3W99B

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99B00
3X1TC 4J8WA 1S32B 5DNMA 3AV1D 1WWIA 3V9RB 5B1LC 3AN2C 2YFWA 3AFAB 5B40B 3LJAC 3LZ1C 3UTBD 5AVCC 3VH6A 3AV2B 3AZEA 4J8WD 5DNMD 5AV8C 2F8NK 5CHLB 1P3AA 4NE3A 1BFMA 1F66A 3VH5T 1P3PC 3AZMC 4HGAC 3AZED 1P3ID 3A6NC 3LZ0D 4KUDB 3AZNA 2FJ7D 1P3AD 4H9PA 3R45A 5F99C 1P3FA 4ZUXB 3O62A 3W98C 4J8UC 5B24A 3AZLC 3REHC 3AZIB 3AZND 3X1SA 5CPJB 5GXQA 1P3FD 4Z2MG 2NZDA 5B31B 5DNMB 1ID3D 4Z5TD 5AY8A 5CP6D 2YFWB 3MGQC 5B33C 5FUGA 4EO5C 1P3OC 5F99A 3X1SD 4R8PC 2PYOB 3WKJA 2CV5C 4LD9C 3MVDA 3TU4D 1P3KC 5GXQD 3VH5W 3KWQC 1U35C 4WNNB 3AZHC 5AVBC 5AY8D 1ZLAB 3UTAA 5AV5A 1F66B 4G92C 3WKJD 3X1TB 3NQUB 1HTAA 4H9RA 5B32A 2IO5C 5JRGC 3AZGC 1HQ3D 4R8PA 3LJAB 3LZ1B 3UTAD 5AVCB 5AV5D 4H9PB 1BH9A 3R45B 5AV6C 1P3FB 3O62B 5B24B 5GT0C 1EQZD 3WTPC 5B32D 5AV8B 1B67A 4AWLC 1ULYA 1TZYC 1S32A 3REJC 5B2IC 2YFVB 3AFAA 4XZQA 5BNVB 5GSUC 1KX5D 4G91B 3A6NB 2NZDB 1KX4C 5B2JC 5AV9C 3X1UC 2BYMB 4QLCC 1S32D 3W98B 5F99B 3WKJB 4J8UB 5GT0A 3B6FA 3MVDB 3AFAD 5B40D 3REHB 3REIC 1TZYA 5B0YA 3REJA 3AV2D 3UT9C 1M18C 4JJNC 1KX3C 2JSSA 1Q9CA 3REKA 3B6FD 2NQBC 4NE5A 4ZUXA 5B33B 3AZFC 3MGQB 3C1CC 1P3OB 5B0YD 3AZIA 4R8PB 5C3IB 4CSRA 4YS3C 4M6BA 4X23C 1WWSA 1BH9B 3REIA 4WU9C 3KSYA 1P3MA 1P3LA 4XUJC 3AZHB 3AZJC 5CPJA 3MGSC 2AROA 4J8XC 4ZUXD 1KU5A 5GT3C 3AZKA 5B31A 4H9SC 3AZID 4G92B 3B0BA 1F1EA 2PYOA 4XZQB 1P3LD 5CPJD 3MGRA 3WAAC 2AROD 5G49A 2F8NA 4H9QA 4WNNA 4YS3A 4YM6C 3X1VC 3AZKD 1P3BC 5E5AC 1P3IC 3B0DC 5B31D 4WU9A 5AV6B 3B0CT 5B0ZC 1ZLAA 5GT0B 3AZJA 3B6FB 5JA4A 4Z66A 1M19C 3AYWA 3W99C 4AWLB 2PYOD 3LELC 3X1TA 3NQUA 5GT3A 1TZYB 3MGRD 5B0YB 1M1AC 2F8ND 5B32G 3REJB 5B1LA 5B2IB 3AN2A 4KGCC 3LJAA 3KXBC 3C1BD 3LZ1A 3REKB 1ZLAD 4Z66D 5AVCA 3WAAA 1F66D 5BT1C 3X1TD 4YM6A 1P3BA 5E5AA 3KUYC 5AV8A 5B1LD 5B0ZA 4CSRB 1ID3C 5CP6C 3W99A 3VH6T 4NFTA 3LJAD 3REIB 3LZ1D 3RELC 1P3MB 1P3PA 1P3LB 5AVCD 3AZMA 2YFVA 3TU4C 2AROB 3UT9B 3O62D 5BNVA 5B24D 3A6NA 3AZKB 1AOIC 5AV8D 1M18B 3KXBA 4JJNB 1KX3B 4J8VC 1TAFA 2BYMA 1P34C 3WA9C 3W98A 4J8UA 3AZFB 3KUYA 3MGRB 3AZMD 3AZLA 3REHA 5G49B 2F8NB 4H9QB 3W96C 4YS3B 3A6ND 2NZDD 3B6GC 4X23B 4WU9B 4H9NA 2RVQC 4WU8C 3AZJB 5JA4B 4Z66B 3AYWB 5CPIC 5DNNC 5F99D 4J8XB 3W98D 3MGPC 4J8UD 5GT3B 3MVDD 2HIOC 5BS7C 3REHD 5B1LB 5B33A 3AN2B 3MGQA 1P3OA 5KDMA 2CWEA 4LD9A 2CV5A 3VH6W 1P3KA 3KWQA 3WAAB 1U35A 4YM6B 4DRAA 1P3BB 3AZHA 5E5AB 3W97C 5AVBA 3NQJB 1P3GC 2L5AA 5B33D 5B0ZB 3MGQD 1P3OD 1M19B 3W99B 5B31G 4R8PD 2CV5D 1P3PB 1R4VA 3KWQD 3AZMB 4HGAB 1U35D 5JRGA 3AZGA 3MNNC 3AZHD 1N1JA 3KXBB 3AV2C 2F8NG 1TAFB 5AV6A 3KUYB 3WTPA 3AZLB 1P3GA 5JRGD 4XZQD 4H9OB 3AZGD 4H9NB 5B2IA 5CPKC 4KUDC 5AV6D 5GSUA 4DRBA 5GT0D 1AOIB 1KX4A 5B2JA 3C1BC 5B1MC 5AV9A 3X1UA 4J8VB 1TZYD 4QLCA 4NE6A 4CAYA 4EO5B 5KDMB 3REJD 4LD9B 5B2ID 3AV1C 2CV5B 1P3KB 3KWQB 5BO0B 1U35B 4KHAA 3REKD 5AVBB 3UTBC 3B6GB 3UT9A 5CPKA 1M18A 4J8WC 5DNNB 4E44A 5CPIB 5DNMC 2LY8A 4JJNA 1KX3A 2NQBA 2IO5B 3REID 5JRGB 1P3MD 3AZFA 3AZGB 3C1CA 2BYKA 1N1JB 3UT9D 3AZEC 3VH5A 3LZ0C 1M18D 4X23A 4JJND 1KX3D 2FJ7C 1P3AC 4XUJA 4UUZA 2NQBD 3W97B 3WTPB 3MGSA 2F8NH 4J8XA 1P3GB 1F66C 3AZFD 3C1CD 4H9SA 4YS3D 4WU9D 4X23D 3AZNC 5GSUB 4XUJD 3MNNB 3AZJD 3MGSD 3AYWD 1KX4B 5B2JB 4J8XD 1P3FC 5AV9B 3X1UB 3O62C 5GT3D 3X1VA 1P3IA 5B24C 4QLCB 3LZ0A 4CAYB 3NQJA 2FJ7A 3AN2D 4Z5TC 1M19A 3LELA 4KHAB 3X1SC 3WAAD 1M1AA 5GXQC 5CPKB 4YM6D 3X1VD 1P3BD 4KGCA 5E5AD 4ZBJC 4G91C 2NZDC 5B0ZD 2NQBB 5AY8C 1M19D 3W99D 3C1BB 3B0CW 5B1MB 3LELD 1P3PD 3WKJC 3C1CB 2BYKB 3MVDC 1M1AD 3AV1B 4H9OA 4KGCD 1ID3A 1B6WA 4Z5TA 5CP6A 3WTPE 3KXBD 1HQ3C 3RELA 4XUJB 4UUZB 1JFIA 3UTBB 5BNXA 1BH8A 3MGSB 3UTAC 5AV5C 3TU4A 5BT1D 4E45A 3KUYD 1AOIA 3AZLD 4J8WB 1EQZC 5B32C 4J8VA 1P34A 3WA9A 2HUEC 3RELD 4WZSB 5C3IC 5BO0A 3W96A 3AZEB 3X1VB 1P3IB 1KX5C 1AOID 3B0DB 3LZ0B 3B6GA 1H3OA 1HQ3A 4WU8A 4J8VD 2FJ7B 1P3AB 1P34D 3WA9D 5CPIA 5DNNA 1S32C 3LELB 4LD9D 3MGPA 1P3KD 2HIOA 1EQZA 5BS7A 1M1AB 3AFAC 3W96D 5B40C 4KGCB 4XZQC 5AVBD 3B6GD 3AZNB 2RVQD 4WU8D 5CPID 5DNND 3MGPD 1A7WA 3W97A 1KX5A 2HIOD 3B6FC 1ID3B 4Z5TB 5CP6B 5B0YC 3RELB 3X1SB 3V9RA 1JFIB 5BNXB 1BH8B 3TU4B 5GXQB 5B40A 3MNNA 3W97D 4ZBJB 3REKC 3WTPD 1P3GD 3AV2A 4ZUXC 5AY8B 1P34B 3WA9B 5FUGB 3AZIC 4Z2MH 3W96B 5GSUD 3MNND 1P3MC 1P3LC 1KX4D 5B2JD 5CPJC 1H3OB 1HQ3B 2AROC 5AV9D 4WU8B 3X1UD 4QLCD 4KUDA 3AZKC 3UTAB 4WV4B 5AV5B 5B31C 3MGPB 2HIOB 1EQZB 3C1BA 4H9RB 5B32B 5B1MA 2PYOC 2HUEB 3MGRC 3AV1A 5CPKD 4KUDD 1KX5B 1ZLAC 3UTBA 4Z66C 3AYWC 5B1MD
chains in the Genus database with same CATH superfamily
3X1TC 4J8WA 1S32B 5DNMA 3AV1D 1WWIA 3V9RB 5B1LC 3AN2C 2YFWA 3AFAB 5B40B 3LJAC 3LZ1C 3UTBD 5AVCC 3VH6A 3AV2B 3AZEA 4J8WD 5DNMD 5AV8C 2F8NK 5CHLB 1P3AA 4NE3A 1BFMA 1F66A 3VH5T 1P3PC 3AZMC 2Y2NA 4HGAC 3AZED 1P3ID 4WJ3C 3A6NC 3LZ0D 4KUDB 3AZNA 2FJ7D 1P3AD 4H9PA 2FFFB 3R45A 5F99C 1P3FA 4ZUXB 3O62A 3W98C 4J8UC 5B24A 2XD5A 3AZLC 3REHC 3AZIB 3AZND 3X1SA 5CPJB 5GXQA 1P3FD 3A1KA 4Z2MG 2NZDA 5B31B 5DNMB 1ID3D 4Z5TD 2ZY5A 2ZY4A 5AY8A 2YFWB 5CP6D 3MGQC 5B33C 5FUGA 4EO5C 1P3OC 5F99A 3X1SD 4R8PC 2PYOB 3WKJA 2CV5C 4LD9C 3MVDA 3TU4D 1P3KC 5GXQD 3VH5W 3KWQC 1U35C 4WNNB 3AZHC 5AVBC 5AY8D 1ZLAB 3UTAA 5AV5A 1F66B 2ZY3A 4G92C 3WKJD 3X1TB 3NQUB 1HTAA 4H9RA 5B32A 2IO5C 5JRGC 2RIQA 3AZGC 3A1IA 1HQ3D 2Y2HA 4R8PA 3LJAB 3LZ1B 3UTAD 5AVCB 5AV5D 4H9PB 1BH9A 3R45B 5AV6C 1P3FB 3O62B 5B24B 5GT0C 1EQZD 1T3UA 5B32D 3WTPC 5AV8B 1B67A 4AWLC 2ZY2A 1ULYA 1TZYC 1S32A 2UWXA 3REJC 5B2IC 2YFVB 3AFAA 2BG1A 4XZQA 5BNVB 5GSUC 1KX5D 4G91B 3A6NB 2NZDB 1KX4C 5B2JC 5AV9C 3X1UC 2BYMB 4QLCC 1S32D 3W98B 5F99B 3WKJB 4J8UB 5GT0A 3B6FA 3MVDB 3AFAD 5B40D 3REHB 3REIC 1TZYA 5B0YA 3REJA 3AV2D 3UT9C 1M18C 4JJNC 1KX3C 2JSSA 1Q9CA 3REKA 3B6FD 2NQBC 4NE5A 4ZUXA 5B33B 3AZFC 3MGQB 3C1CC 1P3OB 5B0YD 3H0LC 3AZIA 4R8PB 5C3IB 3EG5B 4CSRA 4YS3C 4M6BA 4X23C 1WWSA 1BH9B 3REIA 4WU9C 3KSYA 1P3MA 1P3LA 4XUJC 3AZHB 3AZJC 5CPJA 3MGSC 2AROA 4J8XC 4ZUXD 1KU5A 5GT3C 3AZKA 5B31A 4H9SC 2J8PA 3AZID 4G92B 3B0BA 1F1EA 2PYOA 4XZQB 1P3LD 5CPJD 3MGRA 3WAAC 2AROD 5G49A 2F8NA 4H9QA 4WNNA 4YS3A 4YM6C 3X1VC 3AZKD 1P3BC 5E5AC 1P3IC 3B0DC 5B31D 4WU9A 5AV6B 3B0CT 5B0ZC 1ZLAA 5GT0B 3AZJA 3B6FB 5JA4A 4Z66A 1M19C 3AYWA 3W99C 4AWLB 2PYOD 3LELC 3X1TA 3NQUA 5GT3A 1TZYB 3MGRD 5B0YB 1M1AC 2F8ND 5B32G 3REJB 5B1LA 5B2IB 3AN2A 4KGCC 3LJAA 3KXBC 3C1BD 3LZ1A 3REKB 1ZLAD 4Z66D 5AVCA 3WAAA 1F66D 5BT1C 3X1TD 4YM6A 1P3BA 5E5AA 3KUYC 5AV8A 5B1LD 5B0ZA 4CSRB 1ID3C 2G5HC 5CP6C 1W2EA 3VH6T 3W99A 4NFTA 3LJAD 3REIB 3LZ1D 3RELC 1P3MB 1P3PA 1P3LB 5AVCD 3AZMA 2YFVA 3TU4C 2AROB 2JE5A 3UT9B 3O62D 3EPKA 5BNVA 5B24D 3A6NA 3AZKB 1AOIC 5AV8D 1M18B 3KXBA 4JJNB 2JCHA 1KX3B 4J8VC 1TAFA 2BYMA 1P34C 3WA9C 3W98A 4J8UA 3AZFB 3KUYA 3MGRB 3AZMD 3AZLA 2Y2JA 3REHA 5G49B 2F8NB 4H9QB 3W96C 4YS3B 3A6ND 2Y2IA 2NZDD 3B6GC 4X23B 4WU9B 4H9NA 2RVQC 4WU8C 3AZJB 3IP4C 5JA4B 4Z66B 3AYWB 2ZM5A 5CPIC 1PZRA 5F99D 5DNNC 4J8XB 3W98D 3MGPC 4J8UD 5GT3B 3MVDD 2HIOC 5BS7C 3REHD 5B1LB 5B33A 3AN2B 3MGQA 1P3OA 5KDMA 2CWEA 3H0RC 4LD9A 2CV5A 3VH6W 1P3KA 3KWQA 3WAAB 2Y2OA 1U35A 4YM6B 4DRAA 1P3BB 3AZHA 5E5AB 3W97C 5AVBA 3NQJB 2G5IC 1P3GC 2L5AA 5B33D 5B0ZB 3MGQD 1P3OD 1M19B 2W8SA 3W99B 5B31G 4R8PD 2CV5D 1P3PB 1R4VA 3KWQD 3AZMB 4HGAB 1U35D 5JRGA 3AZGA 3MNNC 3AZHD 3P5JB 1N1JA 3KXBB 3AV2C 2F8NG 1TAFB 5AV6A 3KUYB 3WTPA 3AZLB 1P3GA 5JRGD 4XZQD 4H9OB 3AZGD 4H9NB 3AL0C 3EPJA 5B2IA 5CPKC 4KUDC 1Z2CB 5AV6D 5GSUA 4DRBA 5GT0D 1AOIB 1KX4A 5B2JA 3C1BC 5B1MC 5AV9A 3X1UA 4J8VB 1TZYD 4QLCA 2Y2QA 4NE6A 4CAYA 4EO5B 5KDMB 3REJD 4LD9B 5B2ID 3AV1C 2CV5B 1P3KB 3KWQB 2Y2KA 5BO0B 1U35B 4KHAA 3REKD 5AVBB 3UTBC 3B6GB 3UT9A 5CPKA 1M18A 2DQNC 5DNNB 4E44A 4J8WC 5CPIB 5DNMC 2LY8A 4JJNA 1KX3A 2Y2MA 2NQBA 2IO5B 3REID 5JRGB 1P3MD 3AZFA 3AZGB 3C1CA 2BYKA 1N1JB 3UT9D 3AZEC 3VH5A 3LZ0C 1M18D 4X23A 2Y2PA 4JJND 1KX3D 2FJ7C 2DF4C 4XUJA 4UUZA 1P3AC 2NQBD 3W97B 3FDDA 3WTPB 3MGSA 2F8NH 4J8XA 1P3GB 1F66C 3AZFD 3C1CD 4H9SA 2Y2GA 4YS3D 4WU9D 4X23D 3AZNC 5GSUB 4XUJD 3MNNB 4DQYB 3AZJD 3MGSD 3AYWD 1KX4B 5B2JB 4J8XD 1P3FC 5AV9B 3H0MC 3X1UB 5GT3D 3O62C 3X1VA 1P3IA 5B24C 4QLCB 3LZ0A 4CAYB 3NQJA 2FJ7A 3AN2D 4Z5TC 1M19A 3LELA 4KHAB 3X1SC 3WAAD 1M1AA 5GXQC 5CPKB 4YM6D 3X1VD 1P3BD 4KGCA 5E5AD 4ZBJC 4G91C 2NZDC 5B0ZD 2NQBB 5AY8C 1M19D 3W99D 3C1BB 3B0CW 5B1MB 3LELD 1P3PD 3WKJC 3C1CB 2BYKB 3MVDC 1M1AD 3AV1B 4H9OA 4KGCD 1ID3A 1B6WA 4Z5TA 5CP6A 3WTPE 3KXBD 1HQ3C 3RELA 2XD1A 4XUJB 4UUZB 3KFUG 1JFIA 3UTBB 5BNXA 1BH8A 3MGSB 3UTAC 5AV5C 3TU4A 5BT1D 4E45A 3KUYD 1AOIA 3AZLD 4J8WB 1EQZC 5B32C 4J8VA 1P34A 3WA9A 2HUEC 3RELD 4WZSB 5C3IC 5BO0A 3W96A 3AZEB 3X1VB 1P3IB 1KX5C 1AOID 3B0DB 3LZ0B 3B6GA 1H3OA 1HQ3A 4WU8A 4J8VD 2FJ7B 1P3AB 1P34D 3WA9D 5CPIA 5DNNA 1S32C 3LELB 4LD9D 3MGPA 1P3KD 2HIOA 1EQZA 5BS7A 1M1AB 3AFAC 3W96D 5B40C 4KGCB 4XZQC 5AVBD 3B6GD 3AZNB 2RVQD 4WU8D 3EPHA 5CPID 5DNND 3MGPD 1A7WA 3W97A 1KX5A 2HIOD 3B6FC 1ID3B 4Z5TB 5CP6B 2F2AC 3EPLA 5B0YC 3RELB 2VQRA 3X1SB 3V9RA 1JFIB 5BNXB 1BH8B 3TU4B 5GXQB 5B40A 3MNNA 3W97D 4ZBJB 3REKC 3WTPD 1P3GD 3AV2A 4ZUXC 5AY8B 1P34B 3WA9B 5FUGB 3AZIC 4Z2MH 3W96B 5GSUD 3MNND 1P3MC 1P3LC 1KX4D 5B2JD 3F6TA 5CPJC 1H3OB 1HQ3B 2AROC 5AV9D 4WU8B 3X1UD 4QLCD 4KUDA 3AZKC 3UTAB 4WV4B 5AV5B 5B31C 3MGPB 4UPKA 2HIOB 1EQZB 3C1BA 4H9RB 5B32B 5B1MA 2PYOC 2HUEB 3MGRC 3AV1A 5CPKD 4KUDD 1KX5B 2Y2LA 1ZLAC 3UTBA 4Z66C 3AYWC 5B1MD
chains in the Genus database with same CATH topology
3X1TC 4J8WA 1S32B 5DNMA 3AV1D 1WWIA 3V9RB 5B1LC 3AN2C 2YFWA 3AFAB 5B40B 3LJAC 3LZ1C 3UTBD 5AVCC 3VH6A 3AV2B 3AZEA 4J8WD 5DNMD 5AV8C 2F8NK 5CHLB 1P3AA 4NE3A 1BFMA 1F66A 3VH5T 1P3PC 3AZMC 2Y2NA 4HGAC 3AZED 1P3ID 4WJ3C 3A6NC 3LZ0D 4KUDB 3AZNA 2FJ7D 1P3AD 4H9PA 2FFFB 3R45A 5F99C 1P3FA 4ZUXB 3O62A 3W98C 4J8UC 5B24A 2XD5A 3AZLC 3REHC 3AZIB 3AZND 3X1SA 5CPJB 5GXQA 1P3FD 3A1KA 4Z2MG 2NZDA 5B31B 5DNMB 1ID3D 4Z5TD 2ZY5A 2ZY4A 5AY8A 2YFWB 5CP6D 3MGQC 5B33C 5FUGA 4EO5C 1P3OC 5F99A 3X1SD 4R8PC 2PYOB 3WKJA 2CV5C 4LD9C 3MVDA 3TU4D 1P3KC 5GXQD 3VH5W 3KWQC 1U35C 4WNNB 3AZHC 5AVBC 5AY8D 1ZLAB 3UTAA 5AV5A 1F66B 2ZY3A 4G92C 3WKJD 3X1TB 3NQUB 1HTAA 4H9RA 5B32A 2IO5C 5JRGC 2RIQA 3AZGC 3A1IA 1HQ3D 2Y2HA 4R8PA 3LJAB 3LZ1B 3UTAD 5AVCB 5AV5D 4H9PB 1BH9A 3R45B 5AV6C 1P3FB 3O62B 5B24B 5GT0C 1EQZD 1T3UA 5B32D 3WTPC 5AV8B 1B67A 4AWLC 2ZY2A 1ULYA 1TZYC 1S32A 2UWXA 3REJC 5B2IC 2YFVB 3AFAA 2BG1A 4XZQA 5BNVB 5GSUC 1KX5D 4G91B 3A6NB 2NZDB 1KX4C 5B2JC 5AV9C 3X1UC 2BYMB 4QLCC 1S32D 3W98B 5F99B 3WKJB 4J8UB 5GT0A 3B6FA 3MVDB 3AFAD 5B40D 3REHB 3REIC 1TZYA 5B0YA 3REJA 3AV2D 3UT9C 1M18C 4JJNC 1KX3C 2JSSA 1Q9CA 3REKA 3B6FD 2NQBC 4NE5A 4ZUXA 5B33B 3AZFC 3MGQB 3C1CC 1P3OB 5B0YD 3H0LC 3AZIA 4R8PB 5C3IB 3EG5B 4CSRA 4YS3C 4M6BA 4X23C 1WWSA 1BH9B 3REIA 4WU9C 3KSYA 1P3MA 1P3LA 4XUJC 3AZHB 3AZJC 5CPJA 3MGSC 2AROA 4J8XC 4ZUXD 1KU5A 5GT3C 3AZKA 5B31A 4H9SC 2J8PA 3AZID 4G92B 3B0BA 1F1EA 2PYOA 4XZQB 1P3LD 5CPJD 3MGRA 3WAAC 2AROD 5G49A 2F8NA 4H9QA 4WNNA 4YS3A 4YM6C 3X1VC 3AZKD 1P3BC 5E5AC 1P3IC 3B0DC 5B31D 4WU9A 5AV6B 3B0CT 5B0ZC 1ZLAA 5GT0B 3AZJA 3B6FB 5JA4A 4Z66A 1M19C 3AYWA 3W99C 4AWLB 2PYOD 3LELC 3X1TA 3NQUA 5GT3A 1TZYB 3MGRD 5B0YB 1M1AC 2F8ND 5B32G 3REJB 5B1LA 5B2IB 3AN2A 4KGCC 3LJAA 3KXBC 3C1BD 3LZ1A 3REKB 1ZLAD 4Z66D 5AVCA 3WAAA 1F66D 5BT1C 3X1TD 4YM6A 1P3BA 5E5AA 3KUYC 5AV8A 5B1LD 5B0ZA 4CSRB 1ID3C 2G5HC 5CP6C 1W2EA 3VH6T 3W99A 4NFTA 3LJAD 3REIB 3LZ1D 3RELC 1P3MB 1P3PA 1P3LB 5AVCD 3AZMA 2YFVA 3TU4C 2AROB 2JE5A 3UT9B 3O62D 3EPKA 5BNVA 5B24D 3A6NA 3AZKB 1AOIC 5AV8D 1M18B 3KXBA 4JJNB 2JCHA 1KX3B 4J8VC 1TAFA 2BYMA 1P34C 3WA9C 3W98A 4J8UA 3AZFB 3KUYA 3MGRB 3AZMD 3AZLA 2Y2JA 3REHA 5G49B 2F8NB 4H9QB 3W96C 4YS3B 3A6ND 2Y2IA 2NZDD 3B6GC 4X23B 4WU9B 4H9NA 2RVQC 4WU8C 3AZJB 3IP4C 5JA4B 4Z66B 3AYWB 2ZM5A 5CPIC 1PZRA 5F99D 5DNNC 4J8XB 3W98D 3MGPC 4J8UD 5GT3B 3MVDD 2HIOC 5BS7C 3REHD 5B1LB 5B33A 3AN2B 3MGQA 1P3OA 5KDMA 2CWEA 3H0RC 4LD9A 2CV5A 3VH6W 1P3KA 3KWQA 3WAAB 2Y2OA 1U35A 4YM6B 4DRAA 1P3BB 3AZHA 5E5AB 3W97C 5AVBA 3NQJB 2G5IC 1P3GC 2L5AA 5B33D 5B0ZB 3MGQD 1P3OD 1M19B 2W8SA 3W99B 5B31G 4R8PD 2CV5D 1P3PB 1R4VA 3KWQD 3AZMB 4HGAB 1U35D 5JRGA 3AZGA 3MNNC 3AZHD 3P5JB 1N1JA 3KXBB 3AV2C 2F8NG 1TAFB 5AV6A 3KUYB 3WTPA 3AZLB 1P3GA 5JRGD 4XZQD 4H9OB 3AZGD 4H9NB 3AL0C 3EPJA 5B2IA 5CPKC 4KUDC 1Z2CB 5AV6D 5GSUA 4DRBA 5GT0D 1AOIB 1KX4A 5B2JA 3C1BC 5B1MC 5AV9A 3X1UA 4J8VB 1TZYD 4QLCA 2Y2QA 4NE6A 4CAYA 4EO5B 5KDMB 3REJD 4LD9B 5B2ID 3AV1C 2CV5B 1P3KB 3KWQB 2Y2KA 5BO0B 1U35B 4KHAA 3REKD 5AVBB 3UTBC 3B6GB 3UT9A 5CPKA 1M18A 2DQNC 5DNNB 4E44A 4J8WC 5CPIB 5DNMC 2LY8A 4JJNA 1KX3A 2Y2MA 2NQBA 2IO5B 3REID 5JRGB 1P3MD 3AZFA 3AZGB 3C1CA 2BYKA 1N1JB 3UT9D 3AZEC 3VH5A 3LZ0C 1M18D 4X23A 2Y2PA 4JJND 1KX3D 2FJ7C 2DF4C 4XUJA 4UUZA 1P3AC 2NQBD 3W97B 3FDDA 3WTPB 3MGSA 2F8NH 4J8XA 1P3GB 1F66C 3AZFD 3C1CD 4H9SA 2Y2GA 4YS3D 4WU9D 4X23D 3AZNC 5GSUB 4XUJD 3MNNB 4DQYB 3AZJD 3MGSD 3AYWD 1KX4B 5B2JB 4J8XD 1P3FC 5AV9B 3H0MC 3X1UB 5GT3D 3O62C 3X1VA 1P3IA 5B24C 4QLCB 3LZ0A 4CAYB 3NQJA 2FJ7A 3AN2D 4Z5TC 1M19A 3LELA 4KHAB 3X1SC 3WAAD 1M1AA 5GXQC 5CPKB 4YM6D 3X1VD 1P3BD 4KGCA 5E5AD 4ZBJC 4G91C 2NZDC 5B0ZD 2NQBB 5AY8C 1M19D 3W99D 3C1BB 3B0CW 5B1MB 3LELD 1P3PD 3WKJC 3C1CB 2BYKB 3MVDC 1M1AD 3AV1B 4H9OA 4KGCD 1ID3A 1B6WA 4Z5TA 5CP6A 3WTPE 3KXBD 1HQ3C 3RELA 2XD1A 4XUJB 4UUZB 3KFUG 1JFIA 3UTBB 5BNXA 1BH8A 3MGSB 3UTAC 5AV5C 3TU4A 5BT1D 4E45A 3KUYD 1AOIA 3AZLD 4J8WB 1EQZC 5B32C 4J8VA 1P34A 3WA9A 2HUEC 3RELD 4WZSB 5C3IC 5BO0A 3W96A 3AZEB 3X1VB 1P3IB 1KX5C 1AOID 3B0DB 3LZ0B 3B6GA 1H3OA 1HQ3A 4WU8A 4J8VD 2FJ7B 1P3AB 1P34D 3WA9D 5CPIA 5DNNA 1S32C 3LELB 4LD9D 3MGPA 1P3KD 2HIOA 1EQZA 5BS7A 1M1AB 3AFAC 3W96D 5B40C 4KGCB 4XZQC 5AVBD 3B6GD 3AZNB 2RVQD 4WU8D 3EPHA 5CPID 5DNND 3MGPD 1A7WA 3W97A 1KX5A 2HIOD 3B6FC 1ID3B 4Z5TB 5CP6B 2F2AC 3EPLA 5B0YC 3RELB 2VQRA 3X1SB 3V9RA 1JFIB 5BNXB 1BH8B 3TU4B 5GXQB 5B40A 3MNNA 3W97D 4ZBJB 3REKC 3WTPD 1P3GD 3AV2A 4ZUXC 5AY8B 1P34B 3WA9B 5FUGB 3AZIC 4Z2MH 3W96B 5GSUD 3MNND 1P3MC 1P3LC 1KX4D 5B2JD 3F6TA 5CPJC 1H3OB 1HQ3B 2AROC 5AV9D 4WU8B 3X1UD 4QLCD 4KUDA 3AZKC 3UTAB 4WV4B 5AV5B 5B31C 3MGPB 4UPKA 2HIOB 1EQZB 3C1BA 4H9RB 5B32B 5B1MA 2PYOC 2HUEB 3MGRC 3AV1A 5CPKD 4KUDD 1KX5B 2Y2LA 1ZLAC 3UTBA 4Z66C 3AYWC 5B1MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T C;  4J8W A;  1S32 B;  5DNM A;  3AV1 D;  1WWI A;  3V9R B;  5B1L C;  3AN2 C;  2YFW A;  3AFA B;  5B40 B;  3LJA C;  3LZ1 C;  3UTB D;  5AVC C;  3VH6 A;  3AV2 B;  3AZE A;  4J8W D;  5DNM D;  5AV8 C;  2F8N K;  5CHL B;  1P3A A;  4NE3 A;  1BFM A;  1F66 A;  3VH5 T;  1P3P C;  3AZM C;  4HGA C;  3AZE D;  1P3I D;  3A6N C;  3LZ0 D;  4KUD B;  3AZN A;  2FJ7 D;  1P3A D;  4H9P A;  3R45 A;  5F99 C;  1P3F A;  4ZUX B;  3O62 A;  3W98 C;  4J8U C;  5B24 A;  3AZL C;  3REH C;  3AZI B;  3AZN D;  3X1S A;  5CPJ B;  5GXQ A;  1P3F D;  4Z2M G;  2NZD A;  5B31 B;  5DNM B;  1ID3 D;  4Z5T D;  5AY8 A;  5CP6 D;  2YFW B;  3MGQ C;  5B33 C;  5FUG A;  4EO5 C;  1P3O C;  5F99 A;  3X1S D;  4R8P C;  2PYO B;  3WKJ A;  2CV5 C;  4LD9 C;  3MVD A;  3TU4 D;  1P3K C;  5GXQ D;  3VH5 W;  3KWQ C;  1U35 C;  4WNN B;  3AZH C;  5AVB C;  5AY8 D;  1ZLA B;  3UTA A;  5AV5 A;  1F66 B;  4G92 C;  3WKJ D;  3X1T B;  3NQU B;  1HTA A;  4H9R A;  5B32 A;  2IO5 C;  5JRG C;  3AZG C;  1HQ3 D;  4R8P A;  3LJA B;  3LZ1 B;  3UTA D;  5AVC B;  5AV5 D;  4H9P B;  1BH9 A;  3R45 B;  5AV6 C;  1P3F B;  3O62 B;  5B24 B;  5GT0 C;  1EQZ D;  3WTP C;  5B32 D;  5AV8 B;  1B67 A;  4AWL C;  1ULY A;  1TZY C;  1S32 A;  3REJ C;  5B2I C;  2YFV B;  3AFA A;  4XZQ A;  5BNV B;  5GSU C;  1KX5 D;  4G91 B;  3A6N B;  2NZD B;  1KX4 C;  5B2J C;  5AV9 C;  3X1U C;  2BYM B;  4QLC C;  1S32 D;  3W98 B;  5F99 B;  3WKJ B;  4J8U B;  5GT0 A;  3B6F A;  3MVD B;  3AFA D;  5B40 D;  3REH B;  3REI C;  1TZY A;  5B0Y A;  3REJ A;  3AV2 D;  3UT9 C;  1M18 C;  4JJN C;  1KX3 C;  2JSS A;  1Q9C A;  3REK A;  3B6F D;  2NQB C;  4NE5 A;  4ZUX A;  5B33 B;  3AZF C;  3MGQ B;  3C1C C;  1P3O B;  5B0Y D;  3AZI A;  4R8P B;  5C3I B;  4CSR A;  4YS3 C;  4M6B A;  4X23 C;  1WWS A;  1BH9 B;  3REI A;  4WU9 C;  3KSY A;  1P3M A;  1P3L A;  4XUJ C;  3AZH B;  3AZJ C;  5CPJ A;  3MGS C;  2ARO A;  4J8X C;  4ZUX D;  1KU5 A;  5GT3 C;  3AZK A;  5B31 A;  4H9S C;  3AZI D;  4G92 B;  3B0B A;  1F1E A;  2PYO A;  4XZQ B;  1P3L D;  5CPJ D;  3MGR A;  3WAA C;  2ARO D;  5G49 A;  2F8N A;  4H9Q A;  4WNN A;  4YS3 A;  4YM6 C;  3X1V C;  3AZK D;  1P3B C;  5E5A C;  1P3I C;  3B0D C;  5B31 D;  4WU9 A;  5AV6 B;  3B0C T;  5B0Z C;  1ZLA A;  5GT0 B;  3AZJ A;  3B6F B;  5JA4 A;  4Z66 A;  1M19 C;  3AYW A;  3W99 C;  4AWL B;  2PYO D;  3LEL C;  3X1T A;  3NQU A;  5GT3 A;  1TZY B;  3MGR D;  5B0Y B;  1M1A C;  2F8N D;  5B32 G;  3REJ B;  5B1L A;  5B2I B;  3AN2 A;  4KGC C;  3LJA A;  3KXB C;  3C1B D;  3LZ1 A;  3REK B;  1ZLA D;  4Z66 D;  5AVC A;  3WAA A;  1F66 D;  5BT1 C;  3X1T D;  4YM6 A;  1P3B A;  5E5A A;  3KUY C;  5AV8 A;  5B1L D;  5B0Z A;  4CSR B;  1ID3 C;  5CP6 C;  3W99 A;  3VH6 T;  4NFT A;  3LJA D;  3REI B;  3LZ1 D;  3REL C;  1P3M B;  1P3P A;  1P3L B;  5AVC D;  3AZM A;  2YFV A;  3TU4 C;  2ARO B;  3UT9 B;  3O62 D;  5BNV A;  5B24 D;  3A6N A;  3AZK B;  1AOI C;  5AV8 D;  1M18 B;  3KXB A;  4JJN B;  1KX3 B;  4J8V C;  1TAF A;  2BYM A;  1P34 C;  3WA9 C;  3W98 A;  4J8U A;  3AZF B;  3KUY A;  3MGR B;  3AZM D;  3AZL A;  3REH A;  5G49 B;  2F8N B;  4H9Q B;  3W96 C;  4YS3 B;  3A6N D;  2NZD D;  3B6G C;  4X23 B;  4WU9 B;  4H9N A;  2RVQ C;  4WU8 C;  3AZJ B;  5JA4 B;  4Z66 B;  3AYW B;  5CPI C;  5DNN C;  5F99 D;  4J8X B;  3W98 D;  3MGP C;  4J8U D;  5GT3 B;  3MVD D;  2HIO C;  5BS7 C;  3REH D;  5B1L B;  5B33 A;  3AN2 B;  3MGQ A;  1P3O A;  5KDM A;  2CWE A;  4LD9 A;  2CV5 A;  3VH6 W;  1P3K A;  3KWQ A;  3WAA B;  1U35 A;  4YM6 B;  4DRA A;  1P3B B;  3AZH A;  5E5A B;  3W97 C;  5AVB A;  3NQJ B;  1P3G C;  2L5A A;  5B33 D;  5B0Z B;  3MGQ D;  1P3O D;  1M19 B;  3W99 B;  5B31 G;  4R8P D;  2CV5 D;  1P3P B;  1R4V A;  3KWQ D;  3AZM B;  4HGA B;  1U35 D;  5JRG A;  3AZG A;  3MNN C;  3AZH D;  1N1J A;  3KXB B;  3AV2 C;  2F8N G;  1TAF B;  5AV6 A;  3KUY B;  3WTP A;  3AZL B;  1P3G A;  5JRG D;  4XZQ D;  4H9O B;  3AZG D;  4H9N B;  5B2I A;  5CPK C;  4KUD C;  5AV6 D;  5GSU A;  4DRB A;  5GT0 D;  1AOI B;  1KX4 A;  5B2J A;  3C1B C;  5B1M C;  5AV9 A;  3X1U A;  4J8V B;  1TZY D;  4QLC A;  4NE6 A;  4CAY A;  4EO5 B;  5KDM B;  3REJ D;  4LD9 B;  5B2I D;  3AV1 C;  2CV5 B;  1P3K B;  3KWQ B;  5BO0 B;  1U35 B;  4KHA A;  3REK D;  5AVB B;  3UTB C;  3B6G B;  3UT9 A;  5CPK A;  1M18 A;  4J8W C;  5DNN B;  4E44 A;  5CPI B;  5DNM C;  2LY8 A;  4JJN A;  1KX3 A;  2NQB A;  2IO5 B;  3REI D;  5JRG B;  1P3M D;  3AZF A;  3AZG B;  3C1C A;  2BYK A;  1N1J B;  3UT9 D;  3AZE C;  3VH5 A;  3LZ0 C;  1M18 D;  4X23 A;  4JJN D;  1KX3 D;  2FJ7 C;  1P3A C;  4XUJ A;  4UUZ A;  2NQB D;  3W97 B;  3WTP B;  3MGS A;  2F8N H;  4J8X A;  1P3G B;  1F66 C;  3AZF D;  3C1C D;  4H9S A;  4YS3 D;  4WU9 D;  4X23 D;  3AZN C;  5GSU B;  4XUJ D;  3MNN B;  3AZJ D;  3MGS D;  3AYW D;  1KX4 B;  5B2J B;  4J8X D;  1P3F C;  5AV9 B;  3X1U B;  3O62 C;  5GT3 D;  3X1V A;  1P3I A;  5B24 C;  4QLC B;  3LZ0 A;  4CAY B;  3NQJ A;  2FJ7 A;  3AN2 D;  4Z5T C;  1M19 A;  3LEL A;  4KHA B;  3X1S C;  3WAA D;  1M1A A;  5GXQ C;  5CPK B;  4YM6 D;  3X1V D;  1P3B D;  4KGC A;  5E5A D;  4ZBJ C;  4G91 C;  2NZD C;  5B0Z D;  2NQB B;  5AY8 C;  1M19 D;  3W99 D;  3C1B B;  3B0C W;  5B1M B;  3LEL D;  1P3P D;  3WKJ C;  3C1C B;  2BYK B;  3MVD C;  1M1A D;  3AV1 B;  4H9O A;  4KGC D;  1ID3 A;  1B6W A;  4Z5T A;  5CP6 A;  3WTP E;  3KXB D;  1HQ3 C;  3REL A;  4XUJ B;  4UUZ B;  1JFI A;  3UTB B;  5BNX A;  1BH8 A;  3MGS B;  3UTA C;  5AV5 C;  3TU4 A;  5BT1 D;  4E45 A;  3KUY D;  1AOI A;  3AZL D;  4J8W B;  1EQZ C;  5B32 C;  4J8V A;  1P34 A;  3WA9 A;  2HUE C;  3REL D;  4WZS B;  5C3I C;  5BO0 A;  3W96 A;  3AZE B;  3X1V B;  1P3I B;  1KX5 C;  1AOI D;  3B0D B;  3LZ0 B;  3B6G A;  1H3O A;  1HQ3 A;  4WU8 A;  4J8V D;  2FJ7 B;  1P3A B;  1P34 D;  3WA9 D;  5CPI A;  5DNN A;  1S32 C;  3LEL B;  4LD9 D;  3MGP A;  1P3K D;  2HIO A;  1EQZ A;  5BS7 A;  1M1A B;  3AFA C;  3W96 D;  5B40 C;  4KGC B;  4XZQ C;  5AVB D;  3B6G D;  3AZN B;  2RVQ D;  4WU8 D;  5CPI D;  5DNN D;  3MGP D;  1A7W A;  3W97 A;  1KX5 A;  2HIO D;  3B6F C;  1ID3 B;  4Z5T B;  5CP6 B;  5B0Y C;  3REL B;  3X1S B;  3V9R A;  1JFI B;  5BNX B;  1BH8 B;  3TU4 B;  5GXQ B;  5B40 A;  3MNN A;  3W97 D;  4ZBJ B;  3REK C;  3WTP D;  1P3G D;  3AV2 A;  4ZUX C;  5AY8 B;  1P34 B;  3WA9 B;  5FUG B;  3AZI C;  4Z2M H;  3W96 B;  5GSU D;  3MNN D;  1P3M C;  1P3L C;  1KX4 D;  5B2J D;  5CPJ C;  1H3O B;  1HQ3 B;  2ARO C;  5AV9 D;  4WU8 B;  3X1U D;  4QLC D;  4KUD A;  3AZK C;  3UTA B;  4WV4 B;  5AV5 B;  5B31 C;  3MGP B;  2HIO B;  1EQZ B;  3C1B A;  4H9R B;  5B32 B;  5B1M A;  2PYO C;  2HUE B;  3MGR C;  3AV1 A;  5CPK D;  4KUD D;  1KX5 B;  1ZLA C;  3UTB A;  4Z66 C;  3AYW C;  5B1M D; 
#chains in the Genus database with same CATH topology
 3X1T C;  4J8W A;  1S32 B;  5DNM A;  3AV1 D;  1WWI A;  3V9R B;  5B1L C;  3AN2 C;  2YFW A;  3AFA B;  5B40 B;  3LJA C;  3LZ1 C;  3UTB D;  5AVC C;  3VH6 A;  3AV2 B;  3AZE A;  4J8W D;  5DNM D;  5AV8 C;  2F8N K;  5CHL B;  1P3A A;  4NE3 A;  1BFM A;  1F66 A;  3VH5 T;  1P3P C;  3AZM C;  2Y2N A;  4HGA C;  3AZE D;  1P3I D;  4WJ3 C;  3A6N C;  3LZ0 D;  4KUD B;  3AZN A;  2FJ7 D;  1P3A D;  4H9P A;  2FFF B;  3R45 A;  5F99 C;  1P3F A;  4ZUX B;  3O62 A;  3W98 C;  4J8U C;  5B24 A;  2XD5 A;  3AZL C;  3REH C;  3AZI B;  3AZN D;  3X1S A;  5CPJ B;  5GXQ A;  1P3F D;  3A1K A;  4Z2M G;  2NZD A;  5B31 B;  5DNM B;  1ID3 D;  4Z5T D;  2ZY5 A;  2ZY4 A;  5AY8 A;  2YFW B;  5CP6 D;  3MGQ C;  5B33 C;  5FUG A;  4EO5 C;  1P3O C;  5F99 A;  3X1S D;  4R8P C;  2PYO B;  3WKJ A;  2CV5 C;  4LD9 C;  3MVD A;  3TU4 D;  1P3K C;  5GXQ D;  3VH5 W;  3KWQ C;  1U35 C;  4WNN B;  3AZH C;  5AVB C;  5AY8 D;  1ZLA B;  3UTA A;  5AV5 A;  1F66 B;  2ZY3 A;  4G92 C;  3WKJ D;  3X1T B;  3NQU B;  1HTA A;  4H9R A;  5B32 A;  2IO5 C;  5JRG C;  2RIQ A;  3AZG C;  3A1I A;  1HQ3 D;  2Y2H A;  4R8P A;  3LJA B;  3LZ1 B;  3UTA D;  5AVC B;  5AV5 D;  4H9P B;  1BH9 A;  3R45 B;  5AV6 C;  1P3F B;  3O62 B;  5B24 B;  5GT0 C;  1EQZ D;  1T3U A;  5B32 D;  3WTP C;  5AV8 B;  1B67 A;  4AWL C;  2ZY2 A;  1ULY A;  1TZY C;  1S32 A;  2UWX A;  3REJ C;  5B2I C;  2YFV B;  3AFA A;  2BG1 A;  4XZQ A;  5BNV B;  5GSU C;  1KX5 D;  4G91 B;  3A6N B;  2NZD B;  1KX4 C;  5B2J C;  5AV9 C;  3X1U C;  2BYM B;  4QLC C;  1S32 D;  3W98 B;  5F99 B;  3WKJ B;  4J8U B;  5GT0 A;  3B6F A;  3MVD B;  3AFA D;  5B40 D;  3REH B;  3REI C;  1TZY A;  5B0Y A;  3REJ A;  3AV2 D;  3UT9 C;  1M18 C;  4JJN C;  1KX3 C;  2JSS A;  1Q9C A;  3REK A;  3B6F D;  2NQB C;  4NE5 A;  4ZUX A;  5B33 B;  3AZF C;  3MGQ B;  3C1C C;  1P3O B;  5B0Y D;  3H0L C;  3AZI A;  4R8P B;  5C3I B;  3EG5 B;  4CSR A;  4YS3 C;  4M6B A;  4X23 C;  1WWS A;  1BH9 B;  3REI A;  4WU9 C;  3KSY A;  1P3M A;  1P3L A;  4XUJ C;  3AZH B;  3AZJ C;  5CPJ A;  3MGS C;  2ARO A;  4J8X C;  4ZUX D;  1KU5 A;  5GT3 C;  3AZK A;  5B31 A;  4H9S C;  2J8P A;  3AZI D;  4G92 B;  3B0B A;  1F1E A;  2PYO A;  4XZQ B;  1P3L D;  5CPJ D;  3MGR A;  3WAA C;  2ARO D;  5G49 A;  2F8N A;  4H9Q A;  4WNN A;  4YS3 A;  4YM6 C;  3X1V C;  3AZK D;  1P3B C;  5E5A C;  1P3I C;  3B0D C;  5B31 D;  4WU9 A;  5AV6 B;  3B0C T;  5B0Z C;  1ZLA A;  5GT0 B;  3AZJ A;  3B6F B;  5JA4 A;  4Z66 A;  1M19 C;  3AYW A;  3W99 C;  4AWL B;  2PYO D;  3LEL C;  3X1T A;  3NQU A;  5GT3 A;  1TZY B;  3MGR D;  5B0Y B;  1M1A C;  2F8N D;  5B32 G;  3REJ B;  5B1L A;  5B2I B;  3AN2 A;  4KGC C;  3LJA A;  3KXB C;  3C1B D;  3LZ1 A;  3REK B;  1ZLA D;  4Z66 D;  5AVC A;  3WAA A;  1F66 D;  5BT1 C;  3X1T D;  4YM6 A;  1P3B A;  5E5A A;  3KUY C;  5AV8 A;  5B1L D;  5B0Z A;  4CSR B;  1ID3 C;  2G5H C;  5CP6 C;  1W2E A;  3VH6 T;  3W99 A;  4NFT A;  3LJA D;  3REI B;  3LZ1 D;  3REL C;  1P3M B;  1P3P A;  1P3L B;  5AVC D;  3AZM A;  2YFV A;  3TU4 C;  2ARO B;  2JE5 A;  3UT9 B;  3O62 D;  3EPK A;  5BNV A;  5B24 D;  3A6N A;  3AZK B;  1AOI C;  5AV8 D;  1M18 B;  3KXB A;  4JJN B;  2JCH A;  1KX3 B;  4J8V C;  1TAF A;  2BYM A;  1P34 C;  3WA9 C;  3W98 A;  4J8U A;  3AZF B;  3KUY A;  3MGR B;  3AZM D;  3AZL A;  2Y2J A;  3REH A;  5G49 B;  2F8N B;  4H9Q B;  3W96 C;  4YS3 B;  3A6N D;  2Y2I A;  2NZD D;  3B6G C;  4X23 B;  4WU9 B;  4H9N A;  2RVQ C;  4WU8 C;  3AZJ B;  3IP4 C;  5JA4 B;  4Z66 B;  3AYW B;  2ZM5 A;  5CPI C;  1PZR A;  5F99 D;  5DNN C;  4J8X B;  3W98 D;  3MGP C;  4J8U D;  5GT3 B;  3MVD D;  2HIO C;  5BS7 C;  3REH D;  5B1L B;  5B33 A;  3AN2 B;  3MGQ A;  1P3O A;  5KDM A;  2CWE A;  3H0R C;  4LD9 A;  2CV5 A;  3VH6 W;  1P3K A;  3KWQ A;  3WAA B;  2Y2O A;  1U35 A;  4YM6 B;  4DRA A;  1P3B B;  3AZH A;  5E5A B;  3W97 C;  5AVB A;  3NQJ B;  2G5I C;  1P3G C;  2L5A A;  5B33 D;  5B0Z B;  3MGQ D;  1P3O D;  1M19 B;  2W8S A;  3W99 B;  5B31 G;  4R8P D;  2CV5 D;  1P3P B;  1R4V A;  3KWQ D;  3AZM B;  4HGA B;  1U35 D;  5JRG A;  3AZG A;  3MNN C;  3AZH D;  3P5J B;  1N1J A;  3KXB B;  3AV2 C;  2F8N G;  1TAF B;  5AV6 A;  3KUY B;  3WTP A;  3AZL B;  1P3G A;  5JRG D;  4XZQ D;  4H9O B;  3AZG D;  4H9N B;  3AL0 C;  3EPJ A;  5B2I A;  5CPK C;  4KUD C;  1Z2C B;  5AV6 D;  5GSU A;  4DRB A;  5GT0 D;  1AOI B;  1KX4 A;  5B2J A;  3C1B C;  5B1M C;  5AV9 A;  3X1U A;  4J8V B;  1TZY D;  4QLC A;  2Y2Q A;  4NE6 A;  4CAY A;  4EO5 B;  5KDM B;  3REJ D;  4LD9 B;  5B2I D;  3AV1 C;  2CV5 B;  1P3K B;  3KWQ B;  2Y2K A;  5BO0 B;  1U35 B;  4KHA A;  3REK D;  5AVB B;  3UTB C;  3B6G B;  3UT9 A;  5CPK A;  1M18 A;  2DQN C;  5DNN B;  4E44 A;  4J8W C;  5CPI B;  5DNM C;  2LY8 A;  4JJN A;  1KX3 A;  2Y2M A;  2NQB A;  2IO5 B;  3REI D;  5JRG B;  1P3M D;  3AZF A;  3AZG B;  3C1C A;  2BYK A;  1N1J B;  3UT9 D;  3AZE C;  3VH5 A;  3LZ0 C;  1M18 D;  4X23 A;  2Y2P A;  4JJN D;  1KX3 D;  2FJ7 C;  2DF4 C;  4XUJ A;  4UUZ A;  1P3A C;  2NQB D;  3W97 B;  3FDD A;  3WTP B;  3MGS A;  2F8N H;  4J8X A;  1P3G B;  1F66 C;  3AZF D;  3C1C D;  4H9S A;  2Y2G A;  4YS3 D;  4WU9 D;  4X23 D;  3AZN C;  5GSU B;  4XUJ D;  3MNN B;  4DQY B;  3AZJ D;  3MGS D;  3AYW D;  1KX4 B;  5B2J B;  4J8X D;  1P3F C;  5AV9 B;  3H0M C;  3X1U B;  5GT3 D;  3O62 C;  3X1V A;  1P3I A;  5B24 C;  4QLC B;  3LZ0 A;  4CAY B;  3NQJ A;  2FJ7 A;  3AN2 D;  4Z5T C;  1M19 A;  3LEL A;  4KHA B;  3X1S C;  3WAA D;  1M1A A;  5GXQ C;  5CPK B;  4YM6 D;  3X1V D;  1P3B D;  4KGC A;  5E5A D;  4ZBJ C;  4G91 C;  2NZD C;  5B0Z D;  2NQB B;  5AY8 C;  1M19 D;  3W99 D;  3C1B B;  3B0C W;  5B1M B;  3LEL D;  1P3P D;  3WKJ C;  3C1C B;  2BYK B;  3MVD C;  1M1A D;  3AV1 B;  4H9O A;  4KGC D;  1ID3 A;  1B6W A;  4Z5T A;  5CP6 A;  3WTP E;  3KXB D;  1HQ3 C;  3REL A;  2XD1 A;  4XUJ B;  4UUZ B;  3KFU G;  1JFI A;  3UTB B;  5BNX A;  1BH8 A;  3MGS B;  3UTA C;  5AV5 C;  3TU4 A;  5BT1 D;  4E45 A;  3KUY D;  1AOI A;  3AZL D;  4J8W B;  1EQZ C;  5B32 C;  4J8V A;  1P34 A;  3WA9 A;  2HUE C;  3REL D;  4WZS B;  5C3I C;  5BO0 A;  3W96 A;  3AZE B;  3X1V B;  1P3I B;  1KX5 C;  1AOI D;  3B0D B;  3LZ0 B;  3B6G A;  1H3O A;  1HQ3 A;  4WU8 A;  4J8V D;  2FJ7 B;  1P3A B;  1P34 D;  3WA9 D;  5CPI A;  5DNN A;  1S32 C;  3LEL B;  4LD9 D;  3MGP A;  1P3K D;  2HIO A;  1EQZ A;  5BS7 A;  1M1A B;  3AFA C;  3W96 D;  5B40 C;  4KGC B;  4XZQ C;  5AVB D;  3B6G D;  3AZN B;  2RVQ D;  4WU8 D;  3EPH A;  5CPI D;  5DNN D;  3MGP D;  1A7W A;  3W97 A;  1KX5 A;  2HIO D;  3B6F C;  1ID3 B;  4Z5T B;  5CP6 B;  2F2A C;  3EPL A;  5B0Y C;  3REL B;  2VQR A;  3X1S B;  3V9R A;  1JFI B;  5BNX B;  1BH8 B;  3TU4 B;  5GXQ B;  5B40 A;  3MNN A;  3W97 D;  4ZBJ B;  3REK C;  3WTP D;  1P3G D;  3AV2 A;  4ZUX C;  5AY8 B;  1P34 B;  3WA9 B;  5FUG B;  3AZI C;  4Z2M H;  3W96 B;  5GSU D;  3MNN D;  1P3M C;  1P3L C;  1KX4 D;  5B2J D;  3F6T A;  5CPJ C;  1H3O B;  1HQ3 B;  2ARO C;  5AV9 D;  4WU8 B;  3X1U D;  4QLC D;  4KUD A;  3AZK C;  3UTA B;  4WV4 B;  5AV5 B;  5B31 C;  3MGP B;  4UPK A;  2HIO B;  1EQZ B;  3C1B A;  4H9R B;  5B32 B;  5B1M A;  2PYO C;  2HUE B;  3MGR C;  3AV1 A;  5CPK D;  4KUD D;  1KX5 B;  2Y2L A;  1ZLA C;  3UTB A;  4Z66 C;  3AYW C;  5B1M D; 
#chains in the Genus database with same CATH homology
 3X1T C;  4J8W A;  1S32 B;  5DNM A;  3AV1 D;  1WWI A;  3V9R B;  5B1L C;  3AN2 C;  2YFW A;  3AFA B;  5B40 B;  3LJA C;  3LZ1 C;  3UTB D;  5AVC C;  3VH6 A;  3AV2 B;  3AZE A;  4J8W D;  5DNM D;  5AV8 C;  2F8N K;  5CHL B;  1P3A A;  4NE3 A;  1BFM A;  1F66 A;  3VH5 T;  1P3P C;  3AZM C;  2Y2N A;  4HGA C;  3AZE D;  1P3I D;  4WJ3 C;  3A6N C;  3LZ0 D;  4KUD B;  3AZN A;  2FJ7 D;  1P3A D;  4H9P A;  2FFF B;  3R45 A;  5F99 C;  1P3F A;  4ZUX B;  3O62 A;  3W98 C;  4J8U C;  5B24 A;  2XD5 A;  3AZL C;  3REH C;  3AZI B;  3AZN D;  3X1S A;  5CPJ B;  5GXQ A;  1P3F D;  3A1K A;  4Z2M G;  2NZD A;  5B31 B;  5DNM B;  1ID3 D;  4Z5T D;  2ZY5 A;  2ZY4 A;  5AY8 A;  2YFW B;  5CP6 D;  3MGQ C;  5B33 C;  5FUG A;  4EO5 C;  1P3O C;  5F99 A;  3X1S D;  4R8P C;  2PYO B;  3WKJ A;  2CV5 C;  4LD9 C;  3MVD A;  3TU4 D;  1P3K C;  5GXQ D;  3VH5 W;  3KWQ C;  1U35 C;  4WNN B;  3AZH C;  5AVB C;  5AY8 D;  1ZLA B;  3UTA A;  5AV5 A;  1F66 B;  2ZY3 A;  4G92 C;  3WKJ D;  3X1T B;  3NQU B;  1HTA A;  4H9R A;  5B32 A;  2IO5 C;  5JRG C;  2RIQ A;  3AZG C;  3A1I A;  1HQ3 D;  2Y2H A;  4R8P A;  3LJA B;  3LZ1 B;  3UTA D;  5AVC B;  5AV5 D;  4H9P B;  1BH9 A;  3R45 B;  5AV6 C;  1P3F B;  3O62 B;  5B24 B;  5GT0 C;  1EQZ D;  1T3U A;  5B32 D;  3WTP C;  5AV8 B;  1B67 A;  4AWL C;  2ZY2 A;  1ULY A;  1TZY C;  1S32 A;  2UWX A;  3REJ C;  5B2I C;  2YFV B;  3AFA A;  2BG1 A;  4XZQ A;  5BNV B;  5GSU C;  1KX5 D;  4G91 B;  3A6N B;  2NZD B;  1KX4 C;  5B2J C;  5AV9 C;  3X1U C;  2BYM B;  4QLC C;  1S32 D;  3W98 B;  5F99 B;  3WKJ B;  4J8U B;  5GT0 A;  3B6F A;  3MVD B;  3AFA D;  5B40 D;  3REH B;  3REI C;  1TZY A;  5B0Y A;  3REJ A;  3AV2 D;  3UT9 C;  1M18 C;  4JJN C;  1KX3 C;  2JSS A;  1Q9C A;  3REK A;  3B6F D;  2NQB C;  4NE5 A;  4ZUX A;  5B33 B;  3AZF C;  3MGQ B;  3C1C C;  1P3O B;  5B0Y D;  3H0L C;  3AZI A;  4R8P B;  5C3I B;  3EG5 B;  4CSR A;  4YS3 C;  4M6B A;  4X23 C;  1WWS A;  1BH9 B;  3REI A;  4WU9 C;  3KSY A;  1P3M A;  1P3L A;  4XUJ C;  3AZH B;  3AZJ C;  5CPJ A;  3MGS C;  2ARO A;  4J8X C;  4ZUX D;  1KU5 A;  5GT3 C;  3AZK A;  5B31 A;  4H9S C;  2J8P A;  3AZI D;  4G92 B;  3B0B A;  1F1E A;  2PYO A;  4XZQ B;  1P3L D;  5CPJ D;  3MGR A;  3WAA C;  2ARO D;  5G49 A;  2F8N A;  4H9Q A;  4WNN A;  4YS3 A;  4YM6 C;  3X1V C;  3AZK D;  1P3B C;  5E5A C;  1P3I C;  3B0D C;  5B31 D;  4WU9 A;  5AV6 B;  3B0C T;  5B0Z C;  1ZLA A;  5GT0 B;  3AZJ A;  3B6F B;  5JA4 A;  4Z66 A;  1M19 C;  3AYW A;  3W99 C;  4AWL B;  2PYO D;  3LEL C;  3X1T A;  3NQU A;  5GT3 A;  1TZY B;  3MGR D;  5B0Y B;  1M1A C;  2F8N D;  5B32 G;  3REJ B;  5B1L A;  5B2I B;  3AN2 A;  4KGC C;  3LJA A;  3KXB C;  3C1B D;  3LZ1 A;  3REK B;  1ZLA D;  4Z66 D;  5AVC A;  3WAA A;  1F66 D;  5BT1 C;  3X1T D;  4YM6 A;  1P3B A;  5E5A A;  3KUY C;  5AV8 A;  5B1L D;  5B0Z A;  4CSR B;  1ID3 C;  2G5H C;  5CP6 C;  1W2E A;  3VH6 T;  3W99 A;  4NFT A;  3LJA D;  3REI B;  3LZ1 D;  3REL C;  1P3M B;  1P3P A;  1P3L B;  5AVC D;  3AZM A;  2YFV A;  3TU4 C;  2ARO B;  2JE5 A;  3UT9 B;  3O62 D;  3EPK A;  5BNV A;  5B24 D;  3A6N A;  3AZK B;  1AOI C;  5AV8 D;  1M18 B;  3KXB A;  4JJN B;  2JCH A;  1KX3 B;  4J8V C;  1TAF A;  2BYM A;  1P34 C;  3WA9 C;  3W98 A;  4J8U A;  3AZF B;  3KUY A;  3MGR B;  3AZM D;  3AZL A;  2Y2J A;  3REH A;  5G49 B;  2F8N B;  4H9Q B;  3W96 C;  4YS3 B;  3A6N D;  2Y2I A;  2NZD D;  3B6G C;  4X23 B;  4WU9 B;  4H9N A;  2RVQ C;  4WU8 C;  3AZJ B;  3IP4 C;  5JA4 B;  4Z66 B;  3AYW B;  2ZM5 A;  5CPI C;  1PZR A;  5F99 D;  5DNN C;  4J8X B;  3W98 D;  3MGP C;  4J8U D;  5GT3 B;  3MVD D;  2HIO C;  5BS7 C;  3REH D;  5B1L B;  5B33 A;  3AN2 B;  3MGQ A;  1P3O A;  5KDM A;  2CWE A;  3H0R C;  4LD9 A;  2CV5 A;  3VH6 W;  1P3K A;  3KWQ A;  3WAA B;  2Y2O A;  1U35 A;  4YM6 B;  4DRA A;  1P3B B;  3AZH A;  5E5A B;  3W97 C;  5AVB A;  3NQJ B;  2G5I C;  1P3G C;  2L5A A;  5B33 D;  5B0Z B;  3MGQ D;  1P3O D;  1M19 B;  2W8S A;  3W99 B;  5B31 G;  4R8P D;  2CV5 D;  1P3P B;  1R4V A;  3KWQ D;  3AZM B;  4HGA B;  1U35 D;  5JRG A;  3AZG A;  3MNN C;  3AZH D;  3P5J B;  1N1J A;  3KXB B;  3AV2 C;  2F8N G;  1TAF B;  5AV6 A;  3KUY B;  3WTP A;  3AZL B;  1P3G A;  5JRG D;  4XZQ D;  4H9O B;  3AZG D;  4H9N B;  3AL0 C;  3EPJ A;  5B2I A;  5CPK C;  4KUD C;  1Z2C B;  5AV6 D;  5GSU A;  4DRB A;  5GT0 D;  1AOI B;  1KX4 A;  5B2J A;  3C1B C;  5B1M C;  5AV9 A;  3X1U A;  4J8V B;  1TZY D;  4QLC A;  2Y2Q A;  4NE6 A;  4CAY A;  4EO5 B;  5KDM B;  3REJ D;  4LD9 B;  5B2I D;  3AV1 C;  2CV5 B;  1P3K B;  3KWQ B;  2Y2K A;  5BO0 B;  1U35 B;  4KHA A;  3REK D;  5AVB B;  3UTB C;  3B6G B;  3UT9 A;  5CPK A;  1M18 A;  2DQN C;  5DNN B;  4E44 A;  4J8W C;  5CPI B;  5DNM C;  2LY8 A;  4JJN A;  1KX3 A;  2Y2M A;  2NQB A;  2IO5 B;  3REI D;  5JRG B;  1P3M D;  3AZF A;  3AZG B;  3C1C A;  2BYK A;  1N1J B;  3UT9 D;  3AZE C;  3VH5 A;  3LZ0 C;  1M18 D;  4X23 A;  2Y2P A;  4JJN D;  1KX3 D;  2FJ7 C;  2DF4 C;  4XUJ A;  4UUZ A;  1P3A C;  2NQB D;  3W97 B;  3FDD A;  3WTP B;  3MGS A;  2F8N H;  4J8X A;  1P3G B;  1F66 C;  3AZF D;  3C1C D;  4H9S A;  2Y2G A;  4YS3 D;  4WU9 D;  4X23 D;  3AZN C;  5GSU B;  4XUJ D;  3MNN B;  4DQY B;  3AZJ D;  3MGS D;  3AYW D;  1KX4 B;  5B2J B;  4J8X D;  1P3F C;  5AV9 B;  3H0M C;  3X1U B;  5GT3 D;  3O62 C;  3X1V A;  1P3I A;  5B24 C;  4QLC B;  3LZ0 A;  4CAY B;  3NQJ A;  2FJ7 A;  3AN2 D;  4Z5T C;  1M19 A;  3LEL A;  4KHA B;  3X1S C;  3WAA D;  1M1A A;  5GXQ C;  5CPK B;  4YM6 D;  3X1V D;  1P3B D;  4KGC A;  5E5A D;  4ZBJ C;  4G91 C;  2NZD C;  5B0Z D;  2NQB B;  5AY8 C;  1M19 D;  3W99 D;  3C1B B;  3B0C W;  5B1M B;  3LEL D;  1P3P D;  3WKJ C;  3C1C B;  2BYK B;  3MVD C;  1M1A D;  3AV1 B;  4H9O A;  4KGC D;  1ID3 A;  1B6W A;  4Z5T A;  5CP6 A;  3WTP E;  3KXB D;  1HQ3 C;  3REL A;  2XD1 A;  4XUJ B;  4UUZ B;  3KFU G;  1JFI A;  3UTB B;  5BNX A;  1BH8 A;  3MGS B;  3UTA C;  5AV5 C;  3TU4 A;  5BT1 D;  4E45 A;  3KUY D;  1AOI A;  3AZL D;  4J8W B;  1EQZ C;  5B32 C;  4J8V A;  1P34 A;  3WA9 A;  2HUE C;  3REL D;  4WZS B;  5C3I C;  5BO0 A;  3W96 A;  3AZE B;  3X1V B;  1P3I B;  1KX5 C;  1AOI D;  3B0D B;  3LZ0 B;  3B6G A;  1H3O A;  1HQ3 A;  4WU8 A;  4J8V D;  2FJ7 B;  1P3A B;  1P34 D;  3WA9 D;  5CPI A;  5DNN A;  1S32 C;  3LEL B;  4LD9 D;  3MGP A;  1P3K D;  2HIO A;  1EQZ A;  5BS7 A;  1M1A B;  3AFA C;  3W96 D;  5B40 C;  4KGC B;  4XZQ C;  5AVB D;  3B6G D;  3AZN B;  2RVQ D;  4WU8 D;  3EPH A;  5CPI D;  5DNN D;  3MGP D;  1A7W A;  3W97 A;  1KX5 A;  2HIO D;  3B6F C;  1ID3 B;  4Z5T B;  5CP6 B;  2F2A C;  3EPL A;  5B0Y C;  3REL B;  2VQR A;  3X1S B;  3V9R A;  1JFI B;  5BNX B;  1BH8 B;  3TU4 B;  5GXQ B;  5B40 A;  3MNN A;  3W97 D;  4ZBJ B;  3REK C;  3WTP D;  1P3G D;  3AV2 A;  4ZUX C;  5AY8 B;  1P34 B;  3WA9 B;  5FUG B;  3AZI C;  4Z2M H;  3W96 B;  5GSU D;  3MNN D;  1P3M C;  1P3L C;  1KX4 D;  5B2J D;  3F6T A;  5CPJ C;  1H3O B;  1HQ3 B;  2ARO C;  5AV9 D;  4WU8 B;  3X1U D;  4QLC D;  4KUD A;  3AZK C;  3UTA B;  4WV4 B;  5AV5 B;  5B31 C;  3MGP B;  4UPK A;  2HIO B;  1EQZ B;  3C1B A;  4H9R B;  5B32 B;  5B1M A;  2PYO C;  2HUE B;  3MGR C;  3AV1 A;  5CPK D;  4KUD D;  1KX5 B;  2Y2L A;  1ZLA C;  3UTB A;  4Z66 C;  3AYW C;  5B1M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...