3MGRD

Binding of rubidium ions to the nucleosome core particle
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgrD00
3UT9D 4CAYA 3B6GC 1S32A 4J8XB 5F99C 3X1SB 3B6FC 4X23B 5CP6A 4H9PB 5E5AC 3W96D 3LJAB 3A6NA 3RELC 5AV6C 3AZLA 3AZIA 1P3PA 4XZQC 5AV5B 3MGRD 3AN2A 2CWEA 5B2IC 1P3AC 4R8PC 2NQBC 3VH6A 1P3KC 3WTPB 2CV5B 4G92B 1M19A 3KUYA 3MGSA 4Z5TA 5AV9D 3C1CA 1KX3D 2LY8A 2IO5B 1KX4D 5DNNA 4KGCB 3AV1D 1M1AC 5AY8A 3TU4C 3AZFD 1P3GB 1KX5A 3X1TA 3REJC 5GT0B 2BYKA 1BH8A 1P34B 4YM6C 3C1BD 4QLCB 5B32G 5B24C 4J8VD 1S32D 3AZNC 3MGSB 2HUEB 3AV2C 5G49B 5CPIC 3C1CB 2NZDA 3UTAB 4WU9D 4XUJB 5BT1D 4J8UD 4DRBA 1P3BA 2AROA 5AY8B 3A6ND 5B1LA 1F66A 3AZLD 1AOIB 3AZID 1P3PD 3X1TB 3UT9C 4H9NB 1B67A 1N1JB 3UTBB 2BYKB 4H9RA 4H9QB 3WAAB 3LELB 5B33A 3X1UB 2PYOC 1P3OC 5BS7C 3AZHC 1TZYB 4HGAC 2NZDB 3MNNB 3KUYD 2BYMB 4Z5TD 4NE6A 5DNND 3W97A 5AVBB 3AZGA 3W98D 1HQ3A 3AZKA 4H9RB 1KX5D 3AZMA 1M18B 3AYWB 5CPJA 5AV9C 3AFAC 5GXQA 5B32D 3REIB 5BNVA 4LD9D 3AV1C 2HIOA 3AZFC 5B31B 4JJNA 3AZGB 4WV4B 3MVDB 1P3BD 2AROD 5B1LD 3C1BC 1A7WA 1F66D 3AZMB 4J8VC 1S32C 3REKC 3KXBA 5GXQB 4WU9C 1P3FC 3B0DC 5BT1C 1P3LD 4J8UC 1ZLAB 3B6GB 5CPKD 5F99B 3A6NC 5AVCD 3B6FB 3VH5T 3AZIC 1P3IA 3W97D 5E5AB 1HQ3D 2RVQD 4KUDB 4H9SC 3RELB 5AV6B 3O62C 3X1VD 4XZQB 3VH6W 5CPJD 5B2IB 1P3AB 4R8PB 4WNNB 4UUZB 5GT3C 5DNNC 3W98C 1P3KB 3MGPC 2HIOD 1P3MA 5B2JA 3W99B 1EQZA 1BH9A 4ZUXB 2F8NA 3LZ1B 3WTPE 5GSUD 5B0YC 4J8XA 5B32C 5AV8B 4LD9C 4X23A 4YS3D 3KXBD 4CSRB 4YM6B 3MGQC 5B0ZB 4H9PA 5B24B 3AZEC 4WU8D 3LJAA 3AZNB 5CPIB 1P3ID 5AV5A 3R45A 2YFWB 5JRGC 1P3LC 3REHD 4J8WD 4G91C 3WTPA 2CV5A 5CPKC 5AVCC 5B40D 2PYOB 1P3OB 4KGCA 1ID3B 3AZHB 2RVQC 1P3MD 5B2JD 1EQZD 3AZJA 1P3GA 2F8ND 3R45B 5GT0A 3X1VC 5CPJC 1P34A 1WWIA 4QLCA 4J8XD 5BNXB 3X1SD 5G49A 3UTAA 4XUJA 3WA9C 3AFAB 3KWQC 4E44A 5GSUC 3LJAD 5DNMD 1R4VA 1U35C 3AZJB 1AOIA 4H9NA 1N1JA 3UTBA 3KXBC 4YS3C 4H9QA 3WAAA 1H3OB 3LELA 4ZBJC 3X1UA 3B0BA 4Z2MG 3WTPD 4J8VB 2CV5D 1JFIB 4WU8C 1TZYA 5CP6D 3REKB 2FJ7C 3MNNA 3KSYA 2BYMA 4WU9B 1P3FB 3B0DB 4Z66C 4KGCD 5AVBA 3REHC 4J8WC 3AN2D 1P3GD 1M18A 1ULYA 5GT0D 4KHAB 4EO5C 5B1MB 3AYWA 1P34D 4QLCD 4M6BA 5B40C 3W96C 1M19D 3REIA 3O62B 3MGSD 3C1CD 1P3MC 5B31A 4XUJD 1EQZC 3MGRC 3MVDA 5GT3B 5AY8D 3W98B 3LZ0A 3MGPB 1AOID 3X1TD 1F1EA 4AWLC 3X1SC 1KX3C 3WKJB 3WAAD 3X1UD 5B0YB 1KX4C 1ZLAA 3B0CW 4Z2MH 3B6GA 1TZYD 5B32B 3LJAC 5F99A 5DNMC 2NZDD 3B6FA 4LD9B 3MGQB 3LZ0B 5E5AA 5AVBD 4E45A 3AZEB 4KUDA 3RELA 5AV6A 5CP6C 4XZQA 5B33D 3AYWD 5B2IA 1P3AA 5JRGB 4R8PA 4WNNA 4UUZA 4KGCC 1P3KA 3REID 3AZLC 5BO0B 1P3PC 3W99A 3AZGD 3V9RB 3AN2C 4ZUXA 3LZ1A 3AZKD 4QLCC 3AZMD 1M19C 3KUYC 5AV8A 4NE3A 4Z5TC 3MGSC 3REJA 3VH5W 4CSRA 3C1CC 3X1VB 5GXQD 2NQBB 4XUJC 4H9OB 4YM6A 5B0ZA 1ZLAD 5B24A 3B6GD 5AY8C 2F8NG 5F99D 4JJND 3AZNA 3B6FD 3AV2A 1KX5C 5CPIA 3VH6T 3X1TC 1HTAA 3WA9B 3KWQB 1M1AB 3TU4B 4KUDD 5GSUB 2YFWA 3RELD 1U35B 3UT9A 3REJB 1BFMA 2NZDC 3NQJB 5B2ID 4R8PD 4ZBJB 2AROC 1P3BC 1P3OA 2PYOA 5BS7A 1ID3A 5B1LC 1P3KD 1F66C 3AV2B 3AZHA 4WU8B 2FJ7B 3W99D 4ZUXD 5FUGB 4Z66B 3LZ1D 5B33C 4NE5A 3UT9B 5JA4B 5BNXA 4WZSB 4J8WB 3REIC 5AV8D 4EO5B 4YM6D 5B40B 3AZGC 3W97C 5B0ZD 5AV9A 1HQ3C 3AFAA 3W96B 4HGAB 3AZKC 2F8NH 3AZND 3AV1A 3AZFA 5C3IC 3AZMC 3MGRB 1H3OA 3VH5A 5GXQC 4X23D 4J8VA 2HIOC 2JSSA 1JFIA 3REKA 4JJNC 4AWLB 5AV9B 1KX3B 4WU9A 1P3FA 1KX4B 2PYOD 1P3OD 4J8UA 1ID3D 5KDMB 3AZHD 3AV1B 2YFVB 3AZFB 4KUDC 5DNMB 5AV5D 4KHAA 5B1MA 3C1BB 4CAYB 1S32B 4H9SA 2F8NK 3O62A 1P3IC 5CP6B 1TAFA 3W99C 4J8UB 1B6WA 4ZUXC 3AFAD 5GT3A 3LZ1C 3W98A 3NQUA 3A6NB 3AZLB 3MGPA 3AZIB 1P3PB 3AZJD 3AN2B 5AV8C 3WKJA 5B0YA 5B31G 5B0ZC 1M19B 5B32A 1TAFB 5B2JC 3REKD 3UTAD 3KUYB 4LD9A 4Z5TB 1P3FD 5DNNB 3MGQA 3NQUB 3AZEA 4J8XC 3UTBD 1KX5B 4X23C 1BH8B 3LELD 5CHLB 5B1MD 5JRGA 1P3LA 1ID3C 3MNND 5BO0A 3O62D 5CPKA 5AVCA 4DRAA 5AV5C 3V9RA 1P3BB 2AROB 5GT3D 3B0CT 5B1LB 1F66B 3MGPD 2L5AA 3WTPC 1M18D 2CV5C 4G92C 4NFTA 3X1VA 5B33B 3WKJD 2NQBA 2IO5C 5B0YD 4H9OA 1P3LB 1Q9CA 4G91B 5CPKB 5AVCB 5B31D 3AZJC 1P3GC 3MVDD 5GT0C 3MGQD 3LZ0D 3W97B 3WA9A 1P34C 1HQ3B 3KWQA 3AZED 1WWSA 1M1AA 3TU4A 3AZKB 5GSUA 1U35A 5C3IB 2HUEC 3UTAC 5CPJB 3NQJA 4YS3A 5JRGD 5BNVB 2HIOB 1AOIC 4WU8A 2FJ7A 4JJNB 3UTBC 5E5AD 5FUGA 3WAAC 4Z66A 3LELC 3X1UC 5B1MC 5AV6D 1TZYC 4XZQD 3REHA 5JA4A 3MNNC 4J8WA 3KXBB 4YS3B 1P3AD 2NQBD 5B40A 5AVBC 1KU5A 3W96A 1P3IB 1M18C 3MGRA 3AYWC 3WA9D 3KWQD 1M1AD 3TU4D 3WKJC 3REHB 1U35D 3REJD 5B31C 3X1SA 1KX3A 5B24D 3MVDC 1KX4A 3LZ0C 5KDMA 3AV2D 2YFVA 5CPID 1P3MB 5B2JB 2FJ7D 5DNMA 1EQZB 1BH9B 2F8NB 4Z66D 3C1BA 1ZLAC
chains in the Genus database with same CATH superfamily
3UT9D 4CAYA 3B6GC 1S32A 4J8XB 2J8PA 2Y2KA 5F99C 3X1SB 3B6FC 4X23B 5CP6A 4H9PB 5E5AC 3W96D 3LJAB 3A6NA 3RELC 5AV6C 3AZLA 3AZIA 1P3PA 4XZQC 5AV5B 3MGRD 3AN2A 2CWEA 5B2IC 1P3AC 4R8PC 2NQBC 3VH6A 1P3KC 3WTPB 2Y2LA 4G92B 2CV5B 1M19A 3KUYA 3MGSA 4Z5TA 5AV9D 3C1CA 1KX3D 2LY8A 2IO5B 1KX4D 5DNNA 4KGCB 3AV1D 1M1AC 5AY8A 3TU4C 3AZFD 2ZY2A 1P3GB 2ZY4A 1KX5A 3X1TA 3REJC 5GT0B 2Y2HA 2BYKA 1BH8A 1P34B 2W8SA 4YM6C 3C1BD 4QLCB 3AL0C 5B32G 5B24C 4J8VD 1S32D 3AZNC 2FFFB 3MGSB 2HUEB 3AV2C 5G49B 5CPIC 3C1CB 4DQYB 3UTAB 4WU9D 2VQRA 2NZDA 4XUJB 5BT1D 4J8UD 4DRBA 1P3BA 2AROA 5AY8B 3A6ND 5B1LA 1F66A 3AZLD 1AOIB 3AZID 1P3PD 3X1TB 3UT9C 4H9NB 1B67A 1N1JB 3UTBB 2BYKB 4H9RA 4H9QB 3WAAB 3LELB 5B33A 3X1UB 2PYOC 1P3OC 5BS7C 3AZHC 1TZYB 4HGAC 2NZDB 3MNNB 3KUYD 2BYMB 4Z5TD 4NE6A 5DNND 3W97A 5AVBB 3AZGA 3W98D 1HQ3A 2Y2JA 3AZKA 4H9RB 1KX5D 3AZMA 1M18B 3AYWB 5CPJA 5AV9C 3AFAC 5GXQA 5B32D 3REIB 5BNVA 4LD9D 3AV1C 2HIOA 3AZFC 5B31B 4JJNA 3AZGB 4WV4B 3MVDB 1P3BD 2AROD 2ZY5A 5B1LD 3C1BC 1A7WA 1F66D 3AZMB 3H0LC 4J8VC 1S32C 3REKC 3KXBA 5GXQB 2G5IC 4WU9C 1P3FC 3B0DC 5BT1C 1P3LD 4J8UC 1ZLAB 3B6GB 5CPKD 5F99B 3A6NC 5AVCD 3B6FB 3VH5T 3AZIC 1P3IA 3W97D 5E5AB 1HQ3D 2RVQD 4KUDB 4H9SC 3RELB 5AV6B 3O62C 3X1VD 4XZQB 3VH6W 5CPJD 5B2IB 1P3AB 2JCHA 4R8PB 4WNNB 4UUZB 5GT3C 5DNNC 3W98C 1P3KB 3MGPC 2HIOD 1P3MA 4UPKA 5B2JA 3W99B 1EQZA 1BH9A 4ZUXB 2F8NA 3LZ1B 3WTPE 5GSUD 5B0YC 4J8XA 5B32C 3A1KA 5AV8B 4LD9C 4X23A 4YS3D 3KXBD 4CSRB 4YM6B 3MGQC 3EPLA 5B0ZB 4H9PA 5B24B 3AZEC 4WU8D 2BG1A 3LJAA 3AZNB 5CPIB 1P3ID 5AV5A 3R45A 2YFWB 5JRGC 3F6TA 1P3LC 3REHD 4J8WD 3EPJA 4G91C 3WTPA 2CV5A 5CPKC 5AVCC 5B40D 2PYOB 1P3OB 4KGCA 1ID3B 3AZHB 2RVQC 3EPHA 1P3MD 5B2JD 1EQZD 3AZJA 1P3GA 2F8ND 3R45B 5GT0A 3X1VC 5CPJC 1P34A 1WWIA 4QLCA 4J8XD 2ZY3A 5BNXB 2ZM5A 3X1SD 5G49A 3UTAA 4XUJA 3WA9C 3AFAB 3KWQC 4E44A 5GSUC 3LJAD 5DNMD 1R4VA 1U35C 3AZJB 1AOIA 4H9NA 1N1JA 3UTBA 3KXBC 4YS3C 4H9QA 3WAAA 1H3OB 3LELA 4ZBJC 3X1UA 3B0BA 4Z2MG 3WTPD 4J8VB 2CV5D 1JFIB 4WU8C 1TZYA 5CP6D 3REKB 2FJ7C 3MNNA 3KSYA 2BYMA 4WU9B 1P3FB 3B0DB 4Z66C 4KGCD 5AVBA 1Z2CB 3REHC 4J8WC 3AN2D 1P3GD 1M18A 1ULYA 5GT0D 4KHAB 4EO5C 5B1MB 3AYWA 1P34D 4QLCD 4M6BA 5B40C 3W96C 1M19D 3REIA 3O62B 3MGSD 2Y2PA 3C1CD 1P3MC 5B31A 4XUJD 1EQZC 3MGRC 3MVDA 5GT3B 5AY8D 3W98B 3LZ0A 3MGPB 1AOID 3X1TD 1F1EA 4AWLC 3X1SC 1KX3C 3WKJB 3WAAD 3X1UD 5B0YB 1KX4C 2RIQA 1ZLAA 3B0CW 4Z2MH 3B6GA 1TZYD 5B32B 3LJAC 2Y2IA 5F99A 5DNMC 3B6FA 4LD9B 2NZDD 3MGQB 3LZ0B 5E5AA 5AVBD 4E45A 3AZEB 4KUDA 2XD1A 3RELA 5AV6A 5CP6C 4XZQA 5B33D 3AYWD 5B2IA 1P3AA 5JRGB 4R8PA 4WNNA 4UUZA 4KGCC 1P3KA 3REID 3AZLC 5BO0B 1P3PC 3W99A 3AZGD 3V9RB 3AN2C 4ZUXA 3LZ1A 3AZKD 4QLCC 2Y2QA 3AZMD 1M19C 3KUYC 3FDDA 4NE3A 4Z5TC 5AV8A 3MGSC 3VH5W 4CSRA 2DQNC 3C1CC 5GXQD 3REJA 3X1VB 4XUJC 4H9OB 4YM6A 2NQBB 5B0ZA 1ZLAD 5B24A 3B6GD 5AY8C 2F8NG 5F99D 4JJND 3AZNA 3B6FD 3AV2A 1KX5C 5CPIA 3VH6T 3X1TC 1HTAA 3H0MC 3WA9B 3KWQB 1M1AB 3TU4B 4KUDD 5GSUB 2YFWA 3RELD 1U35B 3UT9A 3REJB 2Y2OA 1BFMA 2NZDC 3NQJB 5B2ID 4R8PD 4ZBJB 2AROC 1P3BC 1P3OA 2PYOA 5BS7A 1ID3A 5B1LC 1P3KD 1F66C 3AV2B 3AZHA 4WU8B 2FJ7B 3P5JB 3W99D 4ZUXD 5FUGB 4Z66B 3LZ1D 5B33C 4NE5A 3UT9B 5JA4B 5BNXA 4WZSB 4J8WB 3REIC 5AV8D 4EO5B 4YM6D 5B40B 3AZGC 3W97C 5B0ZD 5AV9A 1HQ3C 3AFAA 3W96B 4HGAB 3AZKC 2F8NH 3AZND 3AV1A 3AZFA 5C3IC 3AZMC 3MGRB 3H0RC 1H3OA 1T3UA 3VH5A 5GXQC 4X23D 4J8VA 2HIOC 2JSSA 1JFIA 3EPKA 3REKA 4JJNC 4AWLB 5AV9B 1KX3B 4WU9A 1P3FA 1KX4B 2UWXA 1P3OD 2PYOD 4J8UA 1ID3D 5KDMB 3AZHD 3AV1B 2YFVB 3AZFB 4KUDC 5DNMB 5AV5D 4KHAA 5B1MA 3C1BB 4CAYB 1S32B 4H9SA 2F8NK 3IP4C 3O62A 1P3IC 5CP6B 1TAFA 3W99C 4J8UB 1B6WA 4ZUXC 3AFAD 5GT3A 3LZ1C 3W98A 3NQUA 3A6NB 3AZLB 3MGPA 3AZIB 1P3PB 3AZJD 3AN2B 5AV8C 3WKJA 5B0YA 5B31G 5B0ZC 1M19B 5B32A 1TAFB 5B2JC 3REKD 3UTAD 3KUYB 4LD9A 4Z5TB 2JE5A 1P3FD 5DNNB 3MGQA 3NQUB 3AZEA 4J8XC 3UTBD 1KX5B 4X23C 2F2AC 1BH8B 3LELD 2Y2MA 5CHLB 5B1MD 5JRGA 2XD5A 1P3LA 1ID3C 3MNND 5BO0A 2DF4C 3O62D 5CPKA 5AVCA 4DRAA 5AV5C 3V9RA 1P3BB 2AROB 5GT3D 3B0CT 5B1LB 1F66B 3MGPD 2L5AA 3KFUG 3WTPC 1M18D 2CV5C 4G92C 4NFTA 3X1VA 5B33B 3WKJD 2NQBA 2IO5C 2Y2GA 4H9OA 5B0YD 1P3LB 1Q9CA 1W2EA 4G91B 5CPKB 1PZRA 5AVCB 5B31D 2Y2NA 3AZJC 1P3GC 3MVDD 5GT0C 3MGQD 3LZ0D 3W97B 3WA9A 1P34C 1HQ3B 3KWQA 3AZED 1WWSA 1M1AA 3TU4A 3AZKB 5GSUA 1U35A 5C3IB 2HUEC 3UTAC 5CPJB 3NQJA 4YS3A 5JRGD 5BNVB 2HIOB 1AOIC 4WU8A 2FJ7A 4JJNB 3UTBC 3EG5B 5E5AD 5FUGA 3WAAC 4Z66A 3LELC 3X1UC 5B1MC 5AV6D 1TZYC 4XZQD 3REHA 5JA4A 3MNNC 4J8WA 3KXBB 4YS3B 1P3AD 2NQBD 5B40A 5AVBC 1KU5A 3W96A 1P3IB 1M18C 3MGRA 3AYWC 3WA9D 3KWQD 2G5HC 1M1AD 3TU4D 3WKJC 3REHB 1U35D 3REJD 5B31C 3A1IA 3X1SA 1KX3A 5B24D 3MVDC 1KX4A 3LZ0C 5KDMA 3AV2D 2YFVA 5CPID 1P3MB 4WJ3C 5B2JB 2FJ7D 5DNMA 1EQZB 1BH9B 2F8NB 4Z66D 3C1BA 1ZLAC
chains in the Genus database with same CATH topology
3UT9D 4CAYA 3B6GC 1S32A 4J8XB 2J8PA 2Y2KA 5F99C 3X1SB 3B6FC 4X23B 5CP6A 4H9PB 5E5AC 3W96D 3LJAB 3A6NA 3RELC 5AV6C 3AZLA 3AZIA 1P3PA 4XZQC 5AV5B 3MGRD 3AN2A 2CWEA 5B2IC 1P3AC 4R8PC 2NQBC 3VH6A 1P3KC 3WTPB 2Y2LA 4G92B 2CV5B 1M19A 3KUYA 3MGSA 4Z5TA 5AV9D 3C1CA 1KX3D 2LY8A 2IO5B 1KX4D 5DNNA 4KGCB 3AV1D 1M1AC 5AY8A 3TU4C 3AZFD 2ZY2A 1P3GB 2ZY4A 1KX5A 3X1TA 3REJC 5GT0B 2Y2HA 2BYKA 1BH8A 1P34B 2W8SA 4YM6C 3C1BD 4QLCB 3AL0C 5B32G 5B24C 4J8VD 1S32D 3AZNC 2FFFB 3MGSB 2HUEB 3AV2C 5G49B 5CPIC 3C1CB 4DQYB 3UTAB 4WU9D 2VQRA 2NZDA 4XUJB 5BT1D 4J8UD 4DRBA 1P3BA 2AROA 5AY8B 3A6ND 5B1LA 1F66A 3AZLD 1AOIB 3AZID 1P3PD 3X1TB 3UT9C 4H9NB 1B67A 1N1JB 3UTBB 2BYKB 4H9RA 4H9QB 3WAAB 3LELB 5B33A 3X1UB 2PYOC 1P3OC 5BS7C 3AZHC 1TZYB 4HGAC 2NZDB 3MNNB 3KUYD 2BYMB 4Z5TD 4NE6A 5DNND 3W97A 5AVBB 3AZGA 3W98D 1HQ3A 2Y2JA 3AZKA 4H9RB 1KX5D 3AZMA 1M18B 3AYWB 5CPJA 5AV9C 3AFAC 5GXQA 5B32D 3REIB 5BNVA 4LD9D 3AV1C 2HIOA 3AZFC 5B31B 4JJNA 3AZGB 4WV4B 3MVDB 1P3BD 2AROD 2ZY5A 5B1LD 3C1BC 1A7WA 1F66D 3AZMB 3H0LC 4J8VC 1S32C 3REKC 3KXBA 5GXQB 2G5IC 4WU9C 1P3FC 3B0DC 5BT1C 1P3LD 4J8UC 1ZLAB 3B6GB 5CPKD 5F99B 3A6NC 5AVCD 3B6FB 3VH5T 3AZIC 1P3IA 3W97D 5E5AB 1HQ3D 2RVQD 4KUDB 4H9SC 3RELB 5AV6B 3O62C 3X1VD 4XZQB 3VH6W 5CPJD 5B2IB 1P3AB 2JCHA 4R8PB 4WNNB 4UUZB 5GT3C 5DNNC 3W98C 1P3KB 3MGPC 2HIOD 1P3MA 4UPKA 5B2JA 3W99B 1EQZA 1BH9A 4ZUXB 2F8NA 3LZ1B 3WTPE 5GSUD 5B0YC 4J8XA 5B32C 3A1KA 5AV8B 4LD9C 4X23A 4YS3D 3KXBD 4CSRB 4YM6B 3MGQC 3EPLA 5B0ZB 4H9PA 5B24B 3AZEC 4WU8D 2BG1A 3LJAA 3AZNB 5CPIB 1P3ID 5AV5A 3R45A 2YFWB 5JRGC 3F6TA 1P3LC 3REHD 4J8WD 3EPJA 4G91C 3WTPA 2CV5A 5CPKC 5AVCC 5B40D 2PYOB 1P3OB 4KGCA 1ID3B 3AZHB 2RVQC 3EPHA 1P3MD 5B2JD 1EQZD 3AZJA 1P3GA 2F8ND 3R45B 5GT0A 3X1VC 5CPJC 1P34A 1WWIA 4QLCA 4J8XD 2ZY3A 5BNXB 2ZM5A 3X1SD 5G49A 3UTAA 4XUJA 3WA9C 3AFAB 3KWQC 4E44A 5GSUC 3LJAD 5DNMD 1R4VA 1U35C 3AZJB 1AOIA 4H9NA 1N1JA 3UTBA 3KXBC 4YS3C 4H9QA 3WAAA 1H3OB 3LELA 4ZBJC 3X1UA 3B0BA 4Z2MG 3WTPD 4J8VB 2CV5D 1JFIB 4WU8C 1TZYA 5CP6D 3REKB 2FJ7C 3MNNA 3KSYA 2BYMA 4WU9B 1P3FB 3B0DB 4Z66C 4KGCD 5AVBA 1Z2CB 3REHC 4J8WC 3AN2D 1P3GD 1M18A 1ULYA 5GT0D 4KHAB 4EO5C 5B1MB 3AYWA 1P34D 4QLCD 4M6BA 5B40C 3W96C 1M19D 3REIA 3O62B 3MGSD 2Y2PA 3C1CD 1P3MC 5B31A 4XUJD 1EQZC 3MGRC 3MVDA 5GT3B 5AY8D 3W98B 3LZ0A 3MGPB 1AOID 3X1TD 1F1EA 4AWLC 3X1SC 1KX3C 3WKJB 3WAAD 3X1UD 5B0YB 1KX4C 2RIQA 1ZLAA 3B0CW 4Z2MH 3B6GA 1TZYD 5B32B 3LJAC 2Y2IA 5F99A 5DNMC 3B6FA 4LD9B 2NZDD 3MGQB 3LZ0B 5E5AA 5AVBD 4E45A 3AZEB 4KUDA 2XD1A 3RELA 5AV6A 5CP6C 4XZQA 5B33D 3AYWD 5B2IA 1P3AA 5JRGB 4R8PA 4WNNA 4UUZA 4KGCC 1P3KA 3REID 3AZLC 5BO0B 1P3PC 3W99A 3AZGD 3V9RB 3AN2C 4ZUXA 3LZ1A 3AZKD 4QLCC 2Y2QA 3AZMD 1M19C 3KUYC 3FDDA 4NE3A 4Z5TC 5AV8A 3MGSC 3VH5W 4CSRA 2DQNC 3C1CC 5GXQD 3REJA 3X1VB 4XUJC 4H9OB 4YM6A 2NQBB 5B0ZA 1ZLAD 5B24A 3B6GD 5AY8C 2F8NG 5F99D 4JJND 3AZNA 3B6FD 3AV2A 1KX5C 5CPIA 3VH6T 3X1TC 1HTAA 3H0MC 3WA9B 3KWQB 1M1AB 3TU4B 4KUDD 5GSUB 2YFWA 3RELD 1U35B 3UT9A 3REJB 2Y2OA 1BFMA 2NZDC 3NQJB 5B2ID 4R8PD 4ZBJB 2AROC 1P3BC 1P3OA 2PYOA 5BS7A 1ID3A 5B1LC 1P3KD 1F66C 3AV2B 3AZHA 4WU8B 2FJ7B 3P5JB 3W99D 4ZUXD 5FUGB 4Z66B 3LZ1D 5B33C 4NE5A 3UT9B 5JA4B 5BNXA 4WZSB 4J8WB 3REIC 5AV8D 4EO5B 4YM6D 5B40B 3AZGC 3W97C 5B0ZD 5AV9A 1HQ3C 3AFAA 3W96B 4HGAB 3AZKC 2F8NH 3AZND 3AV1A 3AZFA 5C3IC 3AZMC 3MGRB 3H0RC 1H3OA 1T3UA 3VH5A 5GXQC 4X23D 4J8VA 2HIOC 2JSSA 1JFIA 3EPKA 3REKA 4JJNC 4AWLB 5AV9B 1KX3B 4WU9A 1P3FA 1KX4B 2UWXA 1P3OD 2PYOD 4J8UA 1ID3D 5KDMB 3AZHD 3AV1B 2YFVB 3AZFB 4KUDC 5DNMB 5AV5D 4KHAA 5B1MA 3C1BB 4CAYB 1S32B 4H9SA 2F8NK 3IP4C 3O62A 1P3IC 5CP6B 1TAFA 3W99C 4J8UB 1B6WA 4ZUXC 3AFAD 5GT3A 3LZ1C 3W98A 3NQUA 3A6NB 3AZLB 3MGPA 3AZIB 1P3PB 3AZJD 3AN2B 5AV8C 3WKJA 5B0YA 5B31G 5B0ZC 1M19B 5B32A 1TAFB 5B2JC 3REKD 3UTAD 3KUYB 4LD9A 4Z5TB 2JE5A 1P3FD 5DNNB 3MGQA 3NQUB 3AZEA 4J8XC 3UTBD 1KX5B 4X23C 2F2AC 1BH8B 3LELD 2Y2MA 5CHLB 5B1MD 5JRGA 2XD5A 1P3LA 1ID3C 3MNND 5BO0A 2DF4C 3O62D 5CPKA 5AVCA 4DRAA 5AV5C 3V9RA 1P3BB 2AROB 5GT3D 3B0CT 5B1LB 1F66B 3MGPD 2L5AA 3KFUG 3WTPC 1M18D 2CV5C 4G92C 4NFTA 3X1VA 5B33B 3WKJD 2NQBA 2IO5C 2Y2GA 4H9OA 5B0YD 1P3LB 1Q9CA 1W2EA 4G91B 5CPKB 1PZRA 5AVCB 5B31D 2Y2NA 3AZJC 1P3GC 3MVDD 5GT0C 3MGQD 3LZ0D 3W97B 3WA9A 1P34C 1HQ3B 3KWQA 3AZED 1WWSA 1M1AA 3TU4A 3AZKB 5GSUA 1U35A 5C3IB 2HUEC 3UTAC 5CPJB 3NQJA 4YS3A 5JRGD 5BNVB 2HIOB 1AOIC 4WU8A 2FJ7A 4JJNB 3UTBC 3EG5B 5E5AD 5FUGA 3WAAC 4Z66A 3LELC 3X1UC 5B1MC 5AV6D 1TZYC 4XZQD 3REHA 5JA4A 3MNNC 4J8WA 3KXBB 4YS3B 1P3AD 2NQBD 5B40A 5AVBC 1KU5A 3W96A 1P3IB 1M18C 3MGRA 3AYWC 3WA9D 3KWQD 2G5HC 1M1AD 3TU4D 3WKJC 3REHB 1U35D 3REJD 5B31C 3A1IA 3X1SA 1KX3A 5B24D 3MVDC 1KX4A 3LZ0C 5KDMA 3AV2D 2YFVA 5CPID 1P3MB 4WJ3C 5B2JB 2FJ7D 5DNMA 1EQZB 1BH9B 2F8NB 4Z66D 3C1BA 1ZLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT9 D;  4CAY A;  3B6G C;  1S32 A;  4J8X B;  5F99 C;  3X1S B;  3B6F C;  4X23 B;  5CP6 A;  4H9P B;  5E5A C;  3W96 D;  3LJA B;  3A6N A;  3REL C;  5AV6 C;  3AZL A;  3AZI A;  1P3P A;  4XZQ C;  5AV5 B;  3MGR D;  3AN2 A;  2CWE A;  5B2I C;  1P3A C;  4R8P C;  2NQB C;  3VH6 A;  1P3K C;  3WTP B;  2CV5 B;  4G92 B;  1M19 A;  3KUY A;  3MGS A;  4Z5T A;  5AV9 D;  3C1C A;  1KX3 D;  2LY8 A;  2IO5 B;  1KX4 D;  5DNN A;  4KGC B;  3AV1 D;  1M1A C;  5AY8 A;  3TU4 C;  3AZF D;  1P3G B;  1KX5 A;  3X1T A;  3REJ C;  5GT0 B;  2BYK A;  1BH8 A;  1P34 B;  4YM6 C;  3C1B D;  4QLC B;  5B32 G;  5B24 C;  4J8V D;  1S32 D;  3AZN C;  3MGS B;  2HUE B;  3AV2 C;  5G49 B;  5CPI C;  3C1C B;  2NZD A;  3UTA B;  4WU9 D;  4XUJ B;  5BT1 D;  4J8U D;  4DRB A;  1P3B A;  2ARO A;  5AY8 B;  3A6N D;  5B1L A;  1F66 A;  3AZL D;  1AOI B;  3AZI D;  1P3P D;  3X1T B;  3UT9 C;  4H9N B;  1B67 A;  1N1J B;  3UTB B;  2BYK B;  4H9R A;  4H9Q B;  3WAA B;  3LEL B;  5B33 A;  3X1U B;  2PYO C;  1P3O C;  5BS7 C;  3AZH C;  1TZY B;  4HGA C;  2NZD B;  3MNN B;  3KUY D;  2BYM B;  4Z5T D;  4NE6 A;  5DNN D;  3W97 A;  5AVB B;  3AZG A;  3W98 D;  1HQ3 A;  3AZK A;  4H9R B;  1KX5 D;  3AZM A;  1M18 B;  3AYW B;  5CPJ A;  5AV9 C;  3AFA C;  5GXQ A;  5B32 D;  3REI B;  5BNV A;  4LD9 D;  3AV1 C;  2HIO A;  3AZF C;  5B31 B;  4JJN A;  3AZG B;  4WV4 B;  3MVD B;  1P3B D;  2ARO D;  5B1L D;  3C1B C;  1A7W A;  1F66 D;  3AZM B;  4J8V C;  1S32 C;  3REK C;  3KXB A;  5GXQ B;  4WU9 C;  1P3F C;  3B0D C;  5BT1 C;  1P3L D;  4J8U C;  1ZLA B;  3B6G B;  5CPK D;  5F99 B;  3A6N C;  5AVC D;  3B6F B;  3VH5 T;  3AZI C;  1P3I A;  3W97 D;  5E5A B;  1HQ3 D;  2RVQ D;  4KUD B;  4H9S C;  3REL B;  5AV6 B;  3O62 C;  3X1V D;  4XZQ B;  3VH6 W;  5CPJ D;  5B2I B;  1P3A B;  4R8P B;  4WNN B;  4UUZ B;  5GT3 C;  5DNN C;  3W98 C;  1P3K B;  3MGP C;  2HIO D;  1P3M A;  5B2J A;  3W99 B;  1EQZ A;  1BH9 A;  4ZUX B;  2F8N A;  3LZ1 B;  3WTP E;  5GSU D;  5B0Y C;  4J8X A;  5B32 C;  5AV8 B;  4LD9 C;  4X23 A;  4YS3 D;  3KXB D;  4CSR B;  4YM6 B;  3MGQ C;  5B0Z B;  4H9P A;  5B24 B;  3AZE C;  4WU8 D;  3LJA A;  3AZN B;  5CPI B;  1P3I D;  5AV5 A;  3R45 A;  2YFW B;  5JRG C;  1P3L C;  3REH D;  4J8W D;  4G91 C;  3WTP A;  2CV5 A;  5CPK C;  5AVC C;  5B40 D;  2PYO B;  1P3O B;  4KGC A;  1ID3 B;  3AZH B;  2RVQ C;  1P3M D;  5B2J D;  1EQZ D;  3AZJ A;  1P3G A;  2F8N D;  3R45 B;  5GT0 A;  3X1V C;  5CPJ C;  1P34 A;  1WWI A;  4QLC A;  4J8X D;  5BNX B;  3X1S D;  5G49 A;  3UTA A;  4XUJ A;  3WA9 C;  3AFA B;  3KWQ C;  4E44 A;  5GSU C;  3LJA D;  5DNM D;  1R4V A;  1U35 C;  3AZJ B;  1AOI A;  4H9N A;  1N1J A;  3UTB A;  3KXB C;  4YS3 C;  4H9Q A;  3WAA A;  1H3O B;  3LEL A;  4ZBJ C;  3X1U A;  3B0B A;  4Z2M G;  3WTP D;  4J8V B;  2CV5 D;  1JFI B;  4WU8 C;  1TZY A;  5CP6 D;  3REK B;  2FJ7 C;  3MNN A;  3KSY A;  2BYM A;  4WU9 B;  1P3F B;  3B0D B;  4Z66 C;  4KGC D;  5AVB A;  3REH C;  4J8W C;  3AN2 D;  1P3G D;  1M18 A;  1ULY A;  5GT0 D;  4KHA B;  4EO5 C;  5B1M B;  3AYW A;  1P34 D;  4QLC D;  4M6B A;  5B40 C;  3W96 C;  1M19 D;  3REI A;  3O62 B;  3MGS D;  3C1C D;  1P3M C;  5B31 A;  4XUJ D;  1EQZ C;  3MGR C;  3MVD A;  5GT3 B;  5AY8 D;  3W98 B;  3LZ0 A;  3MGP B;  1AOI D;  3X1T D;  1F1E A;  4AWL C;  3X1S C;  1KX3 C;  3WKJ B;  3WAA D;  3X1U D;  5B0Y B;  1KX4 C;  1ZLA A;  3B0C W;  4Z2M H;  3B6G A;  1TZY D;  5B32 B;  3LJA C;  5F99 A;  5DNM C;  2NZD D;  3B6F A;  4LD9 B;  3MGQ B;  3LZ0 B;  5E5A A;  5AVB D;  4E45 A;  3AZE B;  4KUD A;  3REL A;  5AV6 A;  5CP6 C;  4XZQ A;  5B33 D;  3AYW D;  5B2I A;  1P3A A;  5JRG B;  4R8P A;  4WNN A;  4UUZ A;  4KGC C;  1P3K A;  3REI D;  3AZL C;  5BO0 B;  1P3P C;  3W99 A;  3AZG D;  3V9R B;  3AN2 C;  4ZUX A;  3LZ1 A;  3AZK D;  4QLC C;  3AZM D;  1M19 C;  3KUY C;  5AV8 A;  4NE3 A;  4Z5T C;  3MGS C;  3REJ A;  3VH5 W;  4CSR A;  3C1C C;  3X1V B;  5GXQ D;  2NQB B;  4XUJ C;  4H9O B;  4YM6 A;  5B0Z A;  1ZLA D;  5B24 A;  3B6G D;  5AY8 C;  2F8N G;  5F99 D;  4JJN D;  3AZN A;  3B6F D;  3AV2 A;  1KX5 C;  5CPI A;  3VH6 T;  3X1T C;  1HTA A;  3WA9 B;  3KWQ B;  1M1A B;  3TU4 B;  4KUD D;  5GSU B;  2YFW A;  3REL D;  1U35 B;  3UT9 A;  3REJ B;  1BFM A;  2NZD C;  3NQJ B;  5B2I D;  4R8P D;  4ZBJ B;  2ARO C;  1P3B C;  1P3O A;  2PYO A;  5BS7 A;  1ID3 A;  5B1L C;  1P3K D;  1F66 C;  3AV2 B;  3AZH A;  4WU8 B;  2FJ7 B;  3W99 D;  4ZUX D;  5FUG B;  4Z66 B;  3LZ1 D;  5B33 C;  4NE5 A;  3UT9 B;  5JA4 B;  5BNX A;  4WZS B;  4J8W B;  3REI C;  5AV8 D;  4EO5 B;  4YM6 D;  5B40 B;  3AZG C;  3W97 C;  5B0Z D;  5AV9 A;  1HQ3 C;  3AFA A;  3W96 B;  4HGA B;  3AZK C;  2F8N H;  3AZN D;  3AV1 A;  3AZF A;  5C3I C;  3AZM C;  3MGR B;  1H3O A;  3VH5 A;  5GXQ C;  4X23 D;  4J8V A;  2HIO C;  2JSS A;  1JFI A;  3REK A;  4JJN C;  4AWL B;  5AV9 B;  1KX3 B;  4WU9 A;  1P3F A;  1KX4 B;  2PYO D;  1P3O D;  4J8U A;  1ID3 D;  5KDM B;  3AZH D;  3AV1 B;  2YFV B;  3AZF B;  4KUD C;  5DNM B;  5AV5 D;  4KHA A;  5B1M A;  3C1B B;  4CAY B;  1S32 B;  4H9S A;  2F8N K;  3O62 A;  1P3I C;  5CP6 B;  1TAF A;  3W99 C;  4J8U B;  1B6W A;  4ZUX C;  3AFA D;  5GT3 A;  3LZ1 C;  3W98 A;  3NQU A;  3A6N B;  3AZL B;  3MGP A;  3AZI B;  1P3P B;  3AZJ D;  3AN2 B;  5AV8 C;  3WKJ A;  5B0Y A;  5B31 G;  5B0Z C;  1M19 B;  5B32 A;  1TAF B;  5B2J C;  3REK D;  3UTA D;  3KUY B;  4LD9 A;  4Z5T B;  1P3F D;  5DNN B;  3MGQ A;  3NQU B;  3AZE A;  4J8X C;  3UTB D;  1KX5 B;  4X23 C;  1BH8 B;  3LEL D;  5CHL B;  5B1M D;  5JRG A;  1P3L A;  1ID3 C;  3MNN D;  5BO0 A;  3O62 D;  5CPK A;  5AVC A;  4DRA A;  5AV5 C;  3V9R A;  1P3B B;  2ARO B;  5GT3 D;  3B0C T;  5B1L B;  1F66 B;  3MGP D;  2L5A A;  3WTP C;  1M18 D;  2CV5 C;  4G92 C;  4NFT A;  3X1V A;  5B33 B;  3WKJ D;  2NQB A;  2IO5 C;  5B0Y D;  4H9O A;  1P3L B;  1Q9C A;  4G91 B;  5CPK B;  5AVC B;  5B31 D;  3AZJ C;  1P3G C;  3MVD D;  5GT0 C;  3MGQ D;  3LZ0 D;  3W97 B;  3WA9 A;  1P34 C;  1HQ3 B;  3KWQ A;  3AZE D;  1WWS A;  1M1A A;  3TU4 A;  3AZK B;  5GSU A;  1U35 A;  5C3I B;  2HUE C;  3UTA C;  5CPJ B;  3NQJ A;  4YS3 A;  5JRG D;  5BNV B;  2HIO B;  1AOI C;  4WU8 A;  2FJ7 A;  4JJN B;  3UTB C;  5E5A D;  5FUG A;  3WAA C;  4Z66 A;  3LEL C;  3X1U C;  5B1M C;  5AV6 D;  1TZY C;  4XZQ D;  3REH A;  5JA4 A;  3MNN C;  4J8W A;  3KXB B;  4YS3 B;  1P3A D;  2NQB D;  5B40 A;  5AVB C;  1KU5 A;  3W96 A;  1P3I B;  1M18 C;  3MGR A;  3AYW C;  3WA9 D;  3KWQ D;  1M1A D;  3TU4 D;  3WKJ C;  3REH B;  1U35 D;  3REJ D;  5B31 C;  3X1S A;  1KX3 A;  5B24 D;  3MVD C;  1KX4 A;  3LZ0 C;  5KDM A;  3AV2 D;  2YFV A;  5CPI D;  1P3M B;  5B2J B;  2FJ7 D;  5DNM A;  1EQZ B;  1BH9 B;  2F8N B;  4Z66 D;  3C1B A;  1ZLA C; 
#chains in the Genus database with same CATH topology
 3UT9 D;  4CAY A;  3B6G C;  1S32 A;  4J8X B;  2J8P A;  2Y2K A;  5F99 C;  3X1S B;  3B6F C;  4X23 B;  5CP6 A;  4H9P B;  5E5A C;  3W96 D;  3LJA B;  3A6N A;  3REL C;  5AV6 C;  3AZL A;  3AZI A;  1P3P A;  4XZQ C;  5AV5 B;  3MGR D;  3AN2 A;  2CWE A;  5B2I C;  1P3A C;  4R8P C;  2NQB C;  3VH6 A;  1P3K C;  3WTP B;  2Y2L A;  4G92 B;  2CV5 B;  1M19 A;  3KUY A;  3MGS A;  4Z5T A;  5AV9 D;  3C1C A;  1KX3 D;  2LY8 A;  2IO5 B;  1KX4 D;  5DNN A;  4KGC B;  3AV1 D;  1M1A C;  5AY8 A;  3TU4 C;  3AZF D;  2ZY2 A;  1P3G B;  2ZY4 A;  1KX5 A;  3X1T A;  3REJ C;  5GT0 B;  2Y2H A;  2BYK A;  1BH8 A;  1P34 B;  2W8S A;  4YM6 C;  3C1B D;  4QLC B;  3AL0 C;  5B32 G;  5B24 C;  4J8V D;  1S32 D;  3AZN C;  2FFF B;  3MGS B;  2HUE B;  3AV2 C;  5G49 B;  5CPI C;  3C1C B;  4DQY B;  3UTA B;  4WU9 D;  2VQR A;  2NZD A;  4XUJ B;  5BT1 D;  4J8U D;  4DRB A;  1P3B A;  2ARO A;  5AY8 B;  3A6N D;  5B1L A;  1F66 A;  3AZL D;  1AOI B;  3AZI D;  1P3P D;  3X1T B;  3UT9 C;  4H9N B;  1B67 A;  1N1J B;  3UTB B;  2BYK B;  4H9R A;  4H9Q B;  3WAA B;  3LEL B;  5B33 A;  3X1U B;  2PYO C;  1P3O C;  5BS7 C;  3AZH C;  1TZY B;  4HGA C;  2NZD B;  3MNN B;  3KUY D;  2BYM B;  4Z5T D;  4NE6 A;  5DNN D;  3W97 A;  5AVB B;  3AZG A;  3W98 D;  1HQ3 A;  2Y2J A;  3AZK A;  4H9R B;  1KX5 D;  3AZM A;  1M18 B;  3AYW B;  5CPJ A;  5AV9 C;  3AFA C;  5GXQ A;  5B32 D;  3REI B;  5BNV A;  4LD9 D;  3AV1 C;  2HIO A;  3AZF C;  5B31 B;  4JJN A;  3AZG B;  4WV4 B;  3MVD B;  1P3B D;  2ARO D;  2ZY5 A;  5B1L D;  3C1B C;  1A7W A;  1F66 D;  3AZM B;  3H0L C;  4J8V C;  1S32 C;  3REK C;  3KXB A;  5GXQ B;  2G5I C;  4WU9 C;  1P3F C;  3B0D C;  5BT1 C;  1P3L D;  4J8U C;  1ZLA B;  3B6G B;  5CPK D;  5F99 B;  3A6N C;  5AVC D;  3B6F B;  3VH5 T;  3AZI C;  1P3I A;  3W97 D;  5E5A B;  1HQ3 D;  2RVQ D;  4KUD B;  4H9S C;  3REL B;  5AV6 B;  3O62 C;  3X1V D;  4XZQ B;  3VH6 W;  5CPJ D;  5B2I B;  1P3A B;  2JCH A;  4R8P B;  4WNN B;  4UUZ B;  5GT3 C;  5DNN C;  3W98 C;  1P3K B;  3MGP C;  2HIO D;  1P3M A;  4UPK A;  5B2J A;  3W99 B;  1EQZ A;  1BH9 A;  4ZUX B;  2F8N A;  3LZ1 B;  3WTP E;  5GSU D;  5B0Y C;  4J8X A;  5B32 C;  3A1K A;  5AV8 B;  4LD9 C;  4X23 A;  4YS3 D;  3KXB D;  4CSR B;  4YM6 B;  3MGQ C;  3EPL A;  5B0Z B;  4H9P A;  5B24 B;  3AZE C;  4WU8 D;  2BG1 A;  3LJA A;  3AZN B;  5CPI B;  1P3I D;  5AV5 A;  3R45 A;  2YFW B;  5JRG C;  3F6T A;  1P3L C;  3REH D;  4J8W D;  3EPJ A;  4G91 C;  3WTP A;  2CV5 A;  5CPK C;  5AVC C;  5B40 D;  2PYO B;  1P3O B;  4KGC A;  1ID3 B;  3AZH B;  2RVQ C;  3EPH A;  1P3M D;  5B2J D;  1EQZ D;  3AZJ A;  1P3G A;  2F8N D;  3R45 B;  5GT0 A;  3X1V C;  5CPJ C;  1P34 A;  1WWI A;  4QLC A;  4J8X D;  2ZY3 A;  5BNX B;  2ZM5 A;  3X1S D;  5G49 A;  3UTA A;  4XUJ A;  3WA9 C;  3AFA B;  3KWQ C;  4E44 A;  5GSU C;  3LJA D;  5DNM D;  1R4V A;  1U35 C;  3AZJ B;  1AOI A;  4H9N A;  1N1J A;  3UTB A;  3KXB C;  4YS3 C;  4H9Q A;  3WAA A;  1H3O B;  3LEL A;  4ZBJ C;  3X1U A;  3B0B A;  4Z2M G;  3WTP D;  4J8V B;  2CV5 D;  1JFI B;  4WU8 C;  1TZY A;  5CP6 D;  3REK B;  2FJ7 C;  3MNN A;  3KSY A;  2BYM A;  4WU9 B;  1P3F B;  3B0D B;  4Z66 C;  4KGC D;  5AVB A;  1Z2C B;  3REH C;  4J8W C;  3AN2 D;  1P3G D;  1M18 A;  1ULY A;  5GT0 D;  4KHA B;  4EO5 C;  5B1M B;  3AYW A;  1P34 D;  4QLC D;  4M6B A;  5B40 C;  3W96 C;  1M19 D;  3REI A;  3O62 B;  3MGS D;  2Y2P A;  3C1C D;  1P3M C;  5B31 A;  4XUJ D;  1EQZ C;  3MGR C;  3MVD A;  5GT3 B;  5AY8 D;  3W98 B;  3LZ0 A;  3MGP B;  1AOI D;  3X1T D;  1F1E A;  4AWL C;  3X1S C;  1KX3 C;  3WKJ B;  3WAA D;  3X1U D;  5B0Y B;  1KX4 C;  2RIQ A;  1ZLA A;  3B0C W;  4Z2M H;  3B6G A;  1TZY D;  5B32 B;  3LJA C;  2Y2I A;  5F99 A;  5DNM C;  3B6F A;  4LD9 B;  2NZD D;  3MGQ B;  3LZ0 B;  5E5A A;  5AVB D;  4E45 A;  3AZE B;  4KUD A;  2XD1 A;  3REL A;  5AV6 A;  5CP6 C;  4XZQ A;  5B33 D;  3AYW D;  5B2I A;  1P3A A;  5JRG B;  4R8P A;  4WNN A;  4UUZ A;  4KGC C;  1P3K A;  3REI D;  3AZL C;  5BO0 B;  1P3P C;  3W99 A;  3AZG D;  3V9R B;  3AN2 C;  4ZUX A;  3LZ1 A;  3AZK D;  4QLC C;  2Y2Q A;  3AZM D;  1M19 C;  3KUY C;  3FDD A;  4NE3 A;  4Z5T C;  5AV8 A;  3MGS C;  3VH5 W;  4CSR A;  2DQN C;  3C1C C;  5GXQ D;  3REJ A;  3X1V B;  4XUJ C;  4H9O B;  4YM6 A;  2NQB B;  5B0Z A;  1ZLA D;  5B24 A;  3B6G D;  5AY8 C;  2F8N G;  5F99 D;  4JJN D;  3AZN A;  3B6F D;  3AV2 A;  1KX5 C;  5CPI A;  3VH6 T;  3X1T C;  1HTA A;  3H0M C;  3WA9 B;  3KWQ B;  1M1A B;  3TU4 B;  4KUD D;  5GSU B;  2YFW A;  3REL D;  1U35 B;  3UT9 A;  3REJ B;  2Y2O A;  1BFM A;  2NZD C;  3NQJ B;  5B2I D;  4R8P D;  4ZBJ B;  2ARO C;  1P3B C;  1P3O A;  2PYO A;  5BS7 A;  1ID3 A;  5B1L C;  1P3K D;  1F66 C;  3AV2 B;  3AZH A;  4WU8 B;  2FJ7 B;  3P5J B;  3W99 D;  4ZUX D;  5FUG B;  4Z66 B;  3LZ1 D;  5B33 C;  4NE5 A;  3UT9 B;  5JA4 B;  5BNX A;  4WZS B;  4J8W B;  3REI C;  5AV8 D;  4EO5 B;  4YM6 D;  5B40 B;  3AZG C;  3W97 C;  5B0Z D;  5AV9 A;  1HQ3 C;  3AFA A;  3W96 B;  4HGA B;  3AZK C;  2F8N H;  3AZN D;  3AV1 A;  3AZF A;  5C3I C;  3AZM C;  3MGR B;  3H0R C;  1H3O A;  1T3U A;  3VH5 A;  5GXQ C;  4X23 D;  4J8V A;  2HIO C;  2JSS A;  1JFI A;  3EPK A;  3REK A;  4JJN C;  4AWL B;  5AV9 B;  1KX3 B;  4WU9 A;  1P3F A;  1KX4 B;  2UWX A;  1P3O D;  2PYO D;  4J8U A;  1ID3 D;  5KDM B;  3AZH D;  3AV1 B;  2YFV B;  3AZF B;  4KUD C;  5DNM B;  5AV5 D;  4KHA A;  5B1M A;  3C1B B;  4CAY B;  1S32 B;  4H9S A;  2F8N K;  3IP4 C;  3O62 A;  1P3I C;  5CP6 B;  1TAF A;  3W99 C;  4J8U B;  1B6W A;  4ZUX C;  3AFA D;  5GT3 A;  3LZ1 C;  3W98 A;  3NQU A;  3A6N B;  3AZL B;  3MGP A;  3AZI B;  1P3P B;  3AZJ D;  3AN2 B;  5AV8 C;  3WKJ A;  5B0Y A;  5B31 G;  5B0Z C;  1M19 B;  5B32 A;  1TAF B;  5B2J C;  3REK D;  3UTA D;  3KUY B;  4LD9 A;  4Z5T B;  2JE5 A;  1P3F D;  5DNN B;  3MGQ A;  3NQU B;  3AZE A;  4J8X C;  3UTB D;  1KX5 B;  4X23 C;  2F2A C;  1BH8 B;  3LEL D;  2Y2M A;  5CHL B;  5B1M D;  5JRG A;  2XD5 A;  1P3L A;  1ID3 C;  3MNN D;  5BO0 A;  2DF4 C;  3O62 D;  5CPK A;  5AVC A;  4DRA A;  5AV5 C;  3V9R A;  1P3B B;  2ARO B;  5GT3 D;  3B0C T;  5B1L B;  1F66 B;  3MGP D;  2L5A A;  3KFU G;  3WTP C;  1M18 D;  2CV5 C;  4G92 C;  4NFT A;  3X1V A;  5B33 B;  3WKJ D;  2NQB A;  2IO5 C;  2Y2G A;  4H9O A;  5B0Y D;  1P3L B;  1Q9C A;  1W2E A;  4G91 B;  5CPK B;  1PZR A;  5AVC B;  5B31 D;  2Y2N A;  3AZJ C;  1P3G C;  3MVD D;  5GT0 C;  3MGQ D;  3LZ0 D;  3W97 B;  3WA9 A;  1P34 C;  1HQ3 B;  3KWQ A;  3AZE D;  1WWS A;  1M1A A;  3TU4 A;  3AZK B;  5GSU A;  1U35 A;  5C3I B;  2HUE C;  3UTA C;  5CPJ B;  3NQJ A;  4YS3 A;  5JRG D;  5BNV B;  2HIO B;  1AOI C;  4WU8 A;  2FJ7 A;  4JJN B;  3UTB C;  3EG5 B;  5E5A D;  5FUG A;  3WAA C;  4Z66 A;  3LEL C;  3X1U C;  5B1M C;  5AV6 D;  1TZY C;  4XZQ D;  3REH A;  5JA4 A;  3MNN C;  4J8W A;  3KXB B;  4YS3 B;  1P3A D;  2NQB D;  5B40 A;  5AVB C;  1KU5 A;  3W96 A;  1P3I B;  1M18 C;  3MGR A;  3AYW C;  3WA9 D;  3KWQ D;  2G5H C;  1M1A D;  3TU4 D;  3WKJ C;  3REH B;  1U35 D;  3REJ D;  5B31 C;  3A1I A;  3X1S A;  1KX3 A;  5B24 D;  3MVD C;  1KX4 A;  3LZ0 C;  5KDM A;  3AV2 D;  2YFV A;  5CPI D;  1P3M B;  4WJ3 C;  5B2J B;  2FJ7 D;  5DNM A;  1EQZ B;  1BH9 B;  2F8N B;  4Z66 D;  3C1B A;  1ZLA C; 
#chains in the Genus database with same CATH homology
 3UT9 D;  4CAY A;  3B6G C;  1S32 A;  4J8X B;  2J8P A;  2Y2K A;  5F99 C;  3X1S B;  3B6F C;  4X23 B;  5CP6 A;  4H9P B;  5E5A C;  3W96 D;  3LJA B;  3A6N A;  3REL C;  5AV6 C;  3AZL A;  3AZI A;  1P3P A;  4XZQ C;  5AV5 B;  3MGR D;  3AN2 A;  2CWE A;  5B2I C;  1P3A C;  4R8P C;  2NQB C;  3VH6 A;  1P3K C;  3WTP B;  2Y2L A;  4G92 B;  2CV5 B;  1M19 A;  3KUY A;  3MGS A;  4Z5T A;  5AV9 D;  3C1C A;  1KX3 D;  2LY8 A;  2IO5 B;  1KX4 D;  5DNN A;  4KGC B;  3AV1 D;  1M1A C;  5AY8 A;  3TU4 C;  3AZF D;  2ZY2 A;  1P3G B;  2ZY4 A;  1KX5 A;  3X1T A;  3REJ C;  5GT0 B;  2Y2H A;  2BYK A;  1BH8 A;  1P34 B;  2W8S A;  4YM6 C;  3C1B D;  4QLC B;  3AL0 C;  5B32 G;  5B24 C;  4J8V D;  1S32 D;  3AZN C;  2FFF B;  3MGS B;  2HUE B;  3AV2 C;  5G49 B;  5CPI C;  3C1C B;  4DQY B;  3UTA B;  4WU9 D;  2VQR A;  2NZD A;  4XUJ B;  5BT1 D;  4J8U D;  4DRB A;  1P3B A;  2ARO A;  5AY8 B;  3A6N D;  5B1L A;  1F66 A;  3AZL D;  1AOI B;  3AZI D;  1P3P D;  3X1T B;  3UT9 C;  4H9N B;  1B67 A;  1N1J B;  3UTB B;  2BYK B;  4H9R A;  4H9Q B;  3WAA B;  3LEL B;  5B33 A;  3X1U B;  2PYO C;  1P3O C;  5BS7 C;  3AZH C;  1TZY B;  4HGA C;  2NZD B;  3MNN B;  3KUY D;  2BYM B;  4Z5T D;  4NE6 A;  5DNN D;  3W97 A;  5AVB B;  3AZG A;  3W98 D;  1HQ3 A;  2Y2J A;  3AZK A;  4H9R B;  1KX5 D;  3AZM A;  1M18 B;  3AYW B;  5CPJ A;  5AV9 C;  3AFA C;  5GXQ A;  5B32 D;  3REI B;  5BNV A;  4LD9 D;  3AV1 C;  2HIO A;  3AZF C;  5B31 B;  4JJN A;  3AZG B;  4WV4 B;  3MVD B;  1P3B D;  2ARO D;  2ZY5 A;  5B1L D;  3C1B C;  1A7W A;  1F66 D;  3AZM B;  3H0L C;  4J8V C;  1S32 C;  3REK C;  3KXB A;  5GXQ B;  2G5I C;  4WU9 C;  1P3F C;  3B0D C;  5BT1 C;  1P3L D;  4J8U C;  1ZLA B;  3B6G B;  5CPK D;  5F99 B;  3A6N C;  5AVC D;  3B6F B;  3VH5 T;  3AZI C;  1P3I A;  3W97 D;  5E5A B;  1HQ3 D;  2RVQ D;  4KUD B;  4H9S C;  3REL B;  5AV6 B;  3O62 C;  3X1V D;  4XZQ B;  3VH6 W;  5CPJ D;  5B2I B;  1P3A B;  2JCH A;  4R8P B;  4WNN B;  4UUZ B;  5GT3 C;  5DNN C;  3W98 C;  1P3K B;  3MGP C;  2HIO D;  1P3M A;  4UPK A;  5B2J A;  3W99 B;  1EQZ A;  1BH9 A;  4ZUX B;  2F8N A;  3LZ1 B;  3WTP E;  5GSU D;  5B0Y C;  4J8X A;  5B32 C;  3A1K A;  5AV8 B;  4LD9 C;  4X23 A;  4YS3 D;  3KXB D;  4CSR B;  4YM6 B;  3MGQ C;  3EPL A;  5B0Z B;  4H9P A;  5B24 B;  3AZE C;  4WU8 D;  2BG1 A;  3LJA A;  3AZN B;  5CPI B;  1P3I D;  5AV5 A;  3R45 A;  2YFW B;  5JRG C;  3F6T A;  1P3L C;  3REH D;  4J8W D;  3EPJ A;  4G91 C;  3WTP A;  2CV5 A;  5CPK C;  5AVC C;  5B40 D;  2PYO B;  1P3O B;  4KGC A;  1ID3 B;  3AZH B;  2RVQ C;  3EPH A;  1P3M D;  5B2J D;  1EQZ D;  3AZJ A;  1P3G A;  2F8N D;  3R45 B;  5GT0 A;  3X1V C;  5CPJ C;  1P34 A;  1WWI A;  4QLC A;  4J8X D;  2ZY3 A;  5BNX B;  2ZM5 A;  3X1S D;  5G49 A;  3UTA A;  4XUJ A;  3WA9 C;  3AFA B;  3KWQ C;  4E44 A;  5GSU C;  3LJA D;  5DNM D;  1R4V A;  1U35 C;  3AZJ B;  1AOI A;  4H9N A;  1N1J A;  3UTB A;  3KXB C;  4YS3 C;  4H9Q A;  3WAA A;  1H3O B;  3LEL A;  4ZBJ C;  3X1U A;  3B0B A;  4Z2M G;  3WTP D;  4J8V B;  2CV5 D;  1JFI B;  4WU8 C;  1TZY A;  5CP6 D;  3REK B;  2FJ7 C;  3MNN A;  3KSY A;  2BYM A;  4WU9 B;  1P3F B;  3B0D B;  4Z66 C;  4KGC D;  5AVB A;  1Z2C B;  3REH C;  4J8W C;  3AN2 D;  1P3G D;  1M18 A;  1ULY A;  5GT0 D;  4KHA B;  4EO5 C;  5B1M B;  3AYW A;  1P34 D;  4QLC D;  4M6B A;  5B40 C;  3W96 C;  1M19 D;  3REI A;  3O62 B;  3MGS D;  2Y2P A;  3C1C D;  1P3M C;  5B31 A;  4XUJ D;  1EQZ C;  3MGR C;  3MVD A;  5GT3 B;  5AY8 D;  3W98 B;  3LZ0 A;  3MGP B;  1AOI D;  3X1T D;  1F1E A;  4AWL C;  3X1S C;  1KX3 C;  3WKJ B;  3WAA D;  3X1U D;  5B0Y B;  1KX4 C;  2RIQ A;  1ZLA A;  3B0C W;  4Z2M H;  3B6G A;  1TZY D;  5B32 B;  3LJA C;  2Y2I A;  5F99 A;  5DNM C;  3B6F A;  4LD9 B;  2NZD D;  3MGQ B;  3LZ0 B;  5E5A A;  5AVB D;  4E45 A;  3AZE B;  4KUD A;  2XD1 A;  3REL A;  5AV6 A;  5CP6 C;  4XZQ A;  5B33 D;  3AYW D;  5B2I A;  1P3A A;  5JRG B;  4R8P A;  4WNN A;  4UUZ A;  4KGC C;  1P3K A;  3REI D;  3AZL C;  5BO0 B;  1P3P C;  3W99 A;  3AZG D;  3V9R B;  3AN2 C;  4ZUX A;  3LZ1 A;  3AZK D;  4QLC C;  2Y2Q A;  3AZM D;  1M19 C;  3KUY C;  3FDD A;  4NE3 A;  4Z5T C;  5AV8 A;  3MGS C;  3VH5 W;  4CSR A;  2DQN C;  3C1C C;  5GXQ D;  3REJ A;  3X1V B;  4XUJ C;  4H9O B;  4YM6 A;  2NQB B;  5B0Z A;  1ZLA D;  5B24 A;  3B6G D;  5AY8 C;  2F8N G;  5F99 D;  4JJN D;  3AZN A;  3B6F D;  3AV2 A;  1KX5 C;  5CPI A;  3VH6 T;  3X1T C;  1HTA A;  3H0M C;  3WA9 B;  3KWQ B;  1M1A B;  3TU4 B;  4KUD D;  5GSU B;  2YFW A;  3REL D;  1U35 B;  3UT9 A;  3REJ B;  2Y2O A;  1BFM A;  2NZD C;  3NQJ B;  5B2I D;  4R8P D;  4ZBJ B;  2ARO C;  1P3B C;  1P3O A;  2PYO A;  5BS7 A;  1ID3 A;  5B1L C;  1P3K D;  1F66 C;  3AV2 B;  3AZH A;  4WU8 B;  2FJ7 B;  3P5J B;  3W99 D;  4ZUX D;  5FUG B;  4Z66 B;  3LZ1 D;  5B33 C;  4NE5 A;  3UT9 B;  5JA4 B;  5BNX A;  4WZS B;  4J8W B;  3REI C;  5AV8 D;  4EO5 B;  4YM6 D;  5B40 B;  3AZG C;  3W97 C;  5B0Z D;  5AV9 A;  1HQ3 C;  3AFA A;  3W96 B;  4HGA B;  3AZK C;  2F8N H;  3AZN D;  3AV1 A;  3AZF A;  5C3I C;  3AZM C;  3MGR B;  3H0R C;  1H3O A;  1T3U A;  3VH5 A;  5GXQ C;  4X23 D;  4J8V A;  2HIO C;  2JSS A;  1JFI A;  3EPK A;  3REK A;  4JJN C;  4AWL B;  5AV9 B;  1KX3 B;  4WU9 A;  1P3F A;  1KX4 B;  2UWX A;  1P3O D;  2PYO D;  4J8U A;  1ID3 D;  5KDM B;  3AZH D;  3AV1 B;  2YFV B;  3AZF B;  4KUD C;  5DNM B;  5AV5 D;  4KHA A;  5B1M A;  3C1B B;  4CAY B;  1S32 B;  4H9S A;  2F8N K;  3IP4 C;  3O62 A;  1P3I C;  5CP6 B;  1TAF A;  3W99 C;  4J8U B;  1B6W A;  4ZUX C;  3AFA D;  5GT3 A;  3LZ1 C;  3W98 A;  3NQU A;  3A6N B;  3AZL B;  3MGP A;  3AZI B;  1P3P B;  3AZJ D;  3AN2 B;  5AV8 C;  3WKJ A;  5B0Y A;  5B31 G;  5B0Z C;  1M19 B;  5B32 A;  1TAF B;  5B2J C;  3REK D;  3UTA D;  3KUY B;  4LD9 A;  4Z5T B;  2JE5 A;  1P3F D;  5DNN B;  3MGQ A;  3NQU B;  3AZE A;  4J8X C;  3UTB D;  1KX5 B;  4X23 C;  2F2A C;  1BH8 B;  3LEL D;  2Y2M A;  5CHL B;  5B1M D;  5JRG A;  2XD5 A;  1P3L A;  1ID3 C;  3MNN D;  5BO0 A;  2DF4 C;  3O62 D;  5CPK A;  5AVC A;  4DRA A;  5AV5 C;  3V9R A;  1P3B B;  2ARO B;  5GT3 D;  3B0C T;  5B1L B;  1F66 B;  3MGP D;  2L5A A;  3KFU G;  3WTP C;  1M18 D;  2CV5 C;  4G92 C;  4NFT A;  3X1V A;  5B33 B;  3WKJ D;  2NQB A;  2IO5 C;  2Y2G A;  4H9O A;  5B0Y D;  1P3L B;  1Q9C A;  1W2E A;  4G91 B;  5CPK B;  1PZR A;  5AVC B;  5B31 D;  2Y2N A;  3AZJ C;  1P3G C;  3MVD D;  5GT0 C;  3MGQ D;  3LZ0 D;  3W97 B;  3WA9 A;  1P34 C;  1HQ3 B;  3KWQ A;  3AZE D;  1WWS A;  1M1A A;  3TU4 A;  3AZK B;  5GSU A;  1U35 A;  5C3I B;  2HUE C;  3UTA C;  5CPJ B;  3NQJ A;  4YS3 A;  5JRG D;  5BNV B;  2HIO B;  1AOI C;  4WU8 A;  2FJ7 A;  4JJN B;  3UTB C;  3EG5 B;  5E5A D;  5FUG A;  3WAA C;  4Z66 A;  3LEL C;  3X1U C;  5B1M C;  5AV6 D;  1TZY C;  4XZQ D;  3REH A;  5JA4 A;  3MNN C;  4J8W A;  3KXB B;  4YS3 B;  1P3A D;  2NQB D;  5B40 A;  5AVB C;  1KU5 A;  3W96 A;  1P3I B;  1M18 C;  3MGR A;  3AYW C;  3WA9 D;  3KWQ D;  2G5H C;  1M1A D;  3TU4 D;  3WKJ C;  3REH B;  1U35 D;  3REJ D;  5B31 C;  3A1I A;  3X1S A;  1KX3 A;  5B24 D;  3MVD C;  1KX4 A;  3LZ0 C;  5KDM A;  3AV2 D;  2YFV A;  5CPI D;  1P3M B;  4WJ3 C;  5B2J B;  2FJ7 D;  5DNM A;  1EQZ B;  1BH9 B;  2F8N B;  4Z66 D;  3C1B A;  1ZLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...