;  4KUD B;  3AZG B;  4Z5T A;  3MNN D;  5B1M A;  5B2J B;  2Y2N A;  1U35 D;  4JJN D;  1HQ3 D;  1U35 C;  4JJN C;  1P3M A;  3P5J B;  3LZ0 D;  1B6W A;  5B2I C;  3MGQ B;  2LY8 A;  1P3I A;  3WTP B;  5GT3 C;  5JA4 B;  1M1A D;  4ZBJ C;  5CPK D;  4H9Q B;  3TU4 D;  1ULY A;  3MGP D;  1M19 B;  2PYO D;  3W98 B;  1R4V A;  5B1L D;  3MNN A;  3LZ1 B;  2CV5 C;  5B1L C;  3X1V D;  4AWL B;  1U35 A;  3X1U B;  4JJN A;  1HQ3 A;  3X1T C;  5AY8 B;  3LZ0 A;  1Q9C A;  3VH5 T;  3LJA D;  2IO5 B;  3LJA C;  3WTP E;  3AYW C;  3AV1 C;  1TZY B;  1M1A A;  5BO0 A;  5DNM B;  3B0C T;  5B0Z C;  3MGS D;  2Y2G A;  5CPK A;  5CPJ B;  3MGS C;  3TU4 A;  3H0R C;  5KDM B;  3AZM B;  2NZD D;  2G5H C;  2PYO A; 
#chains in the Genus database with same CATH homology
 5B1L A;  3X1V A;  5CPI D;  3REH B;  5CP6 B;  3NQJ A;  1F66 D;  1EQZ D;  1EQZ C;  1P3G D;  3B6F B;  3LJA A;  3W99 C;  2Y2O A;  4H9N B;  3H0L C;  5AV8 B;  4KGC D;  2ZY2 A;  3MGR D;  5F99 C;  3C1B D;  3MGR C;  3C1B C;  2NZD A;  4H9R B;  3MVD D;  1KX3 D;  4KUD C;  1KX3 C;  5CPI A;  2RVQ D;  5B24 D;  5E5A C;  4E44 A;  5B24 C;  4XUJ B;  2F8N G;  1HTA A;  1W2E A;  4G91 B;  5GXQ B;  1F66 A;  1ID3 D;  5B2J C;  3AZE D;  1EQZ A;  4E45 A;  2FJ7 C;  1N1J A;  1ID3 C;  3AZE C;  4X23 B;  1P3G A;  5B0Y C;  3NQU A;  5B32 G;  1WWS A;  4KGC A;  5B1M B;  3MGR A;  3C1B A;  3IP4 C;  4WNN B;  3V9R B;  3AZJ C;  3MVD A;  4J8W D;  2F8N H;  1KX3 A;  4J8W C;  1KX4 C;  2XD5 A;  2BG1 A;  4ZUX B;  5B24 A;  4G92 B;  3AV2 B;  3LZ1 C;  3A6N D;  2FJ7 A;  1ID3 A;  3AZE A;  5JRG D;  3KUY B;  1P3I B;  3O62 B;  3KFU G;  3WAA C;  5DNN D;  5AV9 B;  2F8N B;  3MNN B;  1P3B D;  3LEL D;  1S32 D;  4DRA A;  2XD1 A;  1HQ3 B;  4J8W A;  3AL0 C;  3REK D;  3REJ C;  1P3O D;  3LZ0 B;  3C1C D;  2F2A C;  3AZH C;  1P3P D;  3AZI D;  3AN2 D;  1P3P C;  3AZI C;  5CHL B;  3A6N A;  3AN2 C;  2ARO C;  5GT0 D;  4H9O A;  5BO0 B;  5JRG A;  3AFA D;  1M1A B;  5GT0 C;  3AFA C;  5CPK B;  5FUG A;  3TU4 B;  1P3L C;  3MGP B;  5DNN A;  3REL C;  1ZLA C;  5AVB D;  2PYO B;  3WA9 D;  4R8P D;  1P3B A;  5AVB C;  3LEL A;  5GSU D;  1S32 A;  4R8P C;  3X1V B;  3WA9 C;  2J8P A;  5GSU C;  2UWX A;  3NQJ B;  2ZY4 A;  3UT9 D;  2YFV A;  3REK A;  1P3O A;  5AV5 B;  3C1C A;  3AZK D;  1P3P A;  3AZI A;  3AN2 A;  2YFW A;  1P3F C;  4EO5 C;  5GT0 A;  3AFA A;  1P34 D;  2VQR A;  4XZQ C;  2NZD B;  5AVB A;  1BH8 A;  4Z2M G;  4R8P A;  5B31 G;  4J8U C;  3WA9 A;  2F8N K;  5GSU A;  5CPI B;  3EPL A;  1M18 D;  3UTB B;  1M18 C;  3UT9 A;  4H9P B;  1F66 B;  3VH5 A;  4J8X B;  3AZK A;  3A1K A;  5B2I D;  4WU8 C;  1BH9 B;  3REI B;  2L5A A;  1P3G B;  3H0M C;  5B40 B;  2G5I C;  5GT3 D;  1KX5 C;  4KGC B;  1WWI A;  4Z2M H;  4WV4 B;  1P34 A;  2W8S A;  2NQB C;  4J8V C;  3MVD B;  3KXB B;  4YS3 C;  5AV6 C;  3O62 C;  2CV5 D;  1P3K D;  2JE5 A;  3VH6 W;  2CWE A;  1P3K C;  1M18 A;  1JFI A;  3X1T D;  1P3A B;  5B33 D;  5B33 C;  5BT1 C;  5B2I A;  1TAF A;  5B31 B;  5B32 C;  5AVC D;  3AYW D;  3AV1 D;  3WKJ D;  5AVC C;  5GT3 A;  3X1S C;  3WKJ C;  1H3O B;  5B0Z D;  4WU9 B;  3AZL B;  2FJ7 D;  2HIO B;  3B6G C;  2CV5 A;  3KSY A;  1P3K A;  4Z66 C;  5BNX A;  4LD9 B;  3X1T A;  3A6N B;  5B33 A;  5JRG B;  4QLC C;  4YM6 D;  5FUG B;  3W99 D;  5AVC A;  4YM6 C;  3B0D B;  5AV5 C;  3AYW A;  3AV1 A;  3WKJ A;  2HUE B;  3AZF D;  5B0Z A;  3UTA C;  3AZF C;  2BYK A;  5F99 D;  3MGS A;  3LEL B;  1P3B B;  1S32 B;  3W96 B;  3W97 D;  4HGA B;  3W97 C;  1AOI C;  2YFV B;  3REK B;  4NE3 A;  3KWQ C;  3EPJ A;  1P3O B;  4KUD D;  5E5A D;  2Y2P A;  4UUZ A;  3AZG C;  4WJ3 C;  2YFW B;  5B2J D;  4CSR B;  3VH6 T;  5B0Y D;  4YM6 A;  3AZN B;  3W99 A;  3AZF A;  5C3I B;  3MGQ D;  1KU5 A;  2DQN C;  5F99 A;  4Z5T B;  3MGQ C;  3W97 A;  3AZJ D;  3WTP C;  3UT9 B;  1KX4 D;  4KUD A;  1P3M B;  3AZK B;  1M19 D;  5E5A A;  3W98 D;  3LZ1 D;  1M19 C;  3W98 C;  4CAY A;  5B2J A;  3X1U D;  4AWL C;  3X1U C;  5B0Y A;  1P34 B;  5AY8 D;  5AY8 C;  3WAA D;  5G49 A;  3R45 A;  3MGQ A;  4UPK A;  2IO5 C;  3AZJ A;  1JFI B;  1U35 B;  1TZY C;  2RIQ A;  4JJN B;  4H9Q A;  2Y2Q A;  5DNM C;  3REJ D;  1KX4 A;  5CPJ C;  3AZH D;  5B2I B;  3AZM D;  1M19 A;  3W98 A;  3AZM C;  3LZ1 A;  2ARO D;  3X1U A;  3REH D;  5GT3 B;  5BNV A;  4ZBJ B;  5CP6 D;  3REH C;  5CP6 C;  4WZS B;  5AY8 A;  1P3L D;  3WAA A;  1ZLA D;  3REL D;  2CV5 B;  3B6F C;  4H9S C;  5B1L B;  2ZY3 A;  1A7W A;  5AV8 C;  3X1T B;  3REJ A;  3AZH A;  5KDM A;  3AZM A;  3MGP A;  1B67 A;  3LJA B;  3AYW B;  3AV1 B;  2ARO A;  1P3F D;  3REH A;  5B0Z B;  5CP6 A;  4XUJ D;  3MGS B;  4XZQ D;  4XUJ C;  5GXQ C;  4G91 C;  1P3L A;  1ZLA A;  3REL A;  4J8U D;  4H9S A;  3AZN C;  4X23 C;  1BFM A;  5C3I C;  4UUZ B;  4Z5T C;  5B1M C;  1EQZ B;  4WU8 D;  4H9R A;  1N1J B;  3W99 B;  2Y2H A;  3NQU B;  1P3F A;  2BYM A;  1KX5 D;  4ZUX D;  4ZUX C;  4G92 C;  4XUJ A;  5F99 B;  3AV2 D;  4XZQ A;  4J8V D;  2NQB D;  3MGR B;  3C1B B;  3AV2 C;  3KUY D;  2ZM5 A;  2Y2L A;  4YS3 D;  3FDD A;  5AV6 D;  3O62 D;  3KUY C;  4J8U A;  1P3I C;  1KX3 B;  4NFT A;  5AV9 D;  2F8N D;  5E5A B;  5B24 B;  5AV9 C;  4CAY B;  3MNN C;  2FJ7 B;  4WNN A;  5BT1 D;  3V9R A;  1ID3 B;  4WU8 A;  3AZE B;  5B32 D;  5B0Y B;  1HQ3 C;  1Z2C B;  3B0B A;  5G49 B;  3X1S D;  2Y2K A;  4ZUX A;  3R45 B;  3LZ0 C;  1KX5 A;  3AV2 A;  2NQB A;  4J8V A;  3KUY A;  3AZJ B;  3B6G D;  3O62 A;  5AV6 A;  4YS3 A;  1M1A C;  4J8W B;  1KX4 B;  5CPK C;  4Z66 D;  3TU4 C;  5AV9 A;  2F8N A;  3MGP C;  2PYO C;  2Y2I A;  3VH6 A;  3X1V C;  5BNV B;  4QLC D;  4H9O B;  5B32 A;  3EG5 B;  5AV5 D;  2JCH A;  3WAA B;  3X1S A;  3UTA D;  3EPK A;  5DNN B;  3B6G A;  1AOI D;  3REJ B;  3KWQ D;  4Z66 A;  3C1C B;  3AZH B;  4KHA A;  1P3P B;  3AZI B;  3AN2 B;  2NZD C;  3AZG D;  2ARO B;  4DRB A;  5CPI C;  4QLC A;  5GT0 B;  3AFA B;  3UTB D;  2DF4 C;  3UTB C;  5AV5 A;  4J8X D;  1P3L B;  1F66 C;  1ZLA B;  3REL B;  4J8X C;  3REI D;  3UTA A;  5B40 D;  5AVB B;  3REI C;  1BH8 B;  1P3G C;  4R8P B;  5B40 C;  3WA9 B;  5GSU B;  3WTP D;  1AOI A;  4KGC C;  3KWQ A;  3KXB D;  3MVD C;  3KXB C;  3AZG A;  1P3F B;  2BYM B;  4EO5 B;  3UTB A;  2RVQ C;  1P3A D;  4H9P A;  4XZQ B;  1P3A C;  4J8X A;  1BH9 A;  2JSS A;  4J8U B;  5B31 D;  5B40 A;  3REI A;  3A1I A;  5B31 C;  4DQY B;  1M18 B;  1TZY D;  3WTP A;  5JA4 A;  5DNM D;  4WU9 D;  3AZL D;  4WU9 C;  2HIO D;  5CPJ D;  5BS7 C;  3EPH A;  3AZL C;  2HIO C;  4WU8 B;  3KXB A;  1TAF B;  1KX5 B;  4LD9 D;  4LD9 C;  1P3A A;  2NQB B;  4J8V B;  3A6N C;  5JRG C;  5AV6 B;  5B31 A;  4YS3 B;  3B6F D;  1P3K B;  3B0D C;  1TZY A;  1H3O A;  5AV8 D;  5BNX B;  2HUE C;  4WU9 A;  5DNM A;  5DNN C;  3W96 D;  1F1E A;  5BS7 A;  3AZL A;  2HIO A;  3W96 C;  5B33 B;  3LEL C;  5CPJ A;  1S32 C;  1P3B C;  5B32 B;  4HGA C;  1PZR A;  3REK C;  5AVC B;  1P3O C;  3C1C C;  3X1S B;  3WKJ B;  4LD9 A;  2BYK B;  5GXQ D;  3B6G B;  3AZN D;  2ZY5 A;  4X23 D;  3B6F A;  4Z66 B;  4H9N A;  5AV8 A;  4KHA B;  3W96 A;  4Z5T D;  5B1M D;  4M6B A;  3VH5 W;  2Y2M A;  4QLC B;  4NE5 A;  4YM6 B;  3UT9 C;  1P3M D;  3B0C W;  1P3M C;  3AZK C;  3UTA B;  3AZF B;  5GXQ A;  3F6T A;  4CSR A;  1T3U A;  1P3I D;  2Y2J A;  1AOI B;  3W97 B;  3AZN A;  2FFF B;  4X23 A;  3KWQ B;  1P34 C;  4NE6 A;  4KUD B;  3AZG B;  4Z5T A;  3MNN D;  5B1M A;  5B2J B;  2Y2N A;  1U35 D;  4JJN D;  1HQ3 D;  1U35 C;  4JJN C;  1P3M A;  3P5J B;  3LZ0 D;  1B6W A;  5B2I C;  3MGQ B;  2LY8 A;  1P3I A;  3WTP B;  5GT3 C;  5JA4 B;  1M1A D;  4ZBJ C;  5CPK D;  4H9Q B;  3TU4 D;  1ULY A;  3MGP D;  1M19 B;  2PYO D;  3W98 B;  1R4V A;  5B1L D;  3MNN A;  3LZ1 B;  2CV5 C;  5B1L C;  3X1V D;  4AWL B;  1U35 A;  3X1U B;  4JJN A;  1HQ3 A;  3X1T C;  5AY8 B;  3LZ0 A;  1Q9C A;  3VH5 T;  3LJA D;  2IO5 B;  3LJA C;  3WTP E;  3AYW C;  3AV1 C;  1TZY B;  1M1A A;  5BO0 A;  5DNM B;  3B0C T;  5B0Z C;  3MGS D;  2Y2G A;  5CPK A;  5CPJ B;  3MGS C;  3TU4 A;  3H0R C;  5KDM B;  3AZM B;  2NZD D;  2G5H C;  2PYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...