3MGRD

Binding of rubidium ions to the nucleosome core particle
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgrD00
5AY8A 3AZKB 3AFAC 1HQ3C 3AZMA 5BS7C 2F8NB 3AV1C 3NQUA 3REIB 3X1UA 3AFAD 4XZQC 1HQ3D 3AZIA 3AZLB 1JFIA 3AV1D 5B33A 2F8NK 5B32G 4HGAC 1P3IA 1M1AA 3LZ0C 3MNNB 4XZQD 4JJNB 1M18C 4X23B 3X1VB 5JRGA 3LZ0D 5CP6C 3W98C 5GXQA 1EQZA 3LZ1B 5B0ZA 3AZHB 2NZDA 3KXBA 3REJB 5B2JA 4ZUXB 1Q9CA 1P3AA 2JSSA 5BNVA 3KUYC 4XUJA 2CV5C 4NE5A 4E45A 3KUYD 1KX4B 2CV5D 5BO0B 4NE3A 4DRAA 4CSRB 3B0DC 5AV8C 3WTPE 3AFAA 1P3LB 1HQ3A 5BS7A 3AV1A 5AV8D 3AN2B 4XZQA 1TZYC 4ZBJB 4J8VC 3LZ0A 1M18A 1TZYD 3UTBB 4J8VD 4NE6A 5CP6A 3W98A 3REIC 2HUEB 5B32B 4H9OB 1P3BD 3REID 5BNXA 1B67A 3MNNC 4X23C 4H9NA 3B0CW 3X1VC 3AZFB 1BH8B 3MNND 3WAAB 4X23D 5GT0B 5CHLB 3KUYA 3X1VD 3LZ1C 3AZHC 2CV5A 3AV2B 3LZ1D 3AZHD 1P3MB 3VH5W 3B6FB 5AV8A 1P3FC 5CPIB 4KHAB 3TU4C 1KX4C 1AOIB 1P3FD 4KGCB 1TZYA 3V9RA 3TU4D 4YS3B 1KX4D 4CAYA 4J8VA 2YFVB 4WV4B 5AVCD 1P3LC 2F8NA 5FUGB 3REIA 1U35B 3AN2C 1P3LD 5F99B 4WU9B 3AN2D 3MNNA 4Z66B 4X23A 3UTBC 3LJAB 3X1VA 5B31G 3UTBD 3LZ1A 3AZHA 2HUEC 3MGPB 3AZMC 4WNNB 3AZFC 5E5AB 3RELB 3A6NB 3AZMD 5DNMB 3REHB 5GT0C 1HTAA 3AZFD 1P3FA 3AZID 3B6GB 3TU4A 2BYMB 5GT0D 1KX4A 3W97C 4LD9B 5BO0A 3W97D 1EQZC 4J8UB 4CSRA 3B6FC 2PYOC 1EQZD 5AV9B 5CPIC 1P3LA 5B40C 5B1LB 3B6FD 2PYOD 1AOIC 3AN2A 5CPID 3VH6A 5B40D 5GSUB 4YS3C 1AOID 3UTBA 4YS3D 5AVBB 1N1JB 1KU5A 1M19B 3MVDB 1U35C 4EO5B 3W99C 3R45B 4WU9C 4H9OA 4H9RB 1U35D 3W99D 4WU9D 4Z66C 1S32B 3LJAC 3AZFA 1BH8A 4Z66D 5GT0A 3LJAD 3X1SB 3W97A 4YM6B 1M18D 5CPKC 4H9QB 1P34C 5E5AC 5CP6D 3A6NC 3RELC 3W98D 5DNMC 5B24B 3REHC 5CPKD 3B6FA 2PYOA 3C1BB 5CPIA 4KHAA 5B1MB 5E5AD 5B40A 3A6ND 3RELD 5DNMD 3REHD 1P34D 3B6GC 4H9SC 5AV5C 3AZNB 3VH5T 2YFWB 1P3OB 3AZEB 1AOIA 4E44A 3B6GD 4YS3A 5AV5D 3AYWB 4J8UC 2AROB 2YFVA 3UTAB 4KUDB 4J8UD 5KDMB 5FUGA 1U35A 4WU9A 3W99A 1A7WA 5GSUC 1H3OB 4Z66A 5BT1C 5GSUD 3LJAA 3WTPC 5AVBC 5BT1D 3MVDC 3WTPD 4EO5C 5AVBD 3WKJB 3AZKC 1TAFB 2IO5B 3MGPA 3MVDD 3AZJB 4WNNA 3AZKD 5CPKA 1S32C 5DNNB 1P34A 5E5AA 3RELA 3A6NA 3AZLC 2F8ND 5DNMA 3REHA 1F66B 1S32D 4JJNC 3AZLD 3B6GA 3X1SC 2BYMA 4YM6C 4H9SA 5AV5A 3LELB 4JJND 3X1SD 4YM6D 4NFTA 4J8UA 5B24C 3REJC 4J8XB 5AV9A 1WWSA 4ZUXC 5B1MC 5B24D 3REJD 2BYKB 3AZNC 1P3OC 4ZUXD 3AZEC 5B1MD 1ZLAB 5GSUA 3UT9B 3AZND 3AYWC 1P3OD 3AZED 2FJ7B 3UTAC 4KUDC 3WTPA 3AYWD 3VH6W 5G49B 5AVBA 3MVDA 3UTAD 4KUDD 3R45A 3AZKA 4H9RA 3C1CB 4R8PB 1S32A 3AZLA 4ZBJC 1B6WA 5B0ZB 4JJNA 2NZDB 5JA4B 2RVQC 2IO5C 3X1SA 4YM6A 5B0YB 5B2JB 3AZJC 2RVQD 4H9QA 5DNNC 1P3AB 3AZJD 5B32C 5B24A 1F66C 3REJA 3MGQB 3C1BA 4ZUXA 5DNND 5B1MA 5B32D 2LY8A 1F66D 1BFMA 1ULYA 3AZNA 3LELC 1P3OA 3AZEA 3WAAC 3AYWA 3LELD 1WWIA 3WAAD 3MGRB 1KX3B 4J8XC 3UTAA 3KWQB 3AV2C 4KUDA 2HIOB 1HQ3B 1P3MC 4G92B 3AV2D 1ZLAC 4J8WB 1P3MD 1ID3B 3W96B 3UT9C 4WZSB 2FJ7C 1H3OA 1ZLAD 1F1EA 4KGCC 2FJ7D 4KGCD 1TAFA 5B2IB 4UUZB 3AZJA 3C1CC 4R8PC 5DNNA 5F99C 3C1CD 2L5AA 5B32A 1F66A 4R8PD 5F99D 5GT3B 5B31B 5B0YC 3LELA 3WAAA 5B0YD 3B0CT 4H9PB 3MGPC 4J8XA 3MGQC 3AV2A 3MGPD 1P3MA 2BYKA 3MGQD 3AZGB 4G91B 1ZLAA 3UT9A 4J8VB 2FJ7A 3MGRC 1KX3C 4LD9C 1BH9B 3KWQC 5G49A 1P3PB 2HIOC 4KGCA 3MGRD 4G92C 1P3BB 1KX3D 4LD9D 3KWQD 2HIOD 3W96C 4J8WC 1ID3C 5AV9C 3VH6T 3C1CA 4QLCB 5B1LC 4R8PA 4J8WD 3W96D 1ID3D 5AV9D 5F99A 1P3KB 5B1LD 1KX5B 3O62B 5JA4A 2NQBB 5B2IC 5B0YA 4Z5TB 1M19C 5CPJB 5B2ID 3WA9B 3KSYA 1M19D 3MGQA 1P3FB 4AWLB 1P3GB 3TU4B 5GT3C 5B31C 3MGSB 5AVCB 5GT3D 5B31D 3MGRA 3REKB 1KX3A 4LD9A 3KWQA 2HIOA 3X1TB 3AZGC 4G91C 5AV6B 3W96A 4J8WA 1ID3A 3NQJB 3C1BC 3AZGD 5B1LA 4WU8B 3C1BD 1P3PC 1R4VA 1P3BC 1P3PD 2AROC 5AY8B 5B2IA 4UUZA 3AZMB 1N1JA 2AROD 4QLCC 1M19A 3NQUB 3X1UB 3AZIB 1P3KC 1JFIB 4QLCD 5B33B 1KX5C 3O62C 1P3IB 1M1AB 4DRBA 1P3KD 3W97B 2NQBC 5GT3A 5JRGB 3O62D 5B31A 4Z5TC 1KX5D 3B0BA 5GXQB 1EQZB 2NQBD 5CPJC 3WA9C 4Z5TD 3WKJC 4H9PA 3KXBB 2PYOB 5CPJD 4AWLC 3WA9D 1P3GC 3WKJD 5B40B 3AZGA 3MGSC 1P3GD 5BNVB 4XUJB 5AVCC 4M6BA 3MGSD 5C3IB 3REKC 1BH9A 2YFWA 1P3PA 3REKD 4Z2MH 3X1TC 1P3BA 4Z2MG 2AROA 5AV6C 3W99B 3X1TD 3AFAB 4QLCA 5KDMA 5AV6D 3AV1B 4WU8C 4J8XD 2F8NH 2F8NG 4XZQB 1P3KA 4WU8D 1KX5A 4HGAB 3O62A 3LZ0B 1M18B 5AY8C 2NQBA 3UT9D 4Z5TA 5CP6B 3W98B 5AY8D 5CPKB 3X1UC 5CPJA 2CWEA 1P34B 3AZIC 3WA9A 3WKJA 5B33C 1P3IC 3X1UD 1M1AC 5BNXB 1P3GA 4H9NB 5B33D 5JRGC 5AV5B 1P3ID 3MGSA 1M1AD 5GXQC 3KUYB 5JRGD 5AVCA 5B0ZC 2CV5B 2NZDC 3VH5A 5GXQD 3KXBC 3REKA 5B2JC 5B0ZD 2NZDD 3KXBD 3X1TA 1P3AC 5B2JD 5AV6A 3B0DB 5AV8B 4XUJC 3NQJA 1P3AD 5C3IC 4WU8A 4XUJD 3WTPB 1TZYB 3V9RB 4CAYB
chains in the Genus database with same CATH superfamily
5AY8A 3AZKB 2DQNC 3AFAC 1HQ3C 3AZMA 5BS7C 2F8NB 3AV1C 3NQUA 3REIB 3X1UA 3AFAD 4XZQC 1HQ3D 3AZIA 3AZLB 1JFIA 3H0MC 5B33A 3AV1D 2F8NK 5B32G 4HGAC 1P3IA 1M1AA 3LZ0C 3MNNB 4XZQD 4JJNB 1M18C 4X23B 3X1VB 5JRGA 3LZ0D 5CP6C 3W98C 5GXQA 1EQZA 3LZ1B 5B0ZA 3AZHB 2NZDA 3KXBA 3REJB 2Y2GA 5B2JA 4ZUXB 1Q9CA 1P3AA 2JSSA 5BNVA 3KUYC 4XUJA 2CV5C 2ZY5A 4NE5A 4E45A 3KUYD 1KX4B 2CV5D 5BO0B 3A1IA 4NE3A 4DRAA 4CSRB 3B0DC 5AV8C 3F6TA 3WTPE 3AFAA 1P3LB 1HQ3A 5BS7A 3AV1A 5AV8D 3AN2B 4XZQA 1TZYC 3H0RC 2Y2QA 4ZBJB 4J8VC 3LZ0A 1M18A 1TZYD 3UTBB 2FFFB 4J8VD 4NE6A 5CP6A 1PZRA 3W98A 3REIC 2HUEB 5B32B 2XD1A 4H9OB 1P3BD 3REID 5BNXA 1B67A 3MNNC 4X23C 4H9NA 3B0CW 3X1VC 3KFUG 3AZFB 1BH8B 3MNND 3WAAB 4X23D 5GT0B 5CHLB 3KUYA 3X1VD 2Y2LA 3LZ1C 3AZHC 2CV5A 1Z2CB 3AV2B 3LZ1D 3AZHD 1P3MB 3VH5W 3B6FB 5AV8A 2DF4C 1P3FC 3EPHA 5CPIB 4KHAB 3EPJA 3TU4C 1KX4C 1AOIB 1P3FD 4KGCB 1TZYA 3V9RA 3TU4D 4YS3B 1KX4D 4CAYA 4J8VA 2YFVB 4WV4B 5AVCD 1P3LC 3A1KA 2F8NA 5FUGB 3REIA 1U35B 3AN2C 1P3LD 5F99B 4WU9B 2Y2JA 2G5IC 3AN2D 3MNNA 4Z66B 4X23A 3UTBC 3LJAB 3X1VA 5B31G 3UTBD 3H0LC 3LZ1A 3AZHA 2HUEC 3MGPB 2Y2IA 3AZMC 4WNNB 3AZFC 5E5AB 3RELB 3A6NB 3AZMD 5DNMB 3REHB 5GT0C 1HTAA 3AZFD 1P3FA 3EPKA 3AZID 3B6GB 3TU4A 2BYMB 5GT0D 1KX4A 3W97C 4LD9B 5BO0A 3W97D 1EQZC 4J8UB 4CSRA 3B6FC 2PYOC 1EQZD 5AV9B 5CPIC 1P3LA 5B40C 5B1LB 3B6FD 2PYOD 1AOIC 3AN2A 5CPID 3VH6A 5B40D 5GSUB 4YS3C 1AOID 3UTBA 4YS3D 2J8PA 5AVBB 1N1JB 1KU5A 1M19B 3MVDB 1U35C 4EO5B 3W99C 3R45B 4WU9C 4H9OA 2ZY3A 4H9RB 1U35D 3W99D 4WU9D 4Z66C 1S32B 3LJAC 3AZFA 1BH8A 4Z66D 5GT0A 3LJAD 1T3UA 3X1SB 3W97A 4YM6B 1M18D 5CPKC 4H9QB 1P34C 5E5AC 5CP6D 3A6NC 3RELC 3W98D 5DNMC 5B24B 3REHC 5CPKD 3B6FA 2PYOA 3C1BB 5CPIA 4KHAA 5B1MB 2UWXA 5E5AD 5B40A 3A6ND 5DNMD 3REHD 3RELD 3B6GC 4H9SC 5AV5C 3AZNB 3VH5T 2YFWB 1P3OB 3AZEB 1AOIA 4E44A 3B6GD 4YS3A 5AV5D 3AYWB 4J8UC 2AROB 2YFVA 3UTAB 4KUDB 4J8UD 5KDMB 5FUGA 1U35A 4WU9A 3W99A 1A7WA 5GSUC 1H3OB 4Z66A 5BT1C 5GSUD 3LJAA 3WTPC 5AVBC 5BT1D 3MVDC 3WTPD 4EO5C 5AVBD 3WKJB 3AZKC 1TAFB 2IO5B 3MGPA 3MVDD 3AZJB 4WNNA 3AZKD 5CPKA 1S32C 5DNNB 1P34A 5E5AA 3RELA 3A6NA 3AZLC 2F8ND 5DNMA 3REHA 1F66B 1S32D 4JJNC 3AZLD 3B6GA 3EPLA 3X1SC 2BYMA 4YM6C 4H9SA 5AV5A 3LELB 4JJND 3X1SD 4YM6D 4NFTA 4UPKA 4J8UA 5B24C 3REJC 4J8XB 5AV9A 1WWSA 4ZUXC 5B1MC 5B24D 3REJD 2BYKB 3AZNC 1P3OC 4ZUXD 3AZEC 5B1MD 1ZLAB 5GSUA 3UT9B 3AZND 3AYWC 1P3OD 3AZED 2FJ7B 3UTAC 4KUDC 3WTPA 3AYWD 3VH6W 5G49B 5AVBA 3MVDA 3UTAD 4KUDD 3R45A 3AZKA 4H9RA 3C1CB 3P5JB 4R8PB 1S32A 3AZLA 4ZBJC 1B6WA 5B0ZB 4JJNA 2NZDB 2Y2KA 5JA4B 2RVQC 2IO5C 3X1SA 4YM6A 3EG5B 5B0YB 5B2JB 3AZJC 2RVQD 2ZY2A 4H9QA 5DNNC 1P3AB 3AZJD 5B32C 5B24A 1F66C 3REJA 2JCHA 3MGQB 3C1BA 4ZUXA 5DNND 5B1MA 5B32D 2LY8A 1F66D 1BFMA 1ULYA 3AZNA 3LELC 1P3OA 3AZEA 3WAAC 3AYWA 3LELD 1WWIA 3WAAD 3MGRB 1KX3B 4J8XC 3UTAA 3KWQB 3AV2C 4KUDA 2HIOB 1HQ3B 1P34D 1P3MC 4G92B 3AV2D 1ZLAC 4J8WB 2Y2NA 1P3MD 1ID3B 3W96B 3UT9C 4WZSB 2FJ7C 1H3OA 1ZLAD 1F1EA 4KGCC 2FJ7D 4WJ3C 4KGCD 1TAFA 5B2IB 4UUZB 3AZJA 3C1CC 4R8PC 5DNNA 5F99C 3C1CD 2L5AA 5B32A 1F66A 4R8PD 5F99D 2XD5A 5GT3B 5B31B 5B0YC 3LELA 2RIQA 3WAAA 5B0YD 3B0CT 4H9PB 3MGPC 4J8XA 3MGQC 3AV2A 3MGPD 1P3MA 2BYKA 3MGQD 3AZGB 4G91B 1ZLAA 3UT9A 4J8VB 2FJ7A 3MGRC 1KX3C 4LD9C 1BH9B 3KWQC 5G49A 1P3PB 2HIOC 4KGCA 3MGRD 4G92C 1P3BB 1KX3D 4LD9D 3KWQD 2HIOD 3W96C 4J8WC 1ID3C 5AV9C 3VH6T 2F2AC 2Y2PA 4QLCB 3C1CA 5B1LC 4R8PA 4J8WD 3W96D 1ID3D 5AV9D 5F99A 1P3KB 2BG1A 5B1LD 1KX5B 3O62B 5JA4A 2VQRA 2NQBB 5B2IC 5B0YA 4Z5TB 1M19C 5CPJB 5B2ID 3WA9B 3KSYA 2Y2OA 1M19D 3MGQA 1P3FB 4AWLB 1P3GB 3TU4B 2Y2HA 2ZY4A 5GT3C 5B31C 3MGSB 2Y2MA 5AVCB 5GT3D 5B31D 3MGRA 3REKB 1KX3A 4LD9A 3KWQA 2HIOA 3X1TB 3AZGC 4G91C 5AV6B 3W96A 4J8WA 1ID3A 3NQJB 3C1BC 3AZGD 5B1LA 4WU8B 3C1BD 1P3PC 1R4VA 1P3BC 1P3PD 2AROC 5AY8B 3AL0C 5B2IA 4UUZA 3AZMB 1N1JA 2AROD 4QLCC 1M19A 2JE5A 3NQUB 3X1UB 3AZIB 1P3KC 1JFIB 2ZM5A 4QLCD 5B33B 1KX5C 3O62C 1P3IB 1M1AB 4DRBA 1P3KD 3W97B 2NQBC 5GT3A 5JRGB 3O62D 5B31A 1W2EA 4Z5TC 1KX5D 3B0BA 5GXQB 2G5HC 1EQZB 2NQBD 5CPJC 3WA9C 4Z5TD 3WKJC 4H9PA 3KXBB 2PYOB 5CPJD 4AWLC 3WA9D 1P3GC 3WKJD 5B40B 3AZGA 3MGSC 1P3GD 5BNVB 4XUJB 5AVCC 4M6BA 3MGSD 5C3IB 3REKC 1BH9A 2YFWA 1P3PA 3REKD 4Z2MH 3X1TC 1P3BA 4Z2MG 2AROA 5AV6C 3W99B 3X1TD 3AFAB 4QLCA 5KDMA 5AV6D 3AV1B 4WU8C 4J8XD 2F8NH 2F8NG 4XZQB 1P3KA 4WU8D 1KX5A 4HGAB 3O62A 3LZ0B 1M18B 5AY8C 2NQBA 3UT9D 4Z5TA 5CP6B 3W98B 5AY8D 5CPKB 3X1UC 5CPJA 2CWEA 1P34B 3AZIC 3WA9A 3WKJA 5B33C 1P3IC 3X1UD 1M1AC 5BNXB 1P3GA 2W8SA 4H9NB 5B33D 5JRGC 5AV5B 1P3ID 3MGSA 1M1AD 5GXQC 3KUYB 5JRGD 5AVCA 5B0ZC 2CV5B 2NZDC 3VH5A 5GXQD 3KXBC 3REKA 5B2JC 5B0ZD 2NZDD 3KXBD 3X1TA 1P3AC 5B2JD 5AV6A 3B0DB 5AV8B 3IP4C 3NQJA 4XUJC 1P3AD 5C3IC 4WU8A 4XUJD 3WTPB 1TZYB 3V9RB 4DQYB 4CAYB 3FDDA
chains in the Genus database with same CATH topology
5AY8A 3AZKB 2DQNC 3AFAC 1HQ3C 3AZMA 5BS7C 2F8NB 3AV1C 3NQUA 3REIB 3X1UA 3AFAD 4XZQC 1HQ3D 3AZIA 3AZLB 1JFIA 3H0MC 5B33A 3AV1D 2F8NK 5B32G 4HGAC 1P3IA 1M1AA 3LZ0C 3MNNB 4XZQD 4JJNB 1M18C 4X23B 3X1VB 5JRGA 3LZ0D 5CP6C 3W98C 5GXQA 1EQZA 3LZ1B 5B0ZA 3AZHB 2NZDA 3KXBA 3REJB 2Y2GA 5B2JA 4ZUXB 1Q9CA 1P3AA 2JSSA 5BNVA 3KUYC 4XUJA 2CV5C 2ZY5A 4NE5A 4E45A 3KUYD 1KX4B 2CV5D 5BO0B 3A1IA 4NE3A 4DRAA 4CSRB 3B0DC 5AV8C 3F6TA 3WTPE 3AFAA 1P3LB 1HQ3A 5BS7A 3AV1A 5AV8D 3AN2B 4XZQA 1TZYC 3H0RC 2Y2QA 4ZBJB 4J8VC 3LZ0A 1M18A 1TZYD 3UTBB 2FFFB 4J8VD 4NE6A 5CP6A 1PZRA 3W98A 3REIC 2HUEB 5B32B 2XD1A 4H9OB 1P3BD 3REID 5BNXA 1B67A 3MNNC 4X23C 4H9NA 3B0CW 3X1VC 3KFUG 3AZFB 1BH8B 3MNND 3WAAB 4X23D 5GT0B 5CHLB 3KUYA 3X1VD 2Y2LA 3LZ1C 3AZHC 2CV5A 1Z2CB 3AV2B 3LZ1D 3AZHD 1P3MB 3VH5W 3B6FB 5AV8A 2DF4C 1P3FC 3EPHA 5CPIB 4KHAB 3EPJA 3TU4C 1KX4C 1AOIB 1P3FD 4KGCB 1TZYA 3V9RA 3TU4D 4YS3B 1KX4D 4CAYA 4J8VA 2YFVB 4WV4B 5AVCD 1P3LC 3A1KA 2F8NA 5FUGB 3REIA 1U35B 3AN2C 1P3LD 5F99B 4WU9B 2Y2JA 2G5IC 3AN2D 3MNNA 4Z66B 4X23A 3UTBC 3LJAB 3X1VA 5B31G 3UTBD 3H0LC 3LZ1A 3AZHA 2HUEC 3MGPB 2Y2IA 3AZMC 4WNNB 3AZFC 5E5AB 3RELB 3A6NB 3AZMD 5DNMB 3REHB 5GT0C 1HTAA 3AZFD 1P3FA 3EPKA 3AZID 3B6GB 3TU4A 2BYMB 5GT0D 1KX4A 3W97C 4LD9B 5BO0A 3W97D 1EQZC 4J8UB 4CSRA 3B6FC 2PYOC 1EQZD 5AV9B 5CPIC 1P3LA 5B40C 5B1LB 3B6FD 2PYOD 1AOIC 3AN2A 5CPID 3VH6A 5B40D 5GSUB 4YS3C 1AOID 3UTBA 4YS3D 2J8PA 5AVBB 1N1JB 1KU5A 1M19B 3MVDB 1U35C 4EO5B 3W99C 3R45B 4WU9C 4H9OA 2ZY3A 4H9RB 1U35D 3W99D 4WU9D 4Z66C 1S32B 3LJAC 3AZFA 1BH8A 4Z66D 5GT0A 3LJAD 1T3UA 3X1SB 3W97A 4YM6B 1M18D 5CPKC 4H9QB 1P34C 5E5AC 5CP6D 3A6NC 3RELC 3W98D 5DNMC 5B24B 3REHC 5CPKD 3B6FA 2PYOA 3C1BB 5CPIA 4KHAA 5B1MB 2UWXA 5E5AD 5B40A 3A6ND 5DNMD 3REHD 3RELD 3B6GC 4H9SC 5AV5C 3AZNB 3VH5T 2YFWB 1P3OB 3AZEB 1AOIA 4E44A 3B6GD 4YS3A 5AV5D 3AYWB 4J8UC 2AROB 2YFVA 3UTAB 4KUDB 4J8UD 5KDMB 5FUGA 1U35A 4WU9A 3W99A 1A7WA 5GSUC 1H3OB 4Z66A 5BT1C 5GSUD 3LJAA 3WTPC 5AVBC 5BT1D 3MVDC 3WTPD 4EO5C 5AVBD 3WKJB 3AZKC 1TAFB 2IO5B 3MGPA 3MVDD 3AZJB 4WNNA 3AZKD 5CPKA 1S32C 5DNNB 1P34A 5E5AA 3RELA 3A6NA 3AZLC 2F8ND 5DNMA 3REHA 1F66B 1S32D 4JJNC 3AZLD 3B6GA 3EPLA 3X1SC 2BYMA 4YM6C 4H9SA 5AV5A 3LELB 4JJND 3X1SD 4YM6D 4NFTA 4UPKA 4J8UA 5B24C 3REJC 4J8XB 5AV9A 1WWSA 4ZUXC 5B1MC 5B24D 3REJD 2BYKB 3AZNC 1P3OC 4ZUXD 3AZEC 5B1MD 1ZLAB 5GSUA 3UT9B 3AZND 3AYWC 1P3OD 3AZED 2FJ7B 3UTAC 4KUDC 3WTPA 3AYWD 3VH6W 5G49B 5AVBA 3MVDA 3UTAD 4KUDD 3R45A 3AZKA 4H9RA 3C1CB 3P5JB 4R8PB 1S32A 3AZLA 4ZBJC 1B6WA 5B0ZB 4JJNA 2NZDB 2Y2KA 5JA4B 2RVQC 2IO5C 3X1SA 4YM6A 3EG5B 5B0YB 5B2JB 3AZJC 2RVQD 2ZY2A 4H9QA 5DNNC 1P3AB 3AZJD 5B32C 5B24A 1F66C 3REJA 2JCHA 3MGQB 3C1BA 4ZUXA 5DNND 5B1MA 5B32D 2LY8A 1F66D 1BFMA 1ULYA 3AZNA 3LELC 1P3OA 3AZEA 3WAAC 3AYWA 3LELD 1WWIA 3WAAD 3MGRB 1KX3B 4J8XC 3UTAA 3KWQB 3AV2C 4KUDA 2HIOB 1HQ3B 1P34D 1P3MC 4G92B 3AV2D 1ZLAC 4J8WB 2Y2NA 1P3MD 1ID3B 3W96B 3UT9C 4WZSB 2FJ7C 1H3OA 1ZLAD 1F1EA 4KGCC 2FJ7D 4WJ3C 4KGCD 1TAFA 5B2IB 4UUZB 3AZJA 3C1CC 4R8PC 5DNNA 5F99C 3C1CD 2L5AA 5B32A 1F66A 4R8PD 5F99D 2XD5A 5GT3B 5B31B 5B0YC 3LELA 2RIQA 3WAAA 5B0YD 3B0CT 4H9PB 3MGPC 4J8XA 3MGQC 3AV2A 3MGPD 1P3MA 2BYKA 3MGQD 3AZGB 4G91B 1ZLAA 3UT9A 4J8VB 2FJ7A 3MGRC 1KX3C 4LD9C 1BH9B 3KWQC 5G49A 1P3PB 2HIOC 4KGCA 3MGRD 4G92C 1P3BB 1KX3D 4LD9D 3KWQD 2HIOD 3W96C 4J8WC 1ID3C 5AV9C 3VH6T 2F2AC 2Y2PA 4QLCB 3C1CA 5B1LC 4R8PA 4J8WD 3W96D 1ID3D 5AV9D 5F99A 1P3KB 2BG1A 5B1LD 1KX5B 3O62B 5JA4A 2VQRA 2NQBB 5B2IC 5B0YA 4Z5TB 1M19C 5CPJB 5B2ID 3WA9B 3KSYA 2Y2OA 1M19D 3MGQA 1P3FB 4AWLB 1P3GB 3TU4B 2Y2HA 2ZY4A 5GT3C 5B31C 3MGSB 2Y2MA 5AVCB 5GT3D 5B31D 3MGRA 3REKB 1KX3A 4LD9A 3KWQA 2HIOA 3X1TB 3AZGC 4G91C 5AV6B 3W96A 4J8WA 1ID3A 3NQJB 3C1BC 3AZGD 5B1LA 4WU8B 3C1BD 1P3PC 1R4VA 1P3BC 1P3PD 2AROC 5AY8B 3AL0C 5B2IA 4UUZA 3AZMB 1N1JA 2AROD 4QLCC 1M19A 2JE5A 3NQUB 3X1UB 3AZIB 1P3KC 1JFIB 2ZM5A 4QLCD 5B33B 1KX5C 3O62C 1P3IB 1M1AB 4DRBA 1P3KD 3W97B 2NQBC 5GT3A 5JRGB 3O62D 5B31A 1W2EA 4Z5TC 1KX5D 3B0BA 5GXQB 2G5HC 1EQZB 2NQBD 5CPJC 3WA9C 4Z5TD 3WKJC 4H9PA 3KXBB 2PYOB 5CPJD 4AWLC 3WA9D 1P3GC 3WKJD 5B40B 3AZGA 3MGSC 1P3GD 5BNVB 4XUJB 5AVCC 4M6BA 3MGSD 5C3IB 3REKC 1BH9A 2YFWA 1P3PA 3REKD 4Z2MH 3X1TC 1P3BA 4Z2MG 2AROA 5AV6C 3W99B 3X1TD 3AFAB 4QLCA 5KDMA 5AV6D 3AV1B 4WU8C 4J8XD 2F8NH 2F8NG 4XZQB 1P3KA 4WU8D 1KX5A 4HGAB 3O62A 3LZ0B 1M18B 5AY8C 2NQBA 3UT9D 4Z5TA 5CP6B 3W98B 5AY8D 5CPKB 3X1UC 5CPJA 2CWEA 1P34B 3AZIC 3WA9A 3WKJA 5B33C 1P3IC 3X1UD 1M1AC 5BNXB 1P3GA 2W8SA 4H9NB 5B33D 5JRGC 5AV5B 1P3ID 3MGSA 1M1AD 5GXQC 3KUYB 5JRGD 5AVCA 5B0ZC 2CV5B 2NZDC 3VH5A 5GXQD 3KXBC 3REKA 5B2JC 5B0ZD 2NZDD 3KXBD 3X1TA 1P3AC 5B2JD 5AV6A 3B0DB 5AV8B 3IP4C 3NQJA 4XUJC 1P3AD 5C3IC 4WU8A 4XUJD 3WTPB 1TZYB 3V9RB 4DQYB 4CAYB 3FDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AY8 A;  3AZK B;  3AFA C;  1HQ3 C;  3AZM A;  5BS7 C;  2F8N B;  3AV1 C;  3NQU A;  3REI B;  3X1U A;  3AFA D;  4XZQ C;  1HQ3 D;  3AZI A;  3AZL B;  1JFI A;  3AV1 D;  5B33 A;  2F8N K;  5B32 G;  4HGA C;  1P3I A;  1M1A A;  3LZ0 C;  3MNN B;  4XZQ D;  4JJN B;  1M18 C;  4X23 B;  3X1V B;  5JRG A;  3LZ0 D;  5CP6 C;  3W98 C;  5GXQ A;  1EQZ A;  3LZ1 B;  5B0Z A;  3AZH B;  2NZD A;  3KXB A;  3REJ B;  5B2J A;  4ZUX B;  1Q9C A;  1P3A A;  2JSS A;  5BNV A;  3KUY C;  4XUJ A;  2CV5 C;  4NE5 A;  4E45 A;  3KUY D;  1KX4 B;  2CV5 D;  5BO0 B;  4NE3 A;  4DRA A;  4CSR B;  3B0D C;  5AV8 C;  3WTP E;  3AFA A;  1P3L B;  1HQ3 A;  5BS7 A;  3AV1 A;  5AV8 D;  3AN2 B;  4XZQ A;  1TZY C;  4ZBJ B;  4J8V C;  3LZ0 A;  1M18 A;  1TZY D;  3UTB B;  4J8V D;  4NE6 A;  5CP6 A;  3W98 A;  3REI C;  2HUE B;  5B32 B;  4H9O B;  1P3B D;  3REI D;  5BNX A;  1B67 A;  3MNN C;  4X23 C;  4H9N A;  3B0C W;  3X1V C;  3AZF B;  1BH8 B;  3MNN D;  3WAA B;  4X23 D;  5GT0 B;  5CHL B;  3KUY A;  3X1V D;  3LZ1 C;  3AZH C;  2CV5 A;  3AV2 B;  3LZ1 D;  3AZH D;  1P3M B;  3VH5 W;  3B6F B;  5AV8 A;  1P3F C;  5CPI B;  4KHA B;  3TU4 C;  1KX4 C;  1AOI B;  1P3F D;  4KGC B;  1TZY A;  3V9R A;  3TU4 D;  4YS3 B;  1KX4 D;  4CAY A;  4J8V A;  2YFV B;  4WV4 B;  5AVC D;  1P3L C;  2F8N A;  5FUG B;  3REI A;  1U35 B;  3AN2 C;  1P3L D;  5F99 B;  4WU9 B;  3AN2 D;  3MNN A;  4Z66 B;  4X23 A;  3UTB C;  3LJA B;  3X1V A;  5B31 G;  3UTB D;  3LZ1 A;  3AZH A;  2HUE C;  3MGP B;  3AZM C;  4WNN B;  3AZF C;  5E5A B;  3REL B;  3A6N B;  3AZM D;  5DNM B;  3REH B;  5GT0 C;  1HTA A;  3AZF D;  1P3F A;  3AZI D;  3B6G B;  3TU4 A;  2BYM B;  5GT0 D;  1KX4 A;  3W97 C;  4LD9 B;  5BO0 A;  3W97 D;  1EQZ C;  4J8U B;  4CSR A;  3B6F C;  2PYO C;  1EQZ D;  5AV9 B;  5CPI C;  1P3L A;  5B40 C;  5B1L B;  3B6F D;  2PYO D;  1AOI C;  3AN2 A;  5CPI D;  3VH6 A;  5B40 D;  5GSU B;  4YS3 C;  1AOI D;  3UTB A;  4YS3 D;  5AVB B;  1N1J B;  1KU5 A;  1M19 B;  3MVD B;  1U35 C;  4EO5 B;  3W99 C;  3R45 B;  4WU9 C;  4H9O A;  4H9R B;  1U35 D;  3W99 D;  4WU9 D;  4Z66 C;  1S32 B;  3LJA C;  3AZF A;  1BH8 A;  4Z66 D;  5GT0 A;  3LJA D;  3X1S B;  3W97 A;  4YM6 B;  1M18 D;  5CPK C;  4H9Q B;  1P34 C;  5E5A C;  5CP6 D;  3A6N C;  3REL C;  3W98 D;  5DNM C;  5B24 B;  3REH C;  5CPK D;  3B6F A;  2PYO A;  3C1B B;  5CPI A;  4KHA A;  5B1M B;  5E5A D;  5B40 A;  3A6N D;  3REL D;  5DNM D;  3REH D;  1P34 D;  3B6G C;  4H9S C;  5AV5 C;  3AZN B;  3VH5 T;  2YFW B;  1P3O B;  3AZE B;  1AOI A;  4E44 A;  3B6G D;  4YS3 A;  5AV5 D;  3AYW B;  4J8U C;  2ARO B;  2YFV A;  3UTA B;  4KUD B;  4J8U D;  5KDM B;  5FUG A;  1U35 A;  4WU9 A;  3W99 A;  1A7W A;  5GSU C;  1H3O B;  4Z66 A;  5BT1 C;  5GSU D;  3LJA A;  3WTP C;  5AVB C;  5BT1 D;  3MVD C;  3WTP D;  4EO5 C;  5AVB D;  3WKJ B;  3AZK C;  1TAF B;  2IO5 B;  3MGP A;  3MVD D;  3AZJ B;  4WNN A;  3AZK D;  5CPK A;  1S32 C;  5DNN B;  1P34 A;  5E5A A;  3REL A;  3A6N A;  3AZL C;  2F8N D;  5DNM A;  3REH A;  1F66 B;  1S32 D;  4JJN C;  3AZL D;  3B6G A;  3X1S C;  2BYM A;  4YM6 C;  4H9S A;  5AV5 A;  3LEL B;  4JJN D;  3X1S D;  4YM6 D;  4NFT A;  4J8U A;  5B24 C;  3REJ C;  4J8X B;  5AV9 A;  1WWS A;  4ZUX C;  5B1M C;  5B24 D;  3REJ D;  2BYK B;  3AZN C;  1P3O C;  4ZUX D;  3AZE C;  5B1M D;  1ZLA B;  5GSU A;  3UT9 B;  3AZN D;  3AYW C;  1P3O D;  3AZE D;  2FJ7 B;  3UTA C;  4KUD C;  3WTP A;  3AYW D;  3VH6 W;  5G49 B;  5AVB A;  3MVD A;  3UTA D;  4KUD D;  3R45 A;  3AZK A;  4H9R A;  3C1C B;  4R8P B;  1S32 A;  3AZL A;  4ZBJ C;  1B6W A;  5B0Z B;  4JJN A;  2NZD B;  5JA4 B;  2RVQ C;  2IO5 C;  3X1S A;  4YM6 A;  5B0Y B;  5B2J B;  3AZJ C;  2RVQ D;  4H9Q A;  5DNN C;  1P3A B;  3AZJ D;  5B32 C;  5B24 A;  1F66 C;  3REJ A;  3MGQ B;  3C1B A;  4ZUX A;  5DNN D;  5B1M A;  5B32 D;  2LY8 A;  1F66 D;  1BFM A;  1ULY A;  3AZN A;  3LEL C;  1P3O A;  3AZE A;  3WAA C;  3AYW A;  3LEL D;  1WWI A;  3WAA D;  3MGR B;  1KX3 B;  4J8X C;  3UTA A;  3KWQ B;  3AV2 C;  4KUD A;  2HIO B;  1HQ3 B;  1P3M C;  4G92 B;  3AV2 D;  1ZLA C;  4J8W B;  1P3M D;  1ID3 B;  3W96 B;  3UT9 C;  4WZS B;  2FJ7 C;  1H3O A;  1ZLA D;  1F1E A;  4KGC C;  2FJ7 D;  4KGC D;  1TAF A;  5B2I B;  4UUZ B;  3AZJ A;  3C1C C;  4R8P C;  5DNN A;  5F99 C;  3C1C D;  2L5A A;  5B32 A;  1F66 A;  4R8P D;  5F99 D;  5GT3 B;  5B31 B;  5B0Y C;  3LEL A;  3WAA A;  5B0Y D;  3B0C T;  4H9P B;  3MGP C;  4J8X A;  3MGQ C;  3AV2 A;  3MGP D;  1P3M A;  2BYK A;  3MGQ D;  3AZG B;  4G91 B;  1ZLA A;  3UT9 A;  4J8V B;  2FJ7 A;  3MGR C;  1KX3 C;  4LD9 C;  1BH9 B;  3KWQ C;  5G49 A;  1P3P B;  2HIO C;  4KGC A;  3MGR D;  4G92 C;  1P3B B;  1KX3 D;  4LD9 D;  3KWQ D;  2HIO D;  3W96 C;  4J8W C;  1ID3 C;  5AV9 C;  3VH6 T;  3C1C A;  4QLC B;  5B1L C;  4R8P A;  4J8W D;  3W96 D;  1ID3 D;  5AV9 D;  5F99 A;  1P3K B;  5B1L D;  1KX5 B;  3O62 B;  5JA4 A;  2NQB B;  5B2I C;  5B0Y A;  4Z5T B;  1M19 C;  5CPJ B;  5B2I D;  3WA9 B;  3KSY A;  1M19 D;  3MGQ A;  1P3F B;  4AWL B;  1P3G B;  3TU4 B;  5GT3 C;  5B31 C;  3MGS B;  5AVC B;  5GT3 D;  5B31 D;  3MGR A;  3REK B;  1KX3 A;  4LD9 A;  3KWQ A;  2HIO A;  3X1T B;  3AZG C;  4G91 C;  5AV6 B;  3W96 A;  4J8W A;  1ID3 A;  3NQJ B;  3C1B C;  3AZG D;  5B1L A;  4WU8 B;  3C1B D;  1P3P C;  1R4V A;  1P3B C;  1P3P D;  2ARO C;  5AY8 B;  5B2I A;  4UUZ A;  3AZM B;  1N1J A;  2ARO D;  4QLC C;  1M19 A;  3NQU B;  3X1U B;  3AZI B;  1P3K C;  1JFI B;  4QLC D;  5B33 B;  1KX5 C;  3O62 C;  1P3I B;  1M1A B;  4DRB A;  1P3K D;  3W97 B;  2NQB C;  5GT3 A;  5JRG B;  3O62 D;  5B31 A;  4Z5T C;  1KX5 D;  3B0B A;  5GXQ B;  1EQZ B;  2NQB D;  5CPJ C;  3WA9 C;  4Z5T D;  3WKJ C;  4H9P A;  3KXB B;  2PYO B;  5CPJ D;  4AWL C;  3WA9 D;  1P3G C;  3WKJ D;  5B40 B;  3AZG A;  3MGS C;  1P3G D;  5BNV B;  4XUJ B;  5AVC C;  4M6B A;  3MGS D;  5C3I B;  3REK C;  1BH9 A;  2YFW A;  1P3P A;  3REK D;  4Z2M H;  3X1T C;  1P3B A;  4Z2M G;  2ARO A;  5AV6 C;  3W99 B;  3X1T D;  3AFA B;  4QLC A;  5KDM A;  5AV6 D;  3AV1 B;  4WU8 C;  4J8X D;  2F8N H;  2F8N G;  4XZQ B;  1P3K A;  4WU8 D;  1KX5 A;  4HGA B;  3O62 A;  3LZ0 B;  1M18 B;  5AY8 C;  2NQB A;  3UT9 D;  4Z5T A;  5CP6 B;  3W98 B;  5AY8 D;  5CPK B;  3X1U C;  5CPJ A;  2CWE A;  1P34 B;  3AZI C;  3WA9 A;  3WKJ A;  5B33 C;  1P3I C;  3X1U D;  1M1A C;  5BNX B;  1P3G A;  4H9N B;  5B33 D;  5JRG C;  5AV5 B;  1P3I D;  3MGS A;  1M1A D;  5GXQ C;  3KUY B;  5JRG D;  5AVC A;  5B0Z C;  2CV5 B;  2NZD C;  3VH5 A;  5GXQ D;  3KXB C;  3REK A;  5B2J C;  5B0Z D;  2NZD D;  3KXB D;  3X1T A;  1P3A C;  5B2J D;  5AV6 A;  3B0D B;  5AV8 B;  4XUJ C;  3NQJ A;  1P3A D;  5C3I C;  4WU8 A;  4XUJ D;  3WTP B;  1TZY B;  3V9R B;  4CAY B; 
#chains in the Genus database with same CATH topology
 5AY8 A;  3AZK B;  2DQN C;  3AFA C;  1HQ3 C;  3AZM A;  5BS7 C;  2F8N B;  3AV1 C;  3NQU A;  3REI B;  3X1U A;  3AFA D;  4XZQ C;  1HQ3 D;  3AZI A;  3AZL B;  1JFI A;  3H0M C;  5B33 A;  3AV1 D;  2F8N K;  5B32 G;  4HGA C;  1P3I A;  1M1A A;  3LZ0 C;  3MNN B;  4XZQ D;  4JJN B;  1M18 C;  4X23 B;  3X1V B;  5JRG A;  3LZ0 D;  5CP6 C;  3W98 C;  5GXQ A;  1EQZ A;  3LZ1 B;  5B0Z A;  3AZH B;  2NZD A;  3KXB A;  3REJ B;  2Y2G A;  5B2J A;  4ZUX B;  1Q9C A;  1P3A A;  2JSS A;  5BNV A;  3KUY C;  4XUJ A;  2CV5 C;  2ZY5 A;  4NE5 A;  4E45 A;  3KUY D;  1KX4 B;  2CV5 D;  5BO0 B;  3A1I A;  4NE3 A;  4DRA A;  4CSR B;  3B0D C;  5AV8 C;  3F6T A;  3WTP E;  3AFA A;  1P3L B;  1HQ3 A;  5BS7 A;  3AV1 A;  5AV8 D;  3AN2 B;  4XZQ A;  1TZY C;  3H0R C;  2Y2Q A;  4ZBJ B;  4J8V C;  3LZ0 A;  1M18 A;  1TZY D;  3UTB B;  2FFF B;  4J8V D;  4NE6 A;  5CP6 A;  1PZR A;  3W98 A;  3REI C;  2HUE B;  5B32 B;  2XD1 A;  4H9O B;  1P3B D;  3REI D;  5BNX A;  1B67 A;  3MNN C;  4X23 C;  4H9N A;  3B0C W;  3X1V C;  3KFU G;  3AZF B;  1BH8 B;  3MNN D;  3WAA B;  4X23 D;  5GT0 B;  5CHL B;  3KUY A;  3X1V D;  2Y2L A;  3LZ1 C;  3AZH C;  2CV5 A;  1Z2C B;  3AV2 B;  3LZ1 D;  3AZH D;  1P3M B;  3VH5 W;  3B6F B;  5AV8 A;  2DF4 C;  1P3F C;  3EPH A;  5CPI B;  4KHA B;  3EPJ A;  3TU4 C;  1KX4 C;  1AOI B;  1P3F D;  4KGC B;  1TZY A;  3V9R A;  3TU4 D;  4YS3 B;  1KX4 D;  4CAY A;  4J8V A;  2YFV B;  4WV4 B;  5AVC D;  1P3L C;  3A1K A;  2F8N A;  5FUG B;  3REI A;  1U35 B;  3AN2 C;  1P3L D;  5F99 B;  4WU9 B;  2Y2J A;  2G5I C;  3AN2 D;  3MNN A;  4Z66 B;  4X23 A;  3UTB C;  3LJA B;  3X1V A;  5B31 G;  3UTB D;  3H0L C;  3LZ1 A;  3AZH A;  2HUE C;  3MGP B;  2Y2I A;  3AZM C;  4WNN B;  3AZF C;  5E5A B;  3REL B;  3A6N B;  3AZM D;  5DNM B;  3REH B;  5GT0 C;  1HTA A;  3AZF D;  1P3F A;  3EPK A;  3AZI D;  3B6G B;  3TU4 A;  2BYM B;  5GT0 D;  1KX4 A;  3W97 C;  4LD9 B;  5BO0 A;  3W97 D;  1EQZ C;  4J8U B;  4CSR A;  3B6F C;  2PYO C;  1EQZ D;  5AV9 B;  5CPI C;  1P3L A;  5B40 C;  5B1L B;  3B6F D;  2PYO D;  1AOI C;  3AN2 A;  5CPI D;  3VH6 A;  5B40 D;  5GSU B;  4YS3 C;  1AOI D;  3UTB A;  4YS3 D;  2J8P A;  5AVB B;  1N1J B;  1KU5 A;  1M19 B;  3MVD B;  1U35 C;  4EO5 B;  3W99 C;  3R45 B;  4WU9 C;  4H9O A;  2ZY3 A;  4H9R B;  1U35 D;  3W99 D;  4WU9 D;  4Z66 C;  1S32 B;  3LJA C;  3AZF A;  1BH8 A;  4Z66 D;  5GT0 A;  3LJA D;  1T3U A;  3X1S B;  3W97 A;  4YM6 B;  1M18 D;  5CPK C;  4H9Q B;  1P34 C;  5E5A C;  5CP6 D;  3A6N C;  3REL C;  3W98 D;  5DNM C;  5B24 B;  3REH C;  5CPK D;  3B6F A;  2PYO A;  3C1B B;  5CPI A;  4KHA A;  5B1M B;  2UWX A;  5E5A D;  5B40 A;  3A6N D;  5DNM D;  3REH D;  3REL D;  3B6G C;  4H9S C;  5AV5 C;  3AZN B;  3VH5 T;  2YFW B;  1P3O B;  3AZE B;  1AOI A;  4E44 A;  3B6G D;  4YS3 A;  5AV5 D;  3AYW B;  4J8U C;  2ARO B;  2YFV A;  3UTA B;  4KUD B;  4J8U D;  5KDM B;  5FUG A;  1U35 A;  4WU9 A;  3W99 A;  1A7W A;  5GSU C;  1H3O B;  4Z66 A;  5BT1 C;  5GSU D;  3LJA A;  3WTP C;  5AVB C;  5BT1 D;  3MVD C;  3WTP D;  4EO5 C;  5AVB D;  3WKJ B;  3AZK C;  1TAF B;  2IO5 B;  3MGP A;  3MVD D;  3AZJ B;  4WNN A;  3AZK D;  5CPK A;  1S32 C;  5DNN B;  1P34 A;  5E5A A;  3REL A;  3A6N A;  3AZL C;  2F8N D;  5DNM A;  3REH A;  1F66 B;  1S32 D;  4JJN C;  3AZL D;  3B6G A;  3EPL A;  3X1S C;  2BYM A;  4YM6 C;  4H9S A;  5AV5 A;  3LEL B;  4JJN D;  3X1S D;  4YM6 D;  4NFT A;  4UPK A;  4J8U A;  5B24 C;  3REJ C;  4J8X B;  5AV9 A;  1WWS A;  4ZUX C;  5B1M C;  5B24 D;  3REJ D;  2BYK B;  3AZN C;  1P3O C;  4ZUX D;  3AZE C;  5B1M D;  1ZLA B;  5GSU A;  3UT9 B;  3AZN D;  3AYW C;  1P3O D;  3AZE D;  2FJ7 B;  3UTA C;  4KUD C;  3WTP A;  3AYW D;  3VH6 W;  5G49 B;  5AVB A;  3MVD A;  3UTA D;  4KUD D;  3R45 A;  3AZK A;  4H9R A;  3C1C B;  3P5J B;  4R8P B;  1S32 A;  3AZL A;  4ZBJ C;  1B6W A;  5B0Z B;  4JJN A;  2NZD B;  2Y2K A;  5JA4 B;  2RVQ C;  2IO5 C;  3X1S A;  4YM6 A;  3EG5 B;  5B0Y B;  5B2J B;  3AZJ C;  2RVQ D;  2ZY2 A;  4H9Q A;  5DNN C;  1P3A B;  3AZJ D;  5B32 C;  5B24 A;  1F66 C;  3REJ A;  2JCH A;  3MGQ B;  3C1B A;  4ZUX A;  5DNN D;  5B1M A;  5B32 D;  2LY8 A;  1F66 D;  1BFM A;  1ULY A;  3AZN A;  3LEL C;  1P3O A;  3AZE A;  3WAA C;  3AYW A;  3LEL D;  1WWI A;  3WAA D;  3MGR B;  1KX3 B;  4J8X C;  3UTA A;  3KWQ B;  3AV2 C;  4KUD A;  2HIO B;  1HQ3 B;  1P34 D;  1P3M C;  4G92 B;  3AV2 D;  1ZLA C;  4J8W B;  2Y2N A;  1P3M D;  1ID3 B;  3W96 B;  3UT9 C;  4WZS B;  2FJ7 C;  1H3O A;  1ZLA D;  1F1E A;  4KGC C;  2FJ7 D;  4WJ3 C;  4KGC D;  1TAF A;  5B2I B;  4UUZ B;  3AZJ A;  3C1C C;  4R8P C;  5DNN A;  5F99 C;  3C1C D;  2L5A A;  5B32 A;  1F66 A;  4R8P D;  5F99 D;  2XD5 A;  5GT3 B;  5B31 B;  5B0Y C;  3LEL A;  2RIQ A;  3WAA A;  5B0Y D;  3B0C T;  4H9P B;  3MGP C;  4J8X A;  3MGQ C;  3AV2 A;  3MGP D;  1P3M A;  2BYK A;  3MGQ D;  3AZG B;  4G91 B;  1ZLA A;  3UT9 A;  4J8V B;  2FJ7 A;  3MGR C;  1KX3 C;  4LD9 C;  1BH9 B;  3KWQ C;  5G49 A;  1P3P B;  2HIO C;  4KGC A;  3MGR D;  4G92 C;  1P3B B;  1KX3 D;  4LD9 D;  3KWQ D;  2HIO D;  3W96 C;  4J8W C;  1ID3 C;  5AV9 C;  3VH6 T;  2F2A C;  2Y2P A;  4QLC B;  3C1C A;  5B1L C;  4R8P A;  4J8W D;  3W96 D;  1ID3 D;  5AV9 D;  5F99 A;  1P3K B;  2BG1 A;  5B1L D;  1KX5 B;  3O62 B;  5JA4 A;  2VQR A;  2NQB B;  5B2I C;  5B0Y A;  4Z5T B;  1M19 C;  5CPJ B;  5B2I D;  3WA9 B;  3KSY A;  2Y2O A;  1M19 D;  3MGQ A;  1P3F B;  4AWL B;  1P3G B;  3TU4 B;  2Y2H A;  2ZY4 A;  5GT3 C;  5B31 C;  3MGS B;  2Y2M A;  5AVC B;  5GT3 D;  5B31 D;  3MGR A;  3REK B;  1KX3 A;  4LD9 A;  3KWQ A;  2HIO A;  3X1T B;  3AZG C;  4G91 C;  5AV6 B;  3W96 A;  4J8W A;  1ID3 A;  3NQJ B;  3C1B C;  3AZG D;  5B1L A;  4WU8 B;  3C1B D;  1P3P C;  1R4V A;  1P3B C;  1P3P D;  2ARO C;  5AY8 B;  3AL0 C;  5B2I A;  4UUZ A;  3AZM B;  1N1J A;  2ARO D;  4QLC C;  1M19 A;  2JE5 A;  3NQU B;  3X1U B;  3AZI B;  1P3K C;  1JFI B;  2ZM5 A;  4QLC D;  5B33 B;  1KX5 C;  3O62 C;  1P3I B;  1M1A B;  4DRB A;  1P3K D;  3W97 B;  2NQB C;  5GT3 A;  5JRG B;  3O62 D;  5B31 A;  1W2E A;  4Z5T C;  1KX5 D;  3B0B A;  5GXQ B;  2G5H C;  1EQZ B;  2NQB D;  5CPJ C;  3WA9 C;  4Z5T D;  3WKJ C;  4H9P A;  3KXB B;  2PYO B;  5CPJ D;  4AWL C;  3WA9 D;  1P3G C;  3WKJ D;  5B40 B;  3AZG A;  3MGS C;  1P3G D;  5BNV B;  4XUJ B;  5AVC C;  4M6B A;  3MGS D;  5C3I B;  3REK C;  1BH9 A;  2YFW A;  1P3P A;  3REK D;  4Z2M H;  3X1T C;  1P3B A;  4Z2M G;  2ARO A;  5AV6 C;  3W99 B;  3X1T D;  3AFA B;  4QLC A;  5KDM A;  5AV6 D;  3AV1 B;  4WU8 C;  4J8X D;  2F8N H;  2F8N G;  4XZQ B;  1P3K A;  4WU8 D;  1KX5 A;  4HGA B;  3O62 A;  3LZ0 B;  1M18 B;  5AY8 C;  2NQB A;  3UT9 D;  4Z5T A;  5CP6 B;  3W98 B;  5AY8 D;  5CPK B;  3X1U C;  5CPJ A;  2CWE A;  1P34 B;  3AZI C;  3WA9 A;  3WKJ A;  5B33 C;  1P3I C;  3X1U D;  1M1A C;  5BNX B;  1P3G A;  2W8S A;  4H9N B;  5B33 D;  5JRG C;  5AV5 B;  1P3I D;  3MGS A;  1M1A D;  5GXQ C;  3KUY B;  5JRG D;  5AVC A;  5B0Z C;  2CV5 B;  2NZD C;  3VH5 A;  5GXQ D;  3KXB C;  3REK A;  5B2J C;  5B0Z D;  2NZD D;  3KXB D;  3X1T A;  1P3A C;  5B2J D;  5AV6 A;  3B0D B;  5AV8 B;  3IP4 C;  3NQJ A;  4XUJ C;  1P3A D;  5C3I C;  4WU8 A;  4XUJ D;  3WTP B;  1TZY B;  3V9R B;  4DQY B;  4CAY B;  3FDD A; 
#chains in the Genus database with same CATH homology
 5AY8 A;  3AZK B;  2DQN C;  3AFA C;  1HQ3 C;  3AZM A;  5BS7 C;  2F8N B;  3AV1 C;  3NQU A;  3REI B;  3X1U A;  3AFA D;  4XZQ C;  1HQ3 D;  3AZI A;  3AZL B;  1JFI A;  3H0M C;  5B33 A;  3AV1 D;  2F8N K;  5B32 G;  4HGA C;  1P3I A;  1M1A A;  3LZ0 C;  3MNN B;  4XZQ D;  4JJN B;  1M18 C;  4X23 B;  3X1V B;  5JRG A;  3LZ0 D;  5CP6 C;  3W98 C;  5GXQ A;  1EQZ A;  3LZ1 B;  5B0Z A;  3AZH B;  2NZD A;  3KXB A;  3REJ B;  2Y2G A;  5B2J A;  4ZUX B;  1Q9C A;  1P3A A;  2JSS A;  5BNV A;  3KUY C;  4XUJ A;  2CV5 C;  2ZY5 A;  4NE5 A;  4E45 A;  3KUY D;  1KX4 B;  2CV5 D;  5BO0 B;  3A1I A;  4NE3 A;  4DRA A;  4CSR B;  3B0D C;  5AV8 C;  3F6T A;  3WTP E;  3AFA A;  1P3L B;  1HQ3 A;  5BS7 A;  3AV1 A;  5AV8 D;  3AN2 B;  4XZQ A;  1TZY C;  3H0R C;  2Y2Q A;  4ZBJ B;  4J8V C;  3LZ0 A;  1M18 A;  1TZY D;  3UTB B;  2FFF B;  4J8V D;  4NE6 A;  5CP6 A;  1PZR A;  3W98 A;  3REI C;  2HUE B;  5B32 B;  2XD1 A;  4H9O B;  1P3B D;  3REI D;  5BNX A;  1B67 A;  3MNN C;  4X23 C;  4H9N A;  3B0C W;  3X1V C;  3KFU G;  3AZF B;  1BH8 B;  3MNN D;  3WAA B;  4X23 D;  5GT0 B;  5CHL B;  3KUY A;  3X1V D;  2Y2L A;  3LZ1 C;  3AZH C;  2CV5 A;  1Z2C B;  3AV2 B;  3LZ1 D;  3AZH D;  1P3M B;  3VH5 W;  3B6F B;  5AV8 A;  2DF4 C;  1P3F C;  3EPH A;  5CPI B;  4KHA B;  3EPJ A;  3TU4 C;  1KX4 C;  1AOI B;  1P3F D;  4KGC B;  1TZY A;  3V9R A;  3TU4 D;  4YS3 B;  1KX4 D;  4CAY A;  4J8V A;  2YFV B;  4WV4 B;  5AVC D;  1P3L C;  3A1K A;  2F8N A;  5FUG B;  3REI A;  1U35 B;  3AN2 C;  1P3L D;  5F99 B;  4WU9 B;  2Y2J A;  2G5I C;  3AN2 D;  3MNN A;  4Z66 B;  4X23 A;  3UTB C;  3LJA B;  3X1V A;  5B31 G;  3UTB D;  3H0L C;  3LZ1 A;  3AZH A;  2HUE C;  3MGP B;  2Y2I A;  3AZM C;  4WNN B;  3AZF C;  5E5A B;  3REL B;  3A6N B;  3AZM D;  5DNM B;  3REH B;  5GT0 C;  1HTA A;  3AZF D;  1P3F A;  3EPK A;  3AZI D;  3B6G B;  3TU4 A;  2BYM B;  5GT0 D;  1KX4 A;  3W97 C;  4LD9 B;  5BO0 A;  3W97 D;  1EQZ C;  4J8U B;  4CSR A;  3B6F C;  2PYO C;  1EQZ D;  5AV9 B;  5CPI C;  1P3L A;  5B40 C;  5B1L B;  3B6F D;  2PYO D;  1AOI C;  3AN2 A;  5CPI D;  3VH6 A;  5B40 D;  5GSU B;  4YS3 C;  1AOI D;  3UTB A;  4YS3 D;  2J8P A;  5AVB B;  1N1J B;  1KU5 A;  1M19 B;  3MVD B;  1U35 C;  4EO5 B;  3W99 C;  3R45 B;  4WU9 C;  4H9O A;  2ZY3 A;  4H9R B;  1U35 D;  3W99 D;  4WU9 D;  4Z66 C;  1S32 B;  3LJA C;  3AZF A;  1BH8 A;  4Z66 D;  5GT0 A;  3LJA D;  1T3U A;  3X1S B;  3W97 A;  4YM6 B;  1M18 D;  5CPK C;  4H9Q B;  1P34 C;  5E5A C;  5CP6 D;  3A6N C;  3REL C;  3W98 D;  5DNM C;  5B24 B;  3REH C;  5CPK D;  3B6F A;  2PYO A;  3C1B B;  5CPI A;  4KHA A;  5B1M B;  2UWX A;  5E5A D;  5B40 A;  3A6N D;  5DNM D;  3REH D;  3REL D;  3B6G C;  4H9S C;  5AV5 C;  3AZN B;  3VH5 T;  2YFW B;  1P3O B;  3AZE B;  1AOI A;  4E44 A;  3B6G D;  4YS3 A;  5AV5 D;  3AYW B;  4J8U C;  2ARO B;  2YFV A;  3UTA B;  4KUD B;  4J8U D;  5KDM B;  5FUG A;  1U35 A;  4WU9 A;  3W99 A;  1A7W A;  5GSU C;  1H3O B;  4Z66 A;  5BT1 C;  5GSU D;  3LJA A;  3WTP C;  5AVB C;  5BT1 D;  3MVD C;  3WTP D;  4EO5 C;  5AVB D;  3WKJ B;  3AZK C;  1TAF B;  2IO5 B;  3MGP A;  3MVD D;  3AZJ B;  4WNN A;  3AZK D;  5CPK A;  1S32 C;  5DNN B;  1P34 A;  5E5A A;  3REL A;  3A6N A;  3AZL C;  2F8N D;  5DNM A;  3REH A;  1F66 B;  1S32 D;  4JJN C;  3AZL D;  3B6G A;  3EPL A;  3X1S C;  2BYM A;  4YM6 C;  4H9S A;  5AV5 A;  3LEL B;  4JJN D;  3X1S D;  4YM6 D;  4NFT A;  4UPK A;  4J8U A;  5B24 C;  3REJ C;  4J8X B;  5AV9 A;  1WWS A;  4ZUX C;  5B1M C;  5B24 D;  3REJ D;  2BYK B;  3AZN C;  1P3O C;  4ZUX D;  3AZE C;  5B1M D;  1ZLA B;  5GSU A;  3UT9 B;  3AZN D;  3AYW C;  1P3O D;  3AZE D;  2FJ7 B;  3UTA C;  4KUD C;  3WTP A;  3AYW D;  3VH6 W;  5G49 B;  5AVB A;  3MVD A;  3UTA D;  4KUD D;  3R45 A;  3AZK A;  4H9R A;  3C1C B;  3P5J B;  4R8P B;  1S32 A;  3AZL A;  4ZBJ C;  1B6W A;  5B0Z B;  4JJN A;  2NZD B;  2Y2K A;  5JA4 B;  2RVQ C;  2IO5 C;  3X1S A;  4YM6 A;  3EG5 B;  5B0Y B;  5B2J B;  3AZJ C;  2RVQ D;  2ZY2 A;  4H9Q A;  5DNN C;  1P3A B;  3AZJ D;  5B32 C;  5B24 A;  1F66 C;  3REJ A;  2JCH A;  3MGQ B;  3C1B A;  4ZUX A;  5DNN D;  5B1M A;  5B32 D;  2LY8 A;  1F66 D;  1BFM A;  1ULY A;  3AZN A;  3LEL C;  1P3O A;  3AZE A;  3WAA C;  3AYW A;  3LEL D;  1WWI A;  3WAA D;  3MGR B;  1KX3 B;  4J8X C;  3UTA A;  3KWQ B;  3AV2 C;  4KUD A;  2HIO B;  1HQ3 B;  1P34 D;  1P3M C;  4G92 B;  3AV2 D;  1ZLA C;  4J8W B;  2Y2N A;  1P3M D;  1ID3 B;  3W96 B;  3UT9 C;  4WZS B;  2FJ7 C;  1H3O A;  1ZLA D;  1F1E A;  4KGC C;  2FJ7 D;  4WJ3 C;  4KGC D;  1TAF A;  5B2I B;  4UUZ B;  3AZJ A;  3C1C C;  4R8P C;  5DNN A;  5F99 C;  3C1C D;  2L5A A;  5B32 A;  1F66 A;  4R8P D;  5F99 D;  2XD5 A;  5GT3 B;  5B31 B;  5B0Y C;  3LEL A;  2RIQ A;  3WAA A;  5B0Y D;  3B0C T;  4H9P B;  3MGP C;  4J8X A;  3MGQ C;  3AV2 A;  3MGP D;  1P3M A;  2BYK A;  3MGQ D;  3AZG B;  4G91 B;  1ZLA A;  3UT9 A;  4J8V B;  2FJ7 A;  3MGR C;  1KX3 C;  4LD9 C;  1BH9 B;  3KWQ C;  5G49 A;  1P3P B;  2HIO C;  4KGC A;  3MGR D;  4G92 C;  1P3B B;  1KX3 D;  4LD9 D;  3KWQ D;  2HIO D;  3W96 C;  4J8W C;  1ID3 C;  5AV9 C;  3VH6 T;  2F2A C;  2Y2P A;  4QLC B;  3C1C A;  5B1L C;  4R8P A;  4J8W D;  3W96 D;  1ID3 D;  5AV9 D;  5F99 A;  1P3K B;  2BG1 A;  5B1L D;  1KX5 B;  3O62 B;  5JA4 A;  2VQR A;  2NQB B;  5B2I C;  5B0Y A;  4Z5T B;  1M19 C;  5CPJ B;  5B2I D;  3WA9 B;  3KSY A;  2Y2O A;  1M19 D;  3MGQ A;  1P3F B;  4AWL B;  1P3G B;  3TU4 B;  2Y2H A;  2ZY4 A;  5GT3 C;  5B31 C;  3MGS B;  2Y2M A;  5AVC B;  5GT3 D;  5B31 D;  3MGR A;  3REK B;  1KX3 A;  4LD9 A;  3KWQ A;  2HIO A;  3X1T B;  3AZG C;  4G91 C;  5AV6 B;  3W96 A;  4J8W A;  1ID3 A;  3NQJ B;  3C1B C;  3AZG D;  5B1L A;  4WU8 B;  3C1B D;  1P3P C;  1R4V A;  1P3B C;  1P3P D;  2ARO C;  5AY8 B;  3AL0 C;  5B2I A;  4UUZ A;  3AZM B;  1N1J A;  2ARO D;  4QLC C;  1M19 A;  2JE5 A;  3NQU B;  3X1U B;  3AZI B;  1P3K C;  1JFI B;  2ZM5 A;  4QLC D;  5B33 B;  1KX5 C;  3O62 C;  1P3I B;  1M1A B;  4DRB A;  1P3K D;  3W97 B;  2NQB C;  5GT3 A;  5JRG B;  3O62 D;  5B31 A;  1W2E A;  4Z5T C;  1KX5 D;  3B0B A;  5GXQ B;  2G5H C;  1EQZ B;  2NQB D;  5CPJ C;  3WA9 C;  4Z5T D;  3WKJ C;  4H9P A;  3KXB B;  2PYO B;  5CPJ D;  4AWL C;  3WA9 D;  1P3G C;  3WKJ D;  5B40 B;  3AZG A;  3MGS C;  1P3G D;  5BNV B;  4XUJ B;  5AVC C;  4M6B A;  3MGS D;  5C3I B;  3REK C;  1BH9 A;  2YFW A;  1P3P A;  3REK D;  4Z2M H;  3X1T C;  1P3B A;  4Z2M G;  2ARO A;  5AV6 C;  3W99 B;  3X1T D;  3AFA B;  4QLC A;  5KDM A;  5AV6 D;  3AV1 B;  4WU8 C;  4J8X D;  2F8N H;  2F8N G;  4XZQ B;  1P3K A;  4WU8 D;  1KX5 A;  4HGA B;  3O62 A;  3LZ0 B;  1M18 B;  5AY8 C;  2NQB A;  3UT9 D;  4Z5T A;  5CP6 B;  3W98 B;  5AY8 D;  5CPK B;  3X1U C;  5CPJ A;  2CWE A;  1P34 B;  3AZI C;  3WA9 A;  3WKJ A;  5B33 C;  1P3I C;  3X1U D;  1M1A C;  5BNX B;  1P3G A;  2W8S A;  4H9N B;  5B33 D;  5JRG C;  5AV5 B;  1P3I D;  3MGS A;  1M1A D;  5GXQ C;  3KUY B;  5JRG D;  5AVC A;  5B0Z C;  2CV5 B;  2NZD C;  3VH5 A;  5GXQ D;  3KXB C;  3REK A;  5B2J C;  5B0Z D;  2NZD D;  3KXB D;  3X1T A;  1P3A C;  5B2J D;  5AV6 A;  3B0D B;  5AV8 B;  3IP4 C;  3NQJ A;  4XUJ C;  1P3A D;  5C3I C;  4WU8 A;  4XUJ D;  3WTP B;  1TZY B;  3V9R B;  4DQY B;  4CAY B;  3FDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...