1ZLAC

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNWERDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/virus/dna
molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaC00
4KGCA 5B40D 3WTPC 3WTPD 4UUZA 3REJC 5B24B 1M1AC 1M19C 3W98C 3LELD 3C1CB 3B0CT 4ZUXA 5B0ZD 3B0CW 3X1SA 1P3MB 3UT9A 3KXBC 2BYKA 5B0YC 3AZEA 3C1CA 3LELB 3AZLA 1P3PC 3B0BA 4J8WA 4KHAB 2PYOD 5BT1C 3X1SB 5CP6D 4XZQB 4YM6B 3WKJC 5AVBB 2BYKB 3AZEB 3AYWA 3AZFA 3X1VA 1EQZB 5E5AB 5CPJA 1KX5C 1ULYA 5CPKD 3AZKD 4DRBA 3AYWB 4J8XA 5GXQB 3AZND 3UTAC 3C1BC 1B67A 4UUZB 5CPKA 2F8NA 5AV5C 2HUEB 4EO5B 5B40B 1TAFA 1P3LB 5JRGD 4XUJB 5B1LD 3AFAB 3UT9B 3R45A 3MGRC 1P34D 3O62A 3REKB 3REKC 3VH5A 1R4VA 5C3IB 3X1VD 3AZFD 5CPIB 1KX3B 2YFWB 4XUJD 5GT3D 3X1TA 1P3ID 2CWEA 1KX4D 5DNND 4X23C 5AV9A 3X1VB 3X1SD 3NQJB 4J8WD 3AZHA 3REIB 3VH6T 3MGRD 3AZMC 4JJNC 3AZED 2AROB 5AV9B 1KU5A 2BYMA 3W96D 1P3KD 5E5AC 1TZYC 5E5AD 4KGCD 3AZIC 5G49B 5B31B 3AZJA 3MGRB 3AN2A 3KXBA 1P3BC 3TU4C 5B0YA 4JJND 3AZEC 4E45A 5B32C 5B40A 1P3KB 4J8WC 5CP6B 1ID3B 2IO5C 3O62B 3AN2D 1F66D 5B0YB 1ZLAD 1P3LD 5B2IC 5CPIA 1P3KA 3X1TB 1U35A 5B1MD 1P34B 1P3GA 1M18D 2CV5B 3MVDB 3AV1A 1F66B 3REIA 1U35B 4DRAA 4Z2MH 4WNNB 1P3AC 1KX4A 4Z5TC 3MVDA 3KUYD 1P3BB 3KWQC 5AV5A 3LELC 1P3PB 3MGSB 3AZNC 5G49A 5B31A 3KXBB 5AY8D 5BS7C 2AROC 3RELB 3B6GD 1HQ3A 3UTBC 3W99B 5AV5B 4E44A 3LJAB 3MGQA 5B2IB 1ID3A 3AZGC 5B24C 1P3MA 4WU9A 5FUGB 1P3AD 1AOIB 3X1UA 5B0ZB 5CP6C 3LJAA 4J8WB 3MNNA 1KX3C 5B2JB 1P3MD 4CAYA 1AOIA 3A6NC 1H3OB 1BH8B 1P34C 4EO5C 5B2JD 1EQZA 5AV8D 4WU8D 2F8NH 4WNNA 3TU4D 4CAYB 4H9QB 4Z66D 5B0ZC 1M19A 2FJ7A 3W98A 1H3OA 2PYOA 3MGSA 1BH8A 5CHLB 4R8PD 3REJD 1M1AD 4LD9A 3W97A 1HQ3B 5CPKB 3WAAB 3AZKB 5CPIC 5B2IA 4WU9B 5FUGA 3V9RB 4Z66C 1P3GC 1M18B 3W97B 2YFVB 5AVBC 3B6FD 3MNND 2RVQD 4QLCD 3LJAD 1ZLAA 2HIOA 4XUJC 5DNNC 3X1SC 3WKJB 2F8NG 3REIC 4WU9D 4H9NB 3B6FB 1KX3D 3VH5W 4YM6A 3KXBD 3WA9D 1M19B 5BS7A 3LZ1A 2AROA 3W98B 3B6FA 5GSUD 5AV5D 5DNMA 3UTAD 2NZDC 1ID3C 4LD9B 3AFAC 3AZJB 3MGRA 5AVCA 2F8NK 5GT0C 5GSUB 3X1UC 4J8XB 5GXQA 1A7WA 1P3FC 1M18A 3KUYC 5AVCB 2YFVA 3WTPE 3MGPC 5GSUA 5AV9C 1TAFB 1P3LA 5BT1D 4NE5A 3O62D 1EQZD 5AV8B 4WU8B 1P3GB 1P34A 1EQZC 3REKA 4YS3D 4YS3C 2CV5A 4G91C 3AZGD 4AWLC 4WZSB 3AZJC 4H9OB 4LD9C 3B6GC 1P3BA 3X1UD 4QLCA 3W96A 1N1JA 1TZYB 5CPJD 4Z5TD 4QLCB 2BYMB 1JFIA 1N1JB 1TZYA 4M6BA 4WV4B 5BNVA 3A6NB 4LD9D 3REJA 1M1AA 4R8PA 5GT0B 1P3OD 3WA9C 4Z5TB 5F99A 2FJ7D 5AV8A 4WU8A 5B2JA 3REID 3UT9D 1S32A 4Z5TA 3MVDC 3LZ1C 1AOID 3AV2C 3WAAC 2F8ND 1P3GD 5GT3B 4H9OA 5B33C 3WTPA 1P3IB 5AVBD 5AVCC 1Q9CA 4J8XD 5GXQC 5BO0B 4HGAB 1ID3D 3REHC 3TU4B 4G91B 3MGPA 3C1CC 3C1BD 3AZLC 3AYWD 1P3PA 5B31C 3REJB 1M1AB 2NQBC 3V9RA 3RELA 5CPKC 1BH9B 1HQ3C 5F99B 3MGPB 4J8UA 2HIOB 3X1VC 3O62C 1F1EA 3LZ0B 4H9NA 1BH9A 3NQUA 3X1UB 5B0ZA 3LJAC 4J8UB 4QLCC 2FJ7C 3MNNB 3W99C 4ZUXD 3UTBB 5GT3A 5B1MA 3X1TD 1P3IA 1P3FD 3AZIB 5C3IC 3W97C 5AY8B 3RELD 5AY8C 4H9SC 3KWQB 4H9PA 4NE3A 5B1LA 4R8PC 5GT0D 1P3OB 4H9QA 4KUDB 2PYOB 4KUDC 4X23B 2NZDD 5B32G 4CSRA 3AZJD 5AV8C 4WU8C 4J8VC 5AV6A 1S32C 3AZKA 2L5AA 4X23A 5B2ID 3LZ0A 3AZHD 3AZHC 5B33A 5F99D 3NQUB 1BFMA 1P3AB 5AV9D 1ZLAB 5DNNA 3WKJA 5B32B 1U35C 4KGCB 5B1MB 5BNXB 3VH5T 4J8VD 4YS3B 3AZIA 1F66C 3AN2C 3AZLD 4ZUXB 3UTBD 5B32A 1KX5B 4J8VB 2NQBA 3RELC 3LZ1B 3KUYB 4ZBJB 1P3BD 3LELA 3AZLB 5DNMB 2NZDA 3VH6A 4Z2MG 5BNVB 4KGCC 4KHAA 1P3KC 4R8PB 5GT0A 4G92B 2CV5D 3A6ND 2NZDB 1WWIA 4NE6A 3AZGA 1M18C 3AZFC 4WU9C 5GT3C 5B33B 1P3IC 4ZBJC 3REKD 1S32B 3B6GA 1P3LC 3MNNC 2RVQC 4H9SA 5B31D 5JRGC 5BNXA 5B24D 3WTPB 3B6GB 4KUDD 2F8NB 3C1CD 3AYWC 5CPJC 1KX5A 5JA4B 2NQBB 5B24A 5AVCD 2AROD 4Z66B 3W96C 3W96B 3UTAA 4YM6D 3C1BA 1KX3A 5B2JC 3X1TC 3LZ1D 4JJNB 1JFIB 3WAAD 1AOIC 3A6NA 3C1BB 2IO5B 4XZQA 5AVBA 5F99C 5B0YD 4JJNA 1ZLAC 3AV2B 2HIOD 5E5AA 1S32D 4H9RA 3AV2A 4NFTA 1WWSA 4YM6C 5B40C 5JA4A 3REHD 3AZID 5B1LB 3AFAD 3AZMA 1P3OA 1P3FB 3W97D 4Z66A 1M19D 3W98D 4H9RB 3KWQD 1B6WA 3UTAB 3MGSD 1TZYD 2HIOC 4XUJA 5BO0A 3AFAA 3REHA 5B33D 3R45B 5AV6B 3TU4A 3W99D 4ZUXC 4X23D 1HTAA 2YFWA 5JRGA 3UT9C 5B1MC 3WA9B 2HUEC 4J8UC 1P3AA 1KX4C 3B6FC 3NQJA 5DNMC 3MGQD 3VH6W 3AZHB 3AZNA 4XZQD 2NQBD 5B1LC 4YS3A 2CV5C 1HQ3D 3AV1C 2JSSA 5B32D 3W99A 3UTBA 3B0DC 3MGQB 3AZMB 3AN2B 1P3FA 4J8VA 5AY8A 3KUYA 3KWQA 4H9PB 3AZKC 4J8XC 5KDMA 3WKJD 5GSUC 5GXQD 5CP6A 3REHB 4HGAC 1KX5D 3AZMD 4XZQC 2LY8A 3MVDD 3LZ0D 3AV1D 4KUDA 3AV2D 5KDMB 4J8UD 1U35D 3B0DB 4CSRB 5DNMD 3MGQC 5JRGB 3AZGB 1P3MC 5AV6C 5AV6D 5B31G 3WA9A 3AV1B 1F66A 2FJ7B 1P3PD 3MGPD 3AZFB 5CPID 3LZ0C 3MGSC 3AZNB 2PYOC 5CPJB 1KX4B 1P3OC 3KSYA 4G92C 5DNNB 3WAAA 4AWLB
chains in the Genus database with same CATH superfamily
4KGCA 5B40D 3WTPC 3WTPD 4UUZA 3REJC 5B24B 3EPLA 1M1AC 1M19C 3W98C 3LELD 3C1CB 3B0CT 4ZUXA 5B0ZD 2ZY3A 3B0CW 3P5JB 3X1SA 1P3MB 3UT9A 3KXBC 2BYKA 5B0YC 3AZEA 3C1CA 3LELB 2JCHA 3AZLA 3B0BA 1P3PC 4J8WA 4KHAB 2PYOD 5BT1C 3X1SB 5CP6D 2G5IC 4XZQB 4YM6B 3WKJC 5AVBB 2BYKB 3AZEB 2W8SA 3AYWA 3AZFA 3X1VA 1EQZB 5E5AB 5CPJA 1KX5C 1ULYA 5CPKD 3AZKD 2ZY4A 4DRBA 3AYWB 4J8XA 5GXQB 3AZND 3UTAC 3C1BC 1B67A 4UUZB 5CPKA 2F8NA 5AV5C 2HUEB 4EO5B 5B40B 1TAFA 1P3LB 5JRGD 4XUJB 5B1LD 3AFAB 3UT9B 3R45A 3MGRC 1P34D 3O62A 3REKB 3REKC 3VH5A 1R4VA 5C3IB 3X1VD 3AZFD 5CPIB 1KX3B 2YFWB 4XUJD 5GT3D 3X1TA 1P3ID 2CWEA 2Y2PA 1KX4D 5DNND 4X23C 5AV9A 3X1VB 3X1SD 3NQJB 4J8WD 3AZHA 3REIB 3VH6T 3MGRD 3AZMC 4JJNC 3AZED 2AROB 5AV9B 1KU5A 2BYMA 3W96D 1P3KD 5E5AC 1TZYC 5E5AD 4KGCD 3AZIC 5G49B 5B31B 3AZJA 3MGRB 3AN2A 3KXBA 3EPHA 1P3BC 3TU4C 1Z2CB 5B0YA 4JJND 4E45A 5B32C 3AZEC 5B40A 1P3KB 2ZY2A 4J8WC 5CP6B 1ID3B 2IO5C 3O62B 3AN2D 1F66D 5B0YB 1ZLAD 1P3LD 5B2IC 5CPIA 1P3KA 3X1TB 1U35A 5B1MD 1P34B 1P3GA 1M18D 2CV5B 3MVDB 3AV1A 1F66B 3REIA 1U35B 4DRAA 4Z2MH 4WNNB 1P3AC 1KX4A 4Z5TC 3MVDA 3KUYD 1P3BB 3KWQC 5AV5A 3LELC 1P3PB 3MGSB 3AZNC 5G49A 5B31A 3KXBB 5AY8D 5BS7C 2AROC 3RELB 3B6GD 3H0LC 1HQ3A 3UTBC 3W99B 2Y2QA 5AV5B 4E44A 3LJAB 3MGQA 5B2IB 1ID3A 3AZGC 5B24C 1P3MA 4WU9A 5FUGB 1P3AD 1AOIB 3X1UA 4WJ3C 5B0ZB 5CP6C 3LJAA 4J8WB 3MNNA 1KX3C 5B2JB 1P3MD 2DQNC 4CAYA 1AOIA 3A6NC 1H3OB 3KFUG 1BH8B 1P34C 4EO5C 5B2JD 1EQZA 5AV8D 4WU8D 2F8NH 4WNNA 3EPKA 3TU4D 4CAYB 4H9QB 4Z66D 5B0ZC 1M19A 2FJ7A 3W98A 1H3OA 2PYOA 3MGSA 1BH8A 5CHLB 4R8PD 3REJD 1M1AD 4LD9A 3W97A 1HQ3B 5CPKB 3WAAB 3AZKB 5CPIC 5B2IA 4WU9B 5FUGA 3V9RB 4Z66C 1P3GC 1M18B 3W97B 2YFVB 5AVBC 3B6FD 2RVQD 4QLCD 3MNND 3LJAD 1ZLAA 4XUJC 2HIOA 5DNNC 3X1SC 3WKJB 2F8NG 3REIC 4WU9D 4H9NB 2DF4C 2BG1A 3H0RC 3B6FB 2J8PA 1KX3D 3VH5W 4YM6A 3KXBD 3WA9D 3A1KA 5BS7A 3LZ1A 2AROA 1M19B 3W98B 3B6FA 5GSUD 5AV5D 5DNMA 3UTAD 2NZDC 1ID3C 4LD9B 3EG5B 3AFAC 3AZJB 3MGRA 5AVCA 2F8NK 2F2AC 5GT0C 5GSUB 3X1UC 2Y2LA 4J8XB 5GXQA 1A7WA 1P3FC 1M18A 3KUYC 5AVCB 2YFVA 3WTPE 3MGPC 5GSUA 5AV9C 1TAFB 1P3LA 5BT1D 4NE5A 3O62D 1EQZD 5AV8B 4WU8B 1P3GB 1P34A 1EQZC 3REKA 4YS3D 4YS3C 2CV5A 4G91C 3AZGD 4AWLC 4WZSB 3AZJC 4H9OB 4LD9C 3B6GC 1P3BA 3X1UD 4QLCA 3W96A 1N1JA 1TZYB 5CPJD 2Y2OA 4Z5TD 4QLCB 2BYMB 2ZM5A 1JFIA 1N1JB 1TZYA 4M6BA 4WV4B 5BNVA 3A6NB 4LD9D 3REJA 1M1AA 2FFFB 4R8PA 5GT0B 1P3OD 3WA9C 4Z5TB 5F99A 3AL0C 2FJ7D 5AV8A 4WU8A 5B2JA 3REID 3UT9D 1S32A 4Z5TA 3MVDC 3LZ1C 1AOID 3AV2C 3WAAC 2F8ND 1P3GD 5GT3B 4H9OA 5B33C 3WTPA 1P3IB 5AVBD 5AVCC 3H0MC 1Q9CA 4J8XD 5GXQC 5BO0B 4HGAB 1ID3D 3REHC 3TU4B 4G91B 3MGPA 3C1CC 3C1BD 3AZLC 3AYWD 1P3PA 5B31C 3REJB 1M1AB 2NQBC 3V9RA 3RELA 5CPKC 1BH9B 1HQ3C 5F99B 3MGPB 4J8UA 2HIOB 3X1VC 3O62C 3F6TA 1F1EA 3LZ0B 4H9NA 1BH9A 3NQUA 3X1UB 5B0ZA 3LJAC 4J8UB 4QLCC 2FJ7C 2Y2MA 2Y2NA 3MNNB 3W99C 4ZUXD 3UTBB 4UPKA 3X1TD 2Y2JA 5B1MA 5GT3A 1P3IA 1P3FD 3AZIB 5C3IC 3W97C 5AY8B 3RELD 5AY8C 4H9SC 3KWQB 4H9PA 4NE3A 3EPJA 5B1LA 2G5HC 4R8PC 5GT0D 1P3OB 4H9QA 4KUDB 2PYOB 4KUDC 4X23B 2NZDD 5B32G 4CSRA 3AZJD 5AV8C 4WU8C 4J8VC 5AV6A 1PZRA 1S32C 3AZKA 2L5AA 4X23A 5B2ID 3LZ0A 3AZHD 3AZHC 5B33A 5F99D 3NQUB 1BFMA 1P3AB 5AV9D 1ZLAB 5DNNA 1T3UA 3WKJA 5B32B 1U35C 4KGCB 5B1MB 5BNXB 3VH5T 4J8VD 4YS3B 3AZIA 3A1IA 1F66C 2JE5A 3AN2C 3AZLD 4ZUXB 3UTBD 5B32A 1KX5B 4J8VB 2NQBA 3RELC 3LZ1B 3KUYB 4ZBJB 1P3BD 3LELA 3AZLB 5DNMB 2NZDA 3VH6A 4Z2MG 5BNVB 4KGCC 4KHAA 1P3KC 4R8PB 5GT0A 4G92B 2CV5D 3A6ND 2NZDB 1WWIA 4NE6A 3AZGA 2ZY5A 3AZFC 1M18C 4WU9C 5GT3C 5B33B 1P3IC 4ZBJC 2Y2KA 3REKD 1S32B 3B6GA 2Y2HA 1P3LC 2RVQC 3MNNC 4H9SA 5B31D 5JRGC 5BNXA 2Y2GA 5B24D 3WTPB 2Y2IA 3B6GB 4KUDD 2F8NB 3C1CD 3AYWC 5CPJC 1KX5A 5JA4B 2NQBB 5B24A 5AVCD 2AROD 4Z66B 3W96C 3W96B 3UTAA 4YM6D 3C1BA 2UWXA 1KX3A 5B2JC 3X1TC 3LZ1D 4JJNB 1JFIB 3WAAD 1AOIC 3A6NA 3C1BB 2IO5B 4XZQA 5AVBA 5F99C 5B0YD 4JJNA 1ZLAC 3AV2B 2HIOD 5E5AA 1W2EA 1S32D 4H9RA 3AV2A 4NFTA 1WWSA 4YM6C 5B40C 5JA4A 3REHD 3AZID 5B1LB 3AFAD 3AZMA 1P3OA 3IP4C 2VQRA 4Z66A 1P3FB 1M19D 3W97D 3W98D 4H9RB 3KWQD 1B6WA 3UTAB 3MGSD 1TZYD 2HIOC 4XUJA 5BO0A 3AFAA 3REHA 5B33D 3R45B 5AV6B 3TU4A 3W99D 4ZUXC 4X23D 1HTAA 2YFWA 5JRGA 3UT9C 5B1MC 3WA9B 2HUEC 4J8UC 1P3AA 1KX4C 3B6FC 3NQJA 5DNMC 3MGQD 3VH6W 3AZHB 3AZNA 4XZQD 2NQBD 5B1LC 4YS3A 2CV5C 1HQ3D 3AV1C 2JSSA 5B32D 3W99A 3UTBA 3B0DC 3MGQB 3AZMB 3AN2B 1P3FA 4J8VA 5AY8A 3KUYA 3KWQA 2RIQA 4H9PB 4J8XC 5KDMA 3AZKC 5GSUC 3WKJD 5GXQD 5CP6A 3REHB 4HGAC 1KX5D 3AZMD 4XZQC 2LY8A 3MVDD 3FDDA 3LZ0D 3AV1D 4KUDA 3AV2D 5KDMB 4J8UD 1U35D 3B0DB 4CSRB 5DNMD 3MGQC 5JRGB 3AZGB 1P3MC 5AV6C 5AV6D 5B31G 3WA9A 3AV1B 4DQYB 1F66A 2FJ7B 1P3PD 3MGPD 3AZFB 5CPID 3LZ0C 3MGSC 3AZNB 2PYOC 2XD5A 2XD1A 5CPJB 1KX4B 1P3OC 3KSYA 4G92C 5DNNB 3WAAA 4AWLB
chains in the Genus database with same CATH topology
4KGCA 5B40D 3WTPC 3WTPD 4UUZA 3REJC 5B24B 3EPLA 1M1AC 1M19C 3W98C 3LELD 3C1CB 3B0CT 4ZUXA 5B0ZD 2ZY3A 3B0CW 3P5JB 3X1SA 1P3MB 3UT9A 3KXBC 2BYKA 5B0YC 3AZEA 3C1CA 3LELB 2JCHA 3AZLA 3B0BA 1P3PC 4J8WA 4KHAB 2PYOD 5BT1C 3X1SB 5CP6D 2G5IC 4XZQB 4YM6B 3WKJC 5AVBB 2BYKB 3AZEB 2W8SA 3AYWA 3AZFA 3X1VA 1EQZB 5E5AB 5CPJA 1KX5C 1ULYA 5CPKD 3AZKD 2ZY4A 4DRBA 3AYWB 4J8XA 5GXQB 3AZND 3UTAC 3C1BC 1B67A 4UUZB 5CPKA 2F8NA 5AV5C 2HUEB 4EO5B 5B40B 1TAFA 1P3LB 5JRGD 4XUJB 5B1LD 3AFAB 3UT9B 3R45A 3MGRC 1P34D 3O62A 3REKB 3REKC 3VH5A 1R4VA 5C3IB 3X1VD 3AZFD 5CPIB 1KX3B 2YFWB 4XUJD 5GT3D 3X1TA 1P3ID 2CWEA 2Y2PA 1KX4D 5DNND 4X23C 5AV9A 3X1VB 3X1SD 3NQJB 4J8WD 3AZHA 3REIB 3VH6T 3MGRD 3AZMC 4JJNC 3AZED 2AROB 5AV9B 1KU5A 2BYMA 3W96D 1P3KD 5E5AC 1TZYC 5E5AD 4KGCD 3AZIC 5G49B 5B31B 3AZJA 3MGRB 3AN2A 3KXBA 3EPHA 1P3BC 3TU4C 1Z2CB 5B0YA 4JJND 4E45A 5B32C 3AZEC 5B40A 1P3KB 2ZY2A 4J8WC 5CP6B 1ID3B 2IO5C 3O62B 3AN2D 1F66D 5B0YB 1ZLAD 1P3LD 5B2IC 5CPIA 1P3KA 3X1TB 1U35A 5B1MD 1P34B 1P3GA 1M18D 2CV5B 3MVDB 3AV1A 1F66B 3REIA 1U35B 4DRAA 4Z2MH 4WNNB 1P3AC 1KX4A 4Z5TC 3MVDA 3KUYD 1P3BB 3KWQC 5AV5A 3LELC 1P3PB 3MGSB 3AZNC 5G49A 5B31A 3KXBB 5AY8D 5BS7C 2AROC 3RELB 3B6GD 3H0LC 1HQ3A 3UTBC 3W99B 2Y2QA 5AV5B 4E44A 3LJAB 3MGQA 5B2IB 1ID3A 3AZGC 5B24C 1P3MA 4WU9A 5FUGB 1P3AD 1AOIB 3X1UA 4WJ3C 5B0ZB 5CP6C 3LJAA 4J8WB 3MNNA 1KX3C 5B2JB 1P3MD 2DQNC 4CAYA 1AOIA 3A6NC 1H3OB 3KFUG 1BH8B 1P34C 4EO5C 5B2JD 1EQZA 5AV8D 4WU8D 2F8NH 4WNNA 3EPKA 3TU4D 4CAYB 4H9QB 4Z66D 5B0ZC 1M19A 2FJ7A 3W98A 1H3OA 2PYOA 3MGSA 1BH8A 5CHLB 4R8PD 3REJD 1M1AD 4LD9A 3W97A 1HQ3B 5CPKB 3WAAB 3AZKB 5CPIC 5B2IA 4WU9B 5FUGA 3V9RB 4Z66C 1P3GC 1M18B 3W97B 2YFVB 5AVBC 3B6FD 2RVQD 4QLCD 3MNND 3LJAD 1ZLAA 4XUJC 2HIOA 5DNNC 3X1SC 3WKJB 2F8NG 3REIC 4WU9D 4H9NB 2DF4C 2BG1A 3H0RC 3B6FB 2J8PA 1KX3D 3VH5W 4YM6A 3KXBD 3WA9D 3A1KA 5BS7A 3LZ1A 2AROA 1M19B 3W98B 3B6FA 5GSUD 5AV5D 5DNMA 3UTAD 2NZDC 1ID3C 4LD9B 3EG5B 3AFAC 3AZJB 3MGRA 5AVCA 2F8NK 2F2AC 5GT0C 5GSUB 3X1UC 2Y2LA 4J8XB 5GXQA 1A7WA 1P3FC 1M18A 3KUYC 5AVCB 2YFVA 3WTPE 3MGPC 5GSUA 5AV9C 1TAFB 1P3LA 5BT1D 4NE5A 3O62D 1EQZD 5AV8B 4WU8B 1P3GB 1P34A 1EQZC 3REKA 4YS3D 4YS3C 2CV5A 4G91C 3AZGD 4AWLC 4WZSB 3AZJC 4H9OB 4LD9C 3B6GC 1P3BA 3X1UD 4QLCA 3W96A 1N1JA 1TZYB 5CPJD 2Y2OA 4Z5TD 4QLCB 2BYMB 2ZM5A 1JFIA 1N1JB 1TZYA 4M6BA 4WV4B 5BNVA 3A6NB 4LD9D 3REJA 1M1AA 2FFFB 4R8PA 5GT0B 1P3OD 3WA9C 4Z5TB 5F99A 3AL0C 2FJ7D 5AV8A 4WU8A 5B2JA 3REID 3UT9D 1S32A 4Z5TA 3MVDC 3LZ1C 1AOID 3AV2C 3WAAC 2F8ND 1P3GD 5GT3B 4H9OA 5B33C 3WTPA 1P3IB 5AVBD 5AVCC 3H0MC 1Q9CA 4J8XD 5GXQC 5BO0B 4HGAB 1ID3D 3REHC 3TU4B 4G91B 3MGPA 3C1CC 3C1BD 3AZLC 3AYWD 1P3PA 5B31C 3REJB 1M1AB 2NQBC 3V9RA 3RELA 5CPKC 1BH9B 1HQ3C 5F99B 3MGPB 4J8UA 2HIOB 3X1VC 3O62C 3F6TA 1F1EA 3LZ0B 4H9NA 1BH9A 3NQUA 3X1UB 5B0ZA 3LJAC 4J8UB 4QLCC 2FJ7C 2Y2MA 2Y2NA 3MNNB 3W99C 4ZUXD 3UTBB 4UPKA 3X1TD 2Y2JA 5B1MA 5GT3A 1P3IA 1P3FD 3AZIB 5C3IC 3W97C 5AY8B 3RELD 5AY8C 4H9SC 3KWQB 4H9PA 4NE3A 3EPJA 5B1LA 2G5HC 4R8PC 5GT0D 1P3OB 4H9QA 4KUDB 2PYOB 4KUDC 4X23B 2NZDD 5B32G 4CSRA 3AZJD 5AV8C 4WU8C 4J8VC 5AV6A 1PZRA 1S32C 3AZKA 2L5AA 4X23A 5B2ID 3LZ0A 3AZHD 3AZHC 5B33A 5F99D 3NQUB 1BFMA 1P3AB 5AV9D 1ZLAB 5DNNA 1T3UA 3WKJA 5B32B 1U35C 4KGCB 5B1MB 5BNXB 3VH5T 4J8VD 4YS3B 3AZIA 3A1IA 1F66C 2JE5A 3AN2C 3AZLD 4ZUXB 3UTBD 5B32A 1KX5B 4J8VB 2NQBA 3RELC 3LZ1B 3KUYB 4ZBJB 1P3BD 3LELA 3AZLB 5DNMB 2NZDA 3VH6A 4Z2MG 5BNVB 4KGCC 4KHAA 1P3KC 4R8PB 5GT0A 4G92B 2CV5D 3A6ND 2NZDB 1WWIA 4NE6A 3AZGA 2ZY5A 3AZFC 1M18C 4WU9C 5GT3C 5B33B 1P3IC 4ZBJC 2Y2KA 3REKD 1S32B 3B6GA 2Y2HA 1P3LC 2RVQC 3MNNC 4H9SA 5B31D 5JRGC 5BNXA 2Y2GA 5B24D 3WTPB 2Y2IA 3B6GB 4KUDD 2F8NB 3C1CD 3AYWC 5CPJC 1KX5A 5JA4B 2NQBB 5B24A 5AVCD 2AROD 4Z66B 3W96C 3W96B 3UTAA 4YM6D 3C1BA 2UWXA 1KX3A 5B2JC 3X1TC 3LZ1D 4JJNB 1JFIB 3WAAD 1AOIC 3A6NA 3C1BB 2IO5B 4XZQA 5AVBA 5F99C 5B0YD 4JJNA 1ZLAC 3AV2B 2HIOD 5E5AA 1W2EA 1S32D 4H9RA 3AV2A 4NFTA 1WWSA 4YM6C 5B40C 5JA4A 3REHD 3AZID 5B1LB 3AFAD 3AZMA 1P3OA 3IP4C 2VQRA 4Z66A 1P3FB 1M19D 3W97D 3W98D 4H9RB 3KWQD 1B6WA 3UTAB 3MGSD 1TZYD 2HIOC 4XUJA 5BO0A 3AFAA 3REHA 5B33D 3R45B 5AV6B 3TU4A 3W99D 4ZUXC 4X23D 1HTAA 2YFWA 5JRGA 3UT9C 5B1MC 3WA9B 2HUEC 4J8UC 1P3AA 1KX4C 3B6FC 3NQJA 5DNMC 3MGQD 3VH6W 3AZHB 3AZNA 4XZQD 2NQBD 5B1LC 4YS3A 2CV5C 1HQ3D 3AV1C 2JSSA 5B32D 3W99A 3UTBA 3B0DC 3MGQB 3AZMB 3AN2B 1P3FA 4J8VA 5AY8A 3KUYA 3KWQA 2RIQA 4H9PB 4J8XC 5KDMA 3AZKC 5GSUC 3WKJD 5GXQD 5CP6A 3REHB 4HGAC 1KX5D 3AZMD 4XZQC 2LY8A 3MVDD 3FDDA 3LZ0D 3AV1D 4KUDA 3AV2D 5KDMB 4J8UD 1U35D 3B0DB 4CSRB 5DNMD 3MGQC 5JRGB 3AZGB 1P3MC 5AV6C 5AV6D 5B31G 3WA9A 3AV1B 4DQYB 1F66A 2FJ7B 1P3PD 3MGPD 3AZFB 5CPID 3LZ0C 3MGSC 3AZNB 2PYOC 2XD5A 2XD1A 5CPJB 1KX4B 1P3OC 3KSYA 4G92C 5DNNB 3WAAA 4AWLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGC A;  5B40 D;  3WTP C;  3WTP D;  4UUZ A;  3REJ C;  5B24 B;  1M1A C;  1M19 C;  3W98 C;  3LEL D;  3C1C B;  3B0C T;  4ZUX A;  5B0Z D;  3B0C W;  3X1S A;  1P3M B;  3UT9 A;  3KXB C;  2BYK A;  5B0Y C;  3AZE A;  3C1C A;  3LEL B;  3AZL A;  1P3P C;  3B0B A;  4J8W A;  4KHA B;  2PYO D;  5BT1 C;  3X1S B;  5CP6 D;  4XZQ B;  4YM6 B;  3WKJ C;  5AVB B;  2BYK B;  3AZE B;  3AYW A;  3AZF A;  3X1V A;  1EQZ B;  5E5A B;  5CPJ A;  1KX5 C;  1ULY A;  5CPK D;  3AZK D;  4DRB A;  3AYW B;  4J8X A;  5GXQ B;  3AZN D;  3UTA C;  3C1B C;  1B67 A;  4UUZ B;  5CPK A;  2F8N A;  5AV5 C;  2HUE B;  4EO5 B;  5B40 B;  1TAF A;  1P3L B;  5JRG D;  4XUJ B;  5B1L D;  3AFA B;  3UT9 B;  3R45 A;  3MGR C;  1P34 D;  3O62 A;  3REK B;  3REK C;  3VH5 A;  1R4V A;  5C3I B;  3X1V D;  3AZF D;  5CPI B;  1KX3 B;  2YFW B;  4XUJ D;  5GT3 D;  3X1T A;  1P3I D;  2CWE A;  1KX4 D;  5DNN D;  4X23 C;  5AV9 A;  3X1V B;  3X1S D;  3NQJ B;  4J8W D;  3AZH A;  3REI B;  3VH6 T;  3MGR D;  3AZM C;  4JJN C;  3AZE D;  2ARO B;  5AV9 B;  1KU5 A;  2BYM A;  3W96 D;  1P3K D;  5E5A C;  1TZY C;  5E5A D;  4KGC D;  3AZI C;  5G49 B;  5B31 B;  3AZJ A;  3MGR B;  3AN2 A;  3KXB A;  1P3B C;  3TU4 C;  5B0Y A;  4JJN D;  3AZE C;  4E45 A;  5B32 C;  5B40 A;  1P3K B;  4J8W C;  5CP6 B;  1ID3 B;  2IO5 C;  3O62 B;  3AN2 D;  1F66 D;  5B0Y B;  1ZLA D;  1P3L D;  5B2I C;  5CPI A;  1P3K A;  3X1T B;  1U35 A;  5B1M D;  1P34 B;  1P3G A;  1M18 D;  2CV5 B;  3MVD B;  3AV1 A;  1F66 B;  3REI A;  1U35 B;  4DRA A;  4Z2M H;  4WNN B;  1P3A C;  1KX4 A;  4Z5T C;  3MVD A;  3KUY D;  1P3B B;  3KWQ C;  5AV5 A;  3LEL C;  1P3P B;  3MGS B;  3AZN C;  5G49 A;  5B31 A;  3KXB B;  5AY8 D;  5BS7 C;  2ARO C;  3REL B;  3B6G D;  1HQ3 A;  3UTB C;  3W99 B;  5AV5 B;  4E44 A;  3LJA B;  3MGQ A;  5B2I B;  1ID3 A;  3AZG C;  5B24 C;  1P3M A;  4WU9 A;  5FUG B;  1P3A D;  1AOI B;  3X1U A;  5B0Z B;  5CP6 C;  3LJA A;  4J8W B;  3MNN A;  1KX3 C;  5B2J B;  1P3M D;  4CAY A;  1AOI A;  3A6N C;  1H3O B;  1BH8 B;  1P34 C;  4EO5 C;  5B2J D;  1EQZ A;  5AV8 D;  4WU8 D;  2F8N H;  4WNN A;  3TU4 D;  4CAY B;  4H9Q B;  4Z66 D;  5B0Z C;  1M19 A;  2FJ7 A;  3W98 A;  1H3O A;  2PYO A;  3MGS A;  1BH8 A;  5CHL B;  4R8P D;  3REJ D;  1M1A D;  4LD9 A;  3W97 A;  1HQ3 B;  5CPK B;  3WAA B;  3AZK B;  5CPI C;  5B2I A;  4WU9 B;  5FUG A;  3V9R B;  4Z66 C;  1P3G C;  1M18 B;  3W97 B;  2YFV B;  5AVB C;  3B6F D;  3MNN D;  2RVQ D;  4QLC D;  3LJA D;  1ZLA A;  2HIO A;  4XUJ C;  5DNN C;  3X1S C;  3WKJ B;  2F8N G;  3REI C;  4WU9 D;  4H9N B;  3B6F B;  1KX3 D;  3VH5 W;  4YM6 A;  3KXB D;  3WA9 D;  1M19 B;  5BS7 A;  3LZ1 A;  2ARO A;  3W98 B;  3B6F A;  5GSU D;  5AV5 D;  5DNM A;  3UTA D;  2NZD C;  1ID3 C;  4LD9 B;  3AFA C;  3AZJ B;  3MGR A;  5AVC A;  2F8N K;  5GT0 C;  5GSU B;  3X1U C;  4J8X B;  5GXQ A;  1A7W A;  1P3F C;  1M18 A;  3KUY C;  5AVC B;  2YFV A;  3WTP E;  3MGP C;  5GSU A;  5AV9 C;  1TAF B;  1P3L A;  5BT1 D;  4NE5 A;  3O62 D;  1EQZ D;  5AV8 B;  4WU8 B;  1P3G B;  1P34 A;  1EQZ C;  3REK A;  4YS3 D;  4YS3 C;  2CV5 A;  4G91 C;  3AZG D;  4AWL C;  4WZS B;  3AZJ C;  4H9O B;  4LD9 C;  3B6G C;  1P3B A;  3X1U D;  4QLC A;  3W96 A;  1N1J A;  1TZY B;  5CPJ D;  4Z5T D;  4QLC B;  2BYM B;  1JFI A;  1N1J B;  1TZY A;  4M6B A;  4WV4 B;  5BNV A;  3A6N B;  4LD9 D;  3REJ A;  1M1A A;  4R8P A;  5GT0 B;  1P3O D;  3WA9 C;  4Z5T B;  5F99 A;  2FJ7 D;  5AV8 A;  4WU8 A;  5B2J A;  3REI D;  3UT9 D;  1S32 A;  4Z5T A;  3MVD C;  3LZ1 C;  1AOI D;  3AV2 C;  3WAA C;  2F8N D;  1P3G D;  5GT3 B;  4H9O A;  5B33 C;  3WTP A;  1P3I B;  5AVB D;  5AVC C;  1Q9C A;  4J8X D;  5GXQ C;  5BO0 B;  4HGA B;  1ID3 D;  3REH C;  3TU4 B;  4G91 B;  3MGP A;  3C1C C;  3C1B D;  3AZL C;  3AYW D;  1P3P A;  5B31 C;  3REJ B;  1M1A B;  2NQB C;  3V9R A;  3REL A;  5CPK C;  1BH9 B;  1HQ3 C;  5F99 B;  3MGP B;  4J8U A;  2HIO B;  3X1V C;  3O62 C;  1F1E A;  3LZ0 B;  4H9N A;  1BH9 A;  3NQU A;  3X1U B;  5B0Z A;  3LJA C;  4J8U B;  4QLC C;  2FJ7 C;  3MNN B;  3W99 C;  4ZUX D;  3UTB B;  5GT3 A;  5B1M A;  3X1T D;  1P3I A;  1P3F D;  3AZI B;  5C3I C;  3W97 C;  5AY8 B;  3REL D;  5AY8 C;  4H9S C;  3KWQ B;  4H9P A;  4NE3 A;  5B1L A;  4R8P C;  5GT0 D;  1P3O B;  4H9Q A;  4KUD B;  2PYO B;  4KUD C;  4X23 B;  2NZD D;  5B32 G;  4CSR A;  3AZJ D;  5AV8 C;  4WU8 C;  4J8V C;  5AV6 A;  1S32 C;  3AZK A;  2L5A A;  4X23 A;  5B2I D;  3LZ0 A;  3AZH D;  3AZH C;  5B33 A;  5F99 D;  3NQU B;  1BFM A;  1P3A B;  5AV9 D;  1ZLA B;  5DNN A;  3WKJ A;  5B32 B;  1U35 C;  4KGC B;  5B1M B;  5BNX B;  3VH5 T;  4J8V D;  4YS3 B;  3AZI A;  1F66 C;  3AN2 C;  3AZL D;  4ZUX B;  3UTB D;  5B32 A;  1KX5 B;  4J8V B;  2NQB A;  3REL C;  3LZ1 B;  3KUY B;  4ZBJ B;  1P3B D;  3LEL A;  3AZL B;  5DNM B;  2NZD A;  3VH6 A;  4Z2M G;  5BNV B;  4KGC C;  4KHA A;  1P3K C;  4R8P B;  5GT0 A;  4G92 B;  2CV5 D;  3A6N D;  2NZD B;  1WWI A;  4NE6 A;  3AZG A;  1M18 C;  3AZF C;  4WU9 C;  5GT3 C;  5B33 B;  1P3I C;  4ZBJ C;  3REK D;  1S32 B;  3B6G A;  1P3L C;  3MNN C;  2RVQ C;  4H9S A;  5B31 D;  5JRG C;  5BNX A;  5B24 D;  3WTP B;  3B6G B;  4KUD D;  2F8N B;  3C1C D;  3AYW C;  5CPJ C;  1KX5 A;  5JA4 B;  2NQB B;  5B24 A;  5AVC D;  2ARO D;  4Z66 B;  3W96 C;  3W96 B;  3UTA A;  4YM6 D;  3C1B A;  1KX3 A;  5B2J C;  3X1T C;  3LZ1 D;  4JJN B;  1JFI B;  3WAA D;  1AOI C;  3A6N A;  3C1B B;  2IO5 B;  4XZQ A;  5AVB A;  5F99 C;  5B0Y D;  4JJN A;  1ZLA C;  3AV2 B;  2HIO D;  5E5A A;  1S32 D;  4H9R A;  3AV2 A;  4NFT A;  1WWS A;  4YM6 C;  5B40 C;  5JA4 A;  3REH D;  3AZI D;  5B1L B;  3AFA D;  3AZM A;  1P3O A;  1P3F B;  3W97 D;  4Z66 A;  1M19 D;  3W98 D;  4H9R B;  3KWQ D;  1B6W A;  3UTA B;  3MGS D;  1TZY D;  2HIO C;  4XUJ A;  5BO0 A;  3AFA A;  3REH A;  5B33 D;  3R45 B;  5AV6 B;  3TU4 A;  3W99 D;  4ZUX C;  4X23 D;  1HTA A;  2YFW A;  5JRG A;  3UT9 C;  5B1M C;  3WA9 B;  2HUE C;  4J8U C;  1P3A A;  1KX4 C;  3B6F C;  3NQJ A;  5DNM C;  3MGQ D;  3VH6 W;  3AZH B;  3AZN A;  4XZQ D;  2NQB D;  5B1L C;  4YS3 A;  2CV5 C;  1HQ3 D;  3AV1 C;  2JSS A;  5B32 D;  3W99 A;  3UTB A;  3B0D C;  3MGQ B;  3AZM B;  3AN2 B;  1P3F A;  4J8V A;  5AY8 A;  3KUY A;  3KWQ A;  4H9P B;  3AZK C;  4J8X C;  5KDM A;  3WKJ D;  5GSU C;  5GXQ D;  5CP6 A;  3REH B;  4HGA C;  1KX5 D;  3AZM D;  4XZQ C;  2LY8 A;  3MVD D;  3LZ0 D;  3AV1 D;  4KUD A;  3AV2 D;  5KDM B;  4J8U D;  1U35 D;  3B0D B;  4CSR B;  5DNM D;  3MGQ C;  5JRG B;  3AZG B;  1P3M C;  5AV6 C;  5AV6 D;  5B31 G;  3WA9 A;  3AV1 B;  1F66 A;  2FJ7 B;  1P3P D;  3MGP D;  3AZF B;  5CPI D;  3LZ0 C;  3MGS C;  3AZN B;  2PYO C;  5CPJ B;  1KX4 B;  1P3O C;  3KSY A;  4G92 C;  5DNN B;  3WAA A;  4AWL B; 
#chains in the Genus database with same CATH topology
 4KGC A;  5B40 D;  3WTP C;  3WTP D;  4UUZ A;  3REJ C;  5B24 B;  3EPL A;  1M1A C;  1M19 C;  3W98 C;  3LEL D;  3C1C B;  3B0C T;  4ZUX A;  5B0Z D;  2ZY3 A;  3B0C W;  3P5J B;  3X1S A;  1P3M B;  3UT9 A;  3KXB C;  2BYK A;  5B0Y C;  3AZE A;  3C1C A;  3LEL B;  2JCH A;  3AZL A;  3B0B A;  1P3P C;  4J8W A;  4KHA B;  2PYO D;  5BT1 C;  3X1S B;  5CP6 D;  2G5I C;  4XZQ B;  4YM6 B;  3WKJ C;  5AVB B;  2BYK B;  3AZE B;  2W8S A;  3AYW A;  3AZF A;  3X1V A;  1EQZ B;  5E5A B;  5CPJ A;  1KX5 C;  1ULY A;  5CPK D;  3AZK D;  2ZY4 A;  4DRB A;  3AYW B;  4J8X A;  5GXQ B;  3AZN D;  3UTA C;  3C1B C;  1B67 A;  4UUZ B;  5CPK A;  2F8N A;  5AV5 C;  2HUE B;  4EO5 B;  5B40 B;  1TAF A;  1P3L B;  5JRG D;  4XUJ B;  5B1L D;  3AFA B;  3UT9 B;  3R45 A;  3MGR C;  1P34 D;  3O62 A;  3REK B;  3REK C;  3VH5 A;  1R4V A;  5C3I B;  3X1V D;  3AZF D;  5CPI B;  1KX3 B;  2YFW B;  4XUJ D;  5GT3 D;  3X1T A;  1P3I D;  2CWE A;  2Y2P A;  1KX4 D;  5DNN D;  4X23 C;  5AV9 A;  3X1V B;  3X1S D;  3NQJ B;  4J8W D;  3AZH A;  3REI B;  3VH6 T;  3MGR D;  3AZM C;  4JJN C;  3AZE D;  2ARO B;  5AV9 B;  1KU5 A;  2BYM A;  3W96 D;  1P3K D;  5E5A C;  1TZY C;  5E5A D;  4KGC D;  3AZI C;  5G49 B;  5B31 B;  3AZJ A;  3MGR B;  3AN2 A;  3KXB A;  3EPH A;  1P3B C;  3TU4 C;  1Z2C B;  5B0Y A;  4JJN D;  4E45 A;  5B32 C;  3AZE C;  5B40 A;  1P3K B;  2ZY2 A;  4J8W C;  5CP6 B;  1ID3 B;  2IO5 C;  3O62 B;  3AN2 D;  1F66 D;  5B0Y B;  1ZLA D;  1P3L D;  5B2I C;  5CPI A;  1P3K A;  3X1T B;  1U35 A;  5B1M D;  1P34 B;  1P3G A;  1M18 D;  2CV5 B;  3MVD B;  3AV1 A;  1F66 B;  3REI A;  1U35 B;  4DRA A;  4Z2M H;  4WNN B;  1P3A C;  1KX4 A;  4Z5T C;  3MVD A;  3KUY D;  1P3B B;  3KWQ C;  5AV5 A;  3LEL C;  1P3P B;  3MGS B;  3AZN C;  5G49 A;  5B31 A;  3KXB B;  5AY8 D;  5BS7 C;  2ARO C;  3REL B;  3B6G D;  3H0L C;  1HQ3 A;  3UTB C;  3W99 B;  2Y2Q A;  5AV5 B;  4E44 A;  3LJA B;  3MGQ A;  5B2I B;  1ID3 A;  3AZG C;  5B24 C;  1P3M A;  4WU9 A;  5FUG B;  1P3A D;  1AOI B;  3X1U A;  4WJ3 C;  5B0Z B;  5CP6 C;  3LJA A;  4J8W B;  3MNN A;  1KX3 C;  5B2J B;  1P3M D;  2DQN C;  4CAY A;  1AOI A;  3A6N C;  1H3O B;  3KFU G;  1BH8 B;  1P34 C;  4EO5 C;  5B2J D;  1EQZ A;  5AV8 D;  4WU8 D;  2F8N H;  4WNN A;  3EPK A;  3TU4 D;  4CAY B;  4H9Q B;  4Z66 D;  5B0Z C;  1M19 A;  2FJ7 A;  3W98 A;  1H3O A;  2PYO A;  3MGS A;  1BH8 A;  5CHL B;  4R8P D;  3REJ D;  1M1A D;  4LD9 A;  3W97 A;  1HQ3 B;  5CPK B;  3WAA B;  3AZK B;  5CPI C;  5B2I A;  4WU9 B;  5FUG A;  3V9R B;  4Z66 C;  1P3G C;  1M18 B;  3W97 B;  2YFV B;  5AVB C;  3B6F D;  2RVQ D;  4QLC D;  3MNN D;  3LJA D;  1ZLA A;  4XUJ C;  2HIO A;  5DNN C;  3X1S C;  3WKJ B;  2F8N G;  3REI C;  4WU9 D;  4H9N B;  2DF4 C;  2BG1 A;  3H0R C;  3B6F B;  2J8P A;  1KX3 D;  3VH5 W;  4YM6 A;  3KXB D;  3WA9 D;  3A1K A;  5BS7 A;  3LZ1 A;  2ARO A;  1M19 B;  3W98 B;  3B6F A;  5GSU D;  5AV5 D;  5DNM A;  3UTA D;  2NZD C;  1ID3 C;  4LD9 B;  3EG5 B;  3AFA C;  3AZJ B;  3MGR A;  5AVC A;  2F8N K;  2F2A C;  5GT0 C;  5GSU B;  3X1U C;  2Y2L A;  4J8X B;  5GXQ A;  1A7W A;  1P3F C;  1M18 A;  3KUY C;  5AVC B;  2YFV A;  3WTP E;  3MGP C;  5GSU A;  5AV9 C;  1TAF B;  1P3L A;  5BT1 D;  4NE5 A;  3O62 D;  1EQZ D;  5AV8 B;  4WU8 B;  1P3G B;  1P34 A;  1EQZ C;  3REK A;  4YS3 D;  4YS3 C;  2CV5 A;  4G91 C;  3AZG D;  4AWL C;  4WZS B;  3AZJ C;  4H9O B;  4LD9 C;  3B6G C;  1P3B A;  3X1U D;  4QLC A;  3W96 A;  1N1J A;  1TZY B;  5CPJ D;  2Y2O A;  4Z5T D;  4QLC B;  2BYM B;  2ZM5 A;  1JFI A;  1N1J B;  1TZY A;  4M6B A;  4WV4 B;  5BNV A;  3A6N B;  4LD9 D;  3REJ A;  1M1A A;  2FFF B;  4R8P A;  5GT0 B;  1P3O D;  3WA9 C;  4Z5T B;  5F99 A;  3AL0 C;  2FJ7 D;  5AV8 A;  4WU8 A;  5B2J A;  3REI D;  3UT9 D;  1S32 A;  4Z5T A;  3MVD C;  3LZ1 C;  1AOI D;  3AV2 C;  3WAA C;  2F8N D;  1P3G D;  5GT3 B;  4H9O A;  5B33 C;  3WTP A;  1P3I B;  5AVB D;  5AVC C;  3H0M C;  1Q9C A;  4J8X D;  5GXQ C;  5BO0 B;  4HGA B;  1ID3 D;  3REH C;  3TU4 B;  4G91 B;  3MGP A;  3C1C C;  3C1B D;  3AZL C;  3AYW D;  1P3P A;  5B31 C;  3REJ B;  1M1A B;  2NQB C;  3V9R A;  3REL A;  5CPK C;  1BH9 B;  1HQ3 C;  5F99 B;  3MGP B;  4J8U A;  2HIO B;  3X1V C;  3O62 C;  3F6T A;  1F1E A;  3LZ0 B;  4H9N A;  1BH9 A;  3NQU A;  3X1U B;  5B0Z A;  3LJA C;  4J8U B;  4QLC C;  2FJ7 C;  2Y2M A;  2Y2N A;  3MNN B;  3W99 C;  4ZUX D;  3UTB B;  4UPK A;  3X1T D;  2Y2J A;  5B1M A;  5GT3 A;  1P3I A;  1P3F D;  3AZI B;  5C3I C;  3W97 C;  5AY8 B;  3REL D;  5AY8 C;  4H9S C;  3KWQ B;  4H9P A;  4NE3 A;  3EPJ A;  5B1L A;  2G5H C;  4R8P C;  5GT0 D;  1P3O B;  4H9Q A;  4KUD B;  2PYO B;  4KUD C;  4X23 B;  2NZD D;  5B32 G;  4CSR A;  3AZJ D;  5AV8 C;  4WU8 C;  4J8V C;  5AV6 A;  1PZR A;  1S32 C;  3AZK A;  2L5A A;  4X23 A;  5B2I D;  3LZ0 A;  3AZH D;  3AZH C;  5B33 A;  5F99 D;  3NQU B;  1BFM A;  1P3A B;  5AV9 D;  1ZLA B;  5DNN A;  1T3U A;  3WKJ A;  5B32 B;  1U35 C;  4KGC B;  5B1M B;  5BNX B;  3VH5 T;  4J8V D;  4YS3 B;  3AZI A;  3A1I A;  1F66 C;  2JE5 A;  3AN2 C;  3AZL D;  4ZUX B;  3UTB D;  5B32 A;  1KX5 B;  4J8V B;  2NQB A;  3REL C;  3LZ1 B;  3KUY B;  4ZBJ B;  1P3B D;  3LEL A;  3AZL B;  5DNM B;  2NZD A;  3VH6 A;  4Z2M G;  5BNV B;  4KGC C;  4KHA A;  1P3K C;  4R8P B;  5GT0 A;  4G92 B;  2CV5 D;  3A6N D;  2NZD B;  1WWI A;  4NE6 A;  3AZG A;  2ZY5 A;  3AZF C;  1M18 C;  4WU9 C;  5GT3 C;  5B33 B;  1P3I C;  4ZBJ C;  2Y2K A;  3REK D;  1S32 B;  3B6G A;  2Y2H A;  1P3L C;  2RVQ C;  3MNN C;  4H9S A;  5B31 D;  5JRG C;  5BNX A;  2Y2G A;  5B24 D;  3WTP B;  2Y2I A;  3B6G B;  4KUD D;  2F8N B;  3C1C D;  3AYW C;  5CPJ C;  1KX5 A;  5JA4 B;  2NQB B;  5B24 A;  5AVC D;  2ARO D;  4Z66 B;  3W96 C;  3W96 B;  3UTA A;  4YM6 D;  3C1B A;  2UWX A;  1KX3 A;  5B2J C;  3X1T C;  3LZ1 D;  4JJN B;  1JFI B;  3WAA D;  1AOI C;  3A6N A;  3C1B B;  2IO5 B;  4XZQ A;  5AVB A;  5F99 C;  5B0Y D;  4JJN A;  1ZLA C;  3AV2 B;  2HIO D;  5E5A A;  1W2E A;  1S32 D;  4H9R A;  3AV2 A;  4NFT A;  1WWS A;  4YM6 C;  5B40 C;  5JA4 A;  3REH D;  3AZI D;  5B1L B;  3AFA D;  3AZM A;  1P3O A;  3IP4 C;  2VQR A;  4Z66 A;  1P3F B;  1M19 D;  3W97 D;  3W98 D;  4H9R B;  3KWQ D;  1B6W A;  3UTA B;  3MGS D;  1TZY D;  2HIO C;  4XUJ A;  5BO0 A;  3AFA A;  3REH A;  5B33 D;  3R45 B;  5AV6 B;  3TU4 A;  3W99 D;  4ZUX C;  4X23 D;  1HTA A;  2YFW A;  5JRG A;  3UT9 C;  5B1M C;  3WA9 B;  2HUE C;  4J8U C;  1P3A A;  1KX4 C;  3B6F C;  3NQJ A;  5DNM C;  3MGQ D;  3VH6 W;  3AZH B;  3AZN A;  4XZQ D;  2NQB D;  5B1L C;  4YS3 A;  2CV5 C;  1HQ3 D;  3AV1 C;  2JSS A;  5B32 D;  3W99 A;  3UTB A;  3B0D C;  3MGQ B;  3AZM B;  3AN2 B;  1P3F A;  4J8V A;  5AY8 A;  3KUY A;  3KWQ A;  2RIQ A;  4H9P B;  4J8X C;  5KDM A;  3AZK C;  5GSU C;  3WKJ D;  5GXQ D;  5CP6 A;  3REH B;  4HGA C;  1KX5 D;  3AZM D;  4XZQ C;  2LY8 A;  3MVD D;  3FDD A;  3LZ0 D;  3AV1 D;  4KUD A;  3AV2 D;  5KDM B;  4J8U D;  1U35 D;  3B0D B;  4CSR B;  5DNM D;  3MGQ C;  5JRG B;  3AZG B;  1P3M C;  5AV6 C;  5AV6 D;  5B31 G;  3WA9 A;  3AV1 B;  4DQY B;  1F66 A;  2FJ7 B;  1P3P D;  3MGP D;  3AZF B;  5CPI D;  3LZ0 C;  3MGS C;  3AZN B;  2PYO C;  2XD5 A;  2XD1 A;  5CPJ B;  1KX4 B;  1P3O C;  3KSY A;  4G92 C;  5DNN B;  3WAA A;  4AWL B; 
#chains in the Genus database with same CATH homology
 4KGC A;  5B40 D;  3WTP C;  3WTP D;  4UUZ A;  3REJ C;  5B24 B;  3EPL A;  1M1A C;  1M19 C;  3W98 C;  3LEL D;  3C1C B;  3B0C T;  4ZUX A;  5B0Z D;  2ZY3 A;  3B0C W;  3P5J B;  3X1S A;  1P3M B;  3UT9 A;  3KXB C;  2BYK A;  5B0Y C;  3AZE A;  3C1C A;  3LEL B;  2JCH A;  3AZL A;  3B0B A;  1P3P C;  4J8W A;  4KHA B;  2PYO D;  5BT1 C;  3X1S B;  5CP6 D;  2G5I C;  4XZQ B;  4YM6 B;  3WKJ C;  5AVB B;  2BYK B;  3AZE B;  2W8S A;  3AYW A;  3AZF A;  3X1V A;  1EQZ B;  5E5A B;  5CPJ A;  1KX5 C;  1ULY A;  5CPK D;  3AZK D;  2ZY4 A;  4DRB A;  3AYW B;  4J8X A;  5GXQ B;  3AZN D;  3UTA C;  3C1B C;  1B67 A;  4UUZ B;  5CPK A;  2F8N A;  5AV5 C;  2HUE B;  4EO5 B;  5B40 B;  1TAF A;  1P3L B;  5JRG D;  4XUJ B;  5B1L D;  3AFA B;  3UT9 B;  3R45 A;  3MGR C;  1P34 D;  3O62 A;  3REK B;  3REK C;  3VH5 A;  1R4V A;  5C3I B;  3X1V D;  3AZF D;  5CPI B;  1KX3 B;  2YFW B;  4XUJ D;  5GT3 D;  3X1T A;  1P3I D;  2CWE A;  2Y2P A;  1KX4 D;  5DNN D;  4X23 C;  5AV9 A;  3X1V B;  3X1S D;  3NQJ B;  4J8W D;  3AZH A;  3REI B;  3VH6 T;  3MGR D;  3AZM C;  4JJN C;  3AZE D;  2ARO B;  5AV9 B;  1KU5 A;  2BYM A;  3W96 D;  1P3K D;  5E5A C;  1TZY C;  5E5A D;  4KGC D;  3AZI C;  5G49 B;  5B31 B;  3AZJ A;  3MGR B;  3AN2 A;  3KXB A;  3EPH A;  1P3B C;  3TU4 C;  1Z2C B;  5B0Y A;  4JJN D;  4E45 A;  5B32 C;  3AZE C;  5B40 A;  1P3K B;  2ZY2 A;  4J8W C;  5CP6 B;  1ID3 B;  2IO5 C;  3O62 B;  3AN2 D;  1F66 D;  5B0Y B;  1ZLA D;  1P3L D;  5B2I C;  5CPI A;  1P3K A;  3X1T B;  1U35 A;  5B1M D;  1P34 B;  1P3G A;  1M18 D;  2CV5 B;  3MVD B;  3AV1 A;  1F66 B;  3REI A;  1U35 B;  4DRA A;  4Z2M H;  4WNN B;  1P3A C;  1KX4 A;  4Z5T C;  3MVD A;  3KUY D;  1P3B B;  3KWQ C;  5AV5 A;  3LEL C;  1P3P B;  3MGS B;  3AZN C;  5G49 A;  5B31 A;  3KXB B;  5AY8 D;  5BS7 C;  2ARO C;  3REL B;  3B6G D;  3H0L C;  1HQ3 A;  3UTB C;  3W99 B;  2Y2Q A;  5AV5 B;  4E44 A;  3LJA B;  3MGQ A;  5B2I B;  1ID3 A;  3AZG C;  5B24 C;  1P3M A;  4WU9 A;  5FUG B;  1P3A D;  1AOI B;  3X1U A;  4WJ3 C;  5B0Z B;  5CP6 C;  3LJA A;  4J8W B;  3MNN A;  1KX3 C;  5B2J B;  1P3M D;  2DQN C;  4CAY A;  1AOI A;  3A6N C;  1H3O B;  3KFU G;  1BH8 B;  1P34 C;  4EO5 C;  5B2J D;  1EQZ A;  5AV8 D;  4WU8 D;  2F8N H;  4WNN A;  3EPK A;  3TU4 D;  4CAY B;  4H9Q B;  4Z66 D;  5B0Z C;  1M19 A;  2FJ7 A;  3W98 A;  1H3O A;  2PYO A;  3MGS A;  1BH8 A;  5CHL B;  4R8P D;  3REJ D;  1M1A D;  4LD9 A;  3W97 A;  1HQ3 B;  5CPK B;  3WAA B;  3AZK B;  5CPI C;  5B2I A;  4WU9 B;  5FUG A;  3V9R B;  4Z66 C;  1P3G C;  1M18 B;  3W97 B;  2YFV B;  5AVB C;  3B6F D;  2RVQ D;  4QLC D;  3MNN D;  3LJA D;  1ZLA A;  4XUJ C;  2HIO A;  5DNN C;  3X1S C;  3WKJ B;  2F8N G;  3REI C;  4WU9 D;  4H9N B;  2DF4 C;  2BG1 A;  3H0R C;  3B6F B;  2J8P A;  1KX3 D;  3VH5 W;  4YM6 A;  3KXB D;  3WA9 D;  3A1K A;  5BS7 A;  3LZ1 A;  2ARO A;  1M19 B;  3W98 B;  3B6F A;  5GSU D;  5AV5 D;  5DNM A;  3UTA D;  2NZD C;  1ID3 C;  4LD9 B;  3EG5 B;  3AFA C;  3AZJ B;  3MGR A;  5AVC A;  2F8N K;  2F2A C;  5GT0 C;  5GSU B;  3X1U C;  2Y2L A;  4J8X B;  5GXQ A;  1A7W A;  1P3F C;  1M18 A;  3KUY C;  5AVC B;  2YFV A;  3WTP E;  3MGP C;  5GSU A;  5AV9 C;  1TAF B;  1P3L A;  5BT1 D;  4NE5 A;  3O62 D;  1EQZ D;  5AV8 B;  4WU8 B;  1P3G B;  1P34 A;  1EQZ C;  3REK A;  4YS3 D;  4YS3 C;  2CV5 A;  4G91 C;  3AZG D;  4AWL C;  4WZS B;  3AZJ C;  4H9O B;  4LD9 C;  3B6G C;  1P3B A;  3X1U D;  4QLC A;  3W96 A;  1N1J A;  1TZY B;  5CPJ D;  2Y2O A;  4Z5T D;  4QLC B;  2BYM B;  2ZM5 A;  1JFI A;  1N1J B;  1TZY A;  4M6B A;  4WV4 B;  5BNV A;  3A6N B;  4LD9 D;  3REJ A;  1M1A A;  2FFF B;  4R8P A;  5GT0 B;  1P3O D;  3WA9 C;  4Z5T B;  5F99 A;  3AL0 C;  2FJ7 D;  5AV8 A;  4WU8 A;  5B2J A;  3REI D;  3UT9 D;  1S32 A;  4Z5T A;  3MVD C;  3LZ1 C;  1AOI D;  3AV2 C;  3WAA C;  2F8N D;  1P3G D;  5GT3 B;  4H9O A;  5B33 C;  3WTP A;  1P3I B;  5AVB D;  5AVC C;  3H0M C;  1Q9C A;  4J8X D;  5GXQ C;  5BO0 B;  4HGA B;  1ID3 D;  3REH C;  3TU4 B;  4G91 B;  3MGP A;  3C1C C;  3C1B D;  3AZL C;  3AYW D;  1P3P A;  5B31 C;  3REJ B;  1M1A B;  2NQB C;  3V9R A;  3REL A;  5CPK C;  1BH9 B;  1HQ3 C;  5F99 B;  3MGP B;  4J8U A;  2HIO B;  3X1V C;  3O62 C;  3F6T A;  1F1E A;  3LZ0 B;  4H9N A;  1BH9 A;  3NQU A;  3X1U B;  5B0Z A;  3LJA C;  4J8U B;  4QLC C;  2FJ7 C;  2Y2M A;  2Y2N A;  3MNN B;  3W99 C;  4ZUX D;  3UTB B;  4UPK A;  3X1T D;  2Y2J A;  5B1M A;  5GT3 A;  1P3I A;  1P3F D;  3AZI B;  5C3I C;  3W97 C;  5AY8 B;  3REL D;  5AY8 C;  4H9S C;  3KWQ B;  4H9P A;  4NE3 A;  3EPJ A;  5B1L A;  2G5H C;  4R8P C;  5GT0 D;  1P3O B;  4H9Q A;  4KUD B;  2PYO B;  4KUD C;  4X23 B;  2NZD D;  5B32 G;  4CSR A;  3AZJ D;  5AV8 C;  4WU8 C;  4J8V C;  5AV6 A;  1PZR A;  1S32 C;  3AZK A;  2L5A A;  4X23 A;  5B2I D;  3LZ0 A;  3AZH D;  3AZH C;  5B33 A;  5F99 D;  3NQU B;  1BFM A;  1P3A B;  5AV9 D;  1ZLA B;  5DNN A;  1T3U A;  3WKJ A;  5B32 B;  1U35 C;  4KGC B;  5B1M B;  5BNX B;  3VH5 T;  4J8V D;  4YS3 B;  3AZI A;  3A1I A;  1F66 C;  2JE5 A;  3AN2 C;  3AZL D;  4ZUX B;  3UTB D;  5B32 A;  1KX5 B;  4J8V B;  2NQB A;  3REL C;  3LZ1 B;  3KUY B;  4ZBJ B;  1P3B D;  3LEL A;  3AZL B;  5DNM B;  2NZD A;  3VH6 A;  4Z2M G;  5BNV B;  4KGC C;  4KHA A;  1P3K C;  4R8P B;  5GT0 A;  4G92 B;  2CV5 D;  3A6N D;  2NZD B;  1WWI A;  4NE6 A;  3AZG A;  2ZY5 A;  3AZF C;  1M18 C;  4WU9 C;  5GT3 C;  5B33 B;  1P3I C;  4ZBJ C;  2Y2K A;  3REK D;  1S32 B;  3B6G A;  2Y2H A;  1P3L C;  2RVQ C;  3MNN C;  4H9S A;  5B31 D;  5JRG C;  5BNX A;  2Y2G A;  5B24 D;  3WTP B;  2Y2I A;  3B6G B;  4KUD D;  2F8N B;  3C1C D;  3AYW C;  5CPJ C;  1KX5 A;  5JA4 B;  2NQB B;  5B24 A;  5AVC D;  2ARO D;  4Z66 B;  3W96 C;  3W96 B;  3UTA A;  4YM6 D;  3C1B A;  2UWX A;  1KX3 A;  5B2J C;  3X1T C;  3LZ1 D;  4JJN B;  1JFI B;  3WAA D;  1AOI C;  3A6N A;  3C1B B;  2IO5 B;  4XZQ A;  5AVB A;  5F99 C;  5B0Y D;  4JJN A;  1ZLA C;  3AV2 B;  2HIO D;  5E5A A;  1W2E A;  1S32 D;  4H9R A;  3AV2 A;  4NFT A;  1WWS A;  4YM6 C;  5B40 C;  5JA4 A;  3REH D;  3AZI D;  5B1L B;  3AFA D;  3AZM A;  1P3O A;  3IP4 C;  2VQR A;  4Z66 A;  1P3F B;  1M19 D;  3W97 D;  3W98 D;  4H9R B;  3KWQ D;  1B6W A;  3UTA B;  3MGS D;  1TZY D;  2HIO C;  4XUJ A;  5BO0 A;  3AFA A;  3REH A;  5B33 D;  3R45 B;  5AV6 B;  3TU4 A;  3W99 D;  4ZUX C;  4X23 D;  1HTA A;  2YFW A;  5JRG A;  3UT9 C;  5B1M C;  3WA9 B;  2HUE C;  4J8U C;  1P3A A;  1KX4 C;  3B6F C;  3NQJ A;  5DNM C;  3MGQ D;  3VH6 W;  3AZH B;  3AZN A;  4XZQ D;  2NQB D;  5B1L C;  4YS3 A;  2CV5 C;  1HQ3 D;  3AV1 C;  2JSS A;  5B32 D;  3W99 A;  3UTB A;  3B0D C;  3MGQ B;  3AZM B;  3AN2 B;  1P3F A;  4J8V A;  5AY8 A;  3KUY A;  3KWQ A;  2RIQ A;  4H9P B;  4J8X C;  5KDM A;  3AZK C;  5GSU C;  3WKJ D;  5GXQ D;  5CP6 A;  3REH B;  4HGA C;  1KX5 D;  3AZM D;  4XZQ C;  2LY8 A;  3MVD D;  3FDD A;  3LZ0 D;  3AV1 D;  4KUD A;  3AV2 D;  5KDM B;  4J8U D;  1U35 D;  3B0D B;  4CSR B;  5DNM D;  3MGQ C;  5JRG B;  3AZG B;  1P3M C;  5AV6 C;  5AV6 D;  5B31 G;  3WA9 A;  3AV1 B;  4DQY B;  1F66 A;  2FJ7 B;  1P3P D;  3MGP D;  3AZF B;  5CPI D;  3LZ0 C;  3MGS C;  3AZN B;  2PYO C;  2XD5 A;  2XD1 A;  5CPJ B;  1KX4 B;  1P3O C;  3KSY A;  4G92 C;  5DNN B;  3WAA A;  4AWL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...