3MGRD

Binding of rubidium ions to the nucleosome core particle
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgrD00
3V9RA 3MGSC 2CV5A 1P3MD 3AV2A 5AV9A 2CV5C 5B0ZD 5B0YA 3AN2D 5AV9C 5B0YC 3W98A 1P3AA 4H9NB 2F8NK 3W98C 1P3AC 4CAYB 5B33B 1P3FA 4KHAA 1HTAA 4YS3D 3W99A 1P3FC 5B1MA 2YFVB 3VH5T 3W99C 3MNNB 2HIOD 3REKA 3C1BA 1P3GD 3WAAA 3B6FD 1P3BB 5B1MC 5B0YD 3WAAC 3REKC 5BNVA 5DNMA 3C1BC 3AZEB 5AVBB 3W98D 5DNMC 2F8ND 3AZMB 3AZFB 3REHB 3MGRB 1U35B 5B24D 5B40B 1S32A 4XUJB 3REKD 3W96D 4J8UD 3UTBA 1S32C 1ID3B 5GT0B 2NQBD 3UTBC 3AV1A 3AV1C 2IO5B 4LD9A 5AV5D 3LELA 5GXQB 5BNXB 5GSUA 3LELC 1AOIB 5GSUC 5F99B 1KX4B 3REIA 2BYKA 3LJAB 3UTAA 3AZJD 3B0CW 4Z2MH 4XZQD 3REIC 3UTAC 4H9OA 5G49B 4J8WD 5CPKD 1KX5A 2HUEC 3A6NA 1M18A 3KUYA 1KX5C 5JRGD 3A6NC 1M18C 4H9NA 1EQZA 3WKJA 1EQZC 2FJ7B 5GT3A 3UT9B 3WKJC 5GT3C 2YFVA 4UUZA 4H9PB 5AY8A 3AZEA 5AY8C 1BFMA 4WU9A 3AZEC 1P3PA 3O62B 3AZMA 5B33D 3AZFA 4Z5TA 1P3PC 5B40A 3AZMC 3AZFC 4Z5TC 4YS3B 4XUJA 3MNND 3AFAB 5B40C 1M19B 1P3BD 4XUJC 3AZED 5AVBD 1P34A 5CPJA 1P3KB 2BYMA 3AZMD 1P34C 1KX3B 2IO5C 3AZFD 3REHD 3MGRD 5CPJC 1U35D 5B40D 3AZHB 3LZ1B 4E44A 3W97B 4NE6A 4XUJD 5F99A 1ID3D 5GT0D 5F99C 4G91B 3W96B 5AV8A 4Z2MG 5C3IC 5AV8C 1M1AA 5GXQD 1M1AC 5B32G 1AOID 5AV6A 4J8VB 5F99D 5AV6C 1KX4D 3LJAD 3WTPE 3UT9A 3UT9C 1P3MA 4J8WB 5B0ZA 1P3MC 3AN2A 5B0ZC 2YFWB 3AN2C 4KGCB 5B2JB 3AZGB 3KXBB 2FJ7D 3UT9D 1P3IB 4G92B 1P3OD 4YS3A 3AFAA 1ULYA 5JA4B 3X1UB 4YS3C 3AFAC 1P3GA 2HIOA 1M19C 3B6FA 1P3GC 2HIOC 3B6FC 3O62D 3NQJB 2F8NA 2PYOB 1Q9CA 3AZKB 5B24A 3AFAD 3AZHC 1M19D 5B24C 3KWQB 3W96A 4J8UA 3R45A 3W96C 2NQBA 4J8UC 1WWIA 4WU8B 2NQBC 1P3KD 4YM6B 1KX3D 1H3OB 5AV5A 1TZYB 3AZHD 3LZ1D 4ZBJB 3W97D 5CP6B 5AV5C 4QLCB 3AZJA 4XZQA 3AZJC 3X1TB 5AVCB 5B31G 4XZQC 3LZ0B 4J8WA 5CPKA 1JFIA 4KUDB 4J8VD 4J8WC 5CPKC 5JRGA 4EO5C 5JRGC 4KGCA 5B2JA 4AWLB 5B1LB 5B2JC 4KGCC 4H9QB 5JA4A 3X1UA 5CPID 3X1UC 3RELB 5BT1D 4KGCD 5B2JD 3NQJA 3AZGD 3KXBD 1P3ID 3WA9B 4CAYA 5B33A 3C1CB 3AZNB 3MVDB 5B33C 3TU4B 1P3OB 3X1UD 3MNNA 5FUGB 1P3BA 3MNNC 3WTPB 3B0DB 1P3BC 5AVBA 4HGAB 4YM6A 2PYOD 5AVBC 3AYWB 1F1EA 4YM6C 5E5AB 3AZKD 3REHA 3MGRA 1U35A 4QLCA 1BH8B 1WWSA 4ZBJC 5BO0B 3MGRC 3REHC 1U35C 4QLCC 3KWQD 4ZUXB 3B6GB 2AROB 1ID3A 5GT0A 1ID3C 1B67A 5GT0C 4WU8D 5BS7A 3MGPB 4JJNB 4YM6D 5BS7C 1TZYD 5GXQA 3LZ0C 4KUDA 5CP6D 5BNXA 4QLCD 1AOIA 5GXQC 4KUDC 5DNNB 1AOIC 4H9RB 1HQ3B 5B32B 4CSRB 5B2IB 4X23B 3NQUB 3LJAA 1KX4A 1KX4C 3LJAC 3X1TD 3MGSB 5AVCD 3LZ0D 5G49A 2JSSA 3V9RB 2CV5B 4KUDD 3AV2B 5AV9B 1P3AB 5B1LD 3C1CA 2FJ7A 2NZDB 1P3FB 3MVDA 2CWEA 3C1CC 2FJ7C 3W99B 1P3OA 3MVDC 5B1MB 4H9PA 3WAAB 1P3OC 3C1BB 3RELD 5CPIB 2F8NG 5BNVB 5KDMB 5DNMB 3B0DC 1TAFB 1ZLAB 3O62A 3WA9D 5E5AA 3C1CD 3AZND 3O62C 1KU5A 2RVQD 5E5AC 3MVDD 3TU4D 5BO0A 2L5AA 1S32B 1M19A 3WTPD 3UTBB 3AV1B 3MGPA 1N1JB 3AYWD 1P3KA 3MGPC 1KX3A 5E5AD 4LD9B 3LELB 1P3KC 4R8PB 3AZHA 3LZ1A 3X1VB 1KX3C 3W97A 5GSUB 1F66B 1BH9B 3LZ1C 3W97C 4ZUXD 5B2IA 3B6GD 2AROD 4DRAA 3AZIB 3REIB 3UTAB 5B2IC 4G91C 3MGPD 4JJND 1KX5B 3A6NB 1M18B 3KUYB 4J8VA 3AV2C 5B31B 5DNND 3VH6T 4Z66D 5B32D 1HQ3D 5B2ID 4X23D 4J8VC 1EQZB 2NZDA 3WKJB 5GT3B 3MGSD 2NZDC 2CV5D 3AZLB 4UUZB 3AV2D 5AV9D 3VH6A 5CPIA 5AY8B 5KDMA 5CPIC 3MGQB 1TAFA 1A7WA 1P3AD 2YFWA 1ZLAA 4WU9B 5BT1C 1P3PB 3AZGA 1ZLAC 3KXBA 2NZDD 1P3IA 1P3FD 4Z5TB 3AZGC 3KXBC 3W99D 3VH5A 1P3IC 5B1MD 4G92C 3WAAD 3C1BD 4J8XB 5DNMD 1P3LB 1N1JA 1ZLAD 1P34B 2PYOA 5CPJB 2BYMB 3X1SB 4R8PA 3X1VA 2PYOC 3AZKA 4LD9C 4WNNB 1F66A 4R8PC 3X1VC 1BH9A 1S32D 3AZKC 3KWQA 1F66C 3UTBD 3AZIA 3KWQC 5C3IB 2F8NH 5AV8B 3AV1D 3AZIC 4DRBA 4WU8A 1M1AB 1H3OA 3LELD 4LD9D 4WU8C 1TZYA 4R8PD 3X1VD 5GSUD 5CP6A 4NE3A 1TZYC 5B31A 1B6WA 5AV6B 1F66D 3KUYC 5CP6C 5B31C 3AZID 4M6BA 3REID 3UTAD 3REJB 1R4VA 3X1TA 5AVCA 3AZLA 3LZ0A 1KX5D 3X1TC 5AVCC 3A6ND 1P3MB 3KUYD 3AZLC 1M18D 5B31D 4E45A 3B0CT 5B0ZB 3MGQA 3AN2B 4Z66B 1EQZD 3MGQC 3WKJD 5B1LA 4WU9C 5GT3D 4AWLC 5B1LC 3KSYA 3AZLD 4H9QA 4NE5A 1P3GB 2HIOB 5AY8D 4J8XA 3RELA 3B6FB 1P3LA 5B0YB 3MGQD 4J8XC 3RELC 4WU9D 1P3LC 3W98B 1P3PD 2F8NB 4NFTA 3WA9A 3X1SA 4Z5TD 2LY8A 4WV4B 4H9SA 3AZNA 4KHAB 4WNNA 3X1SC 3WA9C 5B24B 3TU4A 3AZNC 4H9SC 2RVQC 3TU4C 3REKB 5FUGA 4J8XD 3WTPA 4J8UB 1P3LD 3R45B 2NQBB 3WTPC 1P34D 5CPJD 3B0BA 3AYWA 4HGAC 3X1SD 5AV5B 3AYWC 1BH8A 5CHLB 4ZUXA 3B6GA 2AROA 3REJA 5AV8D 4ZUXC 3AZJB 2AROC 3REJC 3B6GC 3VH6W 4XZQB 4WZSB 4JJNA 1M1AD 4JJNC 5CPKB 1JFIB 5AV6D 4EO5B 5JRGB 5DNNA 4Z66A 5B32A 4H9RA 1HQ3A 3VH5W 4CSRA 4X23A 3NQUA 5DNNC 4Z66C 3REJD 5B32C 1HQ3C 2BYKB 4X23C 3MGSA 2HUEB 4H9OB
chains in the Genus database with same CATH superfamily
3V9RA 3MGSC 2CV5A 1P3MD 3AV2A 5AV9A 2CV5C 5B0ZD 5B0YA 3AN2D 3EG5B 5AV9C 5B0YC 3W98A 1P3AA 4H9NB 2F8NK 3W98C 1P3AC 4CAYB 5B33B 1P3FA 4KHAA 1HTAA 4YS3D 3W99A 1P3FC 5B1MA 2YFVB 3VH5T 3W99C 3MNNB 2DF4C 2HIOD 3C1BA 3REKA 1P3GD 3B6FD 3WAAA 1P3BB 5B1MC 3H0LC 3WAAC 5B0YD 3REKC 5BNVA 5DNMA 3C1BC 3AZEB 5AVBB 3W98D 2ZY5A 5DNMC 3P5JB 2F8ND 3AZMB 3AZFB 3REHB 3MGRB 1U35B 5B24D 5B40B 4WJ3C 2JE5A 1S32A 4XUJB 3REKD 3W96D 4J8UD 3UTBA 1S32C 1ID3B 5GT0B 2NQBD 3UTBC 3AV1A 3AV1C 2IO5B 4LD9A 5AV5D 3LELA 5GXQB 5BNXB 5GSUA 3LELC 1AOIB 2W8SA 5GSUC 5F99B 1KX4B 3H0RC 3REIA 2BYKA 3LJAB 3UTAA 3AZJD 3B0CW 4Z2MH 4XZQD 3REIC 3UTAC 3EPJA 4H9OA 5G49B 4J8WD 5CPKD 1KX5A 2HUEC 3A6NA 1M18A 3KUYA 1KX5C 5JRGD 3A6NC 1M18C 4H9NA 1EQZA 3AL0C 2JCHA 3WKJA 1EQZC 2FJ7B 5GT3A 3UT9B 3WKJC 5GT3C 2YFVA 4UUZA 4H9PB 5AY8A 3AZEA 5AY8C 1BFMA 4WU9A 3AZEC 1P3PA 3O62B 3AZMA 5B33D 3AZFA 4Z5TA 1P3PC 5B40A 3AZMC 3AZFC 4Z5TC 4YS3B 4XUJA 3MNND 3AFAB 5B40C 1M19B 1P3BD 4XUJC 3AZED 5AVBD 1PZRA 1P34A 5CPJA 1P3KB 2BYMA 3AZMD 1P34C 1KX3B 2IO5C 3AZFD 3REHD 3MGRD 5CPJC 1U35D 5B40D 3AZHB 3LZ1B 4E44A 3W97B 4NE6A 4XUJD 5F99A 1ID3D 4G91B 5F99C 5GT0D 3W96B 5AV8A 4Z2MG 5C3IC 5AV8C 2Y2LA 1M1AA 5GXQD 1M1AC 5B32G 2UWXA 1AOID 5AV6A 4J8VB 5F99D 5AV6C 1KX4D 3LJAD 3WTPE 3UT9A 3UT9C 2Y2IA 1P3MA 4J8WB 5B0ZA 1P3MC 3AN2A 5B0ZC 2YFWB 3AN2C 2Y2PA 5B2JB 4KGCB 3AZGB 4UPKA 3KXBB 2FJ7D 3UT9D 1P3IB 3EPHA 4G92B 1P3OD 4YS3A 3F6TA 3AFAA 1ULYA 5JA4B 3X1UB 4YS3C 3AFAC 1P3GA 2HIOA 1M19C 3B6FA 1P3GC 2HIOC 3B6FC 3O62D 3NQJB 2F8NA 2PYOB 1Q9CA 2VQRA 3AZKB 5B24A 3AFAD 3AZHC 1M19D 5B24C 3KWQB 3W96A 2FFFB 4J8UA 3R45A 3W96C 2NQBA 4J8UC 1WWIA 4WU8B 2NQBC 1P3KD 2ZY4A 4YM6B 1KX3D 1H3OB 5AV5A 1TZYB 3AZHD 3LZ1D 4ZBJB 3W97D 5CP6B 5AV5C 4QLCB 3AZJA 4XZQA 3AZJC 3X1TB 5AVCB 5B31G 4XZQC 3LZ0B 4J8WA 5CPKA 1JFIA 4KUDB 2Y2KA 4J8VD 4J8WC 5CPKC 5JRGA 4EO5C 5JRGC 4KGCA 5B2JA 2XD5A 4AWLB 5B1LB 5B2JC 4KGCC 3FDDA 3IP4C 2ZY3A 4H9QB 5JA4A 3X1UA 5CPID 3X1UC 3RELB 3EPLA 5BT1D 4KGCD 5B2JD 3NQJA 1W2EA 3AZGD 3KXBD 1P3ID 3WA9B 2Y2QA 4CAYA 5B33A 3C1CB 3AZNB 3MVDB 5B33C 3TU4B 1P3OB 3X1UD 3MNNA 2G5HC 5FUGB 1P3BA 3MNNC 3WTPB 3B0DB 1P3BC 5AVBA 4HGAB 4YM6A 2PYOD 5AVBC 3AYWB 1F1EA 4YM6C 5E5AB 2Y2JA 3AZKD 3REHA 3MGRA 1U35A 4QLCA 1BH8B 1WWSA 4ZBJC 5BO0B 3MGRC 3REHC 1U35C 4QLCC 3KWQD 3A1KA 4ZUXB 3B6GB 2AROB 1ID3A 5GT0A 2Y2NA 2Y2MA 1ID3C 1B67A 5GT0C 4WU8D 2J8PA 5BS7A 3MGPB 4YM6D 4JJNB 5BS7C 1TZYD 5GXQA 3LZ0C 4KUDA 5CP6D 5BNXA 4QLCD 1AOIA 5GXQC 4KUDC 5DNNB 1AOIC 4H9RB 1HQ3B 5B32B 4CSRB 5B2IB 4X23B 3NQUB 3LJAA 1KX4A 1KX4C 3LJAC 3X1TD 3MGSB 5AVCD 3LZ0D 5G49A 2JSSA 3V9RB 2CV5B 4KUDD 3AV2B 5AV9B 3H0MC 2DQNC 2BG1A 1P3AB 5B1LD 3C1CA 2FJ7A 2NZDB 1P3FB 1T3UA 3MVDA 2CWEA 3C1CC 2FJ7C 3W99B 1P3OA 3MVDC 5B1MB 4H9PA 2RIQA 3WAAB 1P3OC 3C1BB 3RELD 5CPIB 2F8NG 2Y2GA 5BNVB 5KDMB 5DNMB 3B0DC 1TAFB 1ZLAB 2ZM5A 3O62A 3WA9D 5E5AA 3C1CD 3AZND 3O62C 1KU5A 2RVQD 5E5AC 3MVDD 3TU4D 5BO0A 2L5AA 1S32B 1M19A 3WTPD 1Z2CB 3UTBB 3AV1B 3MGPA 1N1JB 3AYWD 1P3KA 3MGPC 1KX3A 5E5AD 4LD9B 3LELB 1P3KC 4R8PB 3AZHA 2ZY2A 3LZ1A 3X1VB 3W97A 5GSUB 1KX3C 1F66B 1BH9B 3LZ1C 3W97C 4ZUXD 5B2IA 3B6GD 2AROD 4DRAA 3AZIB 3REIB 3UTAB 5B2IC 4G91C 3MGPD 4JJND 1KX5B 3A6NB 1M18B 3KUYB 4J8VA 3AV2C 5B31B 5DNND 3VH6T 4Z66D 5B32D 1HQ3D 5B2ID 4X23D 4J8VC 1EQZB 2NZDA 3WKJB 5GT3B 3MGSD 2NZDC 2CV5D 3AZLB 4UUZB 3AV2D 5AV9D 3VH6A 5CPIA 5AY8B 5KDMA 5CPIC 3MGQB 1TAFA 1A7WA 1P3AD 2YFWA 1ZLAA 2XD1A 5BT1C 4WU9B 1P3PB 3AZGA 1ZLAC 3KXBA 2NZDD 1P3IA 1P3FD 3KFUG 4Z5TB 3AZGC 3KXBC 3W99D 3VH5A 1P3IC 5B1MD 4G92C 3WAAD 3C1BD 4J8XB 5DNMD 1P3LB 1N1JA 1ZLAD 1P34B 2PYOA 5CPJB 2BYMB 3X1SB 4R8PA 3X1VA 2PYOC 3AZKA 4LD9C 3EPKA 4WNNB 1F66A 4R8PC 3X1VC 1BH9A 1S32D 3AZKC 3KWQA 1F66C 3UTBD 3AZIA 3KWQC 5C3IB 2F8NH 5AV8B 3AV1D 3AZIC 4DRBA 2F2AC 4WU8A 1M1AB 1H3OA 3LELD 4LD9D 4WU8C 1TZYA 4R8PD 3X1VD 2Y2HA 5GSUD 5CP6A 4NE3A 1TZYC 5B31A 1B6WA 5AV6B 1F66D 3KUYC 5CP6C 5B31C 3AZID 4M6BA 3REID 3UTAD 3REJB 1R4VA 3X1TA 5AVCA 3AZLA 3LZ0A 1KX5D 3X1TC 5AVCC 3A6ND 1P3MB 3KUYD 3AZLC 1M18D 5B31D 4E45A 3B0CT 5B0ZB 3MGQA 3AN2B 4Z66B 1EQZD 3MGQC 3WKJD 5B1LA 4WU9C 5GT3D 4AWLC 5B1LC 3KSYA 3AZLD 4H9QA 4NE5A 1P3GB 2HIOB 5AY8D 4J8XA 3RELA 3B6FB 1P3LA 5B0YB 3MGQD 4J8XC 3RELC 4WU9D 1P3LC 3W98B 1P3PD 2F8NB 4NFTA 3WA9A 3X1SA 4Z5TD 2LY8A 4WV4B 4H9SA 3AZNA 4KHAB 4WNNA 3X1SC 3WA9C 5B24B 3TU4A 3AZNC 4H9SC 2RVQC 3A1IA 3TU4C 3REKB 5FUGA 4DQYB 4J8XD 3WTPA 4J8UB 2G5IC 3R45B 1P3LD 2NQBB 3WTPC 1P34D 5CPJD 3B0BA 3AYWA 4HGAC 2Y2OA 3X1SD 5AV5B 3AYWC 1BH8A 5CHLB 4ZUXA 3B6GA 2AROA 3REJA 5AV8D 4ZUXC 3AZJB 2AROC 3REJC 3B6GC 3VH6W 4XZQB 4WZSB 4JJNA 1M1AD 4JJNC 5CPKB 1JFIB 5AV6D 4EO5B 5JRGB 5DNNA 4Z66A 5B32A 4H9RA 1HQ3A 3VH5W 4CSRA 4X23A 3NQUA 5DNNC 4Z66C 3REJD 5B32C 1HQ3C 2BYKB 4X23C 3MGSA 2HUEB 4H9OB
chains in the Genus database with same CATH topology
3V9RA 3MGSC 2CV5A 1P3MD 3AV2A 5AV9A 2CV5C 5B0ZD 5B0YA 3AN2D 3EG5B 5AV9C 5B0YC 3W98A 1P3AA 4H9NB 2F8NK 3W98C 1P3AC 4CAYB 5B33B 1P3FA 4KHAA 1HTAA 4YS3D 3W99A 1P3FC 5B1MA 2YFVB 3VH5T 3W99C 3MNNB 2DF4C 2HIOD 3C1BA 3REKA 1P3GD 3B6FD 3WAAA 1P3BB 5B1MC 3H0LC 3WAAC 5B0YD 3REKC 5BNVA 5DNMA 3C1BC 3AZEB 5AVBB 3W98D 2ZY5A 5DNMC 3P5JB 2F8ND 3AZMB 3AZFB 3REHB 3MGRB 1U35B 5B24D 5B40B 4WJ3C 2JE5A 1S32A 4XUJB 3REKD 3W96D 4J8UD 3UTBA 1S32C 1ID3B 5GT0B 2NQBD 3UTBC 3AV1A 3AV1C 2IO5B 4LD9A 5AV5D 3LELA 5GXQB 5BNXB 5GSUA 3LELC 1AOIB 2W8SA 5GSUC 5F99B 1KX4B 3H0RC 3REIA 2BYKA 3LJAB 3UTAA 3AZJD 3B0CW 4Z2MH 4XZQD 3REIC 3UTAC 3EPJA 4H9OA 5G49B 4J8WD 5CPKD 1KX5A 2HUEC 3A6NA 1M18A 3KUYA 1KX5C 5JRGD 3A6NC 1M18C 4H9NA 1EQZA 3AL0C 2JCHA 3WKJA 1EQZC 2FJ7B 5GT3A 3UT9B 3WKJC 5GT3C 2YFVA 4UUZA 4H9PB 5AY8A 3AZEA 5AY8C 1BFMA 4WU9A 3AZEC 1P3PA 3O62B 3AZMA 5B33D 3AZFA 4Z5TA 1P3PC 5B40A 3AZMC 3AZFC 4Z5TC 4YS3B 4XUJA 3MNND 3AFAB 5B40C 1M19B 1P3BD 4XUJC 3AZED 5AVBD 1PZRA 1P34A 5CPJA 1P3KB 2BYMA 3AZMD 1P34C 1KX3B 2IO5C 3AZFD 3REHD 3MGRD 5CPJC 1U35D 5B40D 3AZHB 3LZ1B 4E44A 3W97B 4NE6A 4XUJD 5F99A 1ID3D 4G91B 5F99C 5GT0D 3W96B 5AV8A 4Z2MG 5C3IC 5AV8C 2Y2LA 1M1AA 5GXQD 1M1AC 5B32G 2UWXA 1AOID 5AV6A 4J8VB 5F99D 5AV6C 1KX4D 3LJAD 3WTPE 3UT9A 3UT9C 2Y2IA 1P3MA 4J8WB 5B0ZA 1P3MC 3AN2A 5B0ZC 2YFWB 3AN2C 2Y2PA 5B2JB 4KGCB 3AZGB 4UPKA 3KXBB 2FJ7D 3UT9D 1P3IB 3EPHA 4G92B 1P3OD 4YS3A 3F6TA 3AFAA 1ULYA 5JA4B 3X1UB 4YS3C 3AFAC 1P3GA 2HIOA 1M19C 3B6FA 1P3GC 2HIOC 3B6FC 3O62D 3NQJB 2F8NA 2PYOB 1Q9CA 2VQRA 3AZKB 5B24A 3AFAD 3AZHC 1M19D 5B24C 3KWQB 3W96A 2FFFB 4J8UA 3R45A 3W96C 2NQBA 4J8UC 1WWIA 4WU8B 2NQBC 1P3KD 2ZY4A 4YM6B 1KX3D 1H3OB 5AV5A 1TZYB 3AZHD 3LZ1D 4ZBJB 3W97D 5CP6B 5AV5C 4QLCB 3AZJA 4XZQA 3AZJC 3X1TB 5AVCB 5B31G 4XZQC 3LZ0B 4J8WA 5CPKA 1JFIA 4KUDB 2Y2KA 4J8VD 4J8WC 5CPKC 5JRGA 4EO5C 5JRGC 4KGCA 5B2JA 2XD5A 4AWLB 5B1LB 5B2JC 4KGCC 3FDDA 3IP4C 2ZY3A 4H9QB 5JA4A 3X1UA 5CPID 3X1UC 3RELB 3EPLA 5BT1D 4KGCD 5B2JD 3NQJA 1W2EA 3AZGD 3KXBD 1P3ID 3WA9B 2Y2QA 4CAYA 5B33A 3C1CB 3AZNB 3MVDB 5B33C 3TU4B 1P3OB 3X1UD 3MNNA 2G5HC 5FUGB 1P3BA 3MNNC 3WTPB 3B0DB 1P3BC 5AVBA 4HGAB 4YM6A 2PYOD 5AVBC 3AYWB 1F1EA 4YM6C 5E5AB 2Y2JA 3AZKD 3REHA 3MGRA 1U35A 4QLCA 1BH8B 1WWSA 4ZBJC 5BO0B 3MGRC 3REHC 1U35C 4QLCC 3KWQD 3A1KA 4ZUXB 3B6GB 2AROB 1ID3A 5GT0A 2Y2NA 2Y2MA 1ID3C 1B67A 5GT0C 4WU8D 2J8PA 5BS7A 3MGPB 4YM6D 4JJNB 5BS7C 1TZYD 5GXQA 3LZ0C 4KUDA 5CP6D 5BNXA 4QLCD 1AOIA 5GXQC 4KUDC 5DNNB 1AOIC 4H9RB 1HQ3B 5B32B 4CSRB 5B2IB 4X23B 3NQUB 3LJAA 1KX4A 1KX4C 3LJAC 3X1TD 3MGSB 5AVCD 3LZ0D 5G49A 2JSSA 3V9RB 2CV5B 4KUDD 3AV2B 5AV9B 3H0MC 2DQNC 2BG1A 1P3AB 5B1LD 3C1CA 2FJ7A 2NZDB 1P3FB 1T3UA 3MVDA 2CWEA 3C1CC 2FJ7C 3W99B 1P3OA 3MVDC 5B1MB 4H9PA 2RIQA 3WAAB 1P3OC 3C1BB 3RELD 5CPIB 2F8NG 2Y2GA 5BNVB 5KDMB 5DNMB 3B0DC 1TAFB 1ZLAB 2ZM5A 3O62A 3WA9D 5E5AA 3C1CD 3AZND 3O62C 1KU5A 2RVQD 5E5AC 3MVDD 3TU4D 5BO0A 2L5AA 1S32B 1M19A 3WTPD 1Z2CB 3UTBB 3AV1B 3MGPA 1N1JB 3AYWD 1P3KA 3MGPC 1KX3A 5E5AD 4LD9B 3LELB 1P3KC 4R8PB 3AZHA 2ZY2A 3LZ1A 3X1VB 3W97A 5GSUB 1KX3C 1F66B 1BH9B 3LZ1C 3W97C 4ZUXD 5B2IA 3B6GD 2AROD 4DRAA 3AZIB 3REIB 3UTAB 5B2IC 4G91C 3MGPD 4JJND 1KX5B 3A6NB 1M18B 3KUYB 4J8VA 3AV2C 5B31B 5DNND 3VH6T 4Z66D 5B32D 1HQ3D 5B2ID 4X23D 4J8VC 1EQZB 2NZDA 3WKJB 5GT3B 3MGSD 2NZDC 2CV5D 3AZLB 4UUZB 3AV2D 5AV9D 3VH6A 5CPIA 5AY8B 5KDMA 5CPIC 3MGQB 1TAFA 1A7WA 1P3AD 2YFWA 1ZLAA 2XD1A 5BT1C 4WU9B 1P3PB 3AZGA 1ZLAC 3KXBA 2NZDD 1P3IA 1P3FD 3KFUG 4Z5TB 3AZGC 3KXBC 3W99D 3VH5A 1P3IC 5B1MD 4G92C 3WAAD 3C1BD 4J8XB 5DNMD 1P3LB 1N1JA 1ZLAD 1P34B 2PYOA 5CPJB 2BYMB 3X1SB 4R8PA 3X1VA 2PYOC 3AZKA 4LD9C 3EPKA 4WNNB 1F66A 4R8PC 3X1VC 1BH9A 1S32D 3AZKC 3KWQA 1F66C 3UTBD 3AZIA 3KWQC 5C3IB 2F8NH 5AV8B 3AV1D 3AZIC 4DRBA 2F2AC 4WU8A 1M1AB 1H3OA 3LELD 4LD9D 4WU8C 1TZYA 4R8PD 3X1VD 2Y2HA 5GSUD 5CP6A 4NE3A 1TZYC 5B31A 1B6WA 5AV6B 1F66D 3KUYC 5CP6C 5B31C 3AZID 4M6BA 3REID 3UTAD 3REJB 1R4VA 3X1TA 5AVCA 3AZLA 3LZ0A 1KX5D 3X1TC 5AVCC 3A6ND 1P3MB 3KUYD 3AZLC 1M18D 5B31D 4E45A 3B0CT 5B0ZB 3MGQA 3AN2B 4Z66B 1EQZD 3MGQC 3WKJD 5B1LA 4WU9C 5GT3D 4AWLC 5B1LC 3KSYA 3AZLD 4H9QA 4NE5A 1P3GB 2HIOB 5AY8D 4J8XA 3RELA 3B6FB 1P3LA 5B0YB 3MGQD 4J8XC 3RELC 4WU9D 1P3LC 3W98B 1P3PD 2F8NB 4NFTA 3WA9A 3X1SA 4Z5TD 2LY8A 4WV4B 4H9SA 3AZNA 4KHAB 4WNNA 3X1SC 3WA9C 5B24B 3TU4A 3AZNC 4H9SC 2RVQC 3A1IA 3TU4C 3REKB 5FUGA 4DQYB 4J8XD 3WTPA 4J8UB 2G5IC 3R45B 1P3LD 2NQBB 3WTPC 1P34D 5CPJD 3B0BA 3AYWA 4HGAC 2Y2OA 3X1SD 5AV5B 3AYWC 1BH8A 5CHLB 4ZUXA 3B6GA 2AROA 3REJA 5AV8D 4ZUXC 3AZJB 2AROC 3REJC 3B6GC 3VH6W 4XZQB 4WZSB 4JJNA 1M1AD 4JJNC 5CPKB 1JFIB 5AV6D 4EO5B 5JRGB 5DNNA 4Z66A 5B32A 4H9RA 1HQ3A 3VH5W 4CSRA 4X23A 3NQUA 5DNNC 4Z66C 3REJD 5B32C 1HQ3C 2BYKB 4X23C 3MGSA 2HUEB 4H9OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V9R A;  3MGS C;  2CV5 A;  1P3M D;  3AV2 A;  5AV9 A;  2CV5 C;  5B0Z D;  5B0Y A;  3AN2 D;  5AV9 C;  5B0Y C;  3W98 A;  1P3A A;  4H9N B;  2F8N K;  3W98 C;  1P3A C;  4CAY B;  5B33 B;  1P3F A;  4KHA A;  1HTA A;  4YS3 D;  3W99 A;  1P3F C;  5B1M A;  2YFV B;  3VH5 T;  3W99 C;  3MNN B;  2HIO D;  3REK A;  3C1B A;  1P3G D;  3WAA A;  3B6F D;  1P3B B;  5B1M C;  5B0Y D;  3WAA C;  3REK C;  5BNV A;  5DNM A;  3C1B C;  3AZE B;  5AVB B;  3W98 D;  5DNM C;  2F8N D;  3AZM B;  3AZF B;  3REH B;  3MGR B;  1U35 B;  5B24 D;  5B40 B;  1S32 A;  4XUJ B;  3REK D;  3W96 D;  4J8U D;  3UTB A;  1S32 C;  1ID3 B;  5GT0 B;  2NQB D;  3UTB C;  3AV1 A;  3AV1 C;  2IO5 B;  4LD9 A;  5AV5 D;  3LEL A;  5GXQ B;  5BNX B;  5GSU A;  3LEL C;  1AOI B;  5GSU C;  5F99 B;  1KX4 B;  3REI A;  2BYK A;  3LJA B;  3UTA A;  3AZJ D;  3B0C W;  4Z2M H;  4XZQ D;  3REI C;  3UTA C;  4H9O A;  5G49 B;  4J8W D;  5CPK D;  1KX5 A;  2HUE C;  3A6N A;  1M18 A;  3KUY A;  1KX5 C;  5JRG D;  3A6N C;  1M18 C;  4H9N A;  1EQZ A;  3WKJ A;  1EQZ C;  2FJ7 B;  5GT3 A;  3UT9 B;  3WKJ C;  5GT3 C;  2YFV A;  4UUZ A;  4H9P B;  5AY8 A;  3AZE A;  5AY8 C;  1BFM A;  4WU9 A;  3AZE C;  1P3P A;  3O62 B;  3AZM A;  5B33 D;  3AZF A;  4Z5T A;  1P3P C;  5B40 A;  3AZM C;  3AZF C;  4Z5T C;  4YS3 B;  4XUJ A;  3MNN D;  3AFA B;  5B40 C;  1M19 B;  1P3B D;  4XUJ C;  3AZE D;  5AVB D;  1P34 A;  5CPJ A;  1P3K B;  2BYM A;  3AZM D;  1P34 C;  1KX3 B;  2IO5 C;  3AZF D;  3REH D;  3MGR D;  5CPJ C;  1U35 D;  5B40 D;  3AZH B;  3LZ1 B;  4E44 A;  3W97 B;  4NE6 A;  4XUJ D;  5F99 A;  1ID3 D;  5GT0 D;  5F99 C;  4G91 B;  3W96 B;  5AV8 A;  4Z2M G;  5C3I C;  5AV8 C;  1M1A A;  5GXQ D;  1M1A C;  5B32 G;  1AOI D;  5AV6 A;  4J8V B;  5F99 D;  5AV6 C;  1KX4 D;  3LJA D;  3WTP E;  3UT9 A;  3UT9 C;  1P3M A;  4J8W B;  5B0Z A;  1P3M C;  3AN2 A;  5B0Z C;  2YFW B;  3AN2 C;  4KGC B;  5B2J B;  3AZG B;  3KXB B;  2FJ7 D;  3UT9 D;  1P3I B;  4G92 B;  1P3O D;  4YS3 A;  3AFA A;  1ULY A;  5JA4 B;  3X1U B;  4YS3 C;  3AFA C;  1P3G A;  2HIO A;  1M19 C;  3B6F A;  1P3G C;  2HIO C;  3B6F C;  3O62 D;  3NQJ B;  2F8N A;  2PYO B;  1Q9C A;  3AZK B;  5B24 A;  3AFA D;  3AZH C;  1M19 D;  5B24 C;  3KWQ B;  3W96 A;  4J8U A;  3R45 A;  3W96 C;  2NQB A;  4J8U C;  1WWI A;  4WU8 B;  2NQB C;  1P3K D;  4YM6 B;  1KX3 D;  1H3O B;  5AV5 A;  1TZY B;  3AZH D;  3LZ1 D;  4ZBJ B;  3W97 D;  5CP6 B;  5AV5 C;  4QLC B;  3AZJ A;  4XZQ A;  3AZJ C;  3X1T B;  5AVC B;  5B31 G;  4XZQ C;  3LZ0 B;  4J8W A;  5CPK A;  1JFI A;  4KUD B;  4J8V D;  4J8W C;  5CPK C;  5JRG A;  4EO5 C;  5JRG C;  4KGC A;  5B2J A;  4AWL B;  5B1L B;  5B2J C;  4KGC C;  4H9Q B;  5JA4 A;  3X1U A;  5CPI D;  3X1U C;  3REL B;  5BT1 D;  4KGC D;  5B2J D;  3NQJ A;  3AZG D;  3KXB D;  1P3I D;  3WA9 B;  4CAY A;  5B33 A;  3C1C B;  3AZN B;  3MVD B;  5B33 C;  3TU4 B;  1P3O B;  3X1U D;  3MNN A;  5FUG B;  1P3B A;  3MNN C;  3WTP B;  3B0D B;  1P3B C;  5AVB A;  4HGA B;  4YM6 A;  2PYO D;  5AVB C;  3AYW B;  1F1E A;  4YM6 C;  5E5A B;  3AZK D;  3REH A;  3MGR A;  1U35 A;  4QLC A;  1BH8 B;  1WWS A;  4ZBJ C;  5BO0 B;  3MGR C;  3REH C;  1U35 C;  4QLC C;  3KWQ D;  4ZUX B;  3B6G B;  2ARO B;  1ID3 A;  5GT0 A;  1ID3 C;  1B67 A;  5GT0 C;  4WU8 D;  5BS7 A;  3MGP B;  4JJN B;  4YM6 D;  5BS7 C;  1TZY D;  5GXQ A;  3LZ0 C;  4KUD A;  5CP6 D;  5BNX A;  4QLC D;  1AOI A;  5GXQ C;  4KUD C;  5DNN B;  1AOI C;  4H9R B;  1HQ3 B;  5B32 B;  4CSR B;  5B2I B;  4X23 B;  3NQU B;  3LJA A;  1KX4 A;  1KX4 C;  3LJA C;  3X1T D;  3MGS B;  5AVC D;  3LZ0 D;  5G49 A;  2JSS A;  3V9R B;  2CV5 B;  4KUD D;  3AV2 B;  5AV9 B;  1P3A B;  5B1L D;  3C1C A;  2FJ7 A;  2NZD B;  1P3F B;  3MVD A;  2CWE A;  3C1C C;  2FJ7 C;  3W99 B;  1P3O A;  3MVD C;  5B1M B;  4H9P A;  3WAA B;  1P3O C;  3C1B B;  3REL D;  5CPI B;  2F8N G;  5BNV B;  5KDM B;  5DNM B;  3B0D C;  1TAF B;  1ZLA B;  3O62 A;  3WA9 D;  5E5A A;  3C1C D;  3AZN D;  3O62 C;  1KU5 A;  2RVQ D;  5E5A C;  3MVD D;  3TU4 D;  5BO0 A;  2L5A A;  1S32 B;  1M19 A;  3WTP D;  3UTB B;  3AV1 B;  3MGP A;  1N1J B;  3AYW D;  1P3K A;  3MGP C;  1KX3 A;  5E5A D;  4LD9 B;  3LEL B;  1P3K C;  4R8P B;  3AZH A;  3LZ1 A;  3X1V B;  1KX3 C;  3W97 A;  5GSU B;  1F66 B;  1BH9 B;  3LZ1 C;  3W97 C;  4ZUX D;  5B2I A;  3B6G D;  2ARO D;  4DRA A;  3AZI B;  3REI B;  3UTA B;  5B2I C;  4G91 C;  3MGP D;  4JJN D;  1KX5 B;  3A6N B;  1M18 B;  3KUY B;  4J8V A;  3AV2 C;  5B31 B;  5DNN D;  3VH6 T;  4Z66 D;  5B32 D;  1HQ3 D;  5B2I D;  4X23 D;  4J8V C;  1EQZ B;  2NZD A;  3WKJ B;  5GT3 B;  3MGS D;  2NZD C;  2CV5 D;  3AZL B;  4UUZ B;  3AV2 D;  5AV9 D;  3VH6 A;  5CPI A;  5AY8 B;  5KDM A;  5CPI C;  3MGQ B;  1TAF A;  1A7W A;  1P3A D;  2YFW A;  1ZLA A;  4WU9 B;  5BT1 C;  1P3P B;  3AZG A;  1ZLA C;  3KXB A;  2NZD D;  1P3I A;  1P3F D;  4Z5T B;  3AZG C;  3KXB C;  3W99 D;  3VH5 A;  1P3I C;  5B1M D;  4G92 C;  3WAA D;  3C1B D;  4J8X B;  5DNM D;  1P3L B;  1N1J A;  1ZLA D;  1P34 B;  2PYO A;  5CPJ B;  2BYM B;  3X1S B;  4R8P A;  3X1V A;  2PYO C;  3AZK A;  4LD9 C;  4WNN B;  1F66 A;  4R8P C;  3X1V C;  1BH9 A;  1S32 D;  3AZK C;  3KWQ A;  1F66 C;  3UTB D;  3AZI A;  3KWQ C;  5C3I B;  2F8N H;  5AV8 B;  3AV1 D;  3AZI C;  4DRB A;  4WU8 A;  1M1A B;  1H3O A;  3LEL D;  4LD9 D;  4WU8 C;  1TZY A;  4R8P D;  3X1V D;  5GSU D;  5CP6 A;  4NE3 A;  1TZY C;  5B31 A;  1B6W A;  5AV6 B;  1F66 D;  3KUY C;  5CP6 C;  5B31 C;  3AZI D;  4M6B A;  3REI D;  3UTA D;  3REJ B;  1R4V A;  3X1T A;  5AVC A;  3AZL A;  3LZ0 A;  1KX5 D;  3X1T C;  5AVC C;  3A6N D;  1P3M B;  3KUY D;  3AZL C;  1M18 D;  5B31 D;  4E45 A;  3B0C T;  5B0Z B;  3MGQ A;  3AN2 B;  4Z66 B;  1EQZ D;  3MGQ C;  3WKJ D;  5B1L A;  4WU9 C;  5GT3 D;  4AWL C;  5B1L C;  3KSY A;  3AZL D;  4H9Q A;  4NE5 A;  1P3G B;  2HIO B;  5AY8 D;  4J8X A;  3REL A;  3B6F B;  1P3L A;  5B0Y B;  3MGQ D;  4J8X C;  3REL C;  4WU9 D;  1P3L C;  3W98 B;  1P3P D;  2F8N B;  4NFT A;  3WA9 A;  3X1S A;  4Z5T D;  2LY8 A;  4WV4 B;  4H9S A;  3AZN A;  4KHA B;  4WNN A;  3X1S C;  3WA9 C;  5B24 B;  3TU4 A;  3AZN C;  4H9S C;  2RVQ C;  3TU4 C;  3REK B;  5FUG A;  4J8X D;  3WTP A;  4J8U B;  1P3L D;  3R45 B;  2NQB B;  3WTP C;  1P34 D;  5CPJ D;  3B0B A;  3AYW A;  4HGA C;  3X1S D;  5AV5 B;  3AYW C;  1BH8 A;  5CHL B;  4ZUX A;  3B6G A;  2ARO A;  3REJ A;  5AV8 D;  4ZUX C;  3AZJ B;  2ARO C;  3REJ C;  3B6G C;  3VH6 W;  4XZQ B;  4WZS B;  4JJN A;  1M1A D;  4JJN C;  5CPK B;  1JFI B;  5AV6 D;  4EO5 B;  5JRG B;  5DNN A;  4Z66 A;  5B32 A;  4H9R A;  1HQ3 A;  3VH5 W;  4CSR A;  4X23 A;  3NQU A;  5DNN C;  4Z66 C;  3REJ D;  5B32 C;  1HQ3 C;  2BYK B;  4X23 C;  3MGS A;  2HUE B;  4H9O B; 
#chains in the Genus database with same CATH topology
 3V9R A;  3MGS C;  2CV5 A;  1P3M D;  3AV2 A;  5AV9 A;  2CV5 C;  5B0Z D;  5B0Y A;  3AN2 D;  3EG5 B;  5AV9 C;  5B0Y C;  3W98 A;  1P3A A;  4H9N B;  2F8N K;  3W98 C;  1P3A C;  4CAY B;  5B33 B;  1P3F A;  4KHA A;  1HTA A;  4YS3 D;  3W99 A;  1P3F C;  5B1M A;  2YFV B;  3VH5 T;  3W99 C;  3MNN B;  2DF4 C;  2HIO D;  3C1B A;  3REK A;  1P3G D;  3B6F D;  3WAA A;  1P3B B;  5B1M C;  3H0L C;  3WAA C;  5B0Y D;  3REK C;  5BNV A;  5DNM A;  3C1B C;  3AZE B;  5AVB B;  3W98 D;  2ZY5 A;  5DNM C;  3P5J B;  2F8N D;  3AZM B;  3AZF B;  3REH B;  3MGR B;  1U35 B;  5B24 D;  5B40 B;  4WJ3 C;  2JE5 A;  1S32 A;  4XUJ B;  3REK D;  3W96 D;  4J8U D;  3UTB A;  1S32 C;  1ID3 B;  5GT0 B;  2NQB D;  3UTB C;  3AV1 A;  3AV1 C;  2IO5 B;  4LD9 A;  5AV5 D;  3LEL A;  5GXQ B;  5BNX B;  5GSU A;  3LEL C;  1AOI B;  2W8S A;  5GSU C;  5F99 B;  1KX4 B;  3H0R C;  3REI A;  2BYK A;  3LJA B;  3UTA A;  3AZJ D;  3B0C W;  4Z2M H;  4XZQ D;  3REI C;  3UTA C;  3EPJ A;  4H9O A;  5G49 B;  4J8W D;  5CPK D;  1KX5 A;  2HUE C;  3A6N A;  1M18 A;  3KUY A;  1KX5 C;  5JRG D;  3A6N C;  1M18 C;  4H9N A;  1EQZ A;  3AL0 C;  2JCH A;  3WKJ A;  1EQZ C;  2FJ7 B;  5GT3 A;  3UT9 B;  3WKJ C;  5GT3 C;  2YFV A;  4UUZ A;  4H9P B;  5AY8 A;  3AZE A;  5AY8 C;  1BFM A;  4WU9 A;  3AZE C;  1P3P A;  3O62 B;  3AZM A;  5B33 D;  3AZF A;  4Z5T A;  1P3P C;  5B40 A;  3AZM C;  3AZF C;  4Z5T C;  4YS3 B;  4XUJ A;  3MNN D;  3AFA B;  5B40 C;  1M19 B;  1P3B D;  4XUJ C;  3AZE D;  5AVB D;  1PZR A;  1P34 A;  5CPJ A;  1P3K B;  2BYM A;  3AZM D;  1P34 C;  1KX3 B;  2IO5 C;  3AZF D;  3REH D;  3MGR D;  5CPJ C;  1U35 D;  5B40 D;  3AZH B;  3LZ1 B;  4E44 A;  3W97 B;  4NE6 A;  4XUJ D;  5F99 A;  1ID3 D;  4G91 B;  5F99 C;  5GT0 D;  3W96 B;  5AV8 A;  4Z2M G;  5C3I C;  5AV8 C;  2Y2L A;  1M1A A;  5GXQ D;  1M1A C;  5B32 G;  2UWX A;  1AOI D;  5AV6 A;  4J8V B;  5F99 D;  5AV6 C;  1KX4 D;  3LJA D;  3WTP E;  3UT9 A;  3UT9 C;  2Y2I A;  1P3M A;  4J8W B;  5B0Z A;  1P3M C;  3AN2 A;  5B0Z C;  2YFW B;  3AN2 C;  2Y2P A;  5B2J B;  4KGC B;  3AZG B;  4UPK A;  3KXB B;  2FJ7 D;  3UT9 D;  1P3I B;  3EPH A;  4G92 B;  1P3O D;  4YS3 A;  3F6T A;  3AFA A;  1ULY A;  5JA4 B;  3X1U B;  4YS3 C;  3AFA C;  1P3G A;  2HIO A;  1M19 C;  3B6F A;  1P3G C;  2HIO C;  3B6F C;  3O62 D;  3NQJ B;  2F8N A;  2PYO B;  1Q9C A;  2VQR A;  3AZK B;  5B24 A;  3AFA D;  3AZH C;  1M19 D;  5B24 C;  3KWQ B;  3W96 A;  2FFF B;  4J8U A;  3R45 A;  3W96 C;  2NQB A;  4J8U C;  1WWI A;  4WU8 B;  2NQB C;  1P3K D;  2ZY4 A;  4YM6 B;  1KX3 D;  1H3O B;  5AV5 A;  1TZY B;  3AZH D;  3LZ1 D;  4ZBJ B;  3W97 D;  5CP6 B;  5AV5 C;  4QLC B;  3AZJ A;  4XZQ A;  3AZJ C;  3X1T B;  5AVC B;  5B31 G;  4XZQ C;  3LZ0 B;  4J8W A;  5CPK A;  1JFI A;  4KUD B;  2Y2K A;  4J8V D;  4J8W C;  5CPK C;  5JRG A;  4EO5 C;  5JRG C;  4KGC A;  5B2J A;  2XD5 A;  4AWL B;  5B1L B;  5B2J C;  4KGC C;  3FDD A;  3IP4 C;  2ZY3 A;  4H9Q B;  5JA4 A;  3X1U A;  5CPI D;  3X1U C;  3REL B;  3EPL A;  5BT1 D;  4KGC D;  5B2J D;  3NQJ A;  1W2E A;  3AZG D;  3KXB D;  1P3I D;  3WA9 B;  2Y2Q A;  4CAY A;  5B33 A;  3C1C B;  3AZN B;  3MVD B;  5B33 C;  3TU4 B;  1P3O B;  3X1U D;  3MNN A;  2G5H C;  5FUG B;  1P3B A;  3MNN C;  3WTP B;  3B0D B;  1P3B C;  5AVB A;  4HGA B;  4YM6 A;  2PYO D;  5AVB C;  3AYW B;  1F1E A;  4YM6 C;  5E5A B;  2Y2J A;  3AZK D;  3REH A;  3MGR A;  1U35 A;  4QLC A;  1BH8 B;  1WWS A;  4ZBJ C;  5BO0 B;  3MGR C;  3REH C;  1U35 C;  4QLC C;  3KWQ D;  3A1K A;  4ZUX B;  3B6G B;  2ARO B;  1ID3 A;  5GT0 A;  2Y2N A;  2Y2M A;  1ID3 C;  1B67 A;  5GT0 C;  4WU8 D;  2J8P A;  5BS7 A;  3MGP B;  4YM6 D;  4JJN B;  5BS7 C;  1TZY D;  5GXQ A;  3LZ0 C;  4KUD A;  5CP6 D;  5BNX A;  4QLC D;  1AOI A;  5GXQ C;  4KUD C;  5DNN B;  1AOI C;  4H9R B;  1HQ3 B;  5B32 B;  4CSR B;  5B2I B;  4X23 B;  3NQU B;  3LJA A;  1KX4 A;  1KX4 C;  3LJA C;  3X1T D;  3MGS B;  5AVC D;  3LZ0 D;  5G49 A;  2JSS A;  3V9R B;  2CV5 B;  4KUD D;  3AV2 B;  5AV9 B;  3H0M C;  2DQN C;  2BG1 A;  1P3A B;  5B1L D;  3C1C A;  2FJ7 A;  2NZD B;  1P3F B;  1T3U A;  3MVD A;  2CWE A;  3C1C C;  2FJ7 C;  3W99 B;  1P3O A;  3MVD C;  5B1M B;  4H9P A;  2RIQ A;  3WAA B;  1P3O C;  3C1B B;  3REL D;  5CPI B;  2F8N G;  2Y2G A;  5BNV B;  5KDM B;  5DNM B;  3B0D C;  1TAF B;  1ZLA B;  2ZM5 A;  3O62 A;  3WA9 D;  5E5A A;  3C1C D;  3AZN D;  3O62 C;  1KU5 A;  2RVQ D;  5E5A C;  3MVD D;  3TU4 D;  5BO0 A;  2L5A A;  1S32 B;  1M19 A;  3WTP D;  1Z2C B;  3UTB B;  3AV1 B;  3MGP A;  1N1J B;  3AYW D;  1P3K A;  3MGP C;  1KX3 A;  5E5A D;  4LD9 B;  3LEL B;  1P3K C;  4R8P B;  3AZH A;  2ZY2 A;  3LZ1 A;  3X1V B;  3W97 A;  5GSU B;  1KX3 C;  1F66 B;  1BH9 B;  3LZ1 C;  3W97 C;  4ZUX D;  5B2I A;  3B6G D;  2ARO D;  4DRA A;  3AZI B;  3REI B;  3UTA B;  5B2I C;  4G91 C;  3MGP D;  4JJN D;  1KX5 B;  3A6N B;  1M18 B;  3KUY B;  4J8V A;  3AV2 C;  5B31 B;  5DNN D;  3VH6 T;  4Z66 D;  5B32 D;  1HQ3 D;  5B2I D;  4X23 D;  4J8V C;  1EQZ B;  2NZD A;  3WKJ B;  5GT3 B;  3MGS D;  2NZD C;  2CV5 D;  3AZL B;  4UUZ B;  3AV2 D;  5AV9 D;  3VH6 A;  5CPI A;  5AY8 B;  5KDM A;  5CPI C;  3MGQ B;  1TAF A;  1A7W A;  1P3A D;  2YFW A;  1ZLA A;  2XD1 A;  5BT1 C;  4WU9 B;  1P3P B;  3AZG A;  1ZLA C;  3KXB A;  2NZD D;  1P3I A;  1P3F D;  3KFU G;  4Z5T B;  3AZG C;  3KXB C;  3W99 D;  3VH5 A;  1P3I C;  5B1M D;  4G92 C;  3WAA D;  3C1B D;  4J8X B;  5DNM D;  1P3L B;  1N1J A;  1ZLA D;  1P34 B;  2PYO A;  5CPJ B;  2BYM B;  3X1S B;  4R8P A;  3X1V A;  2PYO C;  3AZK A;  4LD9 C;  3EPK A;  4WNN B;  1F66 A;  4R8P C;  3X1V C;  1BH9 A;  1S32 D;  3AZK C;  3KWQ A;  1F66 C;  3UTB D;  3AZI A;  3KWQ C;  5C3I B;  2F8N H;  5AV8 B;  3AV1 D;  3AZI C;  4DRB A;  2F2A C;  4WU8 A;  1M1A B;  1H3O A;  3LEL D;  4LD9 D;  4WU8 C;  1TZY A;  4R8P D;  3X1V D;  2Y2H A;  5GSU D;  5CP6 A;  4NE3 A;  1TZY C;  5B31 A;  1B6W A;  5AV6 B;  1F66 D;  3KUY C;  5CP6 C;  5B31 C;  3AZI D;  4M6B A;  3REI D;  3UTA D;  3REJ B;  1R4V A;  3X1T A;  5AVC A;  3AZL A;  3LZ0 A;  1KX5 D;  3X1T C;  5AVC C;  3A6N D;  1P3M B;  3KUY D;  3AZL C;  1M18 D;  5B31 D;  4E45 A;  3B0C T;  5B0Z B;  3MGQ A;  3AN2 B;  4Z66 B;  1EQZ D;  3MGQ C;  3WKJ D;  5B1L A;  4WU9 C;  5GT3 D;  4AWL C;  5B1L C;  3KSY A;  3AZL D;  4H9Q A;  4NE5 A;  1P3G B;  2HIO B;  5AY8 D;  4J8X A;  3REL A;  3B6F B;  1P3L A;  5B0Y B;  3MGQ D;  4J8X C;  3REL C;  4WU9 D;  1P3L C;  3W98 B;  1P3P D;  2F8N B;  4NFT A;  3WA9 A;  3X1S A;  4Z5T D;  2LY8 A;  4WV4 B;  4H9S A;  3AZN A;  4KHA B;  4WNN A;  3X1S C;  3WA9 C;  5B24 B;  3TU4 A;  3AZN C;  4H9S C;  2RVQ C;  3A1I A;  3TU4 C;  3REK B;  5FUG A;  4DQY B;  4J8X D;  3WTP A;  4J8U B;  2G5I C;  3R45 B;  1P3L D;  2NQB B;  3WTP C;  1P34 D;  5CPJ D;  3B0B A;  3AYW A;  4HGA C;  2Y2O A;  3X1S D;  5AV5 B;  3AYW C;  1BH8 A;  5CHL B;  4ZUX A;  3B6G A;  2ARO A;  3REJ A;  5AV8 D;  4ZUX C;  3AZJ B;  2ARO C;  3REJ C;  3B6G C;  3VH6 W;  4XZQ B;  4WZS B;  4JJN A;  1M1A D;  4JJN C;  5CPK B;  1JFI B;  5AV6 D;  4EO5 B;  5JRG B;  5DNN A;  4Z66 A;  5B32 A;  4H9R A;  1HQ3 A;  3VH5 W;  4CSR A;  4X23 A;  3NQU A;  5DNN C;  4Z66 C;  3REJ D;  5B32 C;  1HQ3 C;  2BYK B;  4X23 C;  3MGS A;  2HUE B;  4H9O B; 
#chains in the Genus database with same CATH homology
 3V9R A;  3MGS C;  2CV5 A;  1P3M D;  3AV2 A;  5AV9 A;  2CV5 C;  5B0Z D;  5B0Y A;  3AN2 D;  3EG5 B;  5AV9 C;  5B0Y C;  3W98 A;  1P3A A;  4H9N B;  2F8N K;  3W98 C;  1P3A C;  4CAY B;  5B33 B;  1P3F A;  4KHA A;  1HTA A;  4YS3 D;  3W99 A;  1P3F C;  5B1M A;  2YFV B;  3VH5 T;  3W99 C;  3MNN B;  2DF4 C;  2HIO D;  3C1B A;  3REK A;  1P3G D;  3B6F D;  3WAA A;  1P3B B;  5B1M C;  3H0L C;  3WAA C;  5B0Y D;  3REK C;  5BNV A;  5DNM A;  3C1B C;  3AZE B;  5AVB B;  3W98 D;  2ZY5 A;  5DNM C;  3P5J B;  2F8N D;  3AZM B;  3AZF B;  3REH B;  3MGR B;  1U35 B;  5B24 D;  5B40 B;  4WJ3 C;  2JE5 A;  1S32 A;  4XUJ B;  3REK D;  3W96 D;  4J8U D;  3UTB A;  1S32 C;  1ID3 B;  5GT0 B;  2NQB D;  3UTB C;  3AV1 A;  3AV1 C;  2IO5 B;  4LD9 A;  5AV5 D;  3LEL A;  5GXQ B;  5BNX B;  5GSU A;  3LEL C;  1AOI B;  2W8S A;  5GSU C;  5F99 B;  1KX4 B;  3H0R C;  3REI A;  2BYK A;  3LJA B;  3UTA A;  3AZJ D;  3B0C W;  4Z2M H;  4XZQ D;  3REI C;  3UTA C;  3EPJ A;  4H9O A;  5G49 B;  4J8W D;  5CPK D;  1KX5 A;  2HUE C;  3A6N A;  1M18 A;  3KUY A;  1KX5 C;  5JRG D;  3A6N C;  1M18 C;  4H9N A;  1EQZ A;  3AL0 C;  2JCH A;  3WKJ A;  1EQZ C;  2FJ7 B;  5GT3 A;  3UT9 B;  3WKJ C;  5GT3 C;  2YFV A;  4UUZ A;  4H9P B;  5AY8 A;  3AZE A;  5AY8 C;  1BFM A;  4WU9 A;  3AZE C;  1P3P A;  3O62 B;  3AZM A;  5B33 D;  3AZF A;  4Z5T A;  1P3P C;  5B40 A;  3AZM C;  3AZF C;  4Z5T C;  4YS3 B;  4XUJ A;  3MNN D;  3AFA B;  5B40 C;  1M19 B;  1P3B D;  4XUJ C;  3AZE D;  5AVB D;  1PZR A;  1P34 A;  5CPJ A;  1P3K B;  2BYM A;  3AZM D;  1P34 C;  1KX3 B;  2IO5 C;  3AZF D;  3REH D;  3MGR D;  5CPJ C;  1U35 D;  5B40 D;  3AZH B;  3LZ1 B;  4E44 A;  3W97 B;  4NE6 A;  4XUJ D;  5F99 A;  1ID3 D;  4G91 B;  5F99 C;  5GT0 D;  3W96 B;  5AV8 A;  4Z2M G;  5C3I C;  5AV8 C;  2Y2L A;  1M1A A;  5GXQ D;  1M1A C;  5B32 G;  2UWX A;  1AOI D;  5AV6 A;  4J8V B;  5F99 D;  5AV6 C;  1KX4 D;  3LJA D;  3WTP E;  3UT9 A;  3UT9 C;  2Y2I A;  1P3M A;  4J8W B;  5B0Z A;  1P3M C;  3AN2 A;  5B0Z C;  2YFW B;  3AN2 C;  2Y2P A;  5B2J B;  4KGC B;  3AZG B;  4UPK A;  3KXB B;  2FJ7 D;  3UT9 D;  1P3I B;  3EPH A;  4G92 B;  1P3O D;  4YS3 A;  3F6T A;  3AFA A;  1ULY A;  5JA4 B;  3X1U B;  4YS3 C;  3AFA C;  1P3G A;  2HIO A;  1M19 C;  3B6F A;  1P3G C;  2HIO C;  3B6F C;  3O62 D;  3NQJ B;  2F8N A;  2PYO B;  1Q9C A;  2VQR A;  3AZK B;  5B24 A;  3AFA D;  3AZH C;  1M19 D;  5B24 C;  3KWQ B;  3W96 A;  2FFF B;  4J8U A;  3R45 A;  3W96 C;  2NQB A;  4J8U C;  1WWI A;  4WU8 B;  2NQB C;  1P3K D;  2ZY4 A;  4YM6 B;  1KX3 D;  1H3O B;  5AV5 A;  1TZY B;  3AZH D;  3LZ1 D;  4ZBJ B;  3W97 D;  5CP6 B;  5AV5 C;  4QLC B;  3AZJ A;  4XZQ A;  3AZJ C;  3X1T B;  5AVC B;  5B31 G;  4XZQ C;  3LZ0 B;  4J8W A;  5CPK A;  1JFI A;  4KUD B;  2Y2K A;  4J8V D;  4J8W C;  5CPK C;  5JRG A;  4EO5 C;  5JRG C;  4KGC A;  5B2J A;  2XD5 A;  4AWL B;  5B1L B;  5B2J C;  4KGC C;  3FDD A;  3IP4 C;  2ZY3 A;  4H9Q B;  5JA4 A;  3X1U A;  5CPI D;  3X1U C;  3REL B;  3EPL A;  5BT1 D;  4KGC D;  5B2J D;  3NQJ A;  1W2E A;  3AZG D;  3KXB D;  1P3I D;  3WA9 B;  2Y2Q A;  4CAY A;  5B33 A;  3C1C B;  3AZN B;  3MVD B;  5B33 C;  3TU4 B;  1P3O B;  3X1U D;  3MNN A;  2G5H C;  5FUG B;  1P3B A;  3MNN C;  3WTP B;  3B0D B;  1P3B C;  5AVB A;  4HGA B;  4YM6 A;  2PYO D;  5AVB C;  3AYW B;  1F1E A;  4YM6 C;  5E5A B;  2Y2J A;  3AZK D;  3REH A;  3MGR A;  1U35 A;  4QLC A;  1BH8 B;  1WWS A;  4ZBJ C;  5BO0 B;  3MGR C;  3REH C;  1U35 C;  4QLC C;  3KWQ D;  3A1K A;  4ZUX B;  3B6G B;  2ARO B;  1ID3 A;  5GT0 A;  2Y2N A;  2Y2M A;  1ID3 C;  1B67 A;  5GT0 C;  4WU8 D;  2J8P A;  5BS7 A;  3MGP B;  4YM6 D;  4JJN B;  5BS7 C;  1TZY D;  5GXQ A;  3LZ0 C;  4KUD A;  5CP6 D;  5BNX A;  4QLC D;  1AOI A;  5GXQ C;  4KUD C;  5DNN B;  1AOI C;  4H9R B;  1HQ3 B;  5B32 B;  4CSR B;  5B2I B;  4X23 B;  3NQU B;  3LJA A;  1KX4 A;  1KX4 C;  3LJA C;  3X1T D;  3MGS B;  5AVC D;  3LZ0 D;  5G49 A;  2JSS A;  3V9R B;  2CV5 B;  4KUD D;  3AV2 B;  5AV9 B;  3H0M C;  2DQN C;  2BG1 A;  1P3A B;  5B1L D;  3C1C A;  2FJ7 A;  2NZD B;  1P3F B;  1T3U A;  3MVD A;  2CWE A;  3C1C C;  2FJ7 C;  3W99 B;  1P3O A;  3MVD C;  5B1M B;  4H9P A;  2RIQ A;  3WAA B;  1P3O C;  3C1B B;  3REL D;  5CPI B;  2F8N G;  2Y2G A;  5BNV B;  5KDM B;  5DNM B;  3B0D C;  1TAF B;  1ZLA B;  2ZM5 A;  3O62 A;  3WA9 D;  5E5A A;  3C1C D;  3AZN D;  3O62 C;  1KU5 A;  2RVQ D;  5E5A C;  3MVD D;  3TU4 D;  5BO0 A;  2L5A A;  1S32 B;  1M19 A;  3WTP D;  1Z2C B;  3UTB B;  3AV1 B;  3MGP A;  1N1J B;  3AYW D;  1P3K A;  3MGP C;  1KX3 A;  5E5A D;  4LD9 B;  3LEL B;  1P3K C;  4R8P B;  3AZH A;  2ZY2 A;  3LZ1 A;  3X1V B;  3W97 A;  5GSU B;  1KX3 C;  1F66 B;  1BH9 B;  3LZ1 C;  3W97 C;  4ZUX D;  5B2I A;  3B6G D;  2ARO D;  4DRA A;  3AZI B;  3REI B;  3UTA B;  5B2I C;  4G91 C;  3MGP D;  4JJN D;  1KX5 B;  3A6N B;  1M18 B;  3KUY B;  4J8V A;  3AV2 C;  5B31 B;  5DNN D;  3VH6 T;  4Z66 D;  5B32 D;  1HQ3 D;  5B2I D;  4X23 D;  4J8V C;  1EQZ B;  2NZD A;  3WKJ B;  5GT3 B;  3MGS D;  2NZD C;  2CV5 D;  3AZL B;  4UUZ B;  3AV2 D;  5AV9 D;  3VH6 A;  5CPI A;  5AY8 B;  5KDM A;  5CPI C;  3MGQ B;  1TAF A;  1A7W A;  1P3A D;  2YFW A;  1ZLA A;  2XD1 A;  5BT1 C;  4WU9 B;  1P3P B;  3AZG A;  1ZLA C;  3KXB A;  2NZD D;  1P3I A;  1P3F D;  3KFU G;  4Z5T B;  3AZG C;  3KXB C;  3W99 D;  3VH5 A;  1P3I C;  5B1M D;  4G92 C;  3WAA D;  3C1B D;  4J8X B;  5DNM D;  1P3L B;  1N1J A;  1ZLA D;  1P34 B;  2PYO A;  5CPJ B;  2BYM B;  3X1S B;  4R8P A;  3X1V A;  2PYO C;  3AZK A;  4LD9 C;  3EPK A;  4WNN B;  1F66 A;  4R8P C;  3X1V C;  1BH9 A;  1S32 D;  3AZK C;  3KWQ A;  1F66 C;  3UTB D;  3AZI A;  3KWQ C;  5C3I B;  2F8N H;  5AV8 B;  3AV1 D;  3AZI C;  4DRB A;  2F2A C;  4WU8 A;  1M1A B;  1H3O A;  3LEL D;  4LD9 D;  4WU8 C;  1TZY A;  4R8P D;  3X1V D;  2Y2H A;  5GSU D;  5CP6 A;  4NE3 A;  1TZY C;  5B31 A;  1B6W A;  5AV6 B;  1F66 D;  3KUY C;  5CP6 C;  5B31 C;  3AZI D;  4M6B A;  3REI D;  3UTA D;  3REJ B;  1R4V A;  3X1T A;  5AVC A;  3AZL A;  3LZ0 A;  1KX5 D;  3X1T C;  5AVC C;  3A6N D;  1P3M B;  3KUY D;  3AZL C;  1M18 D;  5B31 D;  4E45 A;  3B0C T;  5B0Z B;  3MGQ A;  3AN2 B;  4Z66 B;  1EQZ D;  3MGQ C;  3WKJ D;  5B1L A;  4WU9 C;  5GT3 D;  4AWL C;  5B1L C;  3KSY A;  3AZL D;  4H9Q A;  4NE5 A;  1P3G B;  2HIO B;  5AY8 D;  4J8X A;  3REL A;  3B6F B;  1P3L A;  5B0Y B;  3MGQ D;  4J8X C;  3REL C;  4WU9 D;  1P3L C;  3W98 B;  1P3P D;  2F8N B;  4NFT A;  3WA9 A;  3X1S A;  4Z5T D;  2LY8 A;  4WV4 B;  4H9S A;  3AZN A;  4KHA B;  4WNN A;  3X1S C;  3WA9 C;  5B24 B;  3TU4 A;  3AZN C;  4H9S C;  2RVQ C;  3A1I A;  3TU4 C;  3REK B;  5FUG A;  4DQY B;  4J8X D;  3WTP A;  4J8U B;  2G5I C;  3R45 B;  1P3L D;  2NQB B;  3WTP C;  1P34 D;  5CPJ D;  3B0B A;  3AYW A;  4HGA C;  2Y2O A;  3X1S D;  5AV5 B;  3AYW C;  1BH8 A;  5CHL B;  4ZUX A;  3B6G A;  2ARO A;  3REJ A;  5AV8 D;  4ZUX C;  3AZJ B;  2ARO C;  3REJ C;  3B6G C;  3VH6 W;  4XZQ B;  4WZS B;  4JJN A;  1M1A D;  4JJN C;  5CPK B;  1JFI B;  5AV6 D;  4EO5 B;  5JRG B;  5DNN A;  4Z66 A;  5B32 A;  4H9R A;  1HQ3 A;  3VH5 W;  4CSR A;  4X23 A;  3NQU A;  5DNN C;  4Z66 C;  3REJ D;  5B32 C;  1HQ3 C;  2BYK B;  4X23 C;  3MGS A;  2HUE B;  4H9O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...