1ZLAC

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNWERDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/virus/dna
molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaC00
4YM6B 3MNND 3KUYA 3X1SD 4NFTA 3AV2D 3TU4A 4KUDA 1H3OA 3X1TA 5CPKD 3MVDB 3LZ0B 1P34B 3AZKB 5CP6C 1M18B 3LJAB 2F8NK 5B32D 1TZYB 3RELC 4X23A 4G91B 3KUYD 3AV1A 4LD9B 3C1CB 2BYMA 4H9RB 4H9OA 3TU4D 2F8NH 1P34A 3MVDA 3AZKA 3X1TD 2YFVB 1TZYA 5AVCC 3MNNC 3UTAB 3MGSB 3UTBB 3W96B 4X23D 3MGQB 3C1CA 1U35D 3AV1D 1BH8B 1KX4D 5AV5B 5CPKC 5E5AD 3KXBB 1P3BC 3AZLC 5BNVB 1M1AC 5JRGB 4J8VA 5B2JD 3UTBA 3AZFC 2CWEA 4EO5C 1HTAA 3MGQA 5AVBD 3AZEC 1BH8A 4CAYA 3REJD 3MGRB 3WTPB 5CHLB 3V9RB 5BNVA 5B31C 3AZJB 5JRGA 3LZ1B 3AZGA 5CPJB 3MGPC 1S32C 4J8UC 4HGAC 4KGCD 1HQ3D 1P3KC 2AROA 1KX4C 4H9SC 2PYOA 5E5AC 3LELD 4JJND 3MGRA 1P3FC 1P3MD 5B2JC 2NZDB 3B0DC 3WKJA 3AZGD 2CV5B 4J8WC 3KWQD 2AROD 2PYOD 3AZMC 4J8XB 3AZIB 4XUJD 2CV5A 5B1LC 3WKJD 3AZHA 3A6NB 5BNXB 4CSRB 4ZUXD 1AOIA 3AFAB 4JJNC 4G92C 1P3LA 1N1JB 3X1UC 5B0YB 1P3MC 1P3OC 1P3AB 4J8XA 2BYKB 3AZIA 1M19C 3W98B 5GSUD 3O62A 5GT0C 5GXQB 3VH6T 1KX5C 3A6NA 3AZHD 2HIOC 4CSRA 3REIA 4Z5TA 3VH5W 4YS3C 5B0ZA 5B1MB 1AOID 5B0YA 1P3LD 5B2ID 5B33B 2RVQD 4XUJC 3O62D 4WV4B 5B40A 4ZUXC 5GT3A 5AY8A 3X1VA 2FJ7B 1ULYA 4WU8C 5B1MA 3REID 4Z5TD 5B0ZD 4QLCD 3WAAB 1R4VA 5GSUC 5B31G 4M6BA 5DNNC 1TAFB 5CPID 1WWSA 1KX3D 2JSSA 3W97A 1B6WA 5B40D 5GT3D 5AY8D 3AN2C 5F99C 3W99C 4E45A 5AV9A 4R8PB 3X1VD 1ID3C 3RELB 5B2IC 1P3IA 1EQZB 1TAFA 1ZLAA 3W97D 2IO5C 4QLCC 4R8PA 3RELA 3UT9B 5AVCB 5AV9D 3B6GC 1EQZA 5CPIC 1P3ID 3WA9A 1P3BB 3KSYA 3AZLB 1P3GA 1M1AB 1ZLAD 3UT9A 4WZSB 4R8PD 2YFWB 3AZFB 4EO5B 4YM6A 4J8VD 3R45B 5AV6C 3AZEB 4WU9B 4Z66C 5B24C 5DNMB 3WA9D 5B31B 4KUDD 1P3PC 1P3GD 3B0BA 3LZ0A 3MGPB 1S32B 4J8UB 4HGAB 3B6FB 1M18A 3LJAA 1BH9B 3REKC 3C1BB 3X1SC 4H9NB 4YM6D 4DRAA 3AV2C 4WU9A 4LD9A 5DNMA 4H9RA 1P3FB 3NQUB 3B0DB 3B6FA 4J8UA 2NQBB 2YFVA 3MVDD 5FUGB 5B32C 3LZ0D 1P34D 3AZKD 3C1BA 5AV8B 3LJAD 3UTAA 1M18D 3MGSA 1TZYD 1F66B 3W96A 4H9NA 4H9SA 3KUYC 4Z2MG 4WU9D 3TU4C 4LD9D 3C1CD 3AZMB 5AV5A 4KUDC 3NQUA 3KXBA 3X1TC 2NQBA 5FUGA 3B6FD 5B1LB 5AV8A 1F1EA 4X23C 1F66A 3UTAD 3MGSD 3UTBD 1U35C 4G92B 3W96D 3AV1C 3X1UB 3MGQD 3AZMA 1P3OB 1M19B 5AV5D 3WTPA 3V9RA 5GT0B 3AZJA 4UUZB 3KXBD 1JFIB 1KX5B 3LZ1A 5CPJA 5JRGD 2HIOB 3VH6W 3AZNB 4G91C 4YS3B 1Q9CA 5AVBC 2F8NG 2HUEC 4ZBJC 3X1UA 3REHB 3C1CC 3REJC 2LY8A 3MGRD 3WTPD 2NZDA 3AZJD 4KGCC 3AYWB 5CPJD 3LZ1D 1HQ3C 3AZNA 4WU8B 5BO0B 3REHA 3LELC 5DNNB 5JRGC 3AZGC 3AYWA 2NZDD 3KWQC 3AN2B 1ID3B 5F99B 2CV5D 3W99B 5BNXA 3VH5A 2AROC 3AFAA 3REHD 4NE5A 2PYOC 1N1JA 3MGRC 5BS7A 1P3AA 2BYKA 3W98A 4J8XD 3AZID 5GXQA 3WKJC 5B32G 2IO5B 3A6ND 4XZQB 1WWIA 3B6GB 3AFAD 2F8NB 5B33A 5B0YD 1P3AD 3W98D 3NQJB 4DRBA 5GXQD 2CV5C 3AZHC 4WNNB 2FJ7A 1AOIC 4XZQA 5CP6B 3WAAA 5B1MD 1P3LC 2F8NA 5AV6B 2RVQC 4J8XC 3AZIC 5JA4B 5B33D 4Z66B 5B24B 3O62C 3NQJA 1P3PB 3A6NC 3REIC 4Z5TC 5CP6A 5B0ZC 2FJ7D 3REKB 4XZQD 3MNNB 3X1SB 3WAAD 1BFMA 1KU5A 3AV2B 5JA4A 1KX3C 4AWLC 5CPKB 1P3PA 5B40C 5C3IC 5GT3C 5AY8C 3X1VC 5B32B 5B1MC 5AVCA 3MNNA 5BT1D 3RELD 3KUYB 3TU4B 1EQZD 3WTPE 1H3OB 5CPKA 3W97C 1P3BA 3AZLA 3X1TB 1M1AA 5AV9C 2YFWA 4X23B 3AZFA 3UT9D 5AVCD 1U35B 1P3IC 3AV1B 1P3KB 3R45A 1KX4B 3AZEA 2BYMB 5E5AB 4H9OB 3B0CT 5B31A 1ZLAC 1P3BD 5B2JB 3AZLD 3MGPA 1S32A 4R8PC 1M1AD 5BT1C 1BH9A 4J8WB 5AVBB 3AZFD 1U35A 4J8VC 2HUEB 4ZBJB 1P3KA 1KX4A 1EQZC 5E5AA 3REJB 3AZED 3WA9C 1P3FA 5DNMD 5B2JA 1P3GC 5B31D 4KGCB 3UT9C 1HQ3B 3MGPD 1S32D 4J8WA 4J8UD 5AVBA 2L5AA 4NE3A 3C1BD 4YM6C 3LELB 1P3KD 4JJNB 3REJA 4CAYB 1P3MB 4H9QB 1P3FD 4KGCA 3AZGB 1P34C 3MVDC 3LZ0C 1HQ3A 3KWQB 3AZKC 5B1LA 1M18C 3LJAC 2NQBD 3VH6A 1TZYC 4J8WD 4E44A 5AV8D 5G49B 2AROB 3LELA 4JJNA 1F66D 4WU9C 2PYOB 4LD9C 4H9PB 5DNMC 1P3MA 1P3OA 4H9QA 1M19A 3AZMD 4XUJB 5GT0A 3B6FC 4UUZA 1JFIA 3KWQA 1KX5A 3WKJB 4ZUXB 5B1LD 3C1BC 2HIOA 3UTAC 5G49A 3MGSC 3UTBC 4YS3A 3W96C 3MGQC 4H9PA 3X1UD 5AV5C 5GSUB 4XUJA 1P3OD 3KXBC 1M19D 2NQBC 5GT0D 1KX5D 3AZHB 4ZUXA 5AV8C 1AOIB 4WU8A 1F66C 2HIOD 3AZND 5BO0A 4YS3D 1P3LB 5B2IB 4NE6A 5GSUA 3O62B 3WTPC 5DNNA 3AZJC 3LZ1C 5CPJC 3AYWD 3REIB 4Z5TB 3AN2A 5F99A 1ID3A 5B0ZB 4QLCB 3W99A 4WU8D 5B2IA 5KDMB 5CPIB 1KX3B 4AWLB 5DNND 2NZDC 5B40B 5C3IB 4KHAB 5GT3B 5AY8B 3X1VB 3AZNC 4QLCA 3AN2D 1ID3D 3W99D 5F99D 3REHC 3B6GA 1A7WA 5KDMA 5CPIA 1KX3A 3W97B 4KHAA 3AYWC 5AV9B 4WNNA 3AFAC 1P3IB 3B6GD 5B0YC 5AV6A 2F8ND 5BS7C 1P3AC 3W98C 4Z66A 5B24A 5GXQC 1ZLAB 3VH5T 3B0CW 3REKA 5CP6D 4J8VB 3X1SA 3AV2A 5B33C 5AV6D 3WA9B 1B67A 5B24D 4Z66D 4KUDB 1P3GB 1P3PD 4Z2MH 2FJ7C 5B32A 4XZQC 3WAAC 3REKD
chains in the Genus database with same CATH superfamily
4YM6B 3MNND 3KUYA 3X1SD 4NFTA 3AV2D 3TU4A 4KUDA 1H3OA 3X1TA 5CPKD 3MVDB 3LZ0B 1P34B 3AZKB 5CP6C 1M18B 3LJAB 2F8NK 5B32D 1TZYB 3RELC 4X23A 4G91B 3KUYD 3AV1A 4LD9B 3C1CB 2BYMA 4H9RB 4H9OA 3TU4D 2F8NH 1P34A 3MVDA 3AZKA 3X1TD 2YFVB 1TZYA 5AVCC 3MNNC 3UTAB 3MGSB 3UTBB 3W96B 4X23D 1Z2CB 3MGQB 3C1CA 1U35D 3AV1D 1BH8B 1KX4D 5AV5B 5CPKC 5E5AD 3KXBB 1P3BC 3AZLC 5BNVB 1M1AC 5JRGB 4J8VA 5B2JD 3UTBA 3AZFC 2CWEA 3AL0C 4EO5C 1HTAA 3MGQA 5AVBD 3AZEC 1BH8A 4CAYA 3A1IA 3REJD 3MGRB 3WTPB 5CHLB 3V9RB 5BNVA 5B31C 3AZJB 5JRGA 3LZ1B 3AZGA 5CPJB 3MGPC 1S32C 4J8UC 4HGAC 4KGCD 1HQ3D 2Y2QA 1P3KC 2AROA 1KX4C 4H9SC 2PYOA 5E5AC 3LELD 4JJND 3MGRA 1P3FC 1P3MD 5B2JC 2NZDB 3B0DC 2ZY4A 3WKJA 3AZGD 2F2AC 2CV5B 4J8WC 3KWQD 2AROD 2PYOD 3AZMC 4J8XB 3AZIB 4XUJD 2CV5A 5B1LC 3WKJD 3AZHA 3A6NB 5BNXB 4CSRB 4ZUXD 1AOIA 3AFAB 4JJNC 4G92C 1P3LA 1N1JB 3X1UC 5B0YB 1P3MC 1P3OC 1P3AB 4J8XA 2BYKB 3AZIA 1M19C 3W98B 5GSUD 3O62A 5GT0C 5GXQB 3VH6T 1KX5C 3H0RC 3A6NA 3AZHD 2HIOC 4CSRA 3REIA 4Z5TA 3VH5W 4YS3C 2Y2JA 5B0ZA 5B1MB 1AOID 5B0YA 1P3LD 5B2ID 5B33B 2RVQD 4XUJC 2BG1A 3O62D 4WV4B 5B40A 4ZUXC 5GT3A 5AY8A 3X1VA 2FJ7B 1ULYA 4WU8C 5B1MA 3REID 4Z5TD 4QLCD 5B0ZD 3WAAB 1R4VA 5GSUC 5B31G 4M6BA 5DNNC 1TAFB 5CPID 1WWSA 1KX3D 2JSSA 2JE5A 3W97A 1B6WA 3F6TA 5B40D 5GT3D 5AY8D 3AN2C 3W99C 4E45A 5AV9A 5F99C 4R8PB 3X1VD 1ID3C 3RELB 5B2IC 2ZY5A 4DQYB 1P3IA 1EQZB 1TAFA 3EPLA 1ZLAA 2Y2NA 3W97D 2IO5C 4QLCC 4R8PA 2G5HC 3RELA 3UT9B 5AVCB 5AV9D 3EPJA 3B6GC 1EQZA 5CPIC 1P3ID 3WA9A 1P3BB 3KSYA 3AZLB 1P3GA 2FFFB 1M1AB 1ZLAD 3UT9A 4WZSB 4R8PD 2YFWB 3AZFB 4EO5B 2J8PA 4YM6A 4J8VD 3R45B 5AV6C 3AZEB 4WU9B 2W8SA 4Z66C 5B24C 5DNMB 3WA9D 5B31B 4KUDD 1P3PC 1P3GD 3B0BA 3LZ0A 3MGPB 1S32B 4J8UB 4HGAB 3B6FB 1M18A 3LJAA 1BH9B 2XD5A 3REKC 3C1BB 3H0LC 3X1SC 2Y2OA 4H9NB 4YM6D 4DRAA 3AV2C 4WU9A 4LD9A 5DNMA 4H9RA 1P3FB 3NQUB 3B0DB 3B6FA 4J8UA 2NQBB 2YFVA 3MVDD 5FUGB 5B32C 3LZ0D 1P34D 3AZKD 3C1BA 5AV8B 3LJAD 3UTAA 1M18D 3MGSA 1TZYD 1F66B 3W96A 4H9NA 4H9SA 3KUYC 4Z2MG 4WU9D 3TU4C 4LD9D 3C1CD 3AZMB 5AV5A 4KUDC 3NQUA 3KXBA 3X1TC 3EPHA 2NQBA 5FUGA 3B6FD 5B1LB 5AV8A 1F1EA 4X23C 1F66A 3UTAD 3MGSD 3UTBD 1U35C 4G92B 3W96D 3AV1C 2Y2MA 3X1UB 3MGQD 3AZMA 1P3OB 1M19B 5AV5D 3WTPA 3V9RA 5GT0B 3AZJA 4UUZB 3KXBD 1JFIB 1KX5B 3LZ1A 5CPJA 5JRGD 1PZRA 2HIOB 3VH6W 3AZNB 4G91C 4YS3B 1Q9CA 5AVBC 2F8NG 2HUEC 4ZBJC 3X1UA 3REHB 3C1CC 3KFUG 2UWXA 3REJC 2LY8A 3MGRD 3WTPD 2NZDA 3AZJD 4KGCC 3AYWB 5CPJD 3LZ1D 1HQ3C 2DQNC 3AZNA 4WU8B 2VQRA 5BO0B 2ZM5A 3REHA 2DF4C 2Y2GA 3LELC 2ZY3A 5DNNB 5JRGC 3AZGC 3AYWA 2NZDD 3KWQC 3AN2B 1ID3B 5F99B 2CV5D 3W99B 5BNXA 3VH5A 2AROC 3AFAA 3REHD 4NE5A 3IP4C 1N1JA 2PYOC 3MGRC 5BS7A 1P3AA 2BYKA 3W98A 4J8XD 3AZID 5GXQA 2Y2IA 5B32G 3WKJC 2IO5B 3A6ND 4XZQB 1WWIA 3B6GB 3AFAD 2F8NB 5B33A 5B0YD 1P3AD 3W98D 3NQJB 4DRBA 5GXQD 2CV5C 3AZHC 3A1KA 4WNNB 2G5IC 2ZY2A 4XZQA 1AOIC 5CP6B 2FJ7A 3WAAA 5B1MD 1P3LC 2F8NA 5AV6B 2Y2PA 2RVQC 4J8XC 3AZIC 5JA4B 5B33D 4Z66B 5B24B 3O62C 3NQJA 1P3PB 3A6NC 3REIC 4Z5TC 5CP6A 3FDDA 5B0ZC 2FJ7D 3REKB 4XZQD 3MNNB 3X1SB 3WAAD 1BFMA 1KU5A 3AV2B 5JA4A 1KX3C 4AWLC 5CPKB 1P3PA 5B40C 5C3IC 5GT3C 5AY8C 3X1VC 5B32B 5B1MC 5AVCA 3MNNA 5BT1D 3RELD 3KUYB 3TU4B 1EQZD 3WTPE 1H3OB 5CPKA 2Y2HA 1P3BA 3W97C 3AZLA 3X1TB 1W2EA 1M1AA 5AV9C 2YFWA 4X23B 3AZFA 3UT9D 5AVCD 1U35B 1P3IC 3AV1B 1P3KB 3R45A 1KX4B 3AZEA 2BYMB 5E5AB 4H9OB 3B0CT 5B31A 1ZLAC 1P3BD 5B2JB 2Y2LA 3AZLD 3MGPA 1S32A 4R8PC 1M1AD 3EG5B 5BT1C 1BH9A 4J8WB 5AVBB 3AZFD 1U35A 4J8VC 2HUEB 4ZBJB 1P3KA 1KX4A 1EQZC 5E5AA 3REJB 3AZED 3WA9C 1P3FA 5DNMD 5B2JA 1P3GC 5B31D 4KGCB 3UT9C 1HQ3B 3MGPD 1S32D 4J8WA 4J8UD 5AVBA 2L5AA 4NE3A 3C1BD 4YM6C 3LELB 1P3KD 4JJNB 3REJA 4CAYB 1P3MB 4H9QB 1P3FD 4KGCA 3AZGB 1P34C 3MVDC 3LZ0C 2XD1A 1HQ3A 3KWQB 3AZKC 5B1LA 1M18C 3LJAC 2NQBD 3VH6A 1TZYC 4J8WD 4E44A 5AV8D 5G49B 2AROB 3LELA 4JJNA 1F66D 4WU9C 2PYOB 4LD9C 4H9PB 5DNMC 1P3MA 1P3OA 4H9QA 1M19A 3AZMD 4XUJB 5GT0A 3B6FC 4UUZA 1JFIA 3KWQA 1KX5A 3WKJB 4ZUXB 5B1LD 3C1BC 2HIOA 2Y2KA 2RIQA 5G49A 3MGSC 3UTAC 3UTBC 4YS3A 3W96C 3MGQC 4H9PA 3X1UD 5AV5C 5GSUB 4XUJA 1P3OD 3KXBC 1M19D 2NQBC 5GT0D 1KX5D 3AZHB 4ZUXA 5AV8C 1AOIB 4WU8A 3P5JB 2HIOD 3EPKA 3AZND 1F66C 5BO0A 4YS3D 1P3LB 5B2IB 4NE6A 5GSUA 3O62B 5DNNA 3WTPC 3AZJC 3LZ1C 5CPJC 4WJ3C 3AYWD 3REIB 4Z5TB 3AN2A 5F99A 1ID3A 5B0ZB 4QLCB 3W99A 4WU8D 5B2IA 5KDMB 5CPIB 1KX3B 4AWLB 5DNND 2NZDC 5B40B 5C3IB 4KHAB 5GT3B 5AY8B 3X1VB 3AZNC 4QLCA 3AN2D 1T3UA 1ID3D 3W99D 5F99D 3REHC 3B6GA 1A7WA 5KDMA 5CPIA 1KX3A 3W97B 4KHAA 3AYWC 3H0MC 2JCHA 5AV9B 4WNNA 3AFAC 1P3IB 3B6GD 5B0YC 5AV6A 2F8ND 5BS7C 1P3AC 3W98C 4Z66A 5B24A 5GXQC 1ZLAB 3VH5T 3B0CW 3REKA 5CP6D 4J8VB 3X1SA 3AV2A 5B33C 5AV6D 3WA9B 1B67A 5B24D 4Z66D 4KUDB 1P3GB 1P3PD 4Z2MH 2FJ7C 5B32A 4XZQC 4UPKA 3WAAC 3REKD
chains in the Genus database with same CATH topology
4YM6B 3MNND 3KUYA 3X1SD 4NFTA 3AV2D 3TU4A 4KUDA 1H3OA 3X1TA 5CPKD 3MVDB 3LZ0B 1P34B 3AZKB 5CP6C 1M18B 3LJAB 2F8NK 5B32D 1TZYB 3RELC 4X23A 4G91B 3KUYD 3AV1A 4LD9B 3C1CB 2BYMA 4H9RB 4H9OA 3TU4D 2F8NH 1P34A 3MVDA 3AZKA 3X1TD 2YFVB 1TZYA 5AVCC 3MNNC 3UTAB 3MGSB 3UTBB 3W96B 4X23D 1Z2CB 3MGQB 3C1CA 1U35D 3AV1D 1BH8B 1KX4D 5AV5B 5CPKC 5E5AD 3KXBB 1P3BC 3AZLC 5BNVB 1M1AC 5JRGB 4J8VA 5B2JD 3UTBA 3AZFC 2CWEA 3AL0C 4EO5C 1HTAA 3MGQA 5AVBD 3AZEC 1BH8A 4CAYA 3A1IA 3REJD 3MGRB 3WTPB 5CHLB 3V9RB 5BNVA 5B31C 3AZJB 5JRGA 3LZ1B 3AZGA 5CPJB 3MGPC 1S32C 4J8UC 4HGAC 4KGCD 1HQ3D 2Y2QA 1P3KC 2AROA 1KX4C 4H9SC 2PYOA 5E5AC 3LELD 4JJND 3MGRA 1P3FC 1P3MD 5B2JC 2NZDB 3B0DC 2ZY4A 3WKJA 3AZGD 2F2AC 2CV5B 4J8WC 3KWQD 2AROD 2PYOD 3AZMC 4J8XB 3AZIB 4XUJD 2CV5A 5B1LC 3WKJD 3AZHA 3A6NB 5BNXB 4CSRB 4ZUXD 1AOIA 3AFAB 4JJNC 4G92C 1P3LA 1N1JB 3X1UC 5B0YB 1P3MC 1P3OC 1P3AB 4J8XA 2BYKB 3AZIA 1M19C 3W98B 5GSUD 3O62A 5GT0C 5GXQB 3VH6T 1KX5C 3H0RC 3A6NA 3AZHD 2HIOC 4CSRA 3REIA 4Z5TA 3VH5W 4YS3C 2Y2JA 5B0ZA 5B1MB 1AOID 5B0YA 1P3LD 5B2ID 5B33B 2RVQD 4XUJC 2BG1A 3O62D 4WV4B 5B40A 4ZUXC 5GT3A 5AY8A 3X1VA 2FJ7B 1ULYA 4WU8C 5B1MA 3REID 4Z5TD 4QLCD 5B0ZD 3WAAB 1R4VA 5GSUC 5B31G 4M6BA 5DNNC 1TAFB 5CPID 1WWSA 1KX3D 2JSSA 2JE5A 3W97A 1B6WA 3F6TA 5B40D 5GT3D 5AY8D 3AN2C 3W99C 4E45A 5AV9A 5F99C 4R8PB 3X1VD 1ID3C 3RELB 5B2IC 2ZY5A 4DQYB 1P3IA 1EQZB 1TAFA 3EPLA 1ZLAA 2Y2NA 3W97D 2IO5C 4QLCC 4R8PA 2G5HC 3RELA 3UT9B 5AVCB 5AV9D 3EPJA 3B6GC 1EQZA 5CPIC 1P3ID 3WA9A 1P3BB 3KSYA 3AZLB 1P3GA 2FFFB 1M1AB 1ZLAD 3UT9A 4WZSB 4R8PD 2YFWB 3AZFB 4EO5B 2J8PA 4YM6A 4J8VD 3R45B 5AV6C 3AZEB 4WU9B 2W8SA 4Z66C 5B24C 5DNMB 3WA9D 5B31B 4KUDD 1P3PC 1P3GD 3B0BA 3LZ0A 3MGPB 1S32B 4J8UB 4HGAB 3B6FB 1M18A 3LJAA 1BH9B 2XD5A 3REKC 3C1BB 3H0LC 3X1SC 2Y2OA 4H9NB 4YM6D 4DRAA 3AV2C 4WU9A 4LD9A 5DNMA 4H9RA 1P3FB 3NQUB 3B0DB 3B6FA 4J8UA 2NQBB 2YFVA 3MVDD 5FUGB 5B32C 3LZ0D 1P34D 3AZKD 3C1BA 5AV8B 3LJAD 3UTAA 1M18D 3MGSA 1TZYD 1F66B 3W96A 4H9NA 4H9SA 3KUYC 4Z2MG 4WU9D 3TU4C 4LD9D 3C1CD 3AZMB 5AV5A 4KUDC 3NQUA 3KXBA 3X1TC 3EPHA 2NQBA 5FUGA 3B6FD 5B1LB 5AV8A 1F1EA 4X23C 1F66A 3UTAD 3MGSD 3UTBD 1U35C 4G92B 3W96D 3AV1C 2Y2MA 3X1UB 3MGQD 3AZMA 1P3OB 1M19B 5AV5D 3WTPA 3V9RA 5GT0B 3AZJA 4UUZB 3KXBD 1JFIB 1KX5B 3LZ1A 5CPJA 5JRGD 1PZRA 2HIOB 3VH6W 3AZNB 4G91C 4YS3B 1Q9CA 5AVBC 2F8NG 2HUEC 4ZBJC 3X1UA 3REHB 3C1CC 3KFUG 2UWXA 3REJC 2LY8A 3MGRD 3WTPD 2NZDA 3AZJD 4KGCC 3AYWB 5CPJD 3LZ1D 1HQ3C 2DQNC 3AZNA 4WU8B 2VQRA 5BO0B 2ZM5A 3REHA 2DF4C 2Y2GA 3LELC 2ZY3A 5DNNB 5JRGC 3AZGC 3AYWA 2NZDD 3KWQC 3AN2B 1ID3B 5F99B 2CV5D 3W99B 5BNXA 3VH5A 2AROC 3AFAA 3REHD 4NE5A 3IP4C 1N1JA 2PYOC 3MGRC 5BS7A 1P3AA 2BYKA 3W98A 4J8XD 3AZID 5GXQA 2Y2IA 5B32G 3WKJC 2IO5B 3A6ND 4XZQB 1WWIA 3B6GB 3AFAD 2F8NB 5B33A 5B0YD 1P3AD 3W98D 3NQJB 4DRBA 5GXQD 2CV5C 3AZHC 3A1KA 4WNNB 2G5IC 2ZY2A 4XZQA 1AOIC 5CP6B 2FJ7A 3WAAA 5B1MD 1P3LC 2F8NA 5AV6B 2Y2PA 2RVQC 4J8XC 3AZIC 5JA4B 5B33D 4Z66B 5B24B 3O62C 3NQJA 1P3PB 3A6NC 3REIC 4Z5TC 5CP6A 3FDDA 5B0ZC 2FJ7D 3REKB 4XZQD 3MNNB 3X1SB 3WAAD 1BFMA 1KU5A 3AV2B 5JA4A 1KX3C 4AWLC 5CPKB 1P3PA 5B40C 5C3IC 5GT3C 5AY8C 3X1VC 5B32B 5B1MC 5AVCA 3MNNA 5BT1D 3RELD 3KUYB 3TU4B 1EQZD 3WTPE 1H3OB 5CPKA 2Y2HA 1P3BA 3W97C 3AZLA 3X1TB 1W2EA 1M1AA 5AV9C 2YFWA 4X23B 3AZFA 3UT9D 5AVCD 1U35B 1P3IC 3AV1B 1P3KB 3R45A 1KX4B 3AZEA 2BYMB 5E5AB 4H9OB 3B0CT 5B31A 1ZLAC 1P3BD 5B2JB 2Y2LA 3AZLD 3MGPA 1S32A 4R8PC 1M1AD 3EG5B 5BT1C 1BH9A 4J8WB 5AVBB 3AZFD 1U35A 4J8VC 2HUEB 4ZBJB 1P3KA 1KX4A 1EQZC 5E5AA 3REJB 3AZED 3WA9C 1P3FA 5DNMD 5B2JA 1P3GC 5B31D 4KGCB 3UT9C 1HQ3B 3MGPD 1S32D 4J8WA 4J8UD 5AVBA 2L5AA 4NE3A 3C1BD 4YM6C 3LELB 1P3KD 4JJNB 3REJA 4CAYB 1P3MB 4H9QB 1P3FD 4KGCA 3AZGB 1P34C 3MVDC 3LZ0C 2XD1A 1HQ3A 3KWQB 3AZKC 5B1LA 1M18C 3LJAC 2NQBD 3VH6A 1TZYC 4J8WD 4E44A 5AV8D 5G49B 2AROB 3LELA 4JJNA 1F66D 4WU9C 2PYOB 4LD9C 4H9PB 5DNMC 1P3MA 1P3OA 4H9QA 1M19A 3AZMD 4XUJB 5GT0A 3B6FC 4UUZA 1JFIA 3KWQA 1KX5A 3WKJB 4ZUXB 5B1LD 3C1BC 2HIOA 2Y2KA 2RIQA 5G49A 3MGSC 3UTAC 3UTBC 4YS3A 3W96C 3MGQC 4H9PA 3X1UD 5AV5C 5GSUB 4XUJA 1P3OD 3KXBC 1M19D 2NQBC 5GT0D 1KX5D 3AZHB 4ZUXA 5AV8C 1AOIB 4WU8A 3P5JB 2HIOD 3EPKA 3AZND 1F66C 5BO0A 4YS3D 1P3LB 5B2IB 4NE6A 5GSUA 3O62B 5DNNA 3WTPC 3AZJC 3LZ1C 5CPJC 4WJ3C 3AYWD 3REIB 4Z5TB 3AN2A 5F99A 1ID3A 5B0ZB 4QLCB 3W99A 4WU8D 5B2IA 5KDMB 5CPIB 1KX3B 4AWLB 5DNND 2NZDC 5B40B 5C3IB 4KHAB 5GT3B 5AY8B 3X1VB 3AZNC 4QLCA 3AN2D 1T3UA 1ID3D 3W99D 5F99D 3REHC 3B6GA 1A7WA 5KDMA 5CPIA 1KX3A 3W97B 4KHAA 3AYWC 3H0MC 2JCHA 5AV9B 4WNNA 3AFAC 1P3IB 3B6GD 5B0YC 5AV6A 2F8ND 5BS7C 1P3AC 3W98C 4Z66A 5B24A 5GXQC 1ZLAB 3VH5T 3B0CW 3REKA 5CP6D 4J8VB 3X1SA 3AV2A 5B33C 5AV6D 3WA9B 1B67A 5B24D 4Z66D 4KUDB 1P3GB 1P3PD 4Z2MH 2FJ7C 5B32A 4XZQC 4UPKA 3WAAC 3REKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YM6 B;  3MNN D;  3KUY A;  3X1S D;  4NFT A;  3AV2 D;  3TU4 A;  4KUD A;  1H3O A;  3X1T A;  5CPK D;  3MVD B;  3LZ0 B;  1P34 B;  3AZK B;  5CP6 C;  1M18 B;  3LJA B;  2F8N K;  5B32 D;  1TZY B;  3REL C;  4X23 A;  4G91 B;  3KUY D;  3AV1 A;  4LD9 B;  3C1C B;  2BYM A;  4H9R B;  4H9O A;  3TU4 D;  2F8N H;  1P34 A;  3MVD A;  3AZK A;  3X1T D;  2YFV B;  1TZY A;  5AVC C;  3MNN C;  3UTA B;  3MGS B;  3UTB B;  3W96 B;  4X23 D;  3MGQ B;  3C1C A;  1U35 D;  3AV1 D;  1BH8 B;  1KX4 D;  5AV5 B;  5CPK C;  5E5A D;  3KXB B;  1P3B C;  3AZL C;  5BNV B;  1M1A C;  5JRG B;  4J8V A;  5B2J D;  3UTB A;  3AZF C;  2CWE A;  4EO5 C;  1HTA A;  3MGQ A;  5AVB D;  3AZE C;  1BH8 A;  4CAY A;  3REJ D;  3MGR B;  3WTP B;  5CHL B;  3V9R B;  5BNV A;  5B31 C;  3AZJ B;  5JRG A;  3LZ1 B;  3AZG A;  5CPJ B;  3MGP C;  1S32 C;  4J8U C;  4HGA C;  4KGC D;  1HQ3 D;  1P3K C;  2ARO A;  1KX4 C;  4H9S C;  2PYO A;  5E5A C;  3LEL D;  4JJN D;  3MGR A;  1P3F C;  1P3M D;  5B2J C;  2NZD B;  3B0D C;  3WKJ A;  3AZG D;  2CV5 B;  4J8W C;  3KWQ D;  2ARO D;  2PYO D;  3AZM C;  4J8X B;  3AZI B;  4XUJ D;  2CV5 A;  5B1L C;  3WKJ D;  3AZH A;  3A6N B;  5BNX B;  4CSR B;  4ZUX D;  1AOI A;  3AFA B;  4JJN C;  4G92 C;  1P3L A;  1N1J B;  3X1U C;  5B0Y B;  1P3M C;  1P3O C;  1P3A B;  4J8X A;  2BYK B;  3AZI A;  1M19 C;  3W98 B;  5GSU D;  3O62 A;  5GT0 C;  5GXQ B;  3VH6 T;  1KX5 C;  3A6N A;  3AZH D;  2HIO C;  4CSR A;  3REI A;  4Z5T A;  3VH5 W;  4YS3 C;  5B0Z A;  5B1M B;  1AOI D;  5B0Y A;  1P3L D;  5B2I D;  5B33 B;  2RVQ D;  4XUJ C;  3O62 D;  4WV4 B;  5B40 A;  4ZUX C;  5GT3 A;  5AY8 A;  3X1V A;  2FJ7 B;  1ULY A;  4WU8 C;  5B1M A;  3REI D;  4Z5T D;  5B0Z D;  4QLC D;  3WAA B;  1R4V A;  5GSU C;  5B31 G;  4M6B A;  5DNN C;  1TAF B;  5CPI D;  1WWS A;  1KX3 D;  2JSS A;  3W97 A;  1B6W A;  5B40 D;  5GT3 D;  5AY8 D;  3AN2 C;  5F99 C;  3W99 C;  4E45 A;  5AV9 A;  4R8P B;  3X1V D;  1ID3 C;  3REL B;  5B2I C;  1P3I A;  1EQZ B;  1TAF A;  1ZLA A;  3W97 D;  2IO5 C;  4QLC C;  4R8P A;  3REL A;  3UT9 B;  5AVC B;  5AV9 D;  3B6G C;  1EQZ A;  5CPI C;  1P3I D;  3WA9 A;  1P3B B;  3KSY A;  3AZL B;  1P3G A;  1M1A B;  1ZLA D;  3UT9 A;  4WZS B;  4R8P D;  2YFW B;  3AZF B;  4EO5 B;  4YM6 A;  4J8V D;  3R45 B;  5AV6 C;  3AZE B;  4WU9 B;  4Z66 C;  5B24 C;  5DNM B;  3WA9 D;  5B31 B;  4KUD D;  1P3P C;  1P3G D;  3B0B A;  3LZ0 A;  3MGP B;  1S32 B;  4J8U B;  4HGA B;  3B6F B;  1M18 A;  3LJA A;  1BH9 B;  3REK C;  3C1B B;  3X1S C;  4H9N B;  4YM6 D;  4DRA A;  3AV2 C;  4WU9 A;  4LD9 A;  5DNM A;  4H9R A;  1P3F B;  3NQU B;  3B0D B;  3B6F A;  4J8U A;  2NQB B;  2YFV A;  3MVD D;  5FUG B;  5B32 C;  3LZ0 D;  1P34 D;  3AZK D;  3C1B A;  5AV8 B;  3LJA D;  3UTA A;  1M18 D;  3MGS A;  1TZY D;  1F66 B;  3W96 A;  4H9N A;  4H9S A;  3KUY C;  4Z2M G;  4WU9 D;  3TU4 C;  4LD9 D;  3C1C D;  3AZM B;  5AV5 A;  4KUD C;  3NQU A;  3KXB A;  3X1T C;  2NQB A;  5FUG A;  3B6F D;  5B1L B;  5AV8 A;  1F1E A;  4X23 C;  1F66 A;  3UTA D;  3MGS D;  3UTB D;  1U35 C;  4G92 B;  3W96 D;  3AV1 C;  3X1U B;  3MGQ D;  3AZM A;  1P3O B;  1M19 B;  5AV5 D;  3WTP A;  3V9R A;  5GT0 B;  3AZJ A;  4UUZ B;  3KXB D;  1JFI B;  1KX5 B;  3LZ1 A;  5CPJ A;  5JRG D;  2HIO B;  3VH6 W;  3AZN B;  4G91 C;  4YS3 B;  1Q9C A;  5AVB C;  2F8N G;  2HUE C;  4ZBJ C;  3X1U A;  3REH B;  3C1C C;  3REJ C;  2LY8 A;  3MGR D;  3WTP D;  2NZD A;  3AZJ D;  4KGC C;  3AYW B;  5CPJ D;  3LZ1 D;  1HQ3 C;  3AZN A;  4WU8 B;  5BO0 B;  3REH A;  3LEL C;  5DNN B;  5JRG C;  3AZG C;  3AYW A;  2NZD D;  3KWQ C;  3AN2 B;  1ID3 B;  5F99 B;  2CV5 D;  3W99 B;  5BNX A;  3VH5 A;  2ARO C;  3AFA A;  3REH D;  4NE5 A;  2PYO C;  1N1J A;  3MGR C;  5BS7 A;  1P3A A;  2BYK A;  3W98 A;  4J8X D;  3AZI D;  5GXQ A;  3WKJ C;  5B32 G;  2IO5 B;  3A6N D;  4XZQ B;  1WWI A;  3B6G B;  3AFA D;  2F8N B;  5B33 A;  5B0Y D;  1P3A D;  3W98 D;  3NQJ B;  4DRB A;  5GXQ D;  2CV5 C;  3AZH C;  4WNN B;  2FJ7 A;  1AOI C;  4XZQ A;  5CP6 B;  3WAA A;  5B1M D;  1P3L C;  2F8N A;  5AV6 B;  2RVQ C;  4J8X C;  3AZI C;  5JA4 B;  5B33 D;  4Z66 B;  5B24 B;  3O62 C;  3NQJ A;  1P3P B;  3A6N C;  3REI C;  4Z5T C;  5CP6 A;  5B0Z C;  2FJ7 D;  3REK B;  4XZQ D;  3MNN B;  3X1S B;  3WAA D;  1BFM A;  1KU5 A;  3AV2 B;  5JA4 A;  1KX3 C;  4AWL C;  5CPK B;  1P3P A;  5B40 C;  5C3I C;  5GT3 C;  5AY8 C;  3X1V C;  5B32 B;  5B1M C;  5AVC A;  3MNN A;  5BT1 D;  3REL D;  3KUY B;  3TU4 B;  1EQZ D;  3WTP E;  1H3O B;  5CPK A;  3W97 C;  1P3B A;  3AZL A;  3X1T B;  1M1A A;  5AV9 C;  2YFW A;  4X23 B;  3AZF A;  3UT9 D;  5AVC D;  1U35 B;  1P3I C;  3AV1 B;  1P3K B;  3R45 A;  1KX4 B;  3AZE A;  2BYM B;  5E5A B;  4H9O B;  3B0C T;  5B31 A;  1ZLA C;  1P3B D;  5B2J B;  3AZL D;  3MGP A;  1S32 A;  4R8P C;  1M1A D;  5BT1 C;  1BH9 A;  4J8W B;  5AVB B;  3AZF D;  1U35 A;  4J8V C;  2HUE B;  4ZBJ B;  1P3K A;  1KX4 A;  1EQZ C;  5E5A A;  3REJ B;  3AZE D;  3WA9 C;  1P3F A;  5DNM D;  5B2J A;  1P3G C;  5B31 D;  4KGC B;  3UT9 C;  1HQ3 B;  3MGP D;  1S32 D;  4J8W A;  4J8U D;  5AVB A;  2L5A A;  4NE3 A;  3C1B D;  4YM6 C;  3LEL B;  1P3K D;  4JJN B;  3REJ A;  4CAY B;  1P3M B;  4H9Q B;  1P3F D;  4KGC A;  3AZG B;  1P34 C;  3MVD C;  3LZ0 C;  1HQ3 A;  3KWQ B;  3AZK C;  5B1L A;  1M18 C;  3LJA C;  2NQB D;  3VH6 A;  1TZY C;  4J8W D;  4E44 A;  5AV8 D;  5G49 B;  2ARO B;  3LEL A;  4JJN A;  1F66 D;  4WU9 C;  2PYO B;  4LD9 C;  4H9P B;  5DNM C;  1P3M A;  1P3O A;  4H9Q A;  1M19 A;  3AZM D;  4XUJ B;  5GT0 A;  3B6F C;  4UUZ A;  1JFI A;  3KWQ A;  1KX5 A;  3WKJ B;  4ZUX B;  5B1L D;  3C1B C;  2HIO A;  3UTA C;  5G49 A;  3MGS C;  3UTB C;  4YS3 A;  3W96 C;  3MGQ C;  4H9P A;  3X1U D;  5AV5 C;  5GSU B;  4XUJ A;  1P3O D;  3KXB C;  1M19 D;  2NQB C;  5GT0 D;  1KX5 D;  3AZH B;  4ZUX A;  5AV8 C;  1AOI B;  4WU8 A;  1F66 C;  2HIO D;  3AZN D;  5BO0 A;  4YS3 D;  1P3L B;  5B2I B;  4NE6 A;  5GSU A;  3O62 B;  3WTP C;  5DNN A;  3AZJ C;  3LZ1 C;  5CPJ C;  3AYW D;  3REI B;  4Z5T B;  3AN2 A;  5F99 A;  1ID3 A;  5B0Z B;  4QLC B;  3W99 A;  4WU8 D;  5B2I A;  5KDM B;  5CPI B;  1KX3 B;  4AWL B;  5DNN D;  2NZD C;  5B40 B;  5C3I B;  4KHA B;  5GT3 B;  5AY8 B;  3X1V B;  3AZN C;  4QLC A;  3AN2 D;  1ID3 D;  3W99 D;  5F99 D;  3REH C;  3B6G A;  1A7W A;  5KDM A;  5CPI A;  1KX3 A;  3W97 B;  4KHA A;  3AYW C;  5AV9 B;  4WNN A;  3AFA C;  1P3I B;  3B6G D;  5B0Y C;  5AV6 A;  2F8N D;  5BS7 C;  1P3A C;  3W98 C;  4Z66 A;  5B24 A;  5GXQ C;  1ZLA B;  3VH5 T;  3B0C W;  3REK A;  5CP6 D;  4J8V B;  3X1S A;  3AV2 A;  5B33 C;  5AV6 D;  3WA9 B;  1B67 A;  5B24 D;  4Z66 D;  4KUD B;  1P3G B;  1P3P D;  4Z2M H;  2FJ7 C;  5B32 A;  4XZQ C;  3WAA C;  3REK D; 
#chains in the Genus database with same CATH topology
 4YM6 B;  3MNN D;  3KUY A;  3X1S D;  4NFT A;  3AV2 D;  3TU4 A;  4KUD A;  1H3O A;  3X1T A;  5CPK D;  3MVD B;  3LZ0 B;  1P34 B;  3AZK B;  5CP6 C;  1M18 B;  3LJA B;  2F8N K;  5B32 D;  1TZY B;  3REL C;  4X23 A;  4G91 B;  3KUY D;  3AV1 A;  4LD9 B;  3C1C B;  2BYM A;  4H9R B;  4H9O A;  3TU4 D;  2F8N H;  1P34 A;  3MVD A;  3AZK A;  3X1T D;  2YFV B;  1TZY A;  5AVC C;  3MNN C;  3UTA B;  3MGS B;  3UTB B;  3W96 B;  4X23 D;  1Z2C B;  3MGQ B;  3C1C A;  1U35 D;  3AV1 D;  1BH8 B;  1KX4 D;  5AV5 B;  5CPK C;  5E5A D;  3KXB B;  1P3B C;  3AZL C;  5BNV B;  1M1A C;  5JRG B;  4J8V A;  5B2J D;  3UTB A;  3AZF C;  2CWE A;  3AL0 C;  4EO5 C;  1HTA A;  3MGQ A;  5AVB D;  3AZE C;  1BH8 A;  4CAY A;  3A1I A;  3REJ D;  3MGR B;  3WTP B;  5CHL B;  3V9R B;  5BNV A;  5B31 C;  3AZJ B;  5JRG A;  3LZ1 B;  3AZG A;  5CPJ B;  3MGP C;  1S32 C;  4J8U C;  4HGA C;  4KGC D;  1HQ3 D;  2Y2Q A;  1P3K C;  2ARO A;  1KX4 C;  4H9S C;  2PYO A;  5E5A C;  3LEL D;  4JJN D;  3MGR A;  1P3F C;  1P3M D;  5B2J C;  2NZD B;  3B0D C;  2ZY4 A;  3WKJ A;  3AZG D;  2F2A C;  2CV5 B;  4J8W C;  3KWQ D;  2ARO D;  2PYO D;  3AZM C;  4J8X B;  3AZI B;  4XUJ D;  2CV5 A;  5B1L C;  3WKJ D;  3AZH A;  3A6N B;  5BNX B;  4CSR B;  4ZUX D;  1AOI A;  3AFA B;  4JJN C;  4G92 C;  1P3L A;  1N1J B;  3X1U C;  5B0Y B;  1P3M C;  1P3O C;  1P3A B;  4J8X A;  2BYK B;  3AZI A;  1M19 C;  3W98 B;  5GSU D;  3O62 A;  5GT0 C;  5GXQ B;  3VH6 T;  1KX5 C;  3H0R C;  3A6N A;  3AZH D;  2HIO C;  4CSR A;  3REI A;  4Z5T A;  3VH5 W;  4YS3 C;  2Y2J A;  5B0Z A;  5B1M B;  1AOI D;  5B0Y A;  1P3L D;  5B2I D;  5B33 B;  2RVQ D;  4XUJ C;  2BG1 A;  3O62 D;  4WV4 B;  5B40 A;  4ZUX C;  5GT3 A;  5AY8 A;  3X1V A;  2FJ7 B;  1ULY A;  4WU8 C;  5B1M A;  3REI D;  4Z5T D;  4QLC D;  5B0Z D;  3WAA B;  1R4V A;  5GSU C;  5B31 G;  4M6B A;  5DNN C;  1TAF B;  5CPI D;  1WWS A;  1KX3 D;  2JSS A;  2JE5 A;  3W97 A;  1B6W A;  3F6T A;  5B40 D;  5GT3 D;  5AY8 D;  3AN2 C;  3W99 C;  4E45 A;  5AV9 A;  5F99 C;  4R8P B;  3X1V D;  1ID3 C;  3REL B;  5B2I C;  2ZY5 A;  4DQY B;  1P3I A;  1EQZ B;  1TAF A;  3EPL A;  1ZLA A;  2Y2N A;  3W97 D;  2IO5 C;  4QLC C;  4R8P A;  2G5H C;  3REL A;  3UT9 B;  5AVC B;  5AV9 D;  3EPJ A;  3B6G C;  1EQZ A;  5CPI C;  1P3I D;  3WA9 A;  1P3B B;  3KSY A;  3AZL B;  1P3G A;  2FFF B;  1M1A B;  1ZLA D;  3UT9 A;  4WZS B;  4R8P D;  2YFW B;  3AZF B;  4EO5 B;  2J8P A;  4YM6 A;  4J8V D;  3R45 B;  5AV6 C;  3AZE B;  4WU9 B;  2W8S A;  4Z66 C;  5B24 C;  5DNM B;  3WA9 D;  5B31 B;  4KUD D;  1P3P C;  1P3G D;  3B0B A;  3LZ0 A;  3MGP B;  1S32 B;  4J8U B;  4HGA B;  3B6F B;  1M18 A;  3LJA A;  1BH9 B;  2XD5 A;  3REK C;  3C1B B;  3H0L C;  3X1S C;  2Y2O A;  4H9N B;  4YM6 D;  4DRA A;  3AV2 C;  4WU9 A;  4LD9 A;  5DNM A;  4H9R A;  1P3F B;  3NQU B;  3B0D B;  3B6F A;  4J8U A;  2NQB B;  2YFV A;  3MVD D;  5FUG B;  5B32 C;  3LZ0 D;  1P34 D;  3AZK D;  3C1B A;  5AV8 B;  3LJA D;  3UTA A;  1M18 D;  3MGS A;  1TZY D;  1F66 B;  3W96 A;  4H9N A;  4H9S A;  3KUY C;  4Z2M G;  4WU9 D;  3TU4 C;  4LD9 D;  3C1C D;  3AZM B;  5AV5 A;  4KUD C;  3NQU A;  3KXB A;  3X1T C;  3EPH A;  2NQB A;  5FUG A;  3B6F D;  5B1L B;  5AV8 A;  1F1E A;  4X23 C;  1F66 A;  3UTA D;  3MGS D;  3UTB D;  1U35 C;  4G92 B;  3W96 D;  3AV1 C;  2Y2M A;  3X1U B;  3MGQ D;  3AZM A;  1P3O B;  1M19 B;  5AV5 D;  3WTP A;  3V9R A;  5GT0 B;  3AZJ A;  4UUZ B;  3KXB D;  1JFI B;  1KX5 B;  3LZ1 A;  5CPJ A;  5JRG D;  1PZR A;  2HIO B;  3VH6 W;  3AZN B;  4G91 C;  4YS3 B;  1Q9C A;  5AVB C;  2F8N G;  2HUE C;  4ZBJ C;  3X1U A;  3REH B;  3C1C C;  3KFU G;  2UWX A;  3REJ C;  2LY8 A;  3MGR D;  3WTP D;  2NZD A;  3AZJ D;  4KGC C;  3AYW B;  5CPJ D;  3LZ1 D;  1HQ3 C;  2DQN C;  3AZN A;  4WU8 B;  2VQR A;  5BO0 B;  2ZM5 A;  3REH A;  2DF4 C;  2Y2G A;  3LEL C;  2ZY3 A;  5DNN B;  5JRG C;  3AZG C;  3AYW A;  2NZD D;  3KWQ C;  3AN2 B;  1ID3 B;  5F99 B;  2CV5 D;  3W99 B;  5BNX A;  3VH5 A;  2ARO C;  3AFA A;  3REH D;  4NE5 A;  3IP4 C;  1N1J A;  2PYO C;  3MGR C;  5BS7 A;  1P3A A;  2BYK A;  3W98 A;  4J8X D;  3AZI D;  5GXQ A;  2Y2I A;  5B32 G;  3WKJ C;  2IO5 B;  3A6N D;  4XZQ B;  1WWI A;  3B6G B;  3AFA D;  2F8N B;  5B33 A;  5B0Y D;  1P3A D;  3W98 D;  3NQJ B;  4DRB A;  5GXQ D;  2CV5 C;  3AZH C;  3A1K A;  4WNN B;  2G5I C;  2ZY2 A;  4XZQ A;  1AOI C;  5CP6 B;  2FJ7 A;  3WAA A;  5B1M D;  1P3L C;  2F8N A;  5AV6 B;  2Y2P A;  2RVQ C;  4J8X C;  3AZI C;  5JA4 B;  5B33 D;  4Z66 B;  5B24 B;  3O62 C;  3NQJ A;  1P3P B;  3A6N C;  3REI C;  4Z5T C;  5CP6 A;  3FDD A;  5B0Z C;  2FJ7 D;  3REK B;  4XZQ D;  3MNN B;  3X1S B;  3WAA D;  1BFM A;  1KU5 A;  3AV2 B;  5JA4 A;  1KX3 C;  4AWL C;  5CPK B;  1P3P A;  5B40 C;  5C3I C;  5GT3 C;  5AY8 C;  3X1V C;  5B32 B;  5B1M C;  5AVC A;  3MNN A;  5BT1 D;  3REL D;  3KUY B;  3TU4 B;  1EQZ D;  3WTP E;  1H3O B;  5CPK A;  2Y2H A;  1P3B A;  3W97 C;  3AZL A;  3X1T B;  1W2E A;  1M1A A;  5AV9 C;  2YFW A;  4X23 B;  3AZF A;  3UT9 D;  5AVC D;  1U35 B;  1P3I C;  3AV1 B;  1P3K B;  3R45 A;  1KX4 B;  3AZE A;  2BYM B;  5E5A B;  4H9O B;  3B0C T;  5B31 A;  1ZLA C;  1P3B D;  5B2J B;  2Y2L A;  3AZL D;  3MGP A;  1S32 A;  4R8P C;  1M1A D;  3EG5 B;  5BT1 C;  1BH9 A;  4J8W B;  5AVB B;  3AZF D;  1U35 A;  4J8V C;  2HUE B;  4ZBJ B;  1P3K A;  1KX4 A;  1EQZ C;  5E5A A;  3REJ B;  3AZE D;  3WA9 C;  1P3F A;  5DNM D;  5B2J A;  1P3G C;  5B31 D;  4KGC B;  3UT9 C;  1HQ3 B;  3MGP D;  1S32 D;  4J8W A;  4J8U D;  5AVB A;  2L5A A;  4NE3 A;  3C1B D;  4YM6 C;  3LEL B;  1P3K D;  4JJN B;  3REJ A;  4CAY B;  1P3M B;  4H9Q B;  1P3F D;  4KGC A;  3AZG B;  1P34 C;  3MVD C;  3LZ0 C;  2XD1 A;  1HQ3 A;  3KWQ B;  3AZK C;  5B1L A;  1M18 C;  3LJA C;  2NQB D;  3VH6 A;  1TZY C;  4J8W D;  4E44 A;  5AV8 D;  5G49 B;  2ARO B;  3LEL A;  4JJN A;  1F66 D;  4WU9 C;  2PYO B;  4LD9 C;  4H9P B;  5DNM C;  1P3M A;  1P3O A;  4H9Q A;  1M19 A;  3AZM D;  4XUJ B;  5GT0 A;  3B6F C;  4UUZ A;  1JFI A;  3KWQ A;  1KX5 A;  3WKJ B;  4ZUX B;  5B1L D;  3C1B C;  2HIO A;  2Y2K A;  2RIQ A;  5G49 A;  3MGS C;  3UTA C;  3UTB C;  4YS3 A;  3W96 C;  3MGQ C;  4H9P A;  3X1U D;  5AV5 C;  5GSU B;  4XUJ A;  1P3O D;  3KXB C;  1M19 D;  2NQB C;  5GT0 D;  1KX5 D;  3AZH B;  4ZUX A;  5AV8 C;  1AOI B;  4WU8 A;  3P5J B;  2HIO D;  3EPK A;  3AZN D;  1F66 C;  5BO0 A;  4YS3 D;  1P3L B;  5B2I B;  4NE6 A;  5GSU A;  3O62 B;  5DNN A;  3WTP C;  3AZJ C;  3LZ1 C;  5CPJ C;  4WJ3 C;  3AYW D;  3REI B;  4Z5T B;  3AN2 A;  5F99 A;  1ID3 A;  5B0Z B;  4QLC B;  3W99 A;  4WU8 D;  5B2I A;  5KDM B;  5CPI B;  1KX3 B;  4AWL B;  5DNN D;  2NZD C;  5B40 B;  5C3I B;  4KHA B;  5GT3 B;  5AY8 B;  3X1V B;  3AZN C;  4QLC A;  3AN2 D;  1T3U A;  1ID3 D;  3W99 D;  5F99 D;  3REH C;  3B6G A;  1A7W A;  5KDM A;  5CPI A;  1KX3 A;  3W97 B;  4KHA A;  3AYW C;  3H0M C;  2JCH A;  5AV9 B;  4WNN A;  3AFA C;  1P3I B;  3B6G D;  5B0Y C;  5AV6 A;  2F8N D;  5BS7 C;  1P3A C;  3W98 C;  4Z66 A;  5B24 A;  5GXQ C;  1ZLA B;  3VH5 T;  3B0C W;  3REK A;  5CP6 D;  4J8V B;  3X1S A;  3AV2 A;  5B33 C;  5AV6 D;  3WA9 B;  1B67 A;  5B24 D;  4Z66 D;  4KUD B;  1P3G B;  1P3P D;  4Z2M H;  2FJ7 C;  5B32 A;  4XZQ C;  4UPK A;  3WAA C;  3REK D; 
#chains in the Genus database with same CATH homology
 4YM6 B;  3MNN D;  3KUY A;  3X1S D;  4NFT A;  3AV2 D;  3TU4 A;  4KUD A;  1H3O A;  3X1T A;  5CPK D;  3MVD B;  3LZ0 B;  1P34 B;  3AZK B;  5CP6 C;  1M18 B;  3LJA B;  2F8N K;  5B32 D;  1TZY B;  3REL C;  4X23 A;  4G91 B;  3KUY D;  3AV1 A;  4LD9 B;  3C1C B;  2BYM A;  4H9R B;  4H9O A;  3TU4 D;  2F8N H;  1P34 A;  3MVD A;  3AZK A;  3X1T D;  2YFV B;  1TZY A;  5AVC C;  3MNN C;  3UTA B;  3MGS B;  3UTB B;  3W96 B;  4X23 D;  1Z2C B;  3MGQ B;  3C1C A;  1U35 D;  3AV1 D;  1BH8 B;  1KX4 D;  5AV5 B;  5CPK C;  5E5A D;  3KXB B;  1P3B C;  3AZL C;  5BNV B;  1M1A C;  5JRG B;  4J8V A;  5B2J D;  3UTB A;  3AZF C;  2CWE A;  3AL0 C;  4EO5 C;  1HTA A;  3MGQ A;  5AVB D;  3AZE C;  1BH8 A;  4CAY A;  3A1I A;  3REJ D;  3MGR B;  3WTP B;  5CHL B;  3V9R B;  5BNV A;  5B31 C;  3AZJ B;  5JRG A;  3LZ1 B;  3AZG A;  5CPJ B;  3MGP C;  1S32 C;  4J8U C;  4HGA C;  4KGC D;  1HQ3 D;  2Y2Q A;  1P3K C;  2ARO A;  1KX4 C;  4H9S C;  2PYO A;  5E5A C;  3LEL D;  4JJN D;  3MGR A;  1P3F C;  1P3M D;  5B2J C;  2NZD B;  3B0D C;  2ZY4 A;  3WKJ A;  3AZG D;  2F2A C;  2CV5 B;  4J8W C;  3KWQ D;  2ARO D;  2PYO D;  3AZM C;  4J8X B;  3AZI B;  4XUJ D;  2CV5 A;  5B1L C;  3WKJ D;  3AZH A;  3A6N B;  5BNX B;  4CSR B;  4ZUX D;  1AOI A;  3AFA B;  4JJN C;  4G92 C;  1P3L A;  1N1J B;  3X1U C;  5B0Y B;  1P3M C;  1P3O C;  1P3A B;  4J8X A;  2BYK B;  3AZI A;  1M19 C;  3W98 B;  5GSU D;  3O62 A;  5GT0 C;  5GXQ B;  3VH6 T;  1KX5 C;  3H0R C;  3A6N A;  3AZH D;  2HIO C;  4CSR A;  3REI A;  4Z5T A;  3VH5 W;  4YS3 C;  2Y2J A;  5B0Z A;  5B1M B;  1AOI D;  5B0Y A;  1P3L D;  5B2I D;  5B33 B;  2RVQ D;  4XUJ C;  2BG1 A;  3O62 D;  4WV4 B;  5B40 A;  4ZUX C;  5GT3 A;  5AY8 A;  3X1V A;  2FJ7 B;  1ULY A;  4WU8 C;  5B1M A;  3REI D;  4Z5T D;  4QLC D;  5B0Z D;  3WAA B;  1R4V A;  5GSU C;  5B31 G;  4M6B A;  5DNN C;  1TAF B;  5CPI D;  1WWS A;  1KX3 D;  2JSS A;  2JE5 A;  3W97 A;  1B6W A;  3F6T A;  5B40 D;  5GT3 D;  5AY8 D;  3AN2 C;  3W99 C;  4E45 A;  5AV9 A;  5F99 C;  4R8P B;  3X1V D;  1ID3 C;  3REL B;  5B2I C;  2ZY5 A;  4DQY B;  1P3I A;  1EQZ B;  1TAF A;  3EPL A;  1ZLA A;  2Y2N A;  3W97 D;  2IO5 C;  4QLC C;  4R8P A;  2G5H C;  3REL A;  3UT9 B;  5AVC B;  5AV9 D;  3EPJ A;  3B6G C;  1EQZ A;  5CPI C;  1P3I D;  3WA9 A;  1P3B B;  3KSY A;  3AZL B;  1P3G A;  2FFF B;  1M1A B;  1ZLA D;  3UT9 A;  4WZS B;  4R8P D;  2YFW B;  3AZF B;  4EO5 B;  2J8P A;  4YM6 A;  4J8V D;  3R45 B;  5AV6 C;  3AZE B;  4WU9 B;  2W8S A;  4Z66 C;  5B24 C;  5DNM B;  3WA9 D;  5B31 B;  4KUD D;  1P3P C;  1P3G D;  3B0B A;  3LZ0 A;  3MGP B;  1S32 B;  4J8U B;  4HGA B;  3B6F B;  1M18 A;  3LJA A;  1BH9 B;  2XD5 A;  3REK C;  3C1B B;  3H0L C;  3X1S C;  2Y2O A;  4H9N B;  4YM6 D;  4DRA A;  3AV2 C;  4WU9 A;  4LD9 A;  5DNM A;  4H9R A;  1P3F B;  3NQU B;  3B0D B;  3B6F A;  4J8U A;  2NQB B;  2YFV A;  3MVD D;  5FUG B;  5B32 C;  3LZ0 D;  1P34 D;  3AZK D;  3C1B A;  5AV8 B;  3LJA D;  3UTA A;  1M18 D;  3MGS A;  1TZY D;  1F66 B;  3W96 A;  4H9N A;  4H9S A;  3KUY C;  4Z2M G;  4WU9 D;  3TU4 C;  4LD9 D;  3C1C D;  3AZM B;  5AV5 A;  4KUD C;  3NQU A;  3KXB A;  3X1T C;  3EPH A;  2NQB A;  5FUG A;  3B6F D;  5B1L B;  5AV8 A;  1F1E A;  4X23 C;  1F66 A;  3UTA D;  3MGS D;  3UTB D;  1U35 C;  4G92 B;  3W96 D;  3AV1 C;  2Y2M A;  3X1U B;  3MGQ D;  3AZM A;  1P3O B;  1M19 B;  5AV5 D;  3WTP A;  3V9R A;  5GT0 B;  3AZJ A;  4UUZ B;  3KXB D;  1JFI B;  1KX5 B;  3LZ1 A;  5CPJ A;  5JRG D;  1PZR A;  2HIO B;  3VH6 W;  3AZN B;  4G91 C;  4YS3 B;  1Q9C A;  5AVB C;  2F8N G;  2HUE C;  4ZBJ C;  3X1U A;  3REH B;  3C1C C;  3KFU G;  2UWX A;  3REJ C;  2LY8 A;  3MGR D;  3WTP D;  2NZD A;  3AZJ D;  4KGC C;  3AYW B;  5CPJ D;  3LZ1 D;  1HQ3 C;  2DQN C;  3AZN A;  4WU8 B;  2VQR A;  5BO0 B;  2ZM5 A;  3REH A;  2DF4 C;  2Y2G A;  3LEL C;  2ZY3 A;  5DNN B;  5JRG C;  3AZG C;  3AYW A;  2NZD D;  3KWQ C;  3AN2 B;  1ID3 B;  5F99 B;  2CV5 D;  3W99 B;  5BNX A;  3VH5 A;  2ARO C;  3AFA A;  3REH D;  4NE5 A;  3IP4 C;  1N1J A;  2PYO C;  3MGR C;  5BS7 A;  1P3A A;  2BYK A;  3W98 A;  4J8X D;  3AZI D;  5GXQ A;  2Y2I A;  5B32 G;  3WKJ C;  2IO5 B;  3A6N D;  4XZQ B;  1WWI A;  3B6G B;  3AFA D;  2F8N B;  5B33 A;  5B0Y D;  1P3A D;  3W98 D;  3NQJ B;  4DRB A;  5GXQ D;  2CV5 C;  3AZH C;  3A1K A;  4WNN B;  2G5I C;  2ZY2 A;  4XZQ A;  1AOI C;  5CP6 B;  2FJ7 A;  3WAA A;  5B1M D;  1P3L C;  2F8N A;  5AV6 B;  2Y2P A;  2RVQ C;  4J8X C;  3AZI C;  5JA4 B;  5B33 D;  4Z66 B;  5B24 B;  3O62 C;  3NQJ A;  1P3P B;  3A6N C;  3REI C;  4Z5T C;  5CP6 A;  3FDD A;  5B0Z C;  2FJ7 D;  3REK B;  4XZQ D;  3MNN B;  3X1S B;  3WAA D;  1BFM A;  1KU5 A;  3AV2 B;  5JA4 A;  1KX3 C;  4AWL C;  5CPK B;  1P3P A;  5B40 C;  5C3I C;  5GT3 C;  5AY8 C;  3X1V C;  5B32 B;  5B1M C;  5AVC A;  3MNN A;  5BT1 D;  3REL D;  3KUY B;  3TU4 B;  1EQZ D;  3WTP E;  1H3O B;  5CPK A;  2Y2H A;  1P3B A;  3W97 C;  3AZL A;  3X1T B;  1W2E A;  1M1A A;  5AV9 C;  2YFW A;  4X23 B;  3AZF A;  3UT9 D;  5AVC D;  1U35 B;  1P3I C;  3AV1 B;  1P3K B;  3R45 A;  1KX4 B;  3AZE A;  2BYM B;  5E5A B;  4H9O B;  3B0C T;  5B31 A;  1ZLA C;  1P3B D;  5B2J B;  2Y2L A;  3AZL D;  3MGP A;  1S32 A;  4R8P C;  1M1A D;  3EG5 B;  5BT1 C;  1BH9 A;  4J8W B;  5AVB B;  3AZF D;  1U35 A;  4J8V C;  2HUE B;  4ZBJ B;  1P3K A;  1KX4 A;  1EQZ C;  5E5A A;  3REJ B;  3AZE D;  3WA9 C;  1P3F A;  5DNM D;  5B2J A;  1P3G C;  5B31 D;  4KGC B;  3UT9 C;  1HQ3 B;  3MGP D;  1S32 D;  4J8W A;  4J8U D;  5AVB A;  2L5A A;  4NE3 A;  3C1B D;  4YM6 C;  3LEL B;  1P3K D;  4JJN B;  3REJ A;  4CAY B;  1P3M B;  4H9Q B;  1P3F D;  4KGC A;  3AZG B;  1P34 C;  3MVD C;  3LZ0 C;  2XD1 A;  1HQ3 A;  3KWQ B;  3AZK C;  5B1L A;  1M18 C;  3LJA C;  2NQB D;  3VH6 A;  1TZY C;  4J8W D;  4E44 A;  5AV8 D;  5G49 B;  2ARO B;  3LEL A;  4JJN A;  1F66 D;  4WU9 C;  2PYO B;  4LD9 C;  4H9P B;  5DNM C;  1P3M A;  1P3O A;  4H9Q A;  1M19 A;  3AZM D;  4XUJ B;  5GT0 A;  3B6F C;  4UUZ A;  1JFI A;  3KWQ A;  1KX5 A;  3WKJ B;  4ZUX B;  5B1L D;  3C1B C;  2HIO A;  2Y2K A;  2RIQ A;  5G49 A;  3MGS C;  3UTA C;  3UTB C;  4YS3 A;  3W96 C;  3MGQ C;  4H9P A;  3X1U D;  5AV5 C;  5GSU B;  4XUJ A;  1P3O D;  3KXB C;  1M19 D;  2NQB C;  5GT0 D;  1KX5 D;  3AZH B;  4ZUX A;  5AV8 C;  1AOI B;  4WU8 A;  3P5J B;  2HIO D;  3EPK A;  3AZN D;  1F66 C;  5BO0 A;  4YS3 D;  1P3L B;  5B2I B;  4NE6 A;  5GSU A;  3O62 B;  5DNN A;  3WTP C;  3AZJ C;  3LZ1 C;  5CPJ C;  4WJ3 C;  3AYW D;  3REI B;  4Z5T B;  3AN2 A;  5F99 A;  1ID3 A;  5B0Z B;  4QLC B;  3W99 A;  4WU8 D;  5B2I A;  5KDM B;  5CPI B;  1KX3 B;  4AWL B;  5DNN D;  2NZD C;  5B40 B;  5C3I B;  4KHA B;  5GT3 B;  5AY8 B;  3X1V B;  3AZN C;  4QLC A;  3AN2 D;  1T3U A;  1ID3 D;  3W99 D;  5F99 D;  3REH C;  3B6G A;  1A7W A;  5KDM A;  5CPI A;  1KX3 A;  3W97 B;  4KHA A;  3AYW C;  3H0M C;  2JCH A;  5AV9 B;  4WNN A;  3AFA C;  1P3I B;  3B6G D;  5B0Y C;  5AV6 A;  2F8N D;  5BS7 C;  1P3A C;  3W98 C;  4Z66 A;  5B24 A;  5GXQ C;  1ZLA B;  3VH5 T;  3B0C W;  3REK A;  5CP6 D;  4J8V B;  3X1S A;  3AV2 A;  5B33 C;  5AV6 D;  3WA9 B;  1B67 A;  5B24 D;  4Z66 D;  4KUD B;  1P3G B;  1P3P D;  4Z2M H;  2FJ7 C;  5B32 A;  4XZQ C;  4UPK A;  3WAA C;  3REK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...