1ZLAC

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNWERDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
molecule tags Protein binding/virus/dna
source organism Homo sapiens
publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaC00
4Z66C 4XUJD 5B40A 2BYMA 1EQZB 1H3OB 2NQBA 1P3IB 3WTPC 4KUDD 3W98A 1M19A 4XUJA 1P3MC 3AZLB 5GT0B 3REJB 5B1LB 4JJNC 1P3GD 5B0YD 1P3IC 3AZEA 4WU8D 5B33B 5GSUC 3MVDA 3AV2C 1HQ3A 3O62D 5B33D 5B0YA 5B0ZD 3LZ0C 5JA4B 3MGPA 4X23B 3W97B 3KXBC 3AZMA 2HUEC 5AV8B 3UTAA 5CPIB 1M1AA 1KX3D 2PYOC 3X1UA 2CWEA 2F8NG 3A6NB 3REIB 1ZLAD 1P34A 5CPKB 5AV8D 2HUEB 5CPIC 4XZQA 5GXQB 1AOIC 5AVCA 3LZ1C 1F66B 3B0DB 5AY8C 3W96B 3TU4C 3LELA 3B0CW 5GSUB 3C1BD 3UTBB 1N1JB 3AZID 4CSRB 3KWQB 3REKD 4WNNA 3REHB 3UT9C 5GXQD 3AZLC 4ZBJB 5B2IA 3AZEC 3AZJD 1U35B 5DNNC 1P3FD 4Z5TB 5B31A 1P3PA 4LD9B 4J8VC 3AZIB 4YS3A 3W99C 2BYKB 3LZ0A 3R45A 5B1MD 3AZHA 3W96C 5BNXB 3C1BA 1F66C 5B40C 2HIOB 1TAFA 3WTPA 4E44A 5F99D 4Z2MG 3AZGC 3AZNA 4AWLB 2JSSA 3VH5T 4J8WB 5AV9B 2PYOB 5B2JD 2FJ7D 3B6GB 5E5AD 5CP6A 3AZMD 5AV6B 3X1VD 4DRAA 3MGPC 3AZKB 5DNNB 3UTAC 1M1AC 4J8UC 4LD9C 5AV6D 2NZDC 5B2JA 1P3AA 2AROC 2L5AA 4H9NB 5JRGD 4CAYB 1EQZC 4XZQD 1P34B 5B2IC 5E5AB 5BT1C 4ZUXA 4Z66B 4KHAB 5B31C 5F99A 3B6FD 3LELC 4KGCC 5AVBD 1TZYB 3UTBC 1KX4C 3AZGD 4NE3A 1P3LB 4WZSB 5AV5B 2CV5C 3UT9A 3NQUA 3AV1B 4WU8A 5AVBB 3X1TC 3VH6W 5B1LD 1TZYD 2RVQC 1P3KC 5AV9C 5GT3D 4KUDA 3MGQB 5AVBC 3X1TB 5C3IC 2NQBD 5BO0B 4Z5TA 3AFAB 1S32A 1P3LC 1P3BC 1KX3B 5JRGC 2AROD 3AV1D 3VH6T 1P3MB 3MVDD 2IO5B 1P3AC 3AZGA 3AZFA 3WTPB 4ZBJC 3MGSA 1M19D 3AFAD 3TU4D 2FJ7C 1BH9A 5BNVB 3W98B 3MNNB 3KWQC 1M19B 3REHD 5GT0A 3REJA 5FUGA 3KWQD 3REKB 3RELC 3AZKC 1P3AD 3NQJB 1ZLAC 1KX5C 5CPJD 3AFAC 2CV5A 4H9PB 2YFWB 2AROA 4QLCB 3LZ1B 5B0ZC 3LZ0D 3C1CA 5B1MC 5B2JB 1U35D 1P3FB 5B32A 5B32G 3AZMB 2YFVB 3REIC 3W98D 5E5AA 1HTAA 4KGCA 3AV1C 4KHAA 4UUZB 3LJAA 1P3GC 1P3ID 5AV9D 3AN2A 4XZQB 3VH6A 4E45A 3UT9D 3KUYB 1JFIA 3W98C 1KX4D 3LELB 1U35C 4JJNB 4NFTA 4NE5A 4WU8B 4YM6B 3MGSC 3WA9A 5BS7C 5CPJA 2CV5D 4HGAC 2F8NA 5B31D 1ID3D 4KUDB 1BH8A 5B2ID 3AYWB 4H9OB 4J8UB 1EQZD 1WWSA 4G91C 5CPID 3LJAD 4XUJB 3B6FC 4KGCD 3X1UC 5AV6C 2NZDD 4J8UD 1KX3A 4R8PB 5GT3B 1M19C 1ID3B 3AZIA 1P3MA 2BYKA 4H9QB 4J8XB 5BNXA 3C1BB 5B0YB 3WAAA 5E5AC 1F1EA 1TAFB 1P3KB 3AV2A 4YM6C 3MGSB 2FJ7A 3LJAC 3AN2C 1BH9B 5B40B 2NZDB 5CPKA 5DNMD 5JRGB 2PYOA 3MGSD 3AZLA 3VH5A 5B0ZA 3C1CD 3C1CC 3B0BA 5B33A 1P3KD 5B1LC 3LZ1A 5DNNA 4EO5C 1P3PC 1B6WA 1F66D 4H9RB 3W96D 3REHA 3AN2D 4UUZA 5AV8A 3UTAB 1M1AB 5G49A 2HIOC 3B6FA 4J8VD 3REID 1ZLAB 5F99B 5DNMA 3REKC 5KDMB 3KSYA 3MGRA 3AZIC 3KUYA 5BT1D 3MNNC 2LY8A 5AVCB 3MGPD 3X1VC 5GXQC 1AOIB 1R4VA 5CPJC 3R45B 3AZHB 4HGAB 4YM6A 3WAAD 4LD9D 3LZ1D 1AOID 4YS3C 3W99A 3KUYD 4H9OA 2BYMB 4J8UA 4WNNB 2PYOD 1KX3C 4WV4B 4R8PA 5B33C 3X1SA 3TU4B 5B1LA 1ID3A 3AZEB 4WU9D 4H9QA 2F8ND 1P3OD 5CP6C 3KXBD 4Z2MH 5DNND 1P3FC 1P3BD 5B24B 1M18B 3AZED 1Q9CA 5JA4A 2HIOA 1KX4A 3AZLD 2NQBC 4WU9B 2NZDA 4ZUXB 3X1UB 3AZJA 4XUJC 5GT3C 3MNNA 5AV9A 1EQZA 2NQBB 1P3IA 3AYWC 1TZYA 5GXQA 4ZUXC 4KUDC 3NQJA 3VH5W 3V9RB 1KX5D 5B32D 1S32C 3WKJB 1P3LA 3RELD 3AZKD 3MVDB 3REHC 3UTBA 3UT9B 1P3BA 3C1CB 5AV8C 4CSRA 3LELD 5B31G 4X23A 5AY8D 3X1TA 5CPIA 4XZQC 3MGQD 5BO0A 3AN2B 3MVDC 4H9SA 1HQ3C 5B0YC 4YS3B 3O62A 3AZGB 3RELA 1P3MD 3WKJC 4QLCD 3KXBA 3AZMC 1B67A 1P3LD 1KX5A 5CPJB 5AV5A 4QLCC 3X1SD 1BH8B 3AZFC 4R8PC 3AYWA 1TZYC 2RVQD 4Z5TD 1H3OA 5AY8A 3X1TD 3X1SB 3TU4A 3WTPD 5B40D 5CP6B 3UTBD 3WTPE 1A7WA 2AROB 3AZKA 5B24A 4J8XA 1M18A 1HQ3B 3AZJC 5CHLB 1P3AB 5AVCD 3MGPB 3WA9C 5B32C 1S32D 4H9SC 3REIA 4J8VA 4ZUXD 3UTAD 1M1AD 3AYWD 4J8WC 3V9RA 3AZHC 3W96A 3C1BC 1F66A 3WKJA 3A6NC 4DRBA 5AV5C 5AV6A 2CV5B 4M6BA 4H9PA 5B1MB 5B2JC 4QLCA 5B24D 4X23C 1M18D 3X1VB 2F8NB 3AZNC 3WKJD 4H9RA 5GT0D 3REJD 4G91B 3MGRD 2YFVA 5BS7A 5F99C 1P34D 3B6FB 4KGCB 4WU9C 5KDMA 3MGRB 5B2IB 3AZND 3O62C 3W99D 5B24C 4X23D 5B31B 1M18C 1P3PB 4LD9A 3O62B 5AV5D 2IO5C 4WU8C 4J8XD 4JJND 1P3KA 4YS3D 3WA9B 1P3OB 1WWIA 3WAAC 5AVBA 1P3GB 2F8NH 5AY8B 3AZNB 3A6ND 3B0CT 5BNVA 4Z66D 4J8WA 4G92C 3MNND 3MGQA 5CPKD 5CPKC 4J8XC 3B6GA 5B0ZB 3W97D 4AWLC 2HIOD 3WA9D 2YFWA 5B32B 5CP6D 3AV2B 3AZFB 1P3OC 4WU9A 3W97A 4H9NA 4Z5TC 4CAYA 3AZJB 4J8VB 5GT0C 3REJC 5DNMB 4Z66A 3A6NA 5JRGA 3AV2D 4EO5B 1P34C 5GSUD 2F8NK 5FUGB 5DNMC 3REKA 1KU5A 3MGRC 3KUYC 4NE6A 5B1MA 3AZHD 3AZFD 3X1SC 4JJNA 3X1VA 1P3BB 1HQ3D 4YM6D 5GSUA 3NQUB 3AV1A 1N1JA 5C3IB 1P3FA 3KWQA 3MGQC 5G49B 1ULYA 4J8WD 3B6GC 3B0DC 1ZLAA 3LJAB 3X1UD 3AFAA 1S32B 5GT3A 4G92B 1U35A 1AOIA 1BFMA 5AVCC 1JFIB 1ID3C 3RELB 3KXBB 3WAAB 1P3OA 1KX5B 1P3PD 3LZ0B 1KX4B 3W97C 2FJ7B 3B6GD 3W99B 1P3GA 4R8PD
chains in the Genus database with same CATH superfamily
4Z66C 4XUJD 5B40A 2BYMA 1EQZB 1H3OB 2NQBA 1P3IB 3WTPC 4KUDD 3W98A 1M19A 4XUJA 1P3MC 3AZLB 5GT0B 3REJB 5B1LB 4JJNC 1P3GD 5B0YD 1P3IC 3AZEA 4WU8D 5B33B 2F2AC 5GSUC 3MVDA 3AV2C 2W8SA 1HQ3A 2G5HC 5B33D 3O62D 5B0YA 5B0ZD 3LZ0C 5JA4B 3MGPA 4X23B 3W97B 3EPHA 3KXBC 3AZMA 2HUEC 5AV8B 3UTAA 5CPIB 1M1AA 1KX3D 2PYOC 3X1UA 2CWEA 2F8NG 3A6NB 3REIB 1ZLAD 1P34A 5CPKB 5AV8D 2HUEB 5CPIC 4XZQA 5GXQB 1AOIC 5AVCA 3LZ1C 1F66B 3B0DB 5AY8C 3W96B 3TU4C 2ZY2A 3LELA 3AL0C 3B0CW 5GSUB 3C1BD 3UTBB 1N1JB 3AZID 2G5IC 4CSRB 3KWQB 3REKD 4WNNA 3REHB 3UT9C 2DQNC 5GXQD 3AZLC 4ZBJB 5B2IA 3AZEC 3AZJD 1U35B 5DNNC 1P3FD 4Z5TB 5B31A 1P3PA 4LD9B 4J8VC 3AZIB 4YS3A 3W99C 2BYKB 3LZ0A 3R45A 5B1MD 3AZHA 3W96C 5BNXB 3C1BA 1F66C 5B40C 2HIOB 1TAFA 3WTPA 2XD1A 4E44A 5F99D 4Z2MG 3AZGC 3AZNA 4AWLB 2JSSA 3VH5T 4J8WB 5AV9B 3A1IA 2ZY5A 2PYOB 5B2JD 2FJ7D 3B6GB 5E5AD 5CP6A 3AZMD 3H0LC 5AV6B 3X1VD 4DRAA 3MGPC 3AZKB 5DNNB 3UTAC 1M1AC 4J8UC 4LD9C 5AV6D 2NZDC 5B2JA 1P3AA 2AROC 2L5AA 4H9NB 5JRGD 4CAYB 1EQZC 4XZQD 1P34B 5B2IC 5E5AB 5BT1C 4ZUXA 4Z66B 4KHAB 5B31C 5F99A 3B6FD 3LELC 4KGCC 5AVBD 1TZYB 3IP4C 3UTBC 1KX4C 3AZGD 4NE3A 1P3LB 4WZSB 5AV5B 2CV5C 3UT9A 3NQUA 3AV1B 4WU8A 5AVBB 3X1TC 3VH6W 5B1LD 1TZYD 2RVQC 1P3KC 5AV9C 5GT3D 4KUDA 3MGQB 5AVBC 3X1TB 3FDDA 5C3IC 2NQBD 5BO0B 4Z5TA 3AFAB 1S32A 1P3LC 1P3BC 1KX3B 5JRGC 2AROD 3AV1D 3VH6T 1P3MB 3MVDD 2IO5B 1P3AC 3AZGA 3AZFA 3WTPB 2Y2KA 3EPKA 2Y2OA 4ZBJC 3MGSA 1M19D 3AFAD 3TU4D 2FJ7C 2DF4C 1BH9A 5BNVB 3W98B 3MNNB 3KWQC 1M19B 3REHD 5GT0A 3REJA 5FUGA 3KWQD 3REKB 3RELC 3AZKC 1P3AD 3NQJB 1ZLAC 1KX5C 5CPJD 3AFAC 2CV5A 4H9PB 2YFWB 2AROA 4QLCB 3LZ1B 5B0ZC 3LZ0D 3C1CA 5B1MC 5B2JB 1U35D 1P3FB 5B32A 5B32G 3AZMB 2RIQA 2YFVB 2XD5A 3REIC 5E5AA 3W98D 1HTAA 4KGCA 3AV1C 4KHAA 4UUZB 3LJAA 1P3GC 4DQYB 1P3ID 5AV9D 3AN2A 4XZQB 3VH6A 4E45A 3UT9D 3KUYB 1JFIA 3W98C 1KX4D 3LELB 1U35C 4JJNB 4NFTA 4NE5A 4WU8B 4YM6B 1Z2CB 3MGSC 5BS7C 3WA9A 5CPJA 2CV5D 4HGAC 2F8NA 3KFUG 5B31D 1ID3D 4KUDB 1BH8A 5B2ID 3AYWB 4H9OB 4J8UB 1EQZD 1WWSA 4G91C 5CPID 3LJAD 4XUJB 3B6FC 4KGCD 3X1UC 5AV6C 2NZDD 4J8UD 1KX3A 4R8PB 5GT3B 1M19C 1ID3B 3AZIA 1P3MA 2BYKA 4H9QB 4J8XB 5BNXA 3C1BB 5B0YB 3WAAA 5E5AC 1F1EA 1TAFB 1P3KB 3AV2A 4YM6C 3MGSB 2FJ7A 3LJAC 3AN2C 1BH9B 5B40B 2NZDB 5CPKA 5DNMD 5JRGB 2PYOA 3MGSD 3AZLA 3VH5A 5B0ZA 3C1CD 3C1CC 3B0BA 5B33A 1P3KD 5B1LC 3LZ1A 5DNNA 4EO5C 1P3PC 1B6WA 3H0MC 3EPLA 2Y2HA 1F66D 4H9RB 3W96D 3REHA 3AN2D 4UUZA 5AV8A 3UTAB 1M1AB 5G49A 2HIOC 2Y2LA 3B6FA 4J8VD 3EG5B 3REID 1ZLAB 5F99B 5DNMA 3REKC 5KDMB 3KSYA 3MGRA 3AZIC 3KUYA 5BT1D 3MNNC 2LY8A 5AVCB 3MGPD 3X1VC 5GXQC 1AOIB 1R4VA 5CPJC 3R45B 3AZHB 4HGAB 4YM6A 3WAAD 4LD9D 3LZ1D 1W2EA 1AOID 4YS3C 3W99A 3KUYD 3EPJA 4H9OA 2BYMB 2J8PA 2Y2PA 4J8UA 4WNNB 2PYOD 2Y2QA 1KX3C 4WV4B 4R8PA 5B33C 3X1SA 3TU4B 5B1LA 1ID3A 3AZEB 4WU9D 2Y2JA 4H9QA 2F8ND 1P3OD 5CP6C 3KXBD 4Z2MH 5DNND 1P3FC 1P3BD 5B24B 1M18B 3AZED 1Q9CA 5JA4A 2HIOA 1KX4A 3AZLD 2NQBC 4WU9B 2NZDA 1PZRA 4ZUXB 3X1UB 2ZM5A 3AZJA 2VQRA 4XUJC 5GT3C 3MNNA 5AV9A 1EQZA 2NQBB 1P3IA 3AYWC 1TZYA 5GXQA 4ZUXC 4KUDC 3NQJA 3VH5W 3V9RB 1KX5D 5B32D 1S32C 3WKJB 1P3LA 3RELD 3AZKD 3MVDB 3REHC 3UTBA 3UT9B 1P3BA 3C1CB 5AV8C 4CSRA 3LELD 5B31G 4X23A 5AY8D 3X1TA 5CPIA 4XZQC 3MGQD 5BO0A 3P5JB 3AN2B 3MVDC 4H9SA 1HQ3C 5B0YC 4YS3B 3O62A 3AZGB 3RELA 1P3MD 3WKJC 4QLCD 3KXBA 3AZMC 1B67A 1P3LD 1KX5A 5CPJB 5AV5A 4QLCC 3X1SD 1BH8B 3AZFC 4R8PC 3AYWA 3F6TA 1TZYC 2RVQD 4Z5TD 1H3OA 5AY8A 3X1TD 3X1SB 2Y2IA 3TU4A 3WTPD 5B40D 5CP6B 2ZY3A 2UWXA 3WTPE 3UTBD 2JCHA 1A7WA 2AROB 3AZKA 5B24A 4J8XA 1M18A 1HQ3B 3AZJC 5CHLB 1P3AB 5AVCD 3MGPB 4WJ3C 1T3UA 3WA9C 5B32C 1S32D 4H9SC 3REIA 4J8VA 3H0RC 4ZUXD 3UTAD 1M1AD 3AYWD 4J8WC 3V9RA 3AZHC 3W96A 3C1BC 1F66A 3WKJA 3A6NC 4DRBA 5AV5C 5AV6A 4UPKA 2CV5B 4M6BA 4H9PA 5B1MB 5B2JC 4QLCA 5B24D 4X23C 1M18D 3X1VB 2F8NB 3AZNC 3WKJD 4H9RA 5GT0D 3REJD 4G91B 3MGRD 2YFVA 5BS7A 5F99C 1P34D 3B6FB 4KGCB 4WU9C 2FFFB 5KDMA 3MGRB 5B2IB 3AZND 3O62C 3W99D 5B24C 4X23D 5B31B 1M18C 1P3PB 4LD9A 3O62B 5AV5D 2IO5C 4WU8C 2Y2MA 4J8XD 4JJND 1P3KA 4YS3D 3WA9B 1P3OB 1WWIA 3WAAC 5AVBA 1P3GB 2F8NH 5AY8B 3AZNB 3A6ND 3B0CT 5BNVA 4Z66D 4J8WA 4G92C 3MNND 3MGQA 5CPKD 5CPKC 4J8XC 3B6GA 5B0ZB 3W97D 2Y2NA 4AWLC 2HIOD 3WA9D 2YFWA 5B32B 5CP6D 3AV2B 3AZFB 1P3OC 4WU9A 3W97A 4H9NA 4Z5TC 4CAYA 3AZJB 4J8VB 5GT0C 3REJC 5DNMB 4Z66A 3A6NA 5JRGA 3AV2D 4EO5B 1P34C 3A1KA 5GSUD 2F8NK 5FUGB 5DNMC 3REKA 1KU5A 3MGRC 3KUYC 4NE6A 5B1MA 3AZHD 3AZFD 3X1SC 4JJNA 3X1VA 1P3BB 1HQ3D 4YM6D 5GSUA 3NQUB 3AV1A 1N1JA 5C3IB 2Y2GA 1P3FA 3KWQA 3MGQC 5G49B 1ULYA 4J8WD 3B6GC 3B0DC 1ZLAA 3LJAB 3X1UD 3AFAA 1S32B 2BG1A 5GT3A 4G92B 1U35A 1AOIA 1BFMA 5AVCC 1JFIB 1ID3C 3RELB 2ZY4A 3KXBB 3WAAB 1P3OA 1KX5B 1P3PD 3LZ0B 1KX4B 3W97C 2FJ7B 3B6GD 3W99B 1P3GA 2JE5A 4R8PD
chains in the Genus database with same CATH topology
4Z66C 4XUJD 5B40A 2BYMA 1EQZB 1H3OB 2NQBA 1P3IB 3WTPC 4KUDD 3W98A 1M19A 4XUJA 1P3MC 3AZLB 5GT0B 3REJB 5B1LB 4JJNC 1P3GD 5B0YD 1P3IC 3AZEA 4WU8D 5B33B 2F2AC 5GSUC 3MVDA 3AV2C 2W8SA 1HQ3A 2G5HC 5B33D 3O62D 5B0YA 5B0ZD 3LZ0C 5JA4B 3MGPA 4X23B 3W97B 3EPHA 3KXBC 3AZMA 2HUEC 5AV8B 3UTAA 5CPIB 1M1AA 1KX3D 2PYOC 3X1UA 2CWEA 2F8NG 3A6NB 3REIB 1ZLAD 1P34A 5CPKB 5AV8D 2HUEB 5CPIC 4XZQA 5GXQB 1AOIC 5AVCA 3LZ1C 1F66B 3B0DB 5AY8C 3W96B 3TU4C 2ZY2A 3LELA 3AL0C 3B0CW 5GSUB 3C1BD 3UTBB 1N1JB 3AZID 2G5IC 4CSRB 3KWQB 3REKD 4WNNA 3REHB 3UT9C 2DQNC 5GXQD 3AZLC 4ZBJB 5B2IA 3AZEC 3AZJD 1U35B 5DNNC 1P3FD 4Z5TB 5B31A 1P3PA 4LD9B 4J8VC 3AZIB 4YS3A 3W99C 2BYKB 3LZ0A 3R45A 5B1MD 3AZHA 3W96C 5BNXB 3C1BA 1F66C 5B40C 2HIOB 1TAFA 3WTPA 2XD1A 4E44A 5F99D 4Z2MG 3AZGC 3AZNA 4AWLB 2JSSA 3VH5T 4J8WB 5AV9B 3A1IA 2ZY5A 2PYOB 5B2JD 2FJ7D 3B6GB 5E5AD 5CP6A 3AZMD 3H0LC 5AV6B 3X1VD 4DRAA 3MGPC 3AZKB 5DNNB 3UTAC 1M1AC 4J8UC 4LD9C 5AV6D 2NZDC 5B2JA 1P3AA 2AROC 2L5AA 4H9NB 5JRGD 4CAYB 1EQZC 4XZQD 1P34B 5B2IC 5E5AB 5BT1C 4ZUXA 4Z66B 4KHAB 5B31C 5F99A 3B6FD 3LELC 4KGCC 5AVBD 1TZYB 3IP4C 3UTBC 1KX4C 3AZGD 4NE3A 1P3LB 4WZSB 5AV5B 2CV5C 3UT9A 3NQUA 3AV1B 4WU8A 5AVBB 3X1TC 3VH6W 5B1LD 1TZYD 2RVQC 1P3KC 5AV9C 5GT3D 4KUDA 3MGQB 5AVBC 3X1TB 3FDDA 5C3IC 2NQBD 5BO0B 4Z5TA 3AFAB 1S32A 1P3LC 1P3BC 1KX3B 5JRGC 2AROD 3AV1D 3VH6T 1P3MB 3MVDD 2IO5B 1P3AC 3AZGA 3AZFA 3WTPB 2Y2KA 3EPKA 2Y2OA 4ZBJC 3MGSA 1M19D 3AFAD 3TU4D 2FJ7C 2DF4C 1BH9A 5BNVB 3W98B 3MNNB 3KWQC 1M19B 3REHD 5GT0A 3REJA 5FUGA 3KWQD 3REKB 3RELC 3AZKC 1P3AD 3NQJB 1ZLAC 1KX5C 5CPJD 3AFAC 2CV5A 4H9PB 2YFWB 2AROA 4QLCB 3LZ1B 5B0ZC 3LZ0D 3C1CA 5B1MC 5B2JB 1U35D 1P3FB 5B32A 5B32G 3AZMB 2RIQA 2YFVB 2XD5A 3REIC 5E5AA 3W98D 1HTAA 4KGCA 3AV1C 4KHAA 4UUZB 3LJAA 1P3GC 4DQYB 1P3ID 5AV9D 3AN2A 4XZQB 3VH6A 4E45A 3UT9D 3KUYB 1JFIA 3W98C 1KX4D 3LELB 1U35C 4JJNB 4NFTA 4NE5A 4WU8B 4YM6B 1Z2CB 3MGSC 5BS7C 3WA9A 5CPJA 2CV5D 4HGAC 2F8NA 3KFUG 5B31D 1ID3D 4KUDB 1BH8A 5B2ID 3AYWB 4H9OB 4J8UB 1EQZD 1WWSA 4G91C 5CPID 3LJAD 4XUJB 3B6FC 4KGCD 3X1UC 5AV6C 2NZDD 4J8UD 1KX3A 4R8PB 5GT3B 1M19C 1ID3B 3AZIA 1P3MA 2BYKA 4H9QB 4J8XB 5BNXA 3C1BB 5B0YB 3WAAA 5E5AC 1F1EA 1TAFB 1P3KB 3AV2A 4YM6C 3MGSB 2FJ7A 3LJAC 3AN2C 1BH9B 5B40B 2NZDB 5CPKA 5DNMD 5JRGB 2PYOA 3MGSD 3AZLA 3VH5A 5B0ZA 3C1CD 3C1CC 3B0BA 5B33A 1P3KD 5B1LC 3LZ1A 5DNNA 4EO5C 1P3PC 1B6WA 3H0MC 3EPLA 2Y2HA 1F66D 4H9RB 3W96D 3REHA 3AN2D 4UUZA 5AV8A 3UTAB 1M1AB 5G49A 2HIOC 2Y2LA 3B6FA 4J8VD 3EG5B 3REID 1ZLAB 5F99B 5DNMA 3REKC 5KDMB 3KSYA 3MGRA 3AZIC 3KUYA 5BT1D 3MNNC 2LY8A 5AVCB 3MGPD 3X1VC 5GXQC 1AOIB 1R4VA 5CPJC 3R45B 3AZHB 4HGAB 4YM6A 3WAAD 4LD9D 3LZ1D 1W2EA 1AOID 4YS3C 3W99A 3KUYD 3EPJA 4H9OA 2BYMB 2J8PA 2Y2PA 4J8UA 4WNNB 2PYOD 2Y2QA 1KX3C 4WV4B 4R8PA 5B33C 3X1SA 3TU4B 5B1LA 1ID3A 3AZEB 4WU9D 2Y2JA 4H9QA 2F8ND 1P3OD 5CP6C 3KXBD 4Z2MH 5DNND 1P3FC 1P3BD 5B24B 1M18B 3AZED 1Q9CA 5JA4A 2HIOA 1KX4A 3AZLD 2NQBC 4WU9B 2NZDA 1PZRA 4ZUXB 3X1UB 2ZM5A 3AZJA 2VQRA 4XUJC 5GT3C 3MNNA 5AV9A 1EQZA 2NQBB 1P3IA 3AYWC 1TZYA 5GXQA 4ZUXC 4KUDC 3NQJA 3VH5W 3V9RB 1KX5D 5B32D 1S32C 3WKJB 1P3LA 3RELD 3AZKD 3MVDB 3REHC 3UTBA 3UT9B 1P3BA 3C1CB 5AV8C 4CSRA 3LELD 5B31G 4X23A 5AY8D 3X1TA 5CPIA 4XZQC 3MGQD 5BO0A 3P5JB 3AN2B 3MVDC 4H9SA 1HQ3C 5B0YC 4YS3B 3O62A 3AZGB 3RELA 1P3MD 3WKJC 4QLCD 3KXBA 3AZMC 1B67A 1P3LD 1KX5A 5CPJB 5AV5A 4QLCC 3X1SD 1BH8B 3AZFC 4R8PC 3AYWA 3F6TA 1TZYC 2RVQD 4Z5TD 1H3OA 5AY8A 3X1TD 3X1SB 2Y2IA 3TU4A 3WTPD 5B40D 5CP6B 2ZY3A 2UWXA 3WTPE 3UTBD 2JCHA 1A7WA 2AROB 3AZKA 5B24A 4J8XA 1M18A 1HQ3B 3AZJC 5CHLB 1P3AB 5AVCD 3MGPB 4WJ3C 1T3UA 3WA9C 5B32C 1S32D 4H9SC 3REIA 4J8VA 3H0RC 4ZUXD 3UTAD 1M1AD 3AYWD 4J8WC 3V9RA 3AZHC 3W96A 3C1BC 1F66A 3WKJA 3A6NC 4DRBA 5AV5C 5AV6A 4UPKA 2CV5B 4M6BA 4H9PA 5B1MB 5B2JC 4QLCA 5B24D 4X23C 1M18D 3X1VB 2F8NB 3AZNC 3WKJD 4H9RA 5GT0D 3REJD 4G91B 3MGRD 2YFVA 5BS7A 5F99C 1P34D 3B6FB 4KGCB 4WU9C 2FFFB 5KDMA 3MGRB 5B2IB 3AZND 3O62C 3W99D 5B24C 4X23D 5B31B 1M18C 1P3PB 4LD9A 3O62B 5AV5D 2IO5C 4WU8C 2Y2MA 4J8XD 4JJND 1P3KA 4YS3D 3WA9B 1P3OB 1WWIA 3WAAC 5AVBA 1P3GB 2F8NH 5AY8B 3AZNB 3A6ND 3B0CT 5BNVA 4Z66D 4J8WA 4G92C 3MNND 3MGQA 5CPKD 5CPKC 4J8XC 3B6GA 5B0ZB 3W97D 2Y2NA 4AWLC 2HIOD 3WA9D 2YFWA 5B32B 5CP6D 3AV2B 3AZFB 1P3OC 4WU9A 3W97A 4H9NA 4Z5TC 4CAYA 3AZJB 4J8VB 5GT0C 3REJC 5DNMB 4Z66A 3A6NA 5JRGA 3AV2D 4EO5B 1P34C 3A1KA 5GSUD 2F8NK 5FUGB 5DNMC 3REKA 1KU5A 3MGRC 3KUYC 4NE6A 5B1MA 3AZHD 3AZFD 3X1SC 4JJNA 3X1VA 1P3BB 1HQ3D 4YM6D 5GSUA 3NQUB 3AV1A 1N1JA 5C3IB 2Y2GA 1P3FA 3KWQA 3MGQC 5G49B 1ULYA 4J8WD 3B6GC 3B0DC 1ZLAA 3LJAB 3X1UD 3AFAA 1S32B 2BG1A 5GT3A 4G92B 1U35A 1AOIA 1BFMA 5AVCC 1JFIB 1ID3C 3RELB 2ZY4A 3KXBB 3WAAB 1P3OA 1KX5B 1P3PD 3LZ0B 1KX4B 3W97C 2FJ7B 3B6GD 3W99B 1P3GA 2JE5A 4R8PD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z66 C;  4XUJ D;  5B40 A;  2BYM A;  1EQZ B;  1H3O B;  2NQB A;  1P3I B;  3WTP C;  4KUD D;  3W98 A;  1M19 A;  4XUJ A;  1P3M C;  3AZL B;  5GT0 B;  3REJ B;  5B1L B;  4JJN C;  1P3G D;  5B0Y D;  1P3I C;  3AZE A;  4WU8 D;  5B33 B;  5GSU C;  3MVD A;  3AV2 C;  1HQ3 A;  3O62 D;  5B33 D;  5B0Y A;  5B0Z D;  3LZ0 C;  5JA4 B;  3MGP A;  4X23 B;  3W97 B;  3KXB C;  3AZM A;  2HUE C;  5AV8 B;  3UTA A;  5CPI B;  1M1A A;  1KX3 D;  2PYO C;  3X1U A;  2CWE A;  2F8N G;  3A6N B;  3REI B;  1ZLA D;  1P34 A;  5CPK B;  5AV8 D;  2HUE B;  5CPI C;  4XZQ A;  5GXQ B;  1AOI C;  5AVC A;  3LZ1 C;  1F66 B;  3B0D B;  5AY8 C;  3W96 B;  3TU4 C;  3LEL A;  3B0C W;  5GSU B;  3C1B D;  3UTB B;  1N1J B;  3AZI D;  4CSR B;  3KWQ B;  3REK D;  4WNN A;  3REH B;  3UT9 C;  5GXQ D;  3AZL C;  4ZBJ B;  5B2I A;  3AZE C;  3AZJ D;  1U35 B;  5DNN C;  1P3F D;  4Z5T B;  5B31 A;  1P3P A;  4LD9 B;  4J8V C;  3AZI B;  4YS3 A;  3W99 C;  2BYK B;  3LZ0 A;  3R45 A;  5B1M D;  3AZH A;  3W96 C;  5BNX B;  3C1B A;  1F66 C;  5B40 C;  2HIO B;  1TAF A;  3WTP A;  4E44 A;  5F99 D;  4Z2M G;  3AZG C;  3AZN A;  4AWL B;  2JSS A;  3VH5 T;  4J8W B;  5AV9 B;  2PYO B;  5B2J D;  2FJ7 D;  3B6G B;  5E5A D;  5CP6 A;  3AZM D;  5AV6 B;  3X1V D;  4DRA A;  3MGP C;  3AZK B;  5DNN B;  3UTA C;  1M1A C;  4J8U C;  4LD9 C;  5AV6 D;  2NZD C;  5B2J A;  1P3A A;  2ARO C;  2L5A A;  4H9N B;  5JRG D;  4CAY B;  1EQZ C;  4XZQ D;  1P34 B;  5B2I C;  5E5A B;  5BT1 C;  4ZUX A;  4Z66 B;  4KHA B;  5B31 C;  5F99 A;  3B6F D;  3LEL C;  4KGC C;  5AVB D;  1TZY B;  3UTB C;  1KX4 C;  3AZG D;  4NE3 A;  1P3L B;  4WZS B;  5AV5 B;  2CV5 C;  3UT9 A;  3NQU A;  3AV1 B;  4WU8 A;  5AVB B;  3X1T C;  3VH6 W;  5B1L D;  1TZY D;  2RVQ C;  1P3K C;  5AV9 C;  5GT3 D;  4KUD A;  3MGQ B;  5AVB C;  3X1T B;  5C3I C;  2NQB D;  5BO0 B;  4Z5T A;  3AFA B;  1S32 A;  1P3L C;  1P3B C;  1KX3 B;  5JRG C;  2ARO D;  3AV1 D;  3VH6 T;  1P3M B;  3MVD D;  2IO5 B;  1P3A C;  3AZG A;  3AZF A;  3WTP B;  4ZBJ C;  3MGS A;  1M19 D;  3AFA D;  3TU4 D;  2FJ7 C;  1BH9 A;  5BNV B;  3W98 B;  3MNN B;  3KWQ C;  1M19 B;  3REH D;  5GT0 A;  3REJ A;  5FUG A;  3KWQ D;  3REK B;  3REL C;  3AZK C;  1P3A D;  3NQJ B;  1ZLA C;  1KX5 C;  5CPJ D;  3AFA C;  2CV5 A;  4H9P B;  2YFW B;  2ARO A;  4QLC B;  3LZ1 B;  5B0Z C;  3LZ0 D;  3C1C A;  5B1M C;  5B2J B;  1U35 D;  1P3F B;  5B32 A;  5B32 G;  3AZM B;  2YFV B;  3REI C;  3W98 D;  5E5A A;  1HTA A;  4KGC A;  3AV1 C;  4KHA A;  4UUZ B;  3LJA A;  1P3G C;  1P3I D;  5AV9 D;  3AN2 A;  4XZQ B;  3VH6 A;  4E45 A;  3UT9 D;  3KUY B;  1JFI A;  3W98 C;  1KX4 D;  3LEL B;  1U35 C;  4JJN B;  4NFT A;  4NE5 A;  4WU8 B;  4YM6 B;  3MGS C;  3WA9 A;  5BS7 C;  5CPJ A;  2CV5 D;  4HGA C;  2F8N A;  5B31 D;  1ID3 D;  4KUD B;  1BH8 A;  5B2I D;  3AYW B;  4H9O B;  4J8U B;  1EQZ D;  1WWS A;  4G91 C;  5CPI D;  3LJA D;  4XUJ B;  3B6F C;  4KGC D;  3X1U C;  5AV6 C;  2NZD D;  4J8U D;  1KX3 A;  4R8P B;  5GT3 B;  1M19 C;  1ID3 B;  3AZI A;  1P3M A;  2BYK A;  4H9Q B;  4J8X B;  5BNX A;  3C1B B;  5B0Y B;  3WAA A;  5E5A C;  1F1E A;  1TAF B;  1P3K B;  3AV2 A;  4YM6 C;  3MGS B;  2FJ7 A;  3LJA C;  3AN2 C;  1BH9 B;  5B40 B;  2NZD B;  5CPK A;  5DNM D;  5JRG B;  2PYO A;  3MGS D;  3AZL A;  3VH5 A;  5B0Z A;  3C1C D;  3C1C C;  3B0B A;  5B33 A;  1P3K D;  5B1L C;  3LZ1 A;  5DNN A;  4EO5 C;  1P3P C;  1B6W A;  1F66 D;  4H9R B;  3W96 D;  3REH A;  3AN2 D;  4UUZ A;  5AV8 A;  3UTA B;  1M1A B;  5G49 A;  2HIO C;  3B6F A;  4J8V D;  3REI D;  1ZLA B;  5F99 B;  5DNM A;  3REK C;  5KDM B;  3KSY A;  3MGR A;  3AZI C;  3KUY A;  5BT1 D;  3MNN C;  2LY8 A;  5AVC B;  3MGP D;  3X1V C;  5GXQ C;  1AOI B;  1R4V A;  5CPJ C;  3R45 B;  3AZH B;  4HGA B;  4YM6 A;  3WAA D;  4LD9 D;  3LZ1 D;  1AOI D;  4YS3 C;  3W99 A;  3KUY D;  4H9O A;  2BYM B;  4J8U A;  4WNN B;  2PYO D;  1KX3 C;  4WV4 B;  4R8P A;  5B33 C;  3X1S A;  3TU4 B;  5B1L A;  1ID3 A;  3AZE B;  4WU9 D;  4H9Q A;  2F8N D;  1P3O D;  5CP6 C;  3KXB D;  4Z2M H;  5DNN D;  1P3F C;  1P3B D;  5B24 B;  1M18 B;  3AZE D;  1Q9C A;  5JA4 A;  2HIO A;  1KX4 A;  3AZL D;  2NQB C;  4WU9 B;  2NZD A;  4ZUX B;  3X1U B;  3AZJ A;  4XUJ C;  5GT3 C;  3MNN A;  5AV9 A;  1EQZ A;  2NQB B;  1P3I A;  3AYW C;  1TZY A;  5GXQ A;  4ZUX C;  4KUD C;  3NQJ A;  3VH5 W;  3V9R B;  1KX5 D;  5B32 D;  1S32 C;  3WKJ B;  1P3L A;  3REL D;  3AZK D;  3MVD B;  3REH C;  3UTB A;  3UT9 B;  1P3B A;  3C1C B;  5AV8 C;  4CSR A;  3LEL D;  5B31 G;  4X23 A;  5AY8 D;  3X1T A;  5CPI A;  4XZQ C;  3MGQ D;  5BO0 A;  3AN2 B;  3MVD C;  4H9S A;  1HQ3 C;  5B0Y C;  4YS3 B;  3O62 A;  3AZG B;  3REL A;  1P3M D;  3WKJ C;  4QLC D;  3KXB A;  3AZM C;  1B67 A;  1P3L D;  1KX5 A;  5CPJ B;  5AV5 A;  4QLC C;  3X1S D;  1BH8 B;  3AZF C;  4R8P C;  3AYW A;  1TZY C;  2RVQ D;  4Z5T D;  1H3O A;  5AY8 A;  3X1T D;  3X1S B;  3TU4 A;  3WTP D;  5B40 D;  5CP6 B;  3UTB D;  3WTP E;  1A7W A;  2ARO B;  3AZK A;  5B24 A;  4J8X A;  1M18 A;  1HQ3 B;  3AZJ C;  5CHL B;  1P3A B;  5AVC D;  3MGP B;  3WA9 C;  5B32 C;  1S32 D;  4H9S C;  3REI A;  4J8V A;  4ZUX D;  3UTA D;  1M1A D;  3AYW D;  4J8W C;  3V9R A;  3AZH C;  3W96 A;  3C1B C;  1F66 A;  3WKJ A;  3A6N C;  4DRB A;  5AV5 C;  5AV6 A;  2CV5 B;  4M6B A;  4H9P A;  5B1M B;  5B2J C;  4QLC A;  5B24 D;  4X23 C;  1M18 D;  3X1V B;  2F8N B;  3AZN C;  3WKJ D;  4H9R A;  5GT0 D;  3REJ D;  4G91 B;  3MGR D;  2YFV A;  5BS7 A;  5F99 C;  1P34 D;  3B6F B;  4KGC B;  4WU9 C;  5KDM A;  3MGR B;  5B2I B;  3AZN D;  3O62 C;  3W99 D;  5B24 C;  4X23 D;  5B31 B;  1M18 C;  1P3P B;  4LD9 A;  3O62 B;  5AV5 D;  2IO5 C;  4WU8 C;  4J8X D;  4JJN D;  1P3K A;  4YS3 D;  3WA9 B;  1P3O B;  1WWI A;  3WAA C;  5AVB A;  1P3G B;  2F8N H;  5AY8 B;  3AZN B;  3A6N D;  3B0C T;  5BNV A;  4Z66 D;  4J8W A;  4G92 C;  3MNN D;  3MGQ A;  5CPK D;  5CPK C;  4J8X C;  3B6G A;  5B0Z B;  3W97 D;  4AWL C;  2HIO D;  3WA9 D;  2YFW A;  5B32 B;  5CP6 D;  3AV2 B;  3AZF B;  1P3O C;  4WU9 A;  3W97 A;  4H9N A;  4Z5T C;  4CAY A;  3AZJ B;  4J8V B;  5GT0 C;  3REJ C;  5DNM B;  4Z66 A;  3A6N A;  5JRG A;  3AV2 D;  4EO5 B;  1P34 C;  5GSU D;  2F8N K;  5FUG B;  5DNM C;  3REK A;  1KU5 A;  3MGR C;  3KUY C;  4NE6 A;  5B1M A;  3AZH D;  3AZF D;  3X1S C;  4JJN A;  3X1V A;  1P3B B;  1HQ3 D;  4YM6 D;  5GSU A;  3NQU B;  3AV1 A;  1N1J A;  5C3I B;  1P3F A;  3KWQ A;  3MGQ C;  5G49 B;  1ULY A;  4J8W D;  3B6G C;  3B0D C;  1ZLA A;  3LJA B;  3X1U D;  3AFA A;  1S32 B;  5GT3 A;  4G92 B;  1U35 A;  1AOI A;  1BFM A;  5AVC C;  1JFI B;  1ID3 C;  3REL B;  3KXB B;  3WAA B;  1P3O A;  1KX5 B;  1P3P D;  3LZ0 B;  1KX4 B;  3W97 C;  2FJ7 B;  3B6G D;  3W99 B;  1P3G A;  4R8P D; 
#chains in the Genus database with same CATH topology
 4Z66 C;  4XUJ D;  5B40 A;  2BYM A;  1EQZ B;  1H3O B;  2NQB A;  1P3I B;  3WTP C;  4KUD D;  3W98 A;  1M19 A;  4XUJ A;  1P3M C;  3AZL B;  5GT0 B;  3REJ B;  5B1L B;  4JJN C;  1P3G D;  5B0Y D;  1P3I C;  3AZE A;  4WU8 D;  5B33 B;  2F2A C;  5GSU C;  3MVD A;  3AV2 C;  2W8S A;  1HQ3 A;  2G5H C;  5B33 D;  3O62 D;  5B0Y A;  5B0Z D;  3LZ0 C;  5JA4 B;  3MGP A;  4X23 B;  3W97 B;  3EPH A;  3KXB C;  3AZM A;  2HUE C;  5AV8 B;  3UTA A;  5CPI B;  1M1A A;  1KX3 D;  2PYO C;  3X1U A;  2CWE A;  2F8N G;  3A6N B;  3REI B;  1ZLA D;  1P34 A;  5CPK B;  5AV8 D;  2HUE B;  5CPI C;  4XZQ A;  5GXQ B;  1AOI C;  5AVC A;  3LZ1 C;  1F66 B;  3B0D B;  5AY8 C;  3W96 B;  3TU4 C;  2ZY2 A;  3LEL A;  3AL0 C;  3B0C W;  5GSU B;  3C1B D;  3UTB B;  1N1J B;  3AZI D;  2G5I C;  4CSR B;  3KWQ B;  3REK D;  4WNN A;  3REH B;  3UT9 C;  2DQN C;  5GXQ D;  3AZL C;  4ZBJ B;  5B2I A;  3AZE C;  3AZJ D;  1U35 B;  5DNN C;  1P3F D;  4Z5T B;  5B31 A;  1P3P A;  4LD9 B;  4J8V C;  3AZI B;  4YS3 A;  3W99 C;  2BYK B;  3LZ0 A;  3R45 A;  5B1M D;  3AZH A;  3W96 C;  5BNX B;  3C1B A;  1F66 C;  5B40 C;  2HIO B;  1TAF A;  3WTP A;  2XD1 A;  4E44 A;  5F99 D;  4Z2M G;  3AZG C;  3AZN A;  4AWL B;  2JSS A;  3VH5 T;  4J8W B;  5AV9 B;  3A1I A;  2ZY5 A;  2PYO B;  5B2J D;  2FJ7 D;  3B6G B;  5E5A D;  5CP6 A;  3AZM D;  3H0L C;  5AV6 B;  3X1V D;  4DRA A;  3MGP C;  3AZK B;  5DNN B;  3UTA C;  1M1A C;  4J8U C;  4LD9 C;  5AV6 D;  2NZD C;  5B2J A;  1P3A A;  2ARO C;  2L5A A;  4H9N B;  5JRG D;  4CAY B;  1EQZ C;  4XZQ D;  1P34 B;  5B2I C;  5E5A B;  5BT1 C;  4ZUX A;  4Z66 B;  4KHA B;  5B31 C;  5F99 A;  3B6F D;  3LEL C;  4KGC C;  5AVB D;  1TZY B;  3IP4 C;  3UTB C;  1KX4 C;  3AZG D;  4NE3 A;  1P3L B;  4WZS B;  5AV5 B;  2CV5 C;  3UT9 A;  3NQU A;  3AV1 B;  4WU8 A;  5AVB B;  3X1T C;  3VH6 W;  5B1L D;  1TZY D;  2RVQ C;  1P3K C;  5AV9 C;  5GT3 D;  4KUD A;  3MGQ B;  5AVB C;  3X1T B;  3FDD A;  5C3I C;  2NQB D;  5BO0 B;  4Z5T A;  3AFA B;  1S32 A;  1P3L C;  1P3B C;  1KX3 B;  5JRG C;  2ARO D;  3AV1 D;  3VH6 T;  1P3M B;  3MVD D;  2IO5 B;  1P3A C;  3AZG A;  3AZF A;  3WTP B;  2Y2K A;  3EPK A;  2Y2O A;  4ZBJ C;  3MGS A;  1M19 D;  3AFA D;  3TU4 D;  2FJ7 C;  2DF4 C;  1BH9 A;  5BNV B;  3W98 B;  3MNN B;  3KWQ C;  1M19 B;  3REH D;  5GT0 A;  3REJ A;  5FUG A;  3KWQ D;  3REK B;  3REL C;  3AZK C;  1P3A D;  3NQJ B;  1ZLA C;  1KX5 C;  5CPJ D;  3AFA C;  2CV5 A;  4H9P B;  2YFW B;  2ARO A;  4QLC B;  3LZ1 B;  5B0Z C;  3LZ0 D;  3C1C A;  5B1M C;  5B2J B;  1U35 D;  1P3F B;  5B32 A;  5B32 G;  3AZM B;  2RIQ A;  2YFV B;  2XD5 A;  3REI C;  5E5A A;  3W98 D;  1HTA A;  4KGC A;  3AV1 C;  4KHA A;  4UUZ B;  3LJA A;  1P3G C;  4DQY B;  1P3I D;  5AV9 D;  3AN2 A;  4XZQ B;  3VH6 A;  4E45 A;  3UT9 D;  3KUY B;  1JFI A;  3W98 C;  1KX4 D;  3LEL B;  1U35 C;  4JJN B;  4NFT A;  4NE5 A;  4WU8 B;  4YM6 B;  1Z2C B;  3MGS C;  5BS7 C;  3WA9 A;  5CPJ A;  2CV5 D;  4HGA C;  2F8N A;  3KFU G;  5B31 D;  1ID3 D;  4KUD B;  1BH8 A;  5B2I D;  3AYW B;  4H9O B;  4J8U B;  1EQZ D;  1WWS A;  4G91 C;  5CPI D;  3LJA D;  4XUJ B;  3B6F C;  4KGC D;  3X1U C;  5AV6 C;  2NZD D;  4J8U D;  1KX3 A;  4R8P B;  5GT3 B;  1M19 C;  1ID3 B;  3AZI A;  1P3M A;  2BYK A;  4H9Q B;  4J8X B;  5BNX A;  3C1B B;  5B0Y B;  3WAA A;  5E5A C;  1F1E A;  1TAF B;  1P3K B;  3AV2 A;  4YM6 C;  3MGS B;  2FJ7 A;  3LJA C;  3AN2 C;  1BH9 B;  5B40 B;  2NZD B;  5CPK A;  5DNM D;  5JRG B;  2PYO A;  3MGS D;  3AZL A;  3VH5 A;  5B0Z A;  3C1C D;  3C1C C;  3B0B A;  5B33 A;  1P3K D;  5B1L C;  3LZ1 A;  5DNN A;  4EO5 C;  1P3P C;  1B6W A;  3H0M C;  3EPL A;  2Y2H A;  1F66 D;  4H9R B;  3W96 D;  3REH A;  3AN2 D;  4UUZ A;  5AV8 A;  3UTA B;  1M1A B;  5G49 A;  2HIO C;  2Y2L A;  3B6F A;  4J8V D;  3EG5 B;  3REI D;  1ZLA B;  5F99 B;  5DNM A;  3REK C;  5KDM B;  3KSY A;  3MGR A;  3AZI C;  3KUY A;  5BT1 D;  3MNN C;  2LY8 A;  5AVC B;  3MGP D;  3X1V C;  5GXQ C;  1AOI B;  1R4V A;  5CPJ C;  3R45 B;  3AZH B;  4HGA B;  4YM6 A;  3WAA D;  4LD9 D;  3LZ1 D;  1W2E A;  1AOI D;  4YS3 C;  3W99 A;  3KUY D;  3EPJ A;  4H9O A;  2BYM B;  2J8P A;  2Y2P A;  4J8U A;  4WNN B;  2PYO D;  2Y2Q A;  1KX3 C;  4WV4 B;  4R8P A;  5B33 C;  3X1S A;  3TU4 B;  5B1L A;  1ID3 A;  3AZE B;  4WU9 D;  2Y2J A;  4H9Q A;  2F8N D;  1P3O D;  5CP6 C;  3KXB D;  4Z2M H;  5DNN D;  1P3F C;  1P3B D;  5B24 B;  1M18 B;  3AZE D;  1Q9C A;  5JA4 A;  2HIO A;  1KX4 A;  3AZL D;  2NQB C;  4WU9 B;  2NZD A;  1PZR A;  4ZUX B;  3X1U B;  2ZM5 A;  3AZJ A;  2VQR A;  4XUJ C;  5GT3 C;  3MNN A;  5AV9 A;  1EQZ A;  2NQB B;  1P3I A;  3AYW C;  1TZY A;  5GXQ A;  4ZUX C;  4KUD C;  3NQJ A;  3VH5 W;  3V9R B;  1KX5 D;  5B32 D;  1S32 C;  3WKJ B;  1P3L A;  3REL D;  3AZK D;  3MVD B;  3REH C;  3UTB A;  3UT9 B;  1P3B A;  3C1C B;  5AV8 C;  4CSR A;  3LEL D;  5B31 G;  4X23 A;  5AY8 D;  3X1T A;  5CPI A;  4XZQ C;  3MGQ D;  5BO0 A;  3P5J B;  3AN2 B;  3MVD C;  4H9S A;  1HQ3 C;  5B0Y C;  4YS3 B;  3O62 A;  3AZG B;  3REL A;  1P3M D;  3WKJ C;  4QLC D;  3KXB A;  3AZM C;  1B67 A;  1P3L D;  1KX5 A;  5CPJ B;  5AV5 A;  4QLC C;  3X1S D;  1BH8 B;  3AZF C;  4R8P C;  3AYW A;  3F6T A;  1TZY C;  2RVQ D;  4Z5T D;  1H3O A;  5AY8 A;  3X1T D;  3X1S B;  2Y2I A;  3TU4 A;  3WTP D;  5B40 D;  5CP6 B;  2ZY3 A;  2UWX A;  3WTP E;  3UTB D;  2JCH A;  1A7W A;  2ARO B;  3AZK A;  5B24 A;  4J8X A;  1M18 A;  1HQ3 B;  3AZJ C;  5CHL B;  1P3A B;  5AVC D;  3MGP B;  4WJ3 C;  1T3U A;  3WA9 C;  5B32 C;  1S32 D;  4H9S C;  3REI A;  4J8V A;  3H0R C;  4ZUX D;  3UTA D;  1M1A D;  3AYW D;  4J8W C;  3V9R A;  3AZH C;  3W96 A;  3C1B C;  1F66 A;  3WKJ A;  3A6N C;  4DRB A;  5AV5 C;  5AV6 A;  4UPK A;  2CV5 B;  4M6B A;  4H9P A;  5B1M B;  5B2J C;  4QLC A;  5B24 D;  4X23 C;  1M18 D;  3X1V B;  2F8N B;  3AZN C;  3WKJ D;  4H9R A;  5GT0 D;  3REJ D;  4G91 B;  3MGR D;  2YFV A;  5BS7 A;  5F99 C;  1P34 D;  3B6F B;  4KGC B;  4WU9 C;  2FFF B;  5KDM A;  3MGR B;  5B2I B;  3AZN D;  3O62 C;  3W99 D;  5B24 C;  4X23 D;  5B31 B;  1M18 C;  1P3P B;  4LD9 A;  3O62 B;  5AV5 D;  2IO5 C;  4WU8 C;  2Y2M A;  4J8X D;  4JJN D;  1P3K A;  4YS3 D;  3WA9 B;  1P3O B;  1WWI A;  3WAA C;  5AVB A;  1P3G B;  2F8N H;  5AY8 B;  3AZN B;  3A6N D;  3B0C T;  5BNV A;  4Z66 D;  4J8W A;  4G92 C;  3MNN D;  3MGQ A;  5CPK D;  5CPK C;  4J8X C;  3B6G A;  5B0Z B;  3W97 D;  2Y2N A;  4AWL C;  2HIO D;  3WA9 D;  2YFW A;  5B32 B;  5CP6 D;  3AV2 B;  3AZF B;  1P3O C;  4WU9 A;  3W97 A;  4H9N A;  4Z5T C;  4CAY A;  3AZJ B;  4J8V B;  5GT0 C;  3REJ C;  5DNM B;  4Z66 A;  3A6N A;  5JRG A;  3AV2 D;  4EO5 B;  1P34 C;  3A1K A;  5GSU D;  2F8N K;  5FUG B;  5DNM C;  3REK A;  1KU5 A;  3MGR C;  3KUY C;  4NE6 A;  5B1M A;  3AZH D;  3AZF D;  3X1S C;  4JJN A;  3X1V A;  1P3B B;  1HQ3 D;  4YM6 D;  5GSU A;  3NQU B;  3AV1 A;  1N1J A;  5C3I B;  2Y2G A;  1P3F A;  3KWQ A;  3MGQ C;  5G49 B;  1ULY A;  4J8W D;  3B6G C;  3B0D C;  1ZLA A;  3LJA B;  3X1U D;  3AFA A;  1S32 B;  2BG1 A;  5GT3 A;  4G92 B;  1U35 A;  1AOI A;  1BFM A;  5AVC C;  1JFI B;  1ID3 C;  3REL B;  2ZY4 A;  3KXB B;  3WAA B;  1P3O A;  1KX5 B;  1P3P D;  3LZ0 B;  1KX4 B;  3W97 C;  2FJ7 B;  3B6G D;  3W99 B;  1P3G A;  2JE5 A;  4R8P D; 
#chains in the Genus database with same CATH homology
 4Z66 C;  4XUJ D;  5B40 A;  2BYM A;  1EQZ B;  1H3O B;  2NQB A;  1P3I B;  3WTP C;  4KUD D;  3W98 A;  1M19 A;  4XUJ A;  1P3M C;  3AZL B;  5GT0 B;  3REJ B;  5B1L B;  4JJN C;  1P3G D;  5B0Y D;  1P3I C;  3AZE A;  4WU8 D;  5B33 B;  2F2A C;  5GSU C;  3MVD A;  3AV2 C;  2W8S A;  1HQ3 A;  2G5H C;  5B33 D;  3O62 D;  5B0Y A;  5B0Z D;  3LZ0 C;  5JA4 B;  3MGP A;  4X23 B;  3W97 B;  3EPH A;  3KXB C;  3AZM A;  2HUE C;  5AV8 B;  3UTA A;  5CPI B;  1M1A A;  1KX3 D;  2PYO C;  3X1U A;  2CWE A;  2F8N G;  3A6N B;  3REI B;  1ZLA D;  1P34 A;  5CPK B;  5AV8 D;  2HUE B;  5CPI C;  4XZQ A;  5GXQ B;  1AOI C;  5AVC A;  3LZ1 C;  1F66 B;  3B0D B;  5AY8 C;  3W96 B;  3TU4 C;  2ZY2 A;  3LEL A;  3AL0 C;  3B0C W;  5GSU B;  3C1B D;  3UTB B;  1N1J B;  3AZI D;  2G5I C;  4CSR B;  3KWQ B;  3REK D;  4WNN A;  3REH B;  3UT9 C;  2DQN C;  5GXQ D;  3AZL C;  4ZBJ B;  5B2I A;  3AZE C;  3AZJ D;  1U35 B;  5DNN C;  1P3F D;  4Z5T B;  5B31 A;  1P3P A;  4LD9 B;  4J8V C;  3AZI B;  4YS3 A;  3W99 C;  2BYK B;  3LZ0 A;  3R45 A;  5B1M D;  3AZH A;  3W96 C;  5BNX B;  3C1B A;  1F66 C;  5B40 C;  2HIO B;  1TAF A;  3WTP A;  2XD1 A;  4E44 A;  5F99 D;  4Z2M G;  3AZG C;  3AZN A;  4AWL B;  2JSS A;  3VH5 T;  4J8W B;  5AV9 B;  3A1I A;  2ZY5 A;  2PYO B;  5B2J D;  2FJ7 D;  3B6G B;  5E5A D;  5CP6 A;  3AZM D;  3H0L C;  5AV6 B;  3X1V D;  4DRA A;  3MGP C;  3AZK B;  5DNN B;  3UTA C;  1M1A C;  4J8U C;  4LD9 C;  5AV6 D;  2NZD C;  5B2J A;  1P3A A;  2ARO C;  2L5A A;  4H9N B;  5JRG D;  4CAY B;  1EQZ C;  4XZQ D;  1P34 B;  5B2I C;  5E5A B;  5BT1 C;  4ZUX A;  4Z66 B;  4KHA B;  5B31 C;  5F99 A;  3B6F D;  3LEL C;  4KGC C;  5AVB D;  1TZY B;  3IP4 C;  3UTB C;  1KX4 C;  3AZG D;  4NE3 A;  1P3L B;  4WZS B;  5AV5 B;  2CV5 C;  3UT9 A;  3NQU A;  3AV1 B;  4WU8 A;  5AVB B;  3X1T C;  3VH6 W;  5B1L D;  1TZY D;  2RVQ C;  1P3K C;  5AV9 C;  5GT3 D;  4KUD A;  3MGQ B;  5AVB C;  3X1T B;  3FDD A;  5C3I C;  2NQB D;  5BO0 B;  4Z5T A;  3AFA B;  1S32 A;  1P3L C;  1P3B C;  1KX3 B;  5JRG C;  2ARO D;  3AV1 D;  3VH6 T;  1P3M B;  3MVD D;  2IO5 B;  1P3A C;  3AZG A;  3AZF A;  3WTP B;  2Y2K A;  3EPK A;  2Y2O A;  4ZBJ C;  3MGS A;  1M19 D;  3AFA D;  3TU4 D;  2FJ7 C;  2DF4 C;  1BH9 A;  5BNV B;  3W98 B;  3MNN B;  3KWQ C;  1M19 B;  3REH D;  5GT0 A;  3REJ A;  5FUG A;  3KWQ D;  3REK B;  3REL C;  3AZK C;  1P3A D;  3NQJ B;  1ZLA C;  1KX5 C;  5CPJ D;  3AFA C;  2CV5 A;  4H9P B;  2YFW B;  2ARO A;  4QLC B;  3LZ1 B;  5B0Z C;  3LZ0 D;  3C1C A;  5B1M C;  5B2J B;  1U35 D;  1P3F B;  5B32 A;  5B32 G;  3AZM B;  2RIQ A;  2YFV B;  2XD5 A;  3REI C;  5E5A A;  3W98 D;  1HTA A;  4KGC A;  3AV1 C;  4KHA A;  4UUZ B;  3LJA A;  1P3G C;  4DQY B;  1P3I D;  5AV9 D;  3AN2 A;  4XZQ B;  3VH6 A;  4E45 A;  3UT9 D;  3KUY B;  1JFI A;  3W98 C;  1KX4 D;  3LEL B;  1U35 C;  4JJN B;  4NFT A;  4NE5 A;  4WU8 B;  4YM6 B;  1Z2C B;  3MGS C;  5BS7 C;  3WA9 A;  5CPJ A;  2CV5 D;  4HGA C;  2F8N A;  3KFU G;  5B31 D;  1ID3 D;  4KUD B;  1BH8 A;  5B2I D;  3AYW B;  4H9O B;  4J8U B;  1EQZ D;  1WWS A;  4G91 C;  5CPI D;  3LJA D;  4XUJ B;  3B6F C;  4KGC D;  3X1U C;  5AV6 C;  2NZD D;  4J8U D;  1KX3 A;  4R8P B;  5GT3 B;  1M19 C;  1ID3 B;  3AZI A;  1P3M A;  2BYK A;  4H9Q B;  4J8X B;  5BNX A;  3C1B B;  5B0Y B;  3WAA A;  5E5A C;  1F1E A;  1TAF B;  1P3K B;  3AV2 A;  4YM6 C;  3MGS B;  2FJ7 A;  3LJA C;  3AN2 C;  1BH9 B;  5B40 B;  2NZD B;  5CPK A;  5DNM D;  5JRG B;  2PYO A;  3MGS D;  3AZL A;  3VH5 A;  5B0Z A;  3C1C D;  3C1C C;  3B0B A;  5B33 A;  1P3K D;  5B1L C;  3LZ1 A;  5DNN A;  4EO5 C;  1P3P C;  1B6W A;  3H0M C;  3EPL A;  2Y2H A;  1F66 D;  4H9R B;  3W96 D;  3REH A;  3AN2 D;  4UUZ A;  5AV8 A;  3UTA B;  1M1A B;  5G49 A;  2HIO C;  2Y2L A;  3B6F A;  4J8V D;  3EG5 B;  3REI D;  1ZLA B;  5F99 B;  5DNM A;  3REK C;  5KDM B;  3KSY A;  3MGR A;  3AZI C;  3KUY A;  5BT1 D;  3MNN C;  2LY8 A;  5AVC B;  3MGP D;  3X1V C;  5GXQ C;  1AOI B;  1R4V A;  5CPJ C;  3R45 B;  3AZH B;  4HGA B;  4YM6 A;  3WAA D;  4LD9 D;  3LZ1 D;  1W2E A;  1AOI D;  4YS3 C;  3W99 A;  3KUY D;  3EPJ A;  4H9O A;  2BYM B;  2J8P A;  2Y2P A;  4J8U A;  4WNN B;  2PYO D;  2Y2Q A;  1KX3 C;  4WV4 B;  4R8P A;  5B33 C;  3X1S A;  3TU4 B;  5B1L A;  1ID3 A;  3AZE B;  4WU9 D;  2Y2J A;  4H9Q A;  2F8N D;  1P3O D;  5CP6 C;  3KXB D;  4Z2M H;  5DNN D;  1P3F C;  1P3B D;  5B24 B;  1M18 B;  3AZE D;  1Q9C A;  5JA4 A;  2HIO A;  1KX4 A;  3AZL D;  2NQB C;  4WU9 B;  2NZD A;  1PZR A;  4ZUX B;  3X1U B;  2ZM5 A;  3AZJ A;  2VQR A;  4XUJ C;  5GT3 C;  3MNN A;  5AV9 A;  1EQZ A;  2NQB B;  1P3I A;  3AYW C;  1TZY A;  5GXQ A;  4ZUX C;  4KUD C;  3NQJ A;  3VH5 W;  3V9R B;  1KX5 D;  5B32 D;  1S32 C;  3WKJ B;  1P3L A;  3REL D;  3AZK D;  3MVD B;  3REH C;  3UTB A;  3UT9 B;  1P3B A;  3C1C B;  5AV8 C;  4CSR A;  3LEL D;  5B31 G;  4X23 A;  5AY8 D;  3X1T A;  5CPI A;  4XZQ C;  3MGQ D;  5BO0 A;  3P5J B;  3AN2 B;  3MVD C;  4H9S A;  1HQ3 C;  5B0Y C;  4YS3 B;  3O62 A;  3AZG B;  3REL A;  1P3M D;  3WKJ C;  4QLC D;  3KXB A;  3AZM C;  1B67 A;  1P3L D;  1KX5 A;  5CPJ B;  5AV5 A;  4QLC C;  3X1S D;  1BH8 B;  3AZF C;  4R8P C;  3AYW A;  3F6T A;  1TZY C;  2RVQ D;  4Z5T D;  1H3O A;  5AY8 A;  3X1T D;  3X1S B;  2Y2I A;  3TU4 A;  3WTP D;  5B40 D;  5CP6 B;  2ZY3 A;  2UWX A;  3WTP E;  3UTB D;  2JCH A;  1A7W A;  2ARO B;  3AZK A;  5B24 A;  4J8X A;  1M18 A;  1HQ3 B;  3AZJ C;  5CHL B;  1P3A B;  5AVC D;  3MGP B;  4WJ3 C;  1T3U A;  3WA9 C;  5B32 C;  1S32 D;  4H9S C;  3REI A;  4J8V A;  3H0R C;  4ZUX D;  3UTA D;  1M1A D;  3AYW D;  4J8W C;  3V9R A;  3AZH C;  3W96 A;  3C1B C;  1F66 A;  3WKJ A;  3A6N C;  4DRB A;  5AV5 C;  5AV6 A;  4UPK A;  2CV5 B;  4M6B A;  4H9P A;  5B1M B;  5B2J C;  4QLC A;  5B24 D;  4X23 C;  1M18 D;  3X1V B;  2F8N B;  3AZN C;  3WKJ D;  4H9R A;  5GT0 D;  3REJ D;  4G91 B;  3MGR D;  2YFV A;  5BS7 A;  5F99 C;  1P34 D;  3B6F B;  4KGC B;  4WU9 C;  2FFF B;  5KDM A;  3MGR B;  5B2I B;  3AZN D;  3O62 C;  3W99 D;  5B24 C;  4X23 D;  5B31 B;  1M18 C;  1P3P B;  4LD9 A;  3O62 B;  5AV5 D;  2IO5 C;  4WU8 C;  2Y2M A;  4J8X D;  4JJN D;  1P3K A;  4YS3 D;  3WA9 B;  1P3O B;  1WWI A;  3WAA C;  5AVB A;  1P3G B;  2F8N H;  5AY8 B;  3AZN B;  3A6N D;  3B0C T;  5BNV A;  4Z66 D;  4J8W A;  4G92 C;  3MNN D;  3MGQ A;  5CPK D;  5CPK C;  4J8X C;  3B6G A;  5B0Z B;  3W97 D;  2Y2N A;  4AWL C;  2HIO D;  3WA9 D;  2YFW A;  5B32 B;  5CP6 D;  3AV2 B;  3AZF B;  1P3O C;  4WU9 A;  3W97 A;  4H9N A;  4Z5T C;  4CAY A;  3AZJ B;  4J8V B;  5GT0 C;  3REJ C;  5DNM B;  4Z66 A;  3A6N A;  5JRG A;  3AV2 D;  4EO5 B;  1P34 C;  3A1K A;  5GSU D;  2F8N K;  5FUG B;  5DNM C;  3REK A;  1KU5 A;  3MGR C;  3KUY C;  4NE6 A;  5B1M A;  3AZH D;  3AZF D;  3X1S C;  4JJN A;  3X1V A;  1P3B B;  1HQ3 D;  4YM6 D;  5GSU A;  3NQU B;  3AV1 A;  1N1J A;  5C3I B;  2Y2G A;  1P3F A;  3KWQ A;  3MGQ C;  5G49 B;  1ULY A;  4J8W D;  3B6G C;  3B0D C;  1ZLA A;  3LJA B;  3X1U D;  3AFA A;  1S32 B;  2BG1 A;  5GT3 A;  4G92 B;  1U35 A;  1AOI A;  1BFM A;  5AVC C;  1JFI B;  1ID3 C;  3REL B;  2ZY4 A;  3KXB B;  3WAA B;  1P3O A;  1KX5 B;  1P3P D;  3LZ0 B;  1KX4 B;  3W97 C;  2FJ7 B;  3B6G D;  3W99 B;  1P3G A;  2JE5 A;  4R8P D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...