3W99B

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99B00
2IO5C 5DNMB 3NQJA 3NQUA 1P3AA 1P3MC 4LD9C 1B6WA 3UT9D 3VH6T 3W96B 1P3FC 3TU4D 4J8WA 5B24A 3REHD 1ID3C 3MGSA 4H9RB 4EO5B 3AYWD 4Z2MG 4X23C 3AV1D 1KX5C 2HIOC 3C1BA 1ZLAB 1H3OA 3AN2A 5AVBC 3REHC 2FJ7A 3LZ0B 3X1VD 3LZ1B 2PYOA 1F66B 5B40D 3REKD 3UTAB 4KHAB 3X1VC 2HUEC 1P3FA 5E5AB 1BH8A 3RELD 3MNNC 3X1UB 3AFAB 1ID3A 5B33A 5G49A 4X23A 3MGQB 3AZLD 1KX5A 2CV5B 3R45B 1P34C 1WWIA 3X1SB 2HIOA 5B0ZA 3B6GC 2NZDC 4XUJD 5GT0C 3B0BA 5AVBA 3C1CB 2L5AA 2AROD 5BNXA 4QLCC 3AZFC 1P3BB 2BYKB 4CAYA 5B2ID 5CPIC 1P3GC 2CWEA 4XZQD 3KUYA 5BNVB 3A6NC 4UUZB 4Z66B 1KX4D 5AVCA 3AV2C 5AV8C 1M18C 3MNNA 5DNNB 5B32B 3O62D 1P34A 5B1MD 4J8XC 3B6GA 2NZDA 5GT0A 1BH9A 1S32C 4QLCA 3AZFA 5KDMA 3B0CW 5B1LC 1P3LB 4Z5TD 3W98D 5B1MC 1P3GA 3A6NA 4WU9C 3WKJC 1P3PB 5CP6D 4JJNB 1KX3C 3KXBA 3AZHA 4J8VB 3REID 3AV2A 1EQZD 4G91C 5AV8A 3AZLB 5CPJC 5AV6C 3W98C 2LY8A 2BYMB 4YM6B 4AWLC 4XUJB 3WAAB 1HQ3D 3AZMC 4YS3B 4WU8D 1P3OD 4KUDB 4NE5A 5CPKC 4J8XA 3MGRC 5AV5C 3X1TC 3V9RB 1S32A 1P3AD 5GT3C 4H9OB 3W97C 3AZJC 2NQBD 4XZQB 5BS7C 3B0DB 5B1LA 4KGCA 4H9SA 4R8PB 3MGSD 4WU9A 3WKJA 1KX3A 4DRAA 3W99C 5F99B 3MVDC 4DRBA 3C1BD 1N1JA 4G92B 5CPJA 5B2JC 5AV6A 3AZIB 4J8WC 5B24C 2FJ7D 5C3IB 5B0YB 5GSUC 2PYOD 3AZMA 5CPKA 3UTBA 5JA4B 5GXQB 3MGRA 5AV5A 3AZGB 3AZKA 3AN2C 3X1TA 3W97A 5GT3A 1P3MD 1B67A 1M19B 2YFWB 1P3FD 3LJAB 3MGPB 4J8UB 5JRGB 3REIB 1ID3D 5B33D 4H9PA 1ZLAC 3WTPC 4ZUXB 4X23D 1KX5D 3W99A 3LZ1C 3MVDA 1JFIB 2HIOD 5B0ZD 4WNNA 1U35C 5B2JA 4H9QB 5BO0B 5AVBD 4H9NB 3UTAC 5B33C 5GSUA 3REJC 3AZEC 3W96A 5BT1C 5B0ZC 2NQBB 3KUYD 5E5AC 3AFAC 4H9RA 5AVCD 3KWQB 1KU5A 3MGQC 2CV5C 4E45A 3LELB 3MNND 5AV9B 3KUYC 1ZLAA 3WTPA 4CSRB 1R4VA 3C1CC 5B31B 5AVCC 1P34D 3LZ1A 1M1AB 1P3BC 2F8NB 1U35A 3B6GD 2NZDD 5GT0D 3B6FB 3UTAA 4QLCD 3AZFD 4KHAA 2IO5B 3REJA 3AZEA 5CPID 1P3MB 4LD9B 1P3GD 5E5AA 3A6ND 1TZYB 3X1UA 3AFAA 1BH8B 5DNNC 3KXBD 3MGQA 3AV2D 2CV5A 5B32C 3R45A 5AV8D 3X1SA 1M18D 3UT9B 3C1CA 3TU4B 3KXBC 5AVBB 3REHB 3AZHC 3AYWB 1P3BA 2BYKA 4J8XD 3AV1B 1P3LC 3WA9C 1S32D 4UUZA 4Z66A 3VH5W 1P3PC 4JJNC 2YFVB 5B1LD 4KGCD 4J8VC 3X1VB 1AOIC 1P3KC 5B40B 4YM6C 4WU9D 3WKJD 3REKB 1KX3D 5DNNA 3VH6W 5B32A 5CPJD 4KGCC 5AV6D 4KUDC 4H9SC 5B32G 3AZMD 3RELB 5CPKD 3B0DC 1P3LA 3WA9A 3MGRD 5AV5D 5CHLB 3AZKD 3X1TD 5CPIB 3W97D 5GT3D 3AZJD 1P3PA 4JJNA 4J8VA 5F99C 1BFMA 2AROB 3UTBC 4G92C 1AOIA 3AV2B 3AZKC 5B2IB 2BYMA 4YM6A 3AZNC 1P3KA 1M18B 5C3IC 5B0YC 3W99D 4XUJA 3MVDD 3WAAA 4YS3A 5B2JD 1KX4B 4KUDA 4J8WD 5B24D 5GXQC 3AZGC 5GSUD 5AY8C 3V9RA 1P3IC 4H9OA 1P3OA 4XZQA 1M19C 1HTAA 3MGPC 3O62B 4J8UC 5JRGC 3AN2D 5DNMC 3VH5A 4R8PA 5B1MB 4ZBJB 4ZUXC 4NE6A 3W96C 5F99A 1TAFB 1KX3B 4E44A 1ZLAD 3AZIA 3AZNA 3WTPD 4HGAB 4Z5TB 3W98B 5B0YA 3VH6A 4EO5C 3LZ1D 1U35D 5CP6B 5FUGB 5JA4A 3UTAD 5GXQA 1EQZB 3AZGA 5AY8A 3REJD 1P3IA 2JSSA 3AZED 3LZ0C 3KWQC 1M19A 1ULYA 2YFWA 5BT1D 3AZJB 1F66C 5E5AD 3LELC 3LJAA 1HQ3B 3MGPA 4J8UA 5JRGA 3AFAD 4WU8B 5AV9C 5DNMA 1P3OB 4ZUXA 3MGQD 5B31C 4NFTA 2CV5D 3NQJB 3NQUB 1P3AB 1M1AC 3X1SD 1JFIA 3MVDB 4H9QA 5BO0A 3B6FC 4WNNB 4H9NA 3X1UC 3C1CD 4J8WB 5B24B 3MGSB 1P3BD 5GSUB 3X1SC 2NQBA 3B0CT 3C1BB 1TZYC 4Z66D 1H3OB 3LZ0A 3AN2B 3KWQA 2FJ7B 1F66A 3LELA 2PYOB 3UT9C 5AV9A 5DNND 4Z66C 4CSRA 5B31A 5B32D 3TU4C 3WTPB 1M1AA 3AYWC 2F8NA 3AV1C 3B6FA 1U35B 1P3FB 2RVQD 5B31G 3AZHD 1ID3B 5B33B 1F1EA 2F8NG 5G49B 4X23B 3REJB 1P3LD 1KX5B 3WA9D 1P3MA 4LD9A 3AZEB 2HIOB 5B0ZB 1TZYA 5B40C 2RVQC 1P3PD 4JJND 3REKC 4J8VD 5BNXB 2F8NK 1AOID 3UT9A 4CAYB 4YM6D 1P3KD 4WV4B 5BNVA 1WWSA 3KUYB 3TU4A 3WAAD 4YS3D 3RELC 3REHA 4KUDD 3AYWA 5AVCB 3AZLC 3AV1A 2HUEB 3MNNB 4XUJC 3WAAC 4YS3C 2YFVA 2AROC 1P34B 3X1VA 4R8PD 3B6GB 5B2IC 5B40A 2NZDB 4M6BA 5GT0B 1BH9B 4WZSB 3REKA 4XZQC 5F99D 4QLCB 3UTBD 3WTPE 3AZFB 5KDMB 1KX4C 3AZID 3AZND 4R8PC 5B0YD 1P3GB 3KSYA 3A6NB 3RELA 3KXBB 3AZHB 3AZLA 5GXQD 3AZGD 3O62C 3AZIC 5AV8B 5AY8D 5CPIA 1P3ID 3WA9B 4ZBJC 1M19D 3LJAD 3MGPD 2AROA 4J8UD 5JRGD 5DNMD 4J8XB 5B2IA 4ZUXD 4HGAC 1AOIB 1M18A 4Z5TC 1P3KB 1S32B 3W96D 1KX4A 3LJAC 5CP6C 5B1LB 4Z2MH 3REIC 4KGCB 1EQZC 4WU9B 3WKJB 4G91B 1HQ3C 3O62A 1N1JB 5CPJB 5AV6B 4WU8C 1P3OC 5B1MA 3LZ0D 3KWQD 4AWLB 1F66D 1P3AC 3LELD 1TAFA 3AZMB 2F8NH 1A7WA 2NQBC 5AV9D 5CPKB 3UTBB 3MGRB 5AV5B 4Z5TA 5B31D 3W98A 3AZKB 3AZNB 3X1TB 3W97B 5GT3B 1M1AD 3MGSC 2F8ND 1Q9CA 4NE3A 5FUGA 5CP6A 3B6FD 3REIA 3X1UD 1EQZA 3C1BC 4H9PB 5AY8B 1P3IB 2FJ7C 4LD9D 3AZJA 3VH5T 3W99B 5BS7A 2PYOC 1HQ3A 1TZYD 5B2JB 4WU8A
chains in the Genus database with same CATH superfamily
2IO5C 5DNMB 3NQJA 3NQUA 1P3AA 1P3MC 4LD9C 1B6WA 3UT9D 3VH6T 3W96B 1P3FC 3TU4D 4J8WA 5B24A 3REHD 1ID3C 3H0LC 3MGSA 4H9RB 4EO5B 3AYWD 4Z2MG 4X23C 3AV1D 1KX5C 2HIOC 3C1BA 1ZLAB 1H3OA 3AN2A 5AVBC 3REHC 2FJ7A 3LZ0B 3X1VD 3LZ1B 2PYOA 1F66B 2DF4C 5B40D 3REKD 3UTAB 4KHAB 3X1VC 2HUEC 4WJ3C 1P3FA 5E5AB 1BH8A 3RELD 3MNNC 3X1UB 3AFAB 1ID3A 5B33A 3H0MC 5G49A 4X23A 3MGQB 3AZLD 1KX5A 2CV5B 3R45B 1P34C 1WWIA 3X1SB 2HIOA 2DQNC 5B0ZA 3B6GC 2NZDC 4XUJD 5GT0C 3B0BA 5AVBA 3C1CB 2L5AA 2AROD 5BNXA 4QLCC 3AZFC 1P3BB 2BYKB 2UWXA 4CAYA 5CPIC 2ZY3A 5B2ID 1P3GC 2CWEA 4XZQD 3KUYA 5BNVB 3A6NC 4UUZB 4Z66B 1KX4D 5AVCA 3AV2C 5AV8C 1M18C 3MNNA 5DNNB 5B32B 3O62D 1P34A 5B1MD 4J8XC 3B6GA 2NZDA 5GT0A 1BH9A 1S32C 4QLCA 3AZFA 5KDMA 3B0CW 5B1LC 1P3LB 2Y2OA 4Z5TD 3W98D 2W8SA 5B1MC 1P3GA 3A6NA 4WU9C 3WKJC 1P3PB 5CP6D 4JJNB 1KX3C 3KXBA 3AZHA 4J8VB 3REID 3EPJA 3AV2A 1EQZD 4G91C 5AV8A 3AZLB 5CPJC 5AV6C 3W98C 2LY8A 2BYMB 4YM6B 4AWLC 4XUJB 3WAAB 1HQ3D 3AZMC 4YS3B 4WU8D 1P3OD 4KUDB 4NE5A 5CPKC 4J8XA 3MGRC 5AV5C 3X1TC 3V9RB 1S32A 1P3AD 5GT3C 4H9OB 3W97C 3EPKA 3AZJC 2NQBD 4XZQB 5BS7C 3B0DB 5B1LA 4KGCA 4H9SA 4R8PB 3MGSD 4WU9A 3WKJA 1KX3A 4DRAA 3W99C 5F99B 3MVDC 4DRBA 3C1BD 1N1JA 4G92B 5CPJA 5B2JC 5AV6A 3AZIB 4J8WC 5B24C 2FJ7D 5C3IB 5B0YB 2ZY2A 5GSUC 2PYOD 3AZMA 5CPKA 3UTBA 5JA4B 5GXQB 3MGRA 5AV5A 3AZGB 3AZKA 3AN2C 3X1TA 3W97A 5GT3A 1P3MD 1B67A 1M19B 2YFWB 1P3FD 2Y2QA 3LJAB 3MGPB 4J8UB 5JRGB 3REIB 1ID3D 5B33D 4H9PA 1ZLAC 3WTPC 4ZUXB 4X23D 1KX5D 3W99A 3LZ1C 3MVDA 1JFIB 1W2EA 2HIOD 5B0ZD 4WNNA 3FDDA 5B2JA 1U35C 4H9QB 5BO0B 5AVBD 4H9NB 3UTAC 5B33C 5GSUA 3REJC 2F2AC 3AZEC 3W96A 5BT1C 5B0ZC 2NQBB 3KUYD 5E5AC 4UPKA 3AFAC 2Y2PA 4H9RA 5AVCD 3KWQB 1KU5A 3MGQC 2CV5C 4E45A 3LELB 3MNND 5AV9B 3KUYC 1ZLAA 3WTPA 4CSRB 1R4VA 3C1CC 5B31B 2Y2JA 5AVCC 1P34D 3LZ1A 1M1AB 1P3BC 2F8NB 1U35A 3B6GD 2NZDD 5GT0D 3B6FB 3UTAA 4QLCD 3AZFD 2BG1A 4KHAA 2IO5B 3REJA 3EG5B 3AZEA 5CPID 1P3MB 4LD9B 1P3GD 5E5AA 3A6ND 1T3UA 1TZYB 3X1UA 3AFAA 1BH8B 5DNNC 3KXBD 3MGQA 3AV2D 2CV5A 5B32C 3R45A 5AV8D 3X1SA 1M18D 3UT9B 2XD1A 3IP4C 3C1CA 3TU4B 3KXBC 5AVBB 3REHB 3AZHC 3AYWB 1P3BA 2BYKA 4J8XD 2JE5A 3AV1B 1P3LC 3WA9C 1S32D 4UUZA 4Z66A 3VH5W 1P3PC 2ZY4A 2YFVB 4JJNC 5B1LD 4KGCD 4J8VC 3X1VB 1AOIC 1P3KC 5B40B 4YM6C 4WU9D 3WKJD 3REKB 1KX3D 5DNNA 3VH6W 5B32A 5CPJD 4KGCC 5AV6D 4KUDC 4H9SC 5B32G 3AZMD 3RELB 5CPKD 3B0DC 1P3LA 3WA9A 3MGRD 5AV5D 5CHLB 3AZKD 3X1TD 5CPIB 3W97D 5GT3D 3AZJD 1P3PA 4JJNA 2G5IC 4J8VA 5F99C 1BFMA 2AROB 3UTBC 4G92C 1AOIA 3AV2B 3AZKC 5B2IB 2BYMA 4YM6A 3AZNC 1P3KA 1M18B 5C3IC 5B0YC 3W99D 4XUJA 3MVDD 3WAAA 4YS3A 5B2JD 1KX4B 4KUDA 4J8WD 5B24D 5GXQC 2RIQA 3AZGC 5GSUD 5AY8C 3V9RA 1P3IC 4H9OA 1P3OA 4XZQA 1M19C 1HTAA 3EPHA 3MGPC 3O62B 2VQRA 5JRGC 4J8UC 3AN2D 5DNMC 3VH5A 4R8PA 5B1MB 4ZBJB 4ZUXC 4NE6A 3W96C 5F99A 1TAFB 1KX3B 2G5HC 4E44A 1ZLAD 3AZIA 3AZNA 3WTPD 4HGAB 4Z5TB 3W98B 5B0YA 3VH6A 4EO5C 2ZM5A 3H0RC 3LZ1D 1U35D 5CP6B 5FUGB 5JA4A 3UTAD 5GXQA 1EQZB 2JCHA 3AZGA 5AY8A 3REJD 1P3IA 2JSSA 3AZED 3LZ0C 3KWQC 1M19A 1ULYA 2YFWA 5BT1D 3AZJB 1F66C 5E5AD 3LELC 1PZRA 1HQ3B 3LJAA 3MGPA 4J8UA 5JRGA 3AFAD 4WU8B 5AV9C 5DNMA 1P3OB 4ZUXA 3MGQD 5B31C 4NFTA 2CV5D 3NQJB 3NQUB 1P3AB 1M1AC 3X1SD 1JFIA 2Y2NA 3MVDB 4H9QA 5BO0A 3B6FC 4WNNB 4H9NA 3X1UC 3C1CD 4J8WB 5B24B 3MGSB 1P3BD 5GSUB 2Y2MA 3X1SC 2NQBA 3B0CT 3C1BB 1TZYC 4Z66D 1H3OB 3LZ0A 3AN2B 3KWQA 2FJ7B 1F66A 3LELA 2PYOB 3UT9C 5AV9A 5DNND 4Z66C 4CSRA 5B31A 5B32D 3TU4C 3WTPB 1M1AA 3AYWC 2F8NA 3AV1C 3B6FA 1U35B 1P3FB 2RVQD 5B31G 3AZHD 1ID3B 5B33B 1F1EA 2F8NG 5G49B 4X23B 3REJB 1P3LD 1KX5B 3WA9D 1P3MA 4LD9A 3AZEB 3AL0C 2HIOB 5B0ZB 1TZYA 5B40C 2RVQC 2XD5A 1P3PD 4JJND 3REKC 4J8VD 3EPLA 5BNXB 2F8NK 1AOID 3UT9A 4CAYB 4YM6D 1P3KD 4WV4B 5BNVA 1WWSA 3KUYB 3TU4A 3WAAD 4YS3D 3RELC 3REHA 4KUDD 3AYWA 5AVCB 3AZLC 2ZY5A 3AV1A 2HUEB 3MNNB 4XUJC 3WAAC 4YS3C 2YFVA 2FFFB 2AROC 1P34B 3X1VA 4R8PD 3B6GB 5B2IC 2Y2HA 5B40A 4M6BA 2NZDB 5GT0B 1BH9B 4WZSB 3REKA 4XZQC 5F99D 4QLCB 3UTBD 3WTPE 3AZFB 5KDMB 1KX4C 3AZID 3AZND 4R8PC 5B0YD 1P3GB 3KSYA 3A6NB 3RELA 1Z2CB 3F6TA 3KXBB 3AZHB 3AZLA 5GXQD 3AZGD 3O62C 3AZIC 5AV8B 5AY8D 5CPIA 1P3ID 3WA9B 4ZBJC 3A1KA 1M19D 3LJAD 3MGPD 2AROA 4J8UD 5JRGD 5DNMD 4J8XB 5B2IA 4ZUXD 4HGAC 1AOIB 1M18A 4Z5TC 1P3KB 1S32B 3W96D 2J8PA 1KX4A 3LJAC 3A1IA 5CP6C 5B1LB 4Z2MH 3REIC 4KGCB 1EQZC 4WU9B 3WKJB 2Y2IA 4G91B 1HQ3C 3O62A 1N1JB 5CPJB 5AV6B 4WU8C 1P3OC 5B1MA 3LZ0D 2Y2LA 3KWQD 4AWLB 1F66D 2Y2KA 1P3AC 3LELD 1TAFA 3AZMB 4DQYB 1A7WA 2F8NH 2NQBC 5AV9D 5CPKB 3UTBB 3MGRB 5AV5B 4Z5TA 5B31D 3W98A 3AZKB 3AZNB 3X1TB 3KFUG 3W97B 5GT3B 1M1AD 3MGSC 2F8ND 1Q9CA 4NE3A 5FUGA 5CP6A 3B6FD 3REIA 3X1UD 1EQZA 3C1BC 4H9PB 5AY8B 2Y2GA 1P3IB 2FJ7C 4LD9D 3AZJA 3VH5T 3P5JB 3W99B 5BS7A 2PYOC 1HQ3A 1TZYD 5B2JB 4WU8A
chains in the Genus database with same CATH topology
2IO5C 5DNMB 3NQJA 3NQUA 1P3AA 1P3MC 4LD9C 1B6WA 3UT9D 3VH6T 3W96B 1P3FC 3TU4D 4J8WA 5B24A 3REHD 1ID3C 3H0LC 3MGSA 4H9RB 4EO5B 3AYWD 4Z2MG 4X23C 3AV1D 1KX5C 2HIOC 3C1BA 1ZLAB 1H3OA 3AN2A 5AVBC 3REHC 2FJ7A 3LZ0B 3X1VD 3LZ1B 2PYOA 1F66B 2DF4C 5B40D 3REKD 3UTAB 4KHAB 3X1VC 2HUEC 4WJ3C 1P3FA 5E5AB 1BH8A 3RELD 3MNNC 3X1UB 3AFAB 1ID3A 5B33A 3H0MC 5G49A 4X23A 3MGQB 3AZLD 1KX5A 2CV5B 3R45B 1P34C 1WWIA 3X1SB 2HIOA 2DQNC 5B0ZA 3B6GC 2NZDC 4XUJD 5GT0C 3B0BA 5AVBA 3C1CB 2L5AA 2AROD 5BNXA 4QLCC 3AZFC 1P3BB 2BYKB 2UWXA 4CAYA 5CPIC 2ZY3A 5B2ID 1P3GC 2CWEA 4XZQD 3KUYA 5BNVB 3A6NC 4UUZB 4Z66B 1KX4D 5AVCA 3AV2C 5AV8C 1M18C 3MNNA 5DNNB 5B32B 3O62D 1P34A 5B1MD 4J8XC 3B6GA 2NZDA 5GT0A 1BH9A 1S32C 4QLCA 3AZFA 5KDMA 3B0CW 5B1LC 1P3LB 2Y2OA 4Z5TD 3W98D 2W8SA 5B1MC 1P3GA 3A6NA 4WU9C 3WKJC 1P3PB 5CP6D 4JJNB 1KX3C 3KXBA 3AZHA 4J8VB 3REID 3EPJA 3AV2A 1EQZD 4G91C 5AV8A 3AZLB 5CPJC 5AV6C 3W98C 2LY8A 2BYMB 4YM6B 4AWLC 4XUJB 3WAAB 1HQ3D 3AZMC 4YS3B 4WU8D 1P3OD 4KUDB 4NE5A 5CPKC 4J8XA 3MGRC 5AV5C 3X1TC 3V9RB 1S32A 1P3AD 5GT3C 4H9OB 3W97C 3EPKA 3AZJC 2NQBD 4XZQB 5BS7C 3B0DB 5B1LA 4KGCA 4H9SA 4R8PB 3MGSD 4WU9A 3WKJA 1KX3A 4DRAA 3W99C 5F99B 3MVDC 4DRBA 3C1BD 1N1JA 4G92B 5CPJA 5B2JC 5AV6A 3AZIB 4J8WC 5B24C 2FJ7D 5C3IB 5B0YB 2ZY2A 5GSUC 2PYOD 3AZMA 5CPKA 3UTBA 5JA4B 5GXQB 3MGRA 5AV5A 3AZGB 3AZKA 3AN2C 3X1TA 3W97A 5GT3A 1P3MD 1B67A 1M19B 2YFWB 1P3FD 2Y2QA 3LJAB 3MGPB 4J8UB 5JRGB 3REIB 1ID3D 5B33D 4H9PA 1ZLAC 3WTPC 4ZUXB 4X23D 1KX5D 3W99A 3LZ1C 3MVDA 1JFIB 1W2EA 2HIOD 5B0ZD 4WNNA 3FDDA 5B2JA 1U35C 4H9QB 5BO0B 5AVBD 4H9NB 3UTAC 5B33C 5GSUA 3REJC 2F2AC 3AZEC 3W96A 5BT1C 5B0ZC 2NQBB 3KUYD 5E5AC 4UPKA 3AFAC 2Y2PA 4H9RA 5AVCD 3KWQB 1KU5A 3MGQC 2CV5C 4E45A 3LELB 3MNND 5AV9B 3KUYC 1ZLAA 3WTPA 4CSRB 1R4VA 3C1CC 5B31B 2Y2JA 5AVCC 1P34D 3LZ1A 1M1AB 1P3BC 2F8NB 1U35A 3B6GD 2NZDD 5GT0D 3B6FB 3UTAA 4QLCD 3AZFD 2BG1A 4KHAA 2IO5B 3REJA 3EG5B 3AZEA 5CPID 1P3MB 4LD9B 1P3GD 5E5AA 3A6ND 1T3UA 1TZYB 3X1UA 3AFAA 1BH8B 5DNNC 3KXBD 3MGQA 3AV2D 2CV5A 5B32C 3R45A 5AV8D 3X1SA 1M18D 3UT9B 2XD1A 3IP4C 3C1CA 3TU4B 3KXBC 5AVBB 3REHB 3AZHC 3AYWB 1P3BA 2BYKA 4J8XD 2JE5A 3AV1B 1P3LC 3WA9C 1S32D 4UUZA 4Z66A 3VH5W 1P3PC 2ZY4A 2YFVB 4JJNC 5B1LD 4KGCD 4J8VC 3X1VB 1AOIC 1P3KC 5B40B 4YM6C 4WU9D 3WKJD 3REKB 1KX3D 5DNNA 3VH6W 5B32A 5CPJD 4KGCC 5AV6D 4KUDC 4H9SC 5B32G 3AZMD 3RELB 5CPKD 3B0DC 1P3LA 3WA9A 3MGRD 5AV5D 5CHLB 3AZKD 3X1TD 5CPIB 3W97D 5GT3D 3AZJD 1P3PA 4JJNA 2G5IC 4J8VA 5F99C 1BFMA 2AROB 3UTBC 4G92C 1AOIA 3AV2B 3AZKC 5B2IB 2BYMA 4YM6A 3AZNC 1P3KA 1M18B 5C3IC 5B0YC 3W99D 4XUJA 3MVDD 3WAAA 4YS3A 5B2JD 1KX4B 4KUDA 4J8WD 5B24D 5GXQC 2RIQA 3AZGC 5GSUD 5AY8C 3V9RA 1P3IC 4H9OA 1P3OA 4XZQA 1M19C 1HTAA 3EPHA 3MGPC 3O62B 2VQRA 5JRGC 4J8UC 3AN2D 5DNMC 3VH5A 4R8PA 5B1MB 4ZBJB 4ZUXC 4NE6A 3W96C 5F99A 1TAFB 1KX3B 2G5HC 4E44A 1ZLAD 3AZIA 3AZNA 3WTPD 4HGAB 4Z5TB 3W98B 5B0YA 3VH6A 4EO5C 2ZM5A 3H0RC 3LZ1D 1U35D 5CP6B 5FUGB 5JA4A 3UTAD 5GXQA 1EQZB 2JCHA 3AZGA 5AY8A 3REJD 1P3IA 2JSSA 3AZED 3LZ0C 3KWQC 1M19A 1ULYA 2YFWA 5BT1D 3AZJB 1F66C 5E5AD 3LELC 1PZRA 1HQ3B 3LJAA 3MGPA 4J8UA 5JRGA 3AFAD 4WU8B 5AV9C 5DNMA 1P3OB 4ZUXA 3MGQD 5B31C 4NFTA 2CV5D 3NQJB 3NQUB 1P3AB 1M1AC 3X1SD 1JFIA 2Y2NA 3MVDB 4H9QA 5BO0A 3B6FC 4WNNB 4H9NA 3X1UC 3C1CD 4J8WB 5B24B 3MGSB 1P3BD 5GSUB 2Y2MA 3X1SC 2NQBA 3B0CT 3C1BB 1TZYC 4Z66D 1H3OB 3LZ0A 3AN2B 3KWQA 2FJ7B 1F66A 3LELA 2PYOB 3UT9C 5AV9A 5DNND 4Z66C 4CSRA 5B31A 5B32D 3TU4C 3WTPB 1M1AA 3AYWC 2F8NA 3AV1C 3B6FA 1U35B 1P3FB 2RVQD 5B31G 3AZHD 1ID3B 5B33B 1F1EA 2F8NG 5G49B 4X23B 3REJB 1P3LD 1KX5B 3WA9D 1P3MA 4LD9A 3AZEB 3AL0C 2HIOB 5B0ZB 1TZYA 5B40C 2RVQC 2XD5A 1P3PD 4JJND 3REKC 4J8VD 3EPLA 5BNXB 2F8NK 1AOID 3UT9A 4CAYB 4YM6D 1P3KD 4WV4B 5BNVA 1WWSA 3KUYB 3TU4A 3WAAD 4YS3D 3RELC 3REHA 4KUDD 3AYWA 5AVCB 3AZLC 2ZY5A 3AV1A 2HUEB 3MNNB 4XUJC 3WAAC 4YS3C 2YFVA 2FFFB 2AROC 1P34B 3X1VA 4R8PD 3B6GB 5B2IC 2Y2HA 5B40A 4M6BA 2NZDB 5GT0B 1BH9B 4WZSB 3REKA 4XZQC 5F99D 4QLCB 3UTBD 3WTPE 3AZFB 5KDMB 1KX4C 3AZID 3AZND 4R8PC 5B0YD 1P3GB 3KSYA 3A6NB 3RELA 1Z2CB 3F6TA 3KXBB 3AZHB 3AZLA 5GXQD 3AZGD 3O62C 3AZIC 5AV8B 5AY8D 5CPIA 1P3ID 3WA9B 4ZBJC 3A1KA 1M19D 3LJAD 3MGPD 2AROA 4J8UD 5JRGD 5DNMD 4J8XB 5B2IA 4ZUXD 4HGAC 1AOIB 1M18A 4Z5TC 1P3KB 1S32B 3W96D 2J8PA 1KX4A 3LJAC 3A1IA 5CP6C 5B1LB 4Z2MH 3REIC 4KGCB 1EQZC 4WU9B 3WKJB 2Y2IA 4G91B 1HQ3C 3O62A 1N1JB 5CPJB 5AV6B 4WU8C 1P3OC 5B1MA 3LZ0D 2Y2LA 3KWQD 4AWLB 1F66D 2Y2KA 1P3AC 3LELD 1TAFA 3AZMB 4DQYB 1A7WA 2F8NH 2NQBC 5AV9D 5CPKB 3UTBB 3MGRB 5AV5B 4Z5TA 5B31D 3W98A 3AZKB 3AZNB 3X1TB 3KFUG 3W97B 5GT3B 1M1AD 3MGSC 2F8ND 1Q9CA 4NE3A 5FUGA 5CP6A 3B6FD 3REIA 3X1UD 1EQZA 3C1BC 4H9PB 5AY8B 2Y2GA 1P3IB 2FJ7C 4LD9D 3AZJA 3VH5T 3P5JB 3W99B 5BS7A 2PYOC 1HQ3A 1TZYD 5B2JB 4WU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO5 C;  5DNM B;  3NQJ A;  3NQU A;  1P3A A;  1P3M C;  4LD9 C;  1B6W A;  3UT9 D;  3VH6 T;  3W96 B;  1P3F C;  3TU4 D;  4J8W A;  5B24 A;  3REH D;  1ID3 C;  3MGS A;  4H9R B;  4EO5 B;  3AYW D;  4Z2M G;  4X23 C;  3AV1 D;  1KX5 C;  2HIO C;  3C1B A;  1ZLA B;  1H3O A;  3AN2 A;  5AVB C;  3REH C;  2FJ7 A;  3LZ0 B;  3X1V D;  3LZ1 B;  2PYO A;  1F66 B;  5B40 D;  3REK D;  3UTA B;  4KHA B;  3X1V C;  2HUE C;  1P3F A;  5E5A B;  1BH8 A;  3REL D;  3MNN C;  3X1U B;  3AFA B;  1ID3 A;  5B33 A;  5G49 A;  4X23 A;  3MGQ B;  3AZL D;  1KX5 A;  2CV5 B;  3R45 B;  1P34 C;  1WWI A;  3X1S B;  2HIO A;  5B0Z A;  3B6G C;  2NZD C;  4XUJ D;  5GT0 C;  3B0B A;  5AVB A;  3C1C B;  2L5A A;  2ARO D;  5BNX A;  4QLC C;  3AZF C;  1P3B B;  2BYK B;  4CAY A;  5B2I D;  5CPI C;  1P3G C;  2CWE A;  4XZQ D;  3KUY A;  5BNV B;  3A6N C;  4UUZ B;  4Z66 B;  1KX4 D;  5AVC A;  3AV2 C;  5AV8 C;  1M18 C;  3MNN A;  5DNN B;  5B32 B;  3O62 D;  1P34 A;  5B1M D;  4J8X C;  3B6G A;  2NZD A;  5GT0 A;  1BH9 A;  1S32 C;  4QLC A;  3AZF A;  5KDM A;  3B0C W;  5B1L C;  1P3L B;  4Z5T D;  3W98 D;  5B1M C;  1P3G A;  3A6N A;  4WU9 C;  3WKJ C;  1P3P B;  5CP6 D;  4JJN B;  1KX3 C;  3KXB A;  3AZH A;  4J8V B;  3REI D;  3AV2 A;  1EQZ D;  4G91 C;  5AV8 A;  3AZL B;  5CPJ C;  5AV6 C;  3W98 C;  2LY8 A;  2BYM B;  4YM6 B;  4AWL C;  4XUJ B;  3WAA B;  1HQ3 D;  3AZM C;  4YS3 B;  4WU8 D;  1P3O D;  4KUD B;  4NE5 A;  5CPK C;  4J8X A;  3MGR C;  5AV5 C;  3X1T C;  3V9R B;  1S32 A;  1P3A D;  5GT3 C;  4H9O B;  3W97 C;  3AZJ C;  2NQB D;  4XZQ B;  5BS7 C;  3B0D B;  5B1L A;  4KGC A;  4H9S A;  4R8P B;  3MGS D;  4WU9 A;  3WKJ A;  1KX3 A;  4DRA A;  3W99 C;  5F99 B;  3MVD C;  4DRB A;  3C1B D;  1N1J A;  4G92 B;  5CPJ A;  5B2J C;  5AV6 A;  3AZI B;  4J8W C;  5B24 C;  2FJ7 D;  5C3I B;  5B0Y B;  5GSU C;  2PYO D;  3AZM A;  5CPK A;  3UTB A;  5JA4 B;  5GXQ B;  3MGR A;  5AV5 A;  3AZG B;  3AZK A;  3AN2 C;  3X1T A;  3W97 A;  5GT3 A;  1P3M D;  1B67 A;  1M19 B;  2YFW B;  1P3F D;  3LJA B;  3MGP B;  4J8U B;  5JRG B;  3REI B;  1ID3 D;  5B33 D;  4H9P A;  1ZLA C;  3WTP C;  4ZUX B;  4X23 D;  1KX5 D;  3W99 A;  3LZ1 C;  3MVD A;  1JFI B;  2HIO D;  5B0Z D;  4WNN A;  1U35 C;  5B2J A;  4H9Q B;  5BO0 B;  5AVB D;  4H9N B;  3UTA C;  5B33 C;  5GSU A;  3REJ C;  3AZE C;  3W96 A;  5BT1 C;  5B0Z C;  2NQB B;  3KUY D;  5E5A C;  3AFA C;  4H9R A;  5AVC D;  3KWQ B;  1KU5 A;  3MGQ C;  2CV5 C;  4E45 A;  3LEL B;  3MNN D;  5AV9 B;  3KUY C;  1ZLA A;  3WTP A;  4CSR B;  1R4V A;  3C1C C;  5B31 B;  5AVC C;  1P34 D;  3LZ1 A;  1M1A B;  1P3B C;  2F8N B;  1U35 A;  3B6G D;  2NZD D;  5GT0 D;  3B6F B;  3UTA A;  4QLC D;  3AZF D;  4KHA A;  2IO5 B;  3REJ A;  3AZE A;  5CPI D;  1P3M B;  4LD9 B;  1P3G D;  5E5A A;  3A6N D;  1TZY B;  3X1U A;  3AFA A;  1BH8 B;  5DNN C;  3KXB D;  3MGQ A;  3AV2 D;  2CV5 A;  5B32 C;  3R45 A;  5AV8 D;  3X1S A;  1M18 D;  3UT9 B;  3C1C A;  3TU4 B;  3KXB C;  5AVB B;  3REH B;  3AZH C;  3AYW B;  1P3B A;  2BYK A;  4J8X D;  3AV1 B;  1P3L C;  3WA9 C;  1S32 D;  4UUZ A;  4Z66 A;  3VH5 W;  1P3P C;  4JJN C;  2YFV B;  5B1L D;  4KGC D;  4J8V C;  3X1V B;  1AOI C;  1P3K C;  5B40 B;  4YM6 C;  4WU9 D;  3WKJ D;  3REK B;  1KX3 D;  5DNN A;  3VH6 W;  5B32 A;  5CPJ D;  4KGC C;  5AV6 D;  4KUD C;  4H9S C;  5B32 G;  3AZM D;  3REL B;  5CPK D;  3B0D C;  1P3L A;  3WA9 A;  3MGR D;  5AV5 D;  5CHL B;  3AZK D;  3X1T D;  5CPI B;  3W97 D;  5GT3 D;  3AZJ D;  1P3P A;  4JJN A;  4J8V A;  5F99 C;  1BFM A;  2ARO B;  3UTB C;  4G92 C;  1AOI A;  3AV2 B;  3AZK C;  5B2I B;  2BYM A;  4YM6 A;  3AZN C;  1P3K A;  1M18 B;  5C3I C;  5B0Y C;  3W99 D;  4XUJ A;  3MVD D;  3WAA A;  4YS3 A;  5B2J D;  1KX4 B;  4KUD A;  4J8W D;  5B24 D;  5GXQ C;  3AZG C;  5GSU D;  5AY8 C;  3V9R A;  1P3I C;  4H9O A;  1P3O A;  4XZQ A;  1M19 C;  1HTA A;  3MGP C;  3O62 B;  4J8U C;  5JRG C;  3AN2 D;  5DNM C;  3VH5 A;  4R8P A;  5B1M B;  4ZBJ B;  4ZUX C;  4NE6 A;  3W96 C;  5F99 A;  1TAF B;  1KX3 B;  4E44 A;  1ZLA D;  3AZI A;  3AZN A;  3WTP D;  4HGA B;  4Z5T B;  3W98 B;  5B0Y A;  3VH6 A;  4EO5 C;  3LZ1 D;  1U35 D;  5CP6 B;  5FUG B;  5JA4 A;  3UTA D;  5GXQ A;  1EQZ B;  3AZG A;  5AY8 A;  3REJ D;  1P3I A;  2JSS A;  3AZE D;  3LZ0 C;  3KWQ C;  1M19 A;  1ULY A;  2YFW A;  5BT1 D;  3AZJ B;  1F66 C;  5E5A D;  3LEL C;  3LJA A;  1HQ3 B;  3MGP A;  4J8U A;  5JRG A;  3AFA D;  4WU8 B;  5AV9 C;  5DNM A;  1P3O B;  4ZUX A;  3MGQ D;  5B31 C;  4NFT A;  2CV5 D;  3NQJ B;  3NQU B;  1P3A B;  1M1A C;  3X1S D;  1JFI A;  3MVD B;  4H9Q A;  5BO0 A;  3B6F C;  4WNN B;  4H9N A;  3X1U C;  3C1C D;  4J8W B;  5B24 B;  3MGS B;  1P3B D;  5GSU B;  3X1S C;  2NQB A;  3B0C T;  3C1B B;  1TZY C;  4Z66 D;  1H3O B;  3LZ0 A;  3AN2 B;  3KWQ A;  2FJ7 B;  1F66 A;  3LEL A;  2PYO B;  3UT9 C;  5AV9 A;  5DNN D;  4Z66 C;  4CSR A;  5B31 A;  5B32 D;  3TU4 C;  3WTP B;  1M1A A;  3AYW C;  2F8N A;  3AV1 C;  3B6F A;  1U35 B;  1P3F B;  2RVQ D;  5B31 G;  3AZH D;  1ID3 B;  5B33 B;  1F1E A;  2F8N G;  5G49 B;  4X23 B;  3REJ B;  1P3L D;  1KX5 B;  3WA9 D;  1P3M A;  4LD9 A;  3AZE B;  2HIO B;  5B0Z B;  1TZY A;  5B40 C;  2RVQ C;  1P3P D;  4JJN D;  3REK C;  4J8V D;  5BNX B;  2F8N K;  1AOI D;  3UT9 A;  4CAY B;  4YM6 D;  1P3K D;  4WV4 B;  5BNV A;  1WWS A;  3KUY B;  3TU4 A;  3WAA D;  4YS3 D;  3REL C;  3REH A;  4KUD D;  3AYW A;  5AVC B;  3AZL C;  3AV1 A;  2HUE B;  3MNN B;  4XUJ C;  3WAA C;  4YS3 C;  2YFV A;  2ARO C;  1P34 B;  3X1V A;  4R8P D;  3B6G B;  5B2I C;  5B40 A;  2NZD B;  4M6B A;  5GT0 B;  1BH9 B;  4WZS B;  3REK A;  4XZQ C;  5F99 D;  4QLC B;  3UTB D;  3WTP E;  3AZF B;  5KDM B;  1KX4 C;  3AZI D;  3AZN D;  4R8P C;  5B0Y D;  1P3G B;  3KSY A;  3A6N B;  3REL A;  3KXB B;  3AZH B;  3AZL A;  5GXQ D;  3AZG D;  3O62 C;  3AZI C;  5AV8 B;  5AY8 D;  5CPI A;  1P3I D;  3WA9 B;  4ZBJ C;  1M19 D;  3LJA D;  3MGP D;  2ARO A;  4J8U D;  5JRG D;  5DNM D;  4J8X B;  5B2I A;  4ZUX D;  4HGA C;  1AOI B;  1M18 A;  4Z5T C;  1P3K B;  1S32 B;  3W96 D;  1KX4 A;  3LJA C;  5CP6 C;  5B1L B;  4Z2M H;  3REI C;  4KGC B;  1EQZ C;  4WU9 B;  3WKJ B;  4G91 B;  1HQ3 C;  3O62 A;  1N1J B;  5CPJ B;  5AV6 B;  4WU8 C;  1P3O C;  5B1M A;  3LZ0 D;  3KWQ D;  4AWL B;  1F66 D;  1P3A C;  3LEL D;  1TAF A;  3AZM B;  2F8N H;  1A7W A;  2NQB C;  5AV9 D;  5CPK B;  3UTB B;  3MGR B;  5AV5 B;  4Z5T A;  5B31 D;  3W98 A;  3AZK B;  3AZN B;  3X1T B;  3W97 B;  5GT3 B;  1M1A D;  3MGS C;  2F8N D;  1Q9C A;  4NE3 A;  5FUG A;  5CP6 A;  3B6F D;  3REI A;  3X1U D;  1EQZ A;  3C1B C;  4H9P B;  5AY8 B;  1P3I B;  2FJ7 C;  4LD9 D;  3AZJ A;  3VH5 T;  3W99 B;  5BS7 A;  2PYO C;  1HQ3 A;  1TZY D;  5B2J B;  4WU8 A; 
#chains in the Genus database with same CATH topology
 2IO5 C;  5DNM B;  3NQJ A;  3NQU A;  1P3A A;  1P3M C;  4LD9 C;  1B6W A;  3UT9 D;  3VH6 T;  3W96 B;  1P3F C;  3TU4 D;  4J8W A;  5B24 A;  3REH D;  1ID3 C;  3H0L C;  3MGS A;  4H9R B;  4EO5 B;  3AYW D;  4Z2M G;  4X23 C;  3AV1 D;  1KX5 C;  2HIO C;  3C1B A;  1ZLA B;  1H3O A;  3AN2 A;  5AVB C;  3REH C;  2FJ7 A;  3LZ0 B;  3X1V D;  3LZ1 B;  2PYO A;  1F66 B;  2DF4 C;  5B40 D;  3REK D;  3UTA B;  4KHA B;  3X1V C;  2HUE C;  4WJ3 C;  1P3F A;  5E5A B;  1BH8 A;  3REL D;  3MNN C;  3X1U B;  3AFA B;  1ID3 A;  5B33 A;  3H0M C;  5G49 A;  4X23 A;  3MGQ B;  3AZL D;  1KX5 A;  2CV5 B;  3R45 B;  1P34 C;  1WWI A;  3X1S B;  2HIO A;  2DQN C;  5B0Z A;  3B6G C;  2NZD C;  4XUJ D;  5GT0 C;  3B0B A;  5AVB A;  3C1C B;  2L5A A;  2ARO D;  5BNX A;  4QLC C;  3AZF C;  1P3B B;  2BYK B;  2UWX A;  4CAY A;  5CPI C;  2ZY3 A;  5B2I D;  1P3G C;  2CWE A;  4XZQ D;  3KUY A;  5BNV B;  3A6N C;  4UUZ B;  4Z66 B;  1KX4 D;  5AVC A;  3AV2 C;  5AV8 C;  1M18 C;  3MNN A;  5DNN B;  5B32 B;  3O62 D;  1P34 A;  5B1M D;  4J8X C;  3B6G A;  2NZD A;  5GT0 A;  1BH9 A;  1S32 C;  4QLC A;  3AZF A;  5KDM A;  3B0C W;  5B1L C;  1P3L B;  2Y2O A;  4Z5T D;  3W98 D;  2W8S A;  5B1M C;  1P3G A;  3A6N A;  4WU9 C;  3WKJ C;  1P3P B;  5CP6 D;  4JJN B;  1KX3 C;  3KXB A;  3AZH A;  4J8V B;  3REI D;  3EPJ A;  3AV2 A;  1EQZ D;  4G91 C;  5AV8 A;  3AZL B;  5CPJ C;  5AV6 C;  3W98 C;  2LY8 A;  2BYM B;  4YM6 B;  4AWL C;  4XUJ B;  3WAA B;  1HQ3 D;  3AZM C;  4YS3 B;  4WU8 D;  1P3O D;  4KUD B;  4NE5 A;  5CPK C;  4J8X A;  3MGR C;  5AV5 C;  3X1T C;  3V9R B;  1S32 A;  1P3A D;  5GT3 C;  4H9O B;  3W97 C;  3EPK A;  3AZJ C;  2NQB D;  4XZQ B;  5BS7 C;  3B0D B;  5B1L A;  4KGC A;  4H9S A;  4R8P B;  3MGS D;  4WU9 A;  3WKJ A;  1KX3 A;  4DRA A;  3W99 C;  5F99 B;  3MVD C;  4DRB A;  3C1B D;  1N1J A;  4G92 B;  5CPJ A;  5B2J C;  5AV6 A;  3AZI B;  4J8W C;  5B24 C;  2FJ7 D;  5C3I B;  5B0Y B;  2ZY2 A;  5GSU C;  2PYO D;  3AZM A;  5CPK A;  3UTB A;  5JA4 B;  5GXQ B;  3MGR A;  5AV5 A;  3AZG B;  3AZK A;  3AN2 C;  3X1T A;  3W97 A;  5GT3 A;  1P3M D;  1B67 A;  1M19 B;  2YFW B;  1P3F D;  2Y2Q A;  3LJA B;  3MGP B;  4J8U B;  5JRG B;  3REI B;  1ID3 D;  5B33 D;  4H9P A;  1ZLA C;  3WTP C;  4ZUX B;  4X23 D;  1KX5 D;  3W99 A;  3LZ1 C;  3MVD A;  1JFI B;  1W2E A;  2HIO D;  5B0Z D;  4WNN A;  3FDD A;  5B2J A;  1U35 C;  4H9Q B;  5BO0 B;  5AVB D;  4H9N B;  3UTA C;  5B33 C;  5GSU A;  3REJ C;  2F2A C;  3AZE C;  3W96 A;  5BT1 C;  5B0Z C;  2NQB B;  3KUY D;  5E5A C;  4UPK A;  3AFA C;  2Y2P A;  4H9R A;  5AVC D;  3KWQ B;  1KU5 A;  3MGQ C;  2CV5 C;  4E45 A;  3LEL B;  3MNN D;  5AV9 B;  3KUY C;  1ZLA A;  3WTP A;  4CSR B;  1R4V A;  3C1C C;  5B31 B;  2Y2J A;  5AVC C;  1P34 D;  3LZ1 A;  1M1A B;  1P3B C;  2F8N B;  1U35 A;  3B6G D;  2NZD D;  5GT0 D;  3B6F B;  3UTA A;  4QLC D;  3AZF D;  2BG1 A;  4KHA A;  2IO5 B;  3REJ A;  3EG5 B;  3AZE A;  5CPI D;  1P3M B;  4LD9 B;  1P3G D;  5E5A A;  3A6N D;  1T3U A;  1TZY B;  3X1U A;  3AFA A;  1BH8 B;  5DNN C;  3KXB D;  3MGQ A;  3AV2 D;  2CV5 A;  5B32 C;  3R45 A;  5AV8 D;  3X1S A;  1M18 D;  3UT9 B;  2XD1 A;  3IP4 C;  3C1C A;  3TU4 B;  3KXB C;  5AVB B;  3REH B;  3AZH C;  3AYW B;  1P3B A;  2BYK A;  4J8X D;  2JE5 A;  3AV1 B;  1P3L C;  3WA9 C;  1S32 D;  4UUZ A;  4Z66 A;  3VH5 W;  1P3P C;  2ZY4 A;  2YFV B;  4JJN C;  5B1L D;  4KGC D;  4J8V C;  3X1V B;  1AOI C;  1P3K C;  5B40 B;  4YM6 C;  4WU9 D;  3WKJ D;  3REK B;  1KX3 D;  5DNN A;  3VH6 W;  5B32 A;  5CPJ D;  4KGC C;  5AV6 D;  4KUD C;  4H9S C;  5B32 G;  3AZM D;  3REL B;  5CPK D;  3B0D C;  1P3L A;  3WA9 A;  3MGR D;  5AV5 D;  5CHL B;  3AZK D;  3X1T D;  5CPI B;  3W97 D;  5GT3 D;  3AZJ D;  1P3P A;  4JJN A;  2G5I C;  4J8V A;  5F99 C;  1BFM A;  2ARO B;  3UTB C;  4G92 C;  1AOI A;  3AV2 B;  3AZK C;  5B2I B;  2BYM A;  4YM6 A;  3AZN C;  1P3K A;  1M18 B;  5C3I C;  5B0Y C;  3W99 D;  4XUJ A;  3MVD D;  3WAA A;  4YS3 A;  5B2J D;  1KX4 B;  4KUD A;  4J8W D;  5B24 D;  5GXQ C;  2RIQ A;  3AZG C;  5GSU D;  5AY8 C;  3V9R A;  1P3I C;  4H9O A;  1P3O A;  4XZQ A;  1M19 C;  1HTA A;  3EPH A;  3MGP C;  3O62 B;  2VQR A;  5JRG C;  4J8U C;  3AN2 D;  5DNM C;  3VH5 A;  4R8P A;  5B1M B;  4ZBJ B;  4ZUX C;  4NE6 A;  3W96 C;  5F99 A;  1TAF B;  1KX3 B;  2G5H C;  4E44 A;  1ZLA D;  3AZI A;  3AZN A;  3WTP D;  4HGA B;  4Z5T B;  3W98 B;  5B0Y A;  3VH6 A;  4EO5 C;  2ZM5 A;  3H0R C;  3LZ1 D;  1U35 D;  5CP6 B;  5FUG B;  5JA4 A;  3UTA D;  5GXQ A;  1EQZ B;  2JCH A;  3AZG A;  5AY8 A;  3REJ D;  1P3I A;  2JSS A;  3AZE D;  3LZ0 C;  3KWQ C;  1M19 A;  1ULY A;  2YFW A;  5BT1 D;  3AZJ B;  1F66 C;  5E5A D;  3LEL C;  1PZR A;  1HQ3 B;  3LJA A;  3MGP A;  4J8U A;  5JRG A;  3AFA D;  4WU8 B;  5AV9 C;  5DNM A;  1P3O B;  4ZUX A;  3MGQ D;  5B31 C;  4NFT A;  2CV5 D;  3NQJ B;  3NQU B;  1P3A B;  1M1A C;  3X1S D;  1JFI A;  2Y2N A;  3MVD B;  4H9Q A;  5BO0 A;  3B6F C;  4WNN B;  4H9N A;  3X1U C;  3C1C D;  4J8W B;  5B24 B;  3MGS B;  1P3B D;  5GSU B;  2Y2M A;  3X1S C;  2NQB A;  3B0C T;  3C1B B;  1TZY C;  4Z66 D;  1H3O B;  3LZ0 A;  3AN2 B;  3KWQ A;  2FJ7 B;  1F66 A;  3LEL A;  2PYO B;  3UT9 C;  5AV9 A;  5DNN D;  4Z66 C;  4CSR A;  5B31 A;  5B32 D;  3TU4 C;  3WTP B;  1M1A A;  3AYW C;  2F8N A;  3AV1 C;  3B6F A;  1U35 B;  1P3F B;  2RVQ D;  5B31 G;  3AZH D;  1ID3 B;  5B33 B;  1F1E A;  2F8N G;  5G49 B;  4X23 B;  3REJ B;  1P3L D;  1KX5 B;  3WA9 D;  1P3M A;  4LD9 A;  3AZE B;  3AL0 C;  2HIO B;  5B0Z B;  1TZY A;  5B40 C;  2RVQ C;  2XD5 A;  1P3P D;  4JJN D;  3REK C;  4J8V D;  3EPL A;  5BNX B;  2F8N K;  1AOI D;  3UT9 A;  4CAY B;  4YM6 D;  1P3K D;  4WV4 B;  5BNV A;  1WWS A;  3KUY B;  3TU4 A;  3WAA D;  4YS3 D;  3REL C;  3REH A;  4KUD D;  3AYW A;  5AVC B;  3AZL C;  2ZY5 A;  3AV1 A;  2HUE B;  3MNN B;  4XUJ C;  3WAA C;  4YS3 C;  2YFV A;  2FFF B;  2ARO C;  1P34 B;  3X1V A;  4R8P D;  3B6G B;  5B2I C;  2Y2H A;  5B40 A;  4M6B A;  2NZD B;  5GT0 B;  1BH9 B;  4WZS B;  3REK A;  4XZQ C;  5F99 D;  4QLC B;  3UTB D;  3WTP E;  3AZF B;  5KDM B;  1KX4 C;  3AZI D;  3AZN D;  4R8P C;  5B0Y D;  1P3G B;  3KSY A;  3A6N B;  3REL A;  1Z2C B;  3F6T A;  3KXB B;  3AZH B;  3AZL A;  5GXQ D;  3AZG D;  3O62 C;  3AZI C;  5AV8 B;  5AY8 D;  5CPI A;  1P3I D;  3WA9 B;  4ZBJ C;  3A1K A;  1M19 D;  3LJA D;  3MGP D;  2ARO A;  4J8U D;  5JRG D;  5DNM D;  4J8X B;  5B2I A;  4ZUX D;  4HGA C;  1AOI B;  1M18 A;  4Z5T C;  1P3K B;  1S32 B;  3W96 D;  2J8P A;  1KX4 A;  3LJA C;  3A1I A;  5CP6 C;  5B1L B;  4Z2M H;  3REI C;  4KGC B;  1EQZ C;  4WU9 B;  3WKJ B;  2Y2I A;  4G91 B;  1HQ3 C;  3O62 A;  1N1J B;  5CPJ B;  5AV6 B;  4WU8 C;  1P3O C;  5B1M A;  3LZ0 D;  2Y2L A;  3KWQ D;  4AWL B;  1F66 D;  2Y2K A;  1P3A C;  3LEL D;  1TAF A;  3AZM B;  4DQY B;  1A7W A;  2F8N H;  2NQB C;  5AV9 D;  5CPK B;  3UTB B;  3MGR B;  5AV5 B;  4Z5T A;  5B31 D;  3W98 A;  3AZK B;  3AZN B;  3X1T B;  3KFU G;  3W97 B;  5GT3 B;  1M1A D;  3MGS C;  2F8N D;  1Q9C A;  4NE3 A;  5FUG A;  5CP6 A;  3B6F D;  3REI A;  3X1U D;  1EQZ A;  3C1B C;  4H9P B;  5AY8 B;  2Y2G A;  1P3I B;  2FJ7 C;  4LD9 D;  3AZJ A;  3VH5 T;  3P5J B;  3W99 B;  5BS7 A;  2PYO C;  1HQ3 A;  1TZY D;  5B2J B;  4WU8 A; 
#chains in the Genus database with same CATH homology
 2IO5 C;  5DNM B;  3NQJ A;  3NQU A;  1P3A A;  1P3M C;  4LD9 C;  1B6W A;  3UT9 D;  3VH6 T;  3W96 B;  1P3F C;  3TU4 D;  4J8W A;  5B24 A;  3REH D;  1ID3 C;  3H0L C;  3MGS A;  4H9R B;  4EO5 B;  3AYW D;  4Z2M G;  4X23 C;  3AV1 D;  1KX5 C;  2HIO C;  3C1B A;  1ZLA B;  1H3O A;  3AN2 A;  5AVB C;  3REH C;  2FJ7 A;  3LZ0 B;  3X1V D;  3LZ1 B;  2PYO A;  1F66 B;  2DF4 C;  5B40 D;  3REK D;  3UTA B;  4KHA B;  3X1V C;  2HUE C;  4WJ3 C;  1P3F A;  5E5A B;  1BH8 A;  3REL D;  3MNN C;  3X1U B;  3AFA B;  1ID3 A;  5B33 A;  3H0M C;  5G49 A;  4X23 A;  3MGQ B;  3AZL D;  1KX5 A;  2CV5 B;  3R45 B;  1P34 C;  1WWI A;  3X1S B;  2HIO A;  2DQN C;  5B0Z A;  3B6G C;  2NZD C;  4XUJ D;  5GT0 C;  3B0B A;  5AVB A;  3C1C B;  2L5A A;  2ARO D;  5BNX A;  4QLC C;  3AZF C;  1P3B B;  2BYK B;  2UWX A;  4CAY A;  5CPI C;  2ZY3 A;  5B2I D;  1P3G C;  2CWE A;  4XZQ D;  3KUY A;  5BNV B;  3A6N C;  4UUZ B;  4Z66 B;  1KX4 D;  5AVC A;  3AV2 C;  5AV8 C;  1M18 C;  3MNN A;  5DNN B;  5B32 B;  3O62 D;  1P34 A;  5B1M D;  4J8X C;  3B6G A;  2NZD A;  5GT0 A;  1BH9 A;  1S32 C;  4QLC A;  3AZF A;  5KDM A;  3B0C W;  5B1L C;  1P3L B;  2Y2O A;  4Z5T D;  3W98 D;  2W8S A;  5B1M C;  1P3G A;  3A6N A;  4WU9 C;  3WKJ C;  1P3P B;  5CP6 D;  4JJN B;  1KX3 C;  3KXB A;  3AZH A;  4J8V B;  3REI D;  3EPJ A;  3AV2 A;  1EQZ D;  4G91 C;  5AV8 A;  3AZL B;  5CPJ C;  5AV6 C;  3W98 C;  2LY8 A;  2BYM B;  4YM6 B;  4AWL C;  4XUJ B;  3WAA B;  1HQ3 D;  3AZM C;  4YS3 B;  4WU8 D;  1P3O D;  4KUD B;  4NE5 A;  5CPK C;  4J8X A;  3MGR C;  5AV5 C;  3X1T C;  3V9R B;  1S32 A;  1P3A D;  5GT3 C;  4H9O B;  3W97 C;  3EPK A;  3AZJ C;  2NQB D;  4XZQ B;  5BS7 C;  3B0D B;  5B1L A;  4KGC A;  4H9S A;  4R8P B;  3MGS D;  4WU9 A;  3WKJ A;  1KX3 A;  4DRA A;  3W99 C;  5F99 B;  3MVD C;  4DRB A;  3C1B D;  1N1J A;  4G92 B;  5CPJ A;  5B2J C;  5AV6 A;  3AZI B;  4J8W C;  5B24 C;  2FJ7 D;  5C3I B;  5B0Y B;  2ZY2 A;  5GSU C;  2PYO D;  3AZM A;  5CPK A;  3UTB A;  5JA4 B;  5GXQ B;  3MGR A;  5AV5 A;  3AZG B;  3AZK A;  3AN2 C;  3X1T A;  3W97 A;  5GT3 A;  1P3M D;  1B67 A;  1M19 B;  2YFW B;  1P3F D;  2Y2Q A;  3LJA B;  3MGP B;  4J8U B;  5JRG B;  3REI B;  1ID3 D;  5B33 D;  4H9P A;  1ZLA C;  3WTP C;  4ZUX B;  4X23 D;  1KX5 D;  3W99 A;  3LZ1 C;  3MVD A;  1JFI B;  1W2E A;  2HIO D;  5B0Z D;  4WNN A;  3FDD A;  5B2J A;  1U35 C;  4H9Q B;  5BO0 B;  5AVB D;  4H9N B;  3UTA C;  5B33 C;  5GSU A;  3REJ C;  2F2A C;  3AZE C;  3W96 A;  5BT1 C;  5B0Z C;  2NQB B;  3KUY D;  5E5A C;  4UPK A;  3AFA C;  2Y2P A;  4H9R A;  5AVC D;  3KWQ B;  1KU5 A;  3MGQ C;  2CV5 C;  4E45 A;  3LEL B;  3MNN D;  5AV9 B;  3KUY C;  1ZLA A;  3WTP A;  4CSR B;  1R4V A;  3C1C C;  5B31 B;  2Y2J A;  5AVC C;  1P34 D;  3LZ1 A;  1M1A B;  1P3B C;  2F8N B;  1U35 A;  3B6G D;  2NZD D;  5GT0 D;  3B6F B;  3UTA A;  4QLC D;  3AZF D;  2BG1 A;  4KHA A;  2IO5 B;  3REJ A;  3EG5 B;  3AZE A;  5CPI D;  1P3M B;  4LD9 B;  1P3G D;  5E5A A;  3A6N D;  1T3U A;  1TZY B;  3X1U A;  3AFA A;  1BH8 B;  5DNN C;  3KXB D;  3MGQ A;  3AV2 D;  2CV5 A;  5B32 C;  3R45 A;  5AV8 D;  3X1S A;  1M18 D;  3UT9 B;  2XD1 A;  3IP4 C;  3C1C A;  3TU4 B;  3KXB C;  5AVB B;  3REH B;  3AZH C;  3AYW B;  1P3B A;  2BYK A;  4J8X D;  2JE5 A;  3AV1 B;  1P3L C;  3WA9 C;  1S32 D;  4UUZ A;  4Z66 A;  3VH5 W;  1P3P C;  2ZY4 A;  2YFV B;  4JJN C;  5B1L D;  4KGC D;  4J8V C;  3X1V B;  1AOI C;  1P3K C;  5B40 B;  4YM6 C;  4WU9 D;  3WKJ D;  3REK B;  1KX3 D;  5DNN A;  3VH6 W;  5B32 A;  5CPJ D;  4KGC C;  5AV6 D;  4KUD C;  4H9S C;  5B32 G;  3AZM D;  3REL B;  5CPK D;  3B0D C;  1P3L A;  3WA9 A;  3MGR D;  5AV5 D;  5CHL B;  3AZK D;  3X1T D;  5CPI B;  3W97 D;  5GT3 D;  3AZJ D;  1P3P A;  4JJN A;  2G5I C;  4J8V A;  5F99 C;  1BFM A;  2ARO B;  3UTB C;  4G92 C;  1AOI A;  3AV2 B;  3AZK C;  5B2I B;  2BYM A;  4YM6 A;  3AZN C;  1P3K A;  1M18 B;  5C3I C;  5B0Y C;  3W99 D;  4XUJ A;  3MVD D;  3WAA A;  4YS3 A;  5B2J D;  1KX4 B;  4KUD A;  4J8W D;  5B24 D;  5GXQ C;  2RIQ A;  3AZG C;  5GSU D;  5AY8 C;  3V9R A;  1P3I C;  4H9O A;  1P3O A;  4XZQ A;  1M19 C;  1HTA A;  3EPH A;  3MGP C;  3O62 B;  2VQR A;  5JRG C;  4J8U C;  3AN2 D;  5DNM C;  3VH5 A;  4R8P A;  5B1M B;  4ZBJ B;  4ZUX C;  4NE6 A;  3W96 C;  5F99 A;  1TAF B;  1KX3 B;  2G5H C;  4E44 A;  1ZLA D;  3AZI A;  3AZN A;  3WTP D;  4HGA B;  4Z5T B;  3W98 B;  5B0Y A;  3VH6 A;  4EO5 C;  2ZM5 A;  3H0R C;  3LZ1 D;  1U35 D;  5CP6 B;  5FUG B;  5JA4 A;  3UTA D;  5GXQ A;  1EQZ B;  2JCH A;  3AZG A;  5AY8 A;  3REJ D;  1P3I A;  2JSS A;  3AZE D;  3LZ0 C;  3KWQ C;  1M19 A;  1ULY A;  2YFW A;  5BT1 D;  3AZJ B;  1F66 C;  5E5A D;  3LEL C;  1PZR A;  1HQ3 B;  3LJA A;  3MGP A;  4J8U A;  5JRG A;  3AFA D;  4WU8 B;  5AV9 C;  5DNM A;  1P3O B;  4ZUX A;  3MGQ D;  5B31 C;  4NFT A;  2CV5 D;  3NQJ B;  3NQU B;  1P3A B;  1M1A C;  3X1S D;  1JFI A;  2Y2N A;  3MVD B;  4H9Q A;  5BO0 A;  3B6F C;  4WNN B;  4H9N A;  3X1U C;  3C1C D;  4J8W B;  5B24 B;  3MGS B;  1P3B D;  5GSU B;  2Y2M A;  3X1S C;  2NQB A;  3B0C T;  3C1B B;  1TZY C;  4Z66 D;  1H3O B;  3LZ0 A;  3AN2 B;  3KWQ A;  2FJ7 B;  1F66 A;  3LEL A;  2PYO B;  3UT9 C;  5AV9 A;  5DNN D;  4Z66 C;  4CSR A;  5B31 A;  5B32 D;  3TU4 C;  3WTP B;  1M1A A;  3AYW C;  2F8N A;  3AV1 C;  3B6F A;  1U35 B;  1P3F B;  2RVQ D;  5B31 G;  3AZH D;  1ID3 B;  5B33 B;  1F1E A;  2F8N G;  5G49 B;  4X23 B;  3REJ B;  1P3L D;  1KX5 B;  3WA9 D;  1P3M A;  4LD9 A;  3AZE B;  3AL0 C;  2HIO B;  5B0Z B;  1TZY A;  5B40 C;  2RVQ C;  2XD5 A;  1P3P D;  4JJN D;  3REK C;  4J8V D;  3EPL A;  5BNX B;  2F8N K;  1AOI D;  3UT9 A;  4CAY B;  4YM6 D;  1P3K D;  4WV4 B;  5BNV A;  1WWS A;  3KUY B;  3TU4 A;  3WAA D;  4YS3 D;  3REL C;  3REH A;  4KUD D;  3AYW A;  5AVC B;  3AZL C;  2ZY5 A;  3AV1 A;  2HUE B;  3MNN B;  4XUJ C;  3WAA C;  4YS3 C;  2YFV A;  2FFF B;  2ARO C;  1P34 B;  3X1V A;  4R8P D;  3B6G B;  5B2I C;  2Y2H A;  5B40 A;  4M6B A;  2NZD B;  5GT0 B;  1BH9 B;  4WZS B;  3REK A;  4XZQ C;  5F99 D;  4QLC B;  3UTB D;  3WTP E;  3AZF B;  5KDM B;  1KX4 C;  3AZI D;  3AZN D;  4R8P C;  5B0Y D;  1P3G B;  3KSY A;  3A6N B;  3REL A;  1Z2C B;  3F6T A;  3KXB B;  3AZH B;  3AZL A;  5GXQ D;  3AZG D;  3O62 C;  3AZI C;  5AV8 B;  5AY8 D;  5CPI A;  1P3I D;  3WA9 B;  4ZBJ C;  3A1K A;  1M19 D;  3LJA D;  3MGP D;  2ARO A;  4J8U D;  5JRG D;  5DNM D;  4J8X B;  5B2I A;  4ZUX D;  4HGA C;  1AOI B;  1M18 A;  4Z5T C;  1P3K B;  1S32 B;  3W96 D;  2J8P A;  1KX4 A;  3LJA C;  3A1I A;  5CP6 C;  5B1L B;  4Z2M H;  3REI C;  4KGC B;  1EQZ C;  4WU9 B;  3WKJ B;  2Y2I A;  4G91 B;  1HQ3 C;  3O62 A;  1N1J B;  5CPJ B;  5AV6 B;  4WU8 C;  1P3O C;  5B1M A;  3LZ0 D;  2Y2L A;  3KWQ D;  4AWL B;  1F66 D;  2Y2K A;  1P3A C;  3LEL D;  1TAF A;  3AZM B;  4DQY B;  1A7W A;  2F8N H;  2NQB C;  5AV9 D;  5CPK B;  3UTB B;  3MGR B;  5AV5 B;  4Z5T A;  5B31 D;  3W98 A;  3AZK B;  3AZN B;  3X1T B;  3KFU G;  3W97 B;  5GT3 B;  1M1A D;  3MGS C;  2F8N D;  1Q9C A;  4NE3 A;  5FUG A;  5CP6 A;  3B6F D;  3REI A;  3X1U D;  1EQZ A;  3C1B C;  4H9P B;  5AY8 B;  2Y2G A;  1P3I B;  2FJ7 C;  4LD9 D;  3AZJ A;  3VH5 T;  3P5J B;  3W99 B;  5BS7 A;  2PYO C;  1HQ3 A;  1TZY D;  5B2J B;  4WU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...