1ZLAC

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNWERDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/virus/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaC00
3AFAB 4KUDC 3B6GC 3MNNC 5B0YA 5AV6B 4WZSB 3W96C 3LJAC 1P3LB 5GXQC 3KUYB 4ZBJC 1S32B 2PYOB 1P3GA 3X1UD 4WU8D 4H9PB 1P3FA 5GSUA 1ZLAB 5AY8B 5CPIA 3TU4D 1M19C 1U35A 3WKJD 3MGRC 5F99C 3AZMC 5B1LA 3AZKA 4NE5A 3REHB 3V9RA 2HIOD 4NE3A 1EQZD 5JA4B 5B32A 4QLCB 5FUGA 3AZLA 1HQ3B 4KGCA 3AZJA 4JJNC 4J8UD 1ZLAC 2BYMB 3KSYA 3AZFB 4J8VA 3AZHD 2LY8A 1ID3A 2YFVB 4EO5C 5AV9B 4WU8B 1P3ID 3LZ1D 3AYWC 5GT3B 3LELC 4H9OA 3AV1A 2AROB 3AN2A 1A7WA 5GT0A 2BYKA 3MGQB 2FJ7B 4KUDA 3WA9B 3VH5W 3B6GA 4Z5TC 3B0CT 3WTPD 3R45B 4Z2MH 5AV9C 3AZNB 2IO5C 4WU9A 3B6FC 5DNMC 5B2ID 5E5AA 2NZDA 5B31D 5BNXA 3NQJB 3LZ0D 3MGSA 3X1SD 1P3BD 4ZUXC 3VH6A 3MGQC 2HUEC 4R8PA 3REJA 3UT9C 5F99A 1KU5A 1F66C 3X1TC 4UUZA 5AV8B 3W98A 3X1VD 1KX5C 5BS7A 1P34D 2CV5C 1BH8B 3A6NC 5CPJC 1B6WA 3MVDA 4JJNA 3W99C 2F8NH 3AZGC 4J8WD 3RELA 1M1AD 4NE6A 3KXBA 3MGPA 4AWLB 3X1SB 4WNNA 5CP6A 5B0YC 5AVBA 3AZKB 4WV4B 3WAAA 3KWQD 3C1CB 3AV2A 5G49A 5FUGB 4LD9B 5B2JB 4X23D 3AZED 1P3GC 3REID 4XUJB 1P3FC 3O62A 5GSUC 4Z5TA 1P3PB 5CPIC 2YFWA 5B33A 5AV5B 3W97D 1ID3B 5C3IB 1P3KA 1U35C 1KX4B 5B24D 3REKC 1P3OD 5DNND 5CPKD 1AOIB 4H9OB 3AV1B 5B1LC 3AFAD 5B40A 5BT1D 5B32C 1KX3A 1P3MA 3UT9A 3AZLC 4KUDB 4XZQC 3B6GB 4KGCC 3MNNB 3X1TA 1P3LD 3AZJC 3B0CW 3KUYD 5AVCA 1S32D 2PYOD 3LJAB 3W96B 4J8VC 4H9NB 5C3IC 5GXQB 1ZLAD 3X1UA 4ZBJB 4WU9B 4CAYA 3W99A 3AN2C 3TU4A 1F1EA 2F8NA 3WKJA 5GT0C 3LELD 1M19B 4DRAA 4H9SC 1P3AA 3MGRB 3AZIC 3REHD 5F99B 3AZMB 4QLCD 5KDMA 1HQ3D 3W98B 5B1MA 4J8UA 4WU9C 3AZFD 5E5AC 4JJNB 5AV9D 2NZDC 1M18C 2RVQD 4E45A 1BH9A 3MGSC 4J8XC 5GT3D 4EO5B 2AROD 3REKA 4R8PC 3REJC 3C1BC 3AYWB 2NQBA 3LELB 4KHAB 4H9QA 3MGQD 2FJ7D 5BO0A 3VH6W 3WA9D 4YM6A 3W98C 2F8NK 5BS7C 5G49B 4XZQA 4HGAC 1KX5D 3MVDC 3UTAC 3AZND 4Z5TB 3RELC 2IO5B 3KXBC 5B2IA 3MGPC 3B6FB 5DNMB 5B31A 1TZYA 5CP6C 3LZ0A 1BFMA 5AVBC 4CSRA 4ZUXB 3WAAC 1TAFA 5B0YD 3AV2C 1KX3B 2HUEB 4H9SA 4YS3C 3UT9B 3AZIA 1P3MB 5AV8D 1F66B 3X1TB 3X1VA 3O62C 1WWSA 5AVCB 1JFIA 4Z2MG 1KX5B 5B33C 1P34A 5JRGC 1P3KC 1Q9CA 3B0DC 5B0ZC 2CV5B 3A6NB 5CPJB 4CAYB 5BNVA 3W99B 1N1JB 3NQUA 4G92C 1M18A 3AZGB 1M1AA 4Z66A 2F8NB 4J8XA 5B40C 1B67A 3UTBC 1KX3C 1P3MC 4G91C 5B1LD 3AZKD 1P3AB 3C1BA 5B0YB 3C1CD 3KWQA 5AVCC 4LD9D 5B1MB 5B2JD 2CWEA 4XUJD 4X23A 3X1UC 1P3GB 1P3PD 5AV5D 4J8VD 3UTAA 1ID3D 1P3FB 5GSUB 1H3OA 3W97A 3TU4C 1KX4D 2F8NG 5CPIB 1AOID 1R4VA 3WKJC 5B24A 1P3OA 5DNNA 3AV1D 5CPKA 1U35B 3REKB 1P3AC 4NFTA 5GT0D 3AFAA 2HIOC 5B1LB 4KUDD 1EQZC 3V9RB 3B6GD 5B1MC 3VH6T 5AV6A 3MNND 5B32B 4YS3A 3AZLB 1P3LA 4XZQB 4KGCB 3W96D 4J8UC 3LJAD 3AZJB 3KUYA 1S32A 2PYOA 5GXQD 3AZHC 4WU9D 4H9PA 1P3IC 4J8VB 5JRGA 2NZDD 5AY8A 3LZ1C 5B0ZA 2NQBC 1M19D 3AN2B 2JSSA 4CSRB 3MGRD 5CHLB 3REJD 4YM6C 5F99D 3UTBA 5GT0B 5B32G 4M6BA 2BYKB 3AZMD 3AZIB 5JA4A 3W98D 4QLCA 1JFIB 4JJND 2BYMA 5B2IC 4WU8A 5B31C 5E5AB 2NZDB 1TZYC 3LZ0C 1M18B 5BNXB 3KXBD 1P3BC 3MGSB 4J8XB 3AYWD 2AROA 1HTAA 4R8PB 3REJB 3C1BB 2FJ7A 3AV2D 3WA9A 2HIOA 4UUZB 3X1VC 1EQZA 1P34C 3R45A 4Z5TD 4HGAB 3AZNA 3MVDB 3UTAB 3AZHA 1P3KD 4J8WC 1M1AC 1P3IA 3B6FD 5DNMD 4Z66C 3RELB 3NQJA 3LZ1A 3KXBB 3MGPB 5B40D 4ZUXD 4WNNB 5CP6B 1KX3D 5AVBB 3UT9D 1P3MD 3KWQC 1F66D 3WAAB 3X1TD 3AV2B 5AV8A 4YS3B 4X23C 3AZEC 5AVCD 3REIC 3WTPA 4E44A 1BH8A 3O62B 1WWIA 3W97C 3B0BA 2CV5D 3A6ND 2YFWB 5B33B 5CPJD 5JRGB 3W99D 5B24C 1P3KB 5DNNC 3B0DB 5CPKC 1P3OC 5B0ZB 3AZGD 2F8ND 3AFAC 3X1SA 4G92B 1P3BA 1P3AD 5BT1C 5B40B 3UTBB 5AV6C 4DRBA 4G91B 1P3LC 3C1CA 5B1MD 3KUYC 4LD9A 1S32C 5B2JA 2PYOC 4XUJA 1P3GD 5AY8C 1P3FD 1P3PA 5GSUD 5AV5A 3X1UB 5CPID 1KX4A 1AOIA 4J8WA 1U35D 2L5AA 3TU4B 3REKD 4H9RA 1ULYA 2NQBD 3WKJB 3REHC 4YM6D 4QLCC 1HQ3C 2HIOB 5B32D 3AZLD 5KDMB 3MNNA 4XZQD 1EQZB 4KGCD 3AZJD 3W96A 3LJAA 3AZEA 3AZFC 3REIA 4H9NA 4J8UB 4WU8C 5GXQA 2RVQC 3AZHB 1BH9B 5GT3C 1P3IB 3WTPE 2AROC 1TZYD 3LZ1B 3AN2D 1M19A 2FJ7C 2NQBB 3MGRA 4H9QB 3WA9C 5BO0B 3AZID 4YM6B 3AZMA 3AZNC 3WTPB 1ZLAA 5E5AD 1M18D 5B2IB 3MGSD 4Z66D 5B31B 4J8XD 1TZYB 3LZ0B 1P3BB 3AYWA 4R8PD 3LELA 4KHAA 3C1BD 3VH5A 1TAFB 3REHA 5AV8C 1HQ3A 3WTPC 3X1VB 1P34B 3MVDD 3UTAD 3AZFA 5B31G 2YFVA 5AV9A 3RELD 5BNVB 3NQUB 5DNMA 4AWLC 3X1SC 4J8WB 3B6FA 5GT3A 1M1AB 3MGPD 4Z66B 4H9RB 5CP6D 3AZKC 4ZUXA 5AVBD 3C1CC 3MGQA 3WAAD 5AV6D 4LD9C 4YS3D 1F66A 5B2JC 3KWQB 3VH5T 4XUJC 4X23B 3AZEB 3O62D 1P3PC 5AV5C 1KX5A 3REIB 1ID3C 5B33D 5JRGD 1KX4C 2CV5A 5AY8D 3A6NA 1AOIC 1H3OB 5CPJA 3W97B 5B0ZD 1N1JA 3AV1C 3AZGA 5B24B 1P3OB 5DNNB 5CPKB 3UTBD
chains in the Genus database with same CATH superfamily
3AFAB 4KUDC 3B6GC 3EPLA 3MNNC 5B0YA 5AV6B 4WZSB 3W96C 3LJAC 1P3LB 5GXQC 3KUYB 4ZBJC 1S32B 3A1IA 2PYOB 1P3GA 3A1KA 3X1UD 4WU8D 4H9PB 1P3FA 5GSUA 1ZLAB 3H0RC 5AY8B 5CPIA 3TU4D 1M19C 2Y2PA 1U35A 3WKJD 3MGRC 5F99C 3F6TA 3AZMC 5B1LA 3AZKA 2Y2JA 4NE5A 3REHB 3V9RA 2HIOD 4NE3A 1EQZD 5JA4B 5B32A 4QLCB 5FUGA 3AZLA 1HQ3B 4KGCA 3AZJA 2XD5A 4JJNC 4J8UD 1ZLAC 2BYMB 3KSYA 3AZFB 4J8VA 3AZHD 2LY8A 1ID3A 2YFVB 4EO5C 5AV9B 4WU8B 1P3ID 1PZRA 3LZ1D 3AYWC 5GT3B 3LELC 4H9OA 3AV1A 2AROB 3AN2A 1A7WA 5GT0A 2DF4C 2BYKA 3MGQB 2FJ7B 4KUDA 3WA9B 3VH5W 3B6GA 4Z5TC 3B0CT 3WTPD 3R45B 4Z2MH 5AV9C 3AZNB 2IO5C 2Y2QA 4WU9A 3B6FC 5DNMC 5B2ID 5E5AA 2NZDA 5B31D 5BNXA 3NQJB 3LZ0D 3MGSA 3X1SD 1P3BD 4ZUXC 3VH6A 3MGQC 2HUEC 4R8PA 3REJA 3UT9C 3FDDA 5F99A 1KU5A 1F66C 3X1TC 4UUZA 5AV8B 3W98A 3X1VD 1KX5C 5BS7A 1P34D 2CV5C 1BH8B 2XD1A 3A6NC 5CPJC 1B6WA 3MVDA 4JJNA 3W99C 2F8NH 3AZGC 4J8WD 3RELA 1M1AD 4NE6A 3KXBA 3MGPA 4AWLB 3X1SB 4WNNA 5CP6A 5B0YC 5AVBA 3AZKB 4WV4B 3WAAA 3KWQD 3C1CB 3AV2A 5G49A 5FUGB 4LD9B 5B2JB 4X23D 3AZED 1P3GC 3REID 4XUJB 1P3FC 3O62A 5GSUC 4Z5TA 1P3PB 5CPIC 2YFWA 5B33A 5AV5B 3W97D 1ID3B 5C3IB 1P3KA 1U35C 1KX4B 5B24D 3REKC 1P3OD 2Y2GA 5DNND 5CPKD 1AOIB 2ZY5A 4H9OB 3AV1B 5B1LC 3AFAD 2DQNC 5B40A 5BT1D 5B32C 3H0MC 1P3MA 3UT9A 1KX3A 3AZLC 4KUDB 2BG1A 4XZQC 3B6GB 4KGCC 2RIQA 3MNNB 3X1TA 1P3LD 3AZJC 3B0CW 3KUYD 5AVCA 4UPKA 1S32D 2PYOD 3LJAB 3W96B 4J8VC 4H9NB 5C3IC 5GXQB 1ZLAD 3X1UA 4ZBJB 4WU9B 4CAYA 3W99A 3AN2C 2JCHA 3TU4A 1F1EA 2F8NA 3WKJA 5GT0C 3LELD 1M19B 4DRAA 4H9SC 1P3AA 3MGRB 3AZIC 3REHD 3EG5B 5F99B 3AZMB 4QLCD 5KDMA 3EPHA 1HQ3D 3W98B 5B1MA 2Y2KA 4J8UA 4WU9C 3AZFD 5E5AC 4JJNB 5AV9D 2NZDC 1M18C 2RVQD 4E45A 1BH9A 3MGSC 4J8XC 5GT3D 4EO5B 2AROD 3REKA 4R8PC 3REJC 3C1BC 3AYWB 2NQBA 3LELB 4KHAB 4H9QA 3MGQD 2FJ7D 5BO0A 3VH6W 3WA9D 4YM6A 3W98C 2F8NK 5BS7C 5G49B 4XZQA 4HGAC 1KX5D 3MVDC 3UTAC 3AZND 4Z5TB 3RELC 2Y2IA 2IO5B 3KXBC 5B2IA 3MGPC 3B6FB 5DNMB 5B31A 1TZYA 5CP6C 3LZ0A 1BFMA 5AVBC 4CSRA 4ZUXB 3WAAC 1TAFA 5B0YD 3AV2C 1KX3B 2HUEB 4H9SA 4YS3C 3UT9B 3AZIA 1P3MB 5AV8D 2F2AC 1F66B 3X1TB 3X1VA 3O62C 1WWSA 5AVCB 1JFIA 4Z2MG 1KX5B 5B33C 1P34A 5JRGC 1T3UA 1P3KC 1Q9CA 3B0DC 5B0ZC 2CV5B 3A6NB 1W2EA 5CPJB 4CAYB 5BNVA 3W99B 1N1JB 3NQUA 4G92C 1M18A 3AZGB 1M1AA 4Z66A 2F8NB 4J8XA 5B40C 1B67A 3UTBC 2ZY4A 1P3MC 4G91C 5B1LD 3AZKD 1P3AB 3C1BA 1KX3C 2ZY2A 5B0YB 3C1CD 3KWQA 5AVCC 4LD9D 5B1MB 5B2JD 2CWEA 4XUJD 1Z2CB 4X23A 3X1UC 2ZM5A 1P3GB 5AV5D 4J8VD 1P3PD 3UTAA 1ID3D 1P3FB 5GSUB 1H3OA 3W97A 3TU4C 1KX4D 2F8NG 5CPIB 1AOID 1R4VA 3WKJC 5B24A 1P3OA 5DNNA 3AV1D 5CPKA 1U35B 3REKB 1P3AC 2G5IC 4NFTA 5GT0D 3AFAA 2Y2HA 2HIOC 5B1LB 4KUDD 1EQZC 3V9RB 3B6GD 5B1MC 3VH6T 5AV6A 3MNND 5B32B 4YS3A 3AZLB 1P3LA 4XZQB 4KGCB 3W96D 4J8UC 3LJAD 3AZJB 3KUYA 1S32A 2PYOA 5GXQD 3AZHC 2Y2NA 4H9PA 4WU9D 4J8VB 1P3IC 5JRGA 2NZDD 2W8SA 5AY8A 3LZ1C 5B0ZA 2NQBC 1M19D 3AN2B 2JSSA 4CSRB 3MGRD 5CHLB 3REJD 4YM6C 5F99D 3UTBA 5GT0B 5B32G 4M6BA 2BYKB 3AZMD 3KFUG 3AZIB 5JA4A 3W98D 4QLCA 1JFIB 4JJND 2BYMA 5B2IC 4WU8A 5B31C 2FFFB 5E5AB 2NZDB 1TZYC 3LZ0C 1M18B 5BNXB 3KXBD 1P3BC 3MGSB 4J8XB 3AYWD 2AROA 1HTAA 4R8PB 3REJB 3C1BB 2FJ7A 3AV2D 3WA9A 2HIOA 4UUZB 3X1VC 1EQZA 1P34C 3R45A 4Z5TD 4HGAB 3AZNA 3MVDB 3UTAB 3AZHA 1P3KD 4J8WC 1M1AC 1P3IA 3B6FD 5DNMD 4Z66C 3RELB 3NQJA 3P5JB 3LZ1A 3KXBB 3MGPB 5B40D 4ZUXD 4WNNB 5CP6B 1KX3D 5AVBB 3UT9D 1P3MD 3KWQC 1F66D 3WAAB 3X1TD 3AV2B 5AV8A 4YS3B 4X23C 3AZEC 5AVCD 3REIC 3AL0C 4E44A 3WTPA 1BH8A 3O62B 4WJ3C 1WWIA 3W97C 3B0BA 2CV5D 3A6ND 2YFWB 5B33B 5CPJD 5JRGB 3W99D 5B24C 1P3KB 5DNNC 3B0DB 5CPKC 1P3OC 5B0ZB 3AZGD 2Y2OA 2F8ND 3AFAC 3X1SA 4G92B 1P3BA 1P3AD 5BT1C 5B40B 3UTBB 5AV6C 4DRBA 4G91B 1P3LC 3C1CA 5B1MD 3KUYC 3EPKA 4LD9A 1S32C 5B2JA 2PYOC 4XUJA 1P3GD 5AY8C 1P3FD 1P3PA 5GSUD 5AV5A 3X1UB 5CPID 2UWXA 1KX4A 1AOIA 4J8WA 1U35D 2L5AA 3TU4B 3REKD 4H9RA 1ULYA 2NQBD 3WKJB 3REHC 4YM6D 4QLCC 1HQ3C 2HIOB 2VQRA 5B32D 3AZLD 5KDMB 3MNNA 4XZQD 1EQZB 4KGCD 3AZJD 3W96A 3LJAA 3AZEA 3AZFC 3REIA 4H9NA 4J8UB 4WU8C 5GXQA 2RVQC 2G5HC 3AZHB 1BH9B 5GT3C 1P3IB 3WTPE 2AROC 1TZYD 3LZ1B 3AN2D 1M19A 2FJ7C 2NQBB 3MGRA 4H9QB 3WA9C 5BO0B 3AZID 4YM6B 3AZMA 3AZNC 3EPJA 3WTPB 1ZLAA 5E5AD 1M18D 5B2IB 3MGSD 4Z66D 5B31B 4J8XD 1TZYB 3LZ0B 1P3BB 3H0LC 3AYWA 2JE5A 4R8PD 3LELA 4KHAA 3C1BD 3VH5A 1TAFB 3REHA 5AV8C 1HQ3A 3WTPC 3X1VB 1P34B 3MVDD 3UTAD 3AZFA 5B31G 2YFVA 5AV9A 3RELD 5BNVB 3NQUB 5DNMA 4AWLC 3X1SC 4J8WB 3B6FA 5GT3A 1M1AB 3MGPD 4Z66B 3IP4C 4H9RB 2ZY3A 5CP6D 3AZKC 2Y2LA 4ZUXA 5AVBD 3C1CC 3MGQA 2J8PA 3WAAD 5AV6D 4LD9C 2Y2MA 4YS3D 5B2JC 1F66A 3KWQB 4DQYB 3VH5T 4XUJC 4X23B 3AZEB 3O62D 1P3PC 5AV5C 1KX5A 3REIB 1ID3C 5B33D 5JRGD 1KX4C 2CV5A 5AY8D 3A6NA 1AOIC 1H3OB 5CPJA 3W97B 5B0ZD 1N1JA 3AV1C 3AZGA 5B24B 1P3OB 5DNNB 5CPKB 3UTBD
chains in the Genus database with same CATH topology
3AFAB 4KUDC 3B6GC 3EPLA 3MNNC 5B0YA 5AV6B 4WZSB 3W96C 3LJAC 1P3LB 5GXQC 3KUYB 4ZBJC 1S32B 3A1IA 2PYOB 1P3GA 3A1KA 3X1UD 4WU8D 4H9PB 1P3FA 5GSUA 1ZLAB 3H0RC 5AY8B 5CPIA 3TU4D 1M19C 2Y2PA 1U35A 3WKJD 3MGRC 5F99C 3F6TA 3AZMC 5B1LA 3AZKA 2Y2JA 4NE5A 3REHB 3V9RA 2HIOD 4NE3A 1EQZD 5JA4B 5B32A 4QLCB 5FUGA 3AZLA 1HQ3B 4KGCA 3AZJA 2XD5A 4JJNC 4J8UD 1ZLAC 2BYMB 3KSYA 3AZFB 4J8VA 3AZHD 2LY8A 1ID3A 2YFVB 4EO5C 5AV9B 4WU8B 1P3ID 1PZRA 3LZ1D 3AYWC 5GT3B 3LELC 4H9OA 3AV1A 2AROB 3AN2A 1A7WA 5GT0A 2DF4C 2BYKA 3MGQB 2FJ7B 4KUDA 3WA9B 3VH5W 3B6GA 4Z5TC 3B0CT 3WTPD 3R45B 4Z2MH 5AV9C 3AZNB 2IO5C 2Y2QA 4WU9A 3B6FC 5DNMC 5B2ID 5E5AA 2NZDA 5B31D 5BNXA 3NQJB 3LZ0D 3MGSA 3X1SD 1P3BD 4ZUXC 3VH6A 3MGQC 2HUEC 4R8PA 3REJA 3UT9C 3FDDA 5F99A 1KU5A 1F66C 3X1TC 4UUZA 5AV8B 3W98A 3X1VD 1KX5C 5BS7A 1P34D 2CV5C 1BH8B 2XD1A 3A6NC 5CPJC 1B6WA 3MVDA 4JJNA 3W99C 2F8NH 3AZGC 4J8WD 3RELA 1M1AD 4NE6A 3KXBA 3MGPA 4AWLB 3X1SB 4WNNA 5CP6A 5B0YC 5AVBA 3AZKB 4WV4B 3WAAA 3KWQD 3C1CB 3AV2A 5G49A 5FUGB 4LD9B 5B2JB 4X23D 3AZED 1P3GC 3REID 4XUJB 1P3FC 3O62A 5GSUC 4Z5TA 1P3PB 5CPIC 2YFWA 5B33A 5AV5B 3W97D 1ID3B 5C3IB 1P3KA 1U35C 1KX4B 5B24D 3REKC 1P3OD 2Y2GA 5DNND 5CPKD 1AOIB 2ZY5A 4H9OB 3AV1B 5B1LC 3AFAD 2DQNC 5B40A 5BT1D 5B32C 3H0MC 1P3MA 3UT9A 1KX3A 3AZLC 4KUDB 2BG1A 4XZQC 3B6GB 4KGCC 2RIQA 3MNNB 3X1TA 1P3LD 3AZJC 3B0CW 3KUYD 5AVCA 4UPKA 1S32D 2PYOD 3LJAB 3W96B 4J8VC 4H9NB 5C3IC 5GXQB 1ZLAD 3X1UA 4ZBJB 4WU9B 4CAYA 3W99A 3AN2C 2JCHA 3TU4A 1F1EA 2F8NA 3WKJA 5GT0C 3LELD 1M19B 4DRAA 4H9SC 1P3AA 3MGRB 3AZIC 3REHD 3EG5B 5F99B 3AZMB 4QLCD 5KDMA 3EPHA 1HQ3D 3W98B 5B1MA 2Y2KA 4J8UA 4WU9C 3AZFD 5E5AC 4JJNB 5AV9D 2NZDC 1M18C 2RVQD 4E45A 1BH9A 3MGSC 4J8XC 5GT3D 4EO5B 2AROD 3REKA 4R8PC 3REJC 3C1BC 3AYWB 2NQBA 3LELB 4KHAB 4H9QA 3MGQD 2FJ7D 5BO0A 3VH6W 3WA9D 4YM6A 3W98C 2F8NK 5BS7C 5G49B 4XZQA 4HGAC 1KX5D 3MVDC 3UTAC 3AZND 4Z5TB 3RELC 2Y2IA 2IO5B 3KXBC 5B2IA 3MGPC 3B6FB 5DNMB 5B31A 1TZYA 5CP6C 3LZ0A 1BFMA 5AVBC 4CSRA 4ZUXB 3WAAC 1TAFA 5B0YD 3AV2C 1KX3B 2HUEB 4H9SA 4YS3C 3UT9B 3AZIA 1P3MB 5AV8D 2F2AC 1F66B 3X1TB 3X1VA 3O62C 1WWSA 5AVCB 1JFIA 4Z2MG 1KX5B 5B33C 1P34A 5JRGC 1T3UA 1P3KC 1Q9CA 3B0DC 5B0ZC 2CV5B 3A6NB 1W2EA 5CPJB 4CAYB 5BNVA 3W99B 1N1JB 3NQUA 4G92C 1M18A 3AZGB 1M1AA 4Z66A 2F8NB 4J8XA 5B40C 1B67A 3UTBC 2ZY4A 1P3MC 4G91C 5B1LD 3AZKD 1P3AB 3C1BA 1KX3C 2ZY2A 5B0YB 3C1CD 3KWQA 5AVCC 4LD9D 5B1MB 5B2JD 2CWEA 4XUJD 1Z2CB 4X23A 3X1UC 2ZM5A 1P3GB 5AV5D 4J8VD 1P3PD 3UTAA 1ID3D 1P3FB 5GSUB 1H3OA 3W97A 3TU4C 1KX4D 2F8NG 5CPIB 1AOID 1R4VA 3WKJC 5B24A 1P3OA 5DNNA 3AV1D 5CPKA 1U35B 3REKB 1P3AC 2G5IC 4NFTA 5GT0D 3AFAA 2Y2HA 2HIOC 5B1LB 4KUDD 1EQZC 3V9RB 3B6GD 5B1MC 3VH6T 5AV6A 3MNND 5B32B 4YS3A 3AZLB 1P3LA 4XZQB 4KGCB 3W96D 4J8UC 3LJAD 3AZJB 3KUYA 1S32A 2PYOA 5GXQD 3AZHC 2Y2NA 4H9PA 4WU9D 4J8VB 1P3IC 5JRGA 2NZDD 2W8SA 5AY8A 3LZ1C 5B0ZA 2NQBC 1M19D 3AN2B 2JSSA 4CSRB 3MGRD 5CHLB 3REJD 4YM6C 5F99D 3UTBA 5GT0B 5B32G 4M6BA 2BYKB 3AZMD 3KFUG 3AZIB 5JA4A 3W98D 4QLCA 1JFIB 4JJND 2BYMA 5B2IC 4WU8A 5B31C 2FFFB 5E5AB 2NZDB 1TZYC 3LZ0C 1M18B 5BNXB 3KXBD 1P3BC 3MGSB 4J8XB 3AYWD 2AROA 1HTAA 4R8PB 3REJB 3C1BB 2FJ7A 3AV2D 3WA9A 2HIOA 4UUZB 3X1VC 1EQZA 1P34C 3R45A 4Z5TD 4HGAB 3AZNA 3MVDB 3UTAB 3AZHA 1P3KD 4J8WC 1M1AC 1P3IA 3B6FD 5DNMD 4Z66C 3RELB 3NQJA 3P5JB 3LZ1A 3KXBB 3MGPB 5B40D 4ZUXD 4WNNB 5CP6B 1KX3D 5AVBB 3UT9D 1P3MD 3KWQC 1F66D 3WAAB 3X1TD 3AV2B 5AV8A 4YS3B 4X23C 3AZEC 5AVCD 3REIC 3AL0C 4E44A 3WTPA 1BH8A 3O62B 4WJ3C 1WWIA 3W97C 3B0BA 2CV5D 3A6ND 2YFWB 5B33B 5CPJD 5JRGB 3W99D 5B24C 1P3KB 5DNNC 3B0DB 5CPKC 1P3OC 5B0ZB 3AZGD 2Y2OA 2F8ND 3AFAC 3X1SA 4G92B 1P3BA 1P3AD 5BT1C 5B40B 3UTBB 5AV6C 4DRBA 4G91B 1P3LC 3C1CA 5B1MD 3KUYC 3EPKA 4LD9A 1S32C 5B2JA 2PYOC 4XUJA 1P3GD 5AY8C 1P3FD 1P3PA 5GSUD 5AV5A 3X1UB 5CPID 2UWXA 1KX4A 1AOIA 4J8WA 1U35D 2L5AA 3TU4B 3REKD 4H9RA 1ULYA 2NQBD 3WKJB 3REHC 4YM6D 4QLCC 1HQ3C 2HIOB 2VQRA 5B32D 3AZLD 5KDMB 3MNNA 4XZQD 1EQZB 4KGCD 3AZJD 3W96A 3LJAA 3AZEA 3AZFC 3REIA 4H9NA 4J8UB 4WU8C 5GXQA 2RVQC 2G5HC 3AZHB 1BH9B 5GT3C 1P3IB 3WTPE 2AROC 1TZYD 3LZ1B 3AN2D 1M19A 2FJ7C 2NQBB 3MGRA 4H9QB 3WA9C 5BO0B 3AZID 4YM6B 3AZMA 3AZNC 3EPJA 3WTPB 1ZLAA 5E5AD 1M18D 5B2IB 3MGSD 4Z66D 5B31B 4J8XD 1TZYB 3LZ0B 1P3BB 3H0LC 3AYWA 2JE5A 4R8PD 3LELA 4KHAA 3C1BD 3VH5A 1TAFB 3REHA 5AV8C 1HQ3A 3WTPC 3X1VB 1P34B 3MVDD 3UTAD 3AZFA 5B31G 2YFVA 5AV9A 3RELD 5BNVB 3NQUB 5DNMA 4AWLC 3X1SC 4J8WB 3B6FA 5GT3A 1M1AB 3MGPD 4Z66B 3IP4C 4H9RB 2ZY3A 5CP6D 3AZKC 2Y2LA 4ZUXA 5AVBD 3C1CC 3MGQA 2J8PA 3WAAD 5AV6D 4LD9C 2Y2MA 4YS3D 5B2JC 1F66A 3KWQB 4DQYB 3VH5T 4XUJC 4X23B 3AZEB 3O62D 1P3PC 5AV5C 1KX5A 3REIB 1ID3C 5B33D 5JRGD 1KX4C 2CV5A 5AY8D 3A6NA 1AOIC 1H3OB 5CPJA 3W97B 5B0ZD 1N1JA 3AV1C 3AZGA 5B24B 1P3OB 5DNNB 5CPKB 3UTBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFA B;  4KUD C;  3B6G C;  3MNN C;  5B0Y A;  5AV6 B;  4WZS B;  3W96 C;  3LJA C;  1P3L B;  5GXQ C;  3KUY B;  4ZBJ C;  1S32 B;  2PYO B;  1P3G A;  3X1U D;  4WU8 D;  4H9P B;  1P3F A;  5GSU A;  1ZLA B;  5AY8 B;  5CPI A;  3TU4 D;  1M19 C;  1U35 A;  3WKJ D;  3MGR C;  5F99 C;  3AZM C;  5B1L A;  3AZK A;  4NE5 A;  3REH B;  3V9R A;  2HIO D;  4NE3 A;  1EQZ D;  5JA4 B;  5B32 A;  4QLC B;  5FUG A;  3AZL A;  1HQ3 B;  4KGC A;  3AZJ A;  4JJN C;  4J8U D;  1ZLA C;  2BYM B;  3KSY A;  3AZF B;  4J8V A;  3AZH D;  2LY8 A;  1ID3 A;  2YFV B;  4EO5 C;  5AV9 B;  4WU8 B;  1P3I D;  3LZ1 D;  3AYW C;  5GT3 B;  3LEL C;  4H9O A;  3AV1 A;  2ARO B;  3AN2 A;  1A7W A;  5GT0 A;  2BYK A;  3MGQ B;  2FJ7 B;  4KUD A;  3WA9 B;  3VH5 W;  3B6G A;  4Z5T C;  3B0C T;  3WTP D;  3R45 B;  4Z2M H;  5AV9 C;  3AZN B;  2IO5 C;  4WU9 A;  3B6F C;  5DNM C;  5B2I D;  5E5A A;  2NZD A;  5B31 D;  5BNX A;  3NQJ B;  3LZ0 D;  3MGS A;  3X1S D;  1P3B D;  4ZUX C;  3VH6 A;  3MGQ C;  2HUE C;  4R8P A;  3REJ A;  3UT9 C;  5F99 A;  1KU5 A;  1F66 C;  3X1T C;  4UUZ A;  5AV8 B;  3W98 A;  3X1V D;  1KX5 C;  5BS7 A;  1P34 D;  2CV5 C;  1BH8 B;  3A6N C;  5CPJ C;  1B6W A;  3MVD A;  4JJN A;  3W99 C;  2F8N H;  3AZG C;  4J8W D;  3REL A;  1M1A D;  4NE6 A;  3KXB A;  3MGP A;  4AWL B;  3X1S B;  4WNN A;  5CP6 A;  5B0Y C;  5AVB A;  3AZK B;  4WV4 B;  3WAA A;  3KWQ D;  3C1C B;  3AV2 A;  5G49 A;  5FUG B;  4LD9 B;  5B2J B;  4X23 D;  3AZE D;  1P3G C;  3REI D;  4XUJ B;  1P3F C;  3O62 A;  5GSU C;  4Z5T A;  1P3P B;  5CPI C;  2YFW A;  5B33 A;  5AV5 B;  3W97 D;  1ID3 B;  5C3I B;  1P3K A;  1U35 C;  1KX4 B;  5B24 D;  3REK C;  1P3O D;  5DNN D;  5CPK D;  1AOI B;  4H9O B;  3AV1 B;  5B1L C;  3AFA D;  5B40 A;  5BT1 D;  5B32 C;  1KX3 A;  1P3M A;  3UT9 A;  3AZL C;  4KUD B;  4XZQ C;  3B6G B;  4KGC C;  3MNN B;  3X1T A;  1P3L D;  3AZJ C;  3B0C W;  3KUY D;  5AVC A;  1S32 D;  2PYO D;  3LJA B;  3W96 B;  4J8V C;  4H9N B;  5C3I C;  5GXQ B;  1ZLA D;  3X1U A;  4ZBJ B;  4WU9 B;  4CAY A;  3W99 A;  3AN2 C;  3TU4 A;  1F1E A;  2F8N A;  3WKJ A;  5GT0 C;  3LEL D;  1M19 B;  4DRA A;  4H9S C;  1P3A A;  3MGR B;  3AZI C;  3REH D;  5F99 B;  3AZM B;  4QLC D;  5KDM A;  1HQ3 D;  3W98 B;  5B1M A;  4J8U A;  4WU9 C;  3AZF D;  5E5A C;  4JJN B;  5AV9 D;  2NZD C;  1M18 C;  2RVQ D;  4E45 A;  1BH9 A;  3MGS C;  4J8X C;  5GT3 D;  4EO5 B;  2ARO D;  3REK A;  4R8P C;  3REJ C;  3C1B C;  3AYW B;  2NQB A;  3LEL B;  4KHA B;  4H9Q A;  3MGQ D;  2FJ7 D;  5BO0 A;  3VH6 W;  3WA9 D;  4YM6 A;  3W98 C;  2F8N K;  5BS7 C;  5G49 B;  4XZQ A;  4HGA C;  1KX5 D;  3MVD C;  3UTA C;  3AZN D;  4Z5T B;  3REL C;  2IO5 B;  3KXB C;  5B2I A;  3MGP C;  3B6F B;  5DNM B;  5B31 A;  1TZY A;  5CP6 C;  3LZ0 A;  1BFM A;  5AVB C;  4CSR A;  4ZUX B;  3WAA C;  1TAF A;  5B0Y D;  3AV2 C;  1KX3 B;  2HUE B;  4H9S A;  4YS3 C;  3UT9 B;  3AZI A;  1P3M B;  5AV8 D;  1F66 B;  3X1T B;  3X1V A;  3O62 C;  1WWS A;  5AVC B;  1JFI A;  4Z2M G;  1KX5 B;  5B33 C;  1P34 A;  5JRG C;  1P3K C;  1Q9C A;  3B0D C;  5B0Z C;  2CV5 B;  3A6N B;  5CPJ B;  4CAY B;  5BNV A;  3W99 B;  1N1J B;  3NQU A;  4G92 C;  1M18 A;  3AZG B;  1M1A A;  4Z66 A;  2F8N B;  4J8X A;  5B40 C;  1B67 A;  3UTB C;  1KX3 C;  1P3M C;  4G91 C;  5B1L D;  3AZK D;  1P3A B;  3C1B A;  5B0Y B;  3C1C D;  3KWQ A;  5AVC C;  4LD9 D;  5B1M B;  5B2J D;  2CWE A;  4XUJ D;  4X23 A;  3X1U C;  1P3G B;  1P3P D;  5AV5 D;  4J8V D;  3UTA A;  1ID3 D;  1P3F B;  5GSU B;  1H3O A;  3W97 A;  3TU4 C;  1KX4 D;  2F8N G;  5CPI B;  1AOI D;  1R4V A;  3WKJ C;  5B24 A;  1P3O A;  5DNN A;  3AV1 D;  5CPK A;  1U35 B;  3REK B;  1P3A C;  4NFT A;  5GT0 D;  3AFA A;  2HIO C;  5B1L B;  4KUD D;  1EQZ C;  3V9R B;  3B6G D;  5B1M C;  3VH6 T;  5AV6 A;  3MNN D;  5B32 B;  4YS3 A;  3AZL B;  1P3L A;  4XZQ B;  4KGC B;  3W96 D;  4J8U C;  3LJA D;  3AZJ B;  3KUY A;  1S32 A;  2PYO A;  5GXQ D;  3AZH C;  4WU9 D;  4H9P A;  1P3I C;  4J8V B;  5JRG A;  2NZD D;  5AY8 A;  3LZ1 C;  5B0Z A;  2NQB C;  1M19 D;  3AN2 B;  2JSS A;  4CSR B;  3MGR D;  5CHL B;  3REJ D;  4YM6 C;  5F99 D;  3UTB A;  5GT0 B;  5B32 G;  4M6B A;  2BYK B;  3AZM D;  3AZI B;  5JA4 A;  3W98 D;  4QLC A;  1JFI B;  4JJN D;  2BYM A;  5B2I C;  4WU8 A;  5B31 C;  5E5A B;  2NZD B;  1TZY C;  3LZ0 C;  1M18 B;  5BNX B;  3KXB D;  1P3B C;  3MGS B;  4J8X B;  3AYW D;  2ARO A;  1HTA A;  4R8P B;  3REJ B;  3C1B B;  2FJ7 A;  3AV2 D;  3WA9 A;  2HIO A;  4UUZ B;  3X1V C;  1EQZ A;  1P34 C;  3R45 A;  4Z5T D;  4HGA B;  3AZN A;  3MVD B;  3UTA B;  3AZH A;  1P3K D;  4J8W C;  1M1A C;  1P3I A;  3B6F D;  5DNM D;  4Z66 C;  3REL B;  3NQJ A;  3LZ1 A;  3KXB B;  3MGP B;  5B40 D;  4ZUX D;  4WNN B;  5CP6 B;  1KX3 D;  5AVB B;  3UT9 D;  1P3M D;  3KWQ C;  1F66 D;  3WAA B;  3X1T D;  3AV2 B;  5AV8 A;  4YS3 B;  4X23 C;  3AZE C;  5AVC D;  3REI C;  3WTP A;  4E44 A;  1BH8 A;  3O62 B;  1WWI A;  3W97 C;  3B0B A;  2CV5 D;  3A6N D;  2YFW B;  5B33 B;  5CPJ D;  5JRG B;  3W99 D;  5B24 C;  1P3K B;  5DNN C;  3B0D B;  5CPK C;  1P3O C;  5B0Z B;  3AZG D;  2F8N D;  3AFA C;  3X1S A;  4G92 B;  1P3B A;  1P3A D;  5BT1 C;  5B40 B;  3UTB B;  5AV6 C;  4DRB A;  4G91 B;  1P3L C;  3C1C A;  5B1M D;  3KUY C;  4LD9 A;  1S32 C;  5B2J A;  2PYO C;  4XUJ A;  1P3G D;  5AY8 C;  1P3F D;  1P3P A;  5GSU D;  5AV5 A;  3X1U B;  5CPI D;  1KX4 A;  1AOI A;  4J8W A;  1U35 D;  2L5A A;  3TU4 B;  3REK D;  4H9R A;  1ULY A;  2NQB D;  3WKJ B;  3REH C;  4YM6 D;  4QLC C;  1HQ3 C;  2HIO B;  5B32 D;  3AZL D;  5KDM B;  3MNN A;  4XZQ D;  1EQZ B;  4KGC D;  3AZJ D;  3W96 A;  3LJA A;  3AZE A;  3AZF C;  3REI A;  4H9N A;  4J8U B;  4WU8 C;  5GXQ A;  2RVQ C;  3AZH B;  1BH9 B;  5GT3 C;  1P3I B;  3WTP E;  2ARO C;  1TZY D;  3LZ1 B;  3AN2 D;  1M19 A;  2FJ7 C;  2NQB B;  3MGR A;  4H9Q B;  3WA9 C;  5BO0 B;  3AZI D;  4YM6 B;  3AZM A;  3AZN C;  3WTP B;  1ZLA A;  5E5A D;  1M18 D;  5B2I B;  3MGS D;  4Z66 D;  5B31 B;  4J8X D;  1TZY B;  3LZ0 B;  1P3B B;  3AYW A;  4R8P D;  3LEL A;  4KHA A;  3C1B D;  3VH5 A;  1TAF B;  3REH A;  5AV8 C;  1HQ3 A;  3WTP C;  3X1V B;  1P34 B;  3MVD D;  3UTA D;  3AZF A;  5B31 G;  2YFV A;  5AV9 A;  3REL D;  5BNV B;  3NQU B;  5DNM A;  4AWL C;  3X1S C;  4J8W B;  3B6F A;  5GT3 A;  1M1A B;  3MGP D;  4Z66 B;  4H9R B;  5CP6 D;  3AZK C;  4ZUX A;  5AVB D;  3C1C C;  3MGQ A;  3WAA D;  5AV6 D;  4LD9 C;  4YS3 D;  1F66 A;  5B2J C;  3KWQ B;  3VH5 T;  4XUJ C;  4X23 B;  3AZE B;  3O62 D;  1P3P C;  5AV5 C;  1KX5 A;  3REI B;  1ID3 C;  5B33 D;  5JRG D;  1KX4 C;  2CV5 A;  5AY8 D;  3A6N A;  1AOI C;  1H3O B;  5CPJ A;  3W97 B;  5B0Z D;  1N1J A;  3AV1 C;  3AZG A;  5B24 B;  1P3O B;  5DNN B;  5CPK B;  3UTB D; 
#chains in the Genus database with same CATH topology
 3AFA B;  4KUD C;  3B6G C;  3EPL A;  3MNN C;  5B0Y A;  5AV6 B;  4WZS B;  3W96 C;  3LJA C;  1P3L B;  5GXQ C;  3KUY B;  4ZBJ C;  1S32 B;  3A1I A;  2PYO B;  1P3G A;  3A1K A;  3X1U D;  4WU8 D;  4H9P B;  1P3F A;  5GSU A;  1ZLA B;  3H0R C;  5AY8 B;  5CPI A;  3TU4 D;  1M19 C;  2Y2P A;  1U35 A;  3WKJ D;  3MGR C;  5F99 C;  3F6T A;  3AZM C;  5B1L A;  3AZK A;  2Y2J A;  4NE5 A;  3REH B;  3V9R A;  2HIO D;  4NE3 A;  1EQZ D;  5JA4 B;  5B32 A;  4QLC B;  5FUG A;  3AZL A;  1HQ3 B;  4KGC A;  3AZJ A;  2XD5 A;  4JJN C;  4J8U D;  1ZLA C;  2BYM B;  3KSY A;  3AZF B;  4J8V A;  3AZH D;  2LY8 A;  1ID3 A;  2YFV B;  4EO5 C;  5AV9 B;  4WU8 B;  1P3I D;  1PZR A;  3LZ1 D;  3AYW C;  5GT3 B;  3LEL C;  4H9O A;  3AV1 A;  2ARO B;  3AN2 A;  1A7W A;  5GT0 A;  2DF4 C;  2BYK A;  3MGQ B;  2FJ7 B;  4KUD A;  3WA9 B;  3VH5 W;  3B6G A;  4Z5T C;  3B0C T;  3WTP D;  3R45 B;  4Z2M H;  5AV9 C;  3AZN B;  2IO5 C;  2Y2Q A;  4WU9 A;  3B6F C;  5DNM C;  5B2I D;  5E5A A;  2NZD A;  5B31 D;  5BNX A;  3NQJ B;  3LZ0 D;  3MGS A;  3X1S D;  1P3B D;  4ZUX C;  3VH6 A;  3MGQ C;  2HUE C;  4R8P A;  3REJ A;  3UT9 C;  3FDD A;  5F99 A;  1KU5 A;  1F66 C;  3X1T C;  4UUZ A;  5AV8 B;  3W98 A;  3X1V D;  1KX5 C;  5BS7 A;  1P34 D;  2CV5 C;  1BH8 B;  2XD1 A;  3A6N C;  5CPJ C;  1B6W A;  3MVD A;  4JJN A;  3W99 C;  2F8N H;  3AZG C;  4J8W D;  3REL A;  1M1A D;  4NE6 A;  3KXB A;  3MGP A;  4AWL B;  3X1S B;  4WNN A;  5CP6 A;  5B0Y C;  5AVB A;  3AZK B;  4WV4 B;  3WAA A;  3KWQ D;  3C1C B;  3AV2 A;  5G49 A;  5FUG B;  4LD9 B;  5B2J B;  4X23 D;  3AZE D;  1P3G C;  3REI D;  4XUJ B;  1P3F C;  3O62 A;  5GSU C;  4Z5T A;  1P3P B;  5CPI C;  2YFW A;  5B33 A;  5AV5 B;  3W97 D;  1ID3 B;  5C3I B;  1P3K A;  1U35 C;  1KX4 B;  5B24 D;  3REK C;  1P3O D;  2Y2G A;  5DNN D;  5CPK D;  1AOI B;  2ZY5 A;  4H9O B;  3AV1 B;  5B1L C;  3AFA D;  2DQN C;  5B40 A;  5BT1 D;  5B32 C;  3H0M C;  1P3M A;  3UT9 A;  1KX3 A;  3AZL C;  4KUD B;  2BG1 A;  4XZQ C;  3B6G B;  4KGC C;  2RIQ A;  3MNN B;  3X1T A;  1P3L D;  3AZJ C;  3B0C W;  3KUY D;  5AVC A;  4UPK A;  1S32 D;  2PYO D;  3LJA B;  3W96 B;  4J8V C;  4H9N B;  5C3I C;  5GXQ B;  1ZLA D;  3X1U A;  4ZBJ B;  4WU9 B;  4CAY A;  3W99 A;  3AN2 C;  2JCH A;  3TU4 A;  1F1E A;  2F8N A;  3WKJ A;  5GT0 C;  3LEL D;  1M19 B;  4DRA A;  4H9S C;  1P3A A;  3MGR B;  3AZI C;  3REH D;  3EG5 B;  5F99 B;  3AZM B;  4QLC D;  5KDM A;  3EPH A;  1HQ3 D;  3W98 B;  5B1M A;  2Y2K A;  4J8U A;  4WU9 C;  3AZF D;  5E5A C;  4JJN B;  5AV9 D;  2NZD C;  1M18 C;  2RVQ D;  4E45 A;  1BH9 A;  3MGS C;  4J8X C;  5GT3 D;  4EO5 B;  2ARO D;  3REK A;  4R8P C;  3REJ C;  3C1B C;  3AYW B;  2NQB A;  3LEL B;  4KHA B;  4H9Q A;  3MGQ D;  2FJ7 D;  5BO0 A;  3VH6 W;  3WA9 D;  4YM6 A;  3W98 C;  2F8N K;  5BS7 C;  5G49 B;  4XZQ A;  4HGA C;  1KX5 D;  3MVD C;  3UTA C;  3AZN D;  4Z5T B;  3REL C;  2Y2I A;  2IO5 B;  3KXB C;  5B2I A;  3MGP C;  3B6F B;  5DNM B;  5B31 A;  1TZY A;  5CP6 C;  3LZ0 A;  1BFM A;  5AVB C;  4CSR A;  4ZUX B;  3WAA C;  1TAF A;  5B0Y D;  3AV2 C;  1KX3 B;  2HUE B;  4H9S A;  4YS3 C;  3UT9 B;  3AZI A;  1P3M B;  5AV8 D;  2F2A C;  1F66 B;  3X1T B;  3X1V A;  3O62 C;  1WWS A;  5AVC B;  1JFI A;  4Z2M G;  1KX5 B;  5B33 C;  1P34 A;  5JRG C;  1T3U A;  1P3K C;  1Q9C A;  3B0D C;  5B0Z C;  2CV5 B;  3A6N B;  1W2E A;  5CPJ B;  4CAY B;  5BNV A;  3W99 B;  1N1J B;  3NQU A;  4G92 C;  1M18 A;  3AZG B;  1M1A A;  4Z66 A;  2F8N B;  4J8X A;  5B40 C;  1B67 A;  3UTB C;  2ZY4 A;  1P3M C;  4G91 C;  5B1L D;  3AZK D;  1P3A B;  3C1B A;  1KX3 C;  2ZY2 A;  5B0Y B;  3C1C D;  3KWQ A;  5AVC C;  4LD9 D;  5B1M B;  5B2J D;  2CWE A;  4XUJ D;  1Z2C B;  4X23 A;  3X1U C;  2ZM5 A;  1P3G B;  5AV5 D;  4J8V D;  1P3P D;  3UTA A;  1ID3 D;  1P3F B;  5GSU B;  1H3O A;  3W97 A;  3TU4 C;  1KX4 D;  2F8N G;  5CPI B;  1AOI D;  1R4V A;  3WKJ C;  5B24 A;  1P3O A;  5DNN A;  3AV1 D;  5CPK A;  1U35 B;  3REK B;  1P3A C;  2G5I C;  4NFT A;  5GT0 D;  3AFA A;  2Y2H A;  2HIO C;  5B1L B;  4KUD D;  1EQZ C;  3V9R B;  3B6G D;  5B1M C;  3VH6 T;  5AV6 A;  3MNN D;  5B32 B;  4YS3 A;  3AZL B;  1P3L A;  4XZQ B;  4KGC B;  3W96 D;  4J8U C;  3LJA D;  3AZJ B;  3KUY A;  1S32 A;  2PYO A;  5GXQ D;  3AZH C;  2Y2N A;  4H9P A;  4WU9 D;  4J8V B;  1P3I C;  5JRG A;  2NZD D;  2W8S A;  5AY8 A;  3LZ1 C;  5B0Z A;  2NQB C;  1M19 D;  3AN2 B;  2JSS A;  4CSR B;  3MGR D;  5CHL B;  3REJ D;  4YM6 C;  5F99 D;  3UTB A;  5GT0 B;  5B32 G;  4M6B A;  2BYK B;  3AZM D;  3KFU G;  3AZI B;  5JA4 A;  3W98 D;  4QLC A;  1JFI B;  4JJN D;  2BYM A;  5B2I C;  4WU8 A;  5B31 C;  2FFF B;  5E5A B;  2NZD B;  1TZY C;  3LZ0 C;  1M18 B;  5BNX B;  3KXB D;  1P3B C;  3MGS B;  4J8X B;  3AYW D;  2ARO A;  1HTA A;  4R8P B;  3REJ B;  3C1B B;  2FJ7 A;  3AV2 D;  3WA9 A;  2HIO A;  4UUZ B;  3X1V C;  1EQZ A;  1P34 C;  3R45 A;  4Z5T D;  4HGA B;  3AZN A;  3MVD B;  3UTA B;  3AZH A;  1P3K D;  4J8W C;  1M1A C;  1P3I A;  3B6F D;  5DNM D;  4Z66 C;  3REL B;  3NQJ A;  3P5J B;  3LZ1 A;  3KXB B;  3MGP B;  5B40 D;  4ZUX D;  4WNN B;  5CP6 B;  1KX3 D;  5AVB B;  3UT9 D;  1P3M D;  3KWQ C;  1F66 D;  3WAA B;  3X1T D;  3AV2 B;  5AV8 A;  4YS3 B;  4X23 C;  3AZE C;  5AVC D;  3REI C;  3AL0 C;  4E44 A;  3WTP A;  1BH8 A;  3O62 B;  4WJ3 C;  1WWI A;  3W97 C;  3B0B A;  2CV5 D;  3A6N D;  2YFW B;  5B33 B;  5CPJ D;  5JRG B;  3W99 D;  5B24 C;  1P3K B;  5DNN C;  3B0D B;  5CPK C;  1P3O C;  5B0Z B;  3AZG D;  2Y2O A;  2F8N D;  3AFA C;  3X1S A;  4G92 B;  1P3B A;  1P3A D;  5BT1 C;  5B40 B;  3UTB B;  5AV6 C;  4DRB A;  4G91 B;  1P3L C;  3C1C A;  5B1M D;  3KUY C;  3EPK A;  4LD9 A;  1S32 C;  5B2J A;  2PYO C;  4XUJ A;  1P3G D;  5AY8 C;  1P3F D;  1P3P A;  5GSU D;  5AV5 A;  3X1U B;  5CPI D;  2UWX A;  1KX4 A;  1AOI A;  4J8W A;  1U35 D;  2L5A A;  3TU4 B;  3REK D;  4H9R A;  1ULY A;  2NQB D;  3WKJ B;  3REH C;  4YM6 D;  4QLC C;  1HQ3 C;  2HIO B;  2VQR A;  5B32 D;  3AZL D;  5KDM B;  3MNN A;  4XZQ D;  1EQZ B;  4KGC D;  3AZJ D;  3W96 A;  3LJA A;  3AZE A;  3AZF C;  3REI A;  4H9N A;  4J8U B;  4WU8 C;  5GXQ A;  2RVQ C;  2G5H C;  3AZH B;  1BH9 B;  5GT3 C;  1P3I B;  3WTP E;  2ARO C;  1TZY D;  3LZ1 B;  3AN2 D;  1M19 A;  2FJ7 C;  2NQB B;  3MGR A;  4H9Q B;  3WA9 C;  5BO0 B;  3AZI D;  4YM6 B;  3AZM A;  3AZN C;  3EPJ A;  3WTP B;  1ZLA A;  5E5A D;  1M18 D;  5B2I B;  3MGS D;  4Z66 D;  5B31 B;  4J8X D;  1TZY B;  3LZ0 B;  1P3B B;  3H0L C;  3AYW A;  2JE5 A;  4R8P D;  3LEL A;  4KHA A;  3C1B D;  3VH5 A;  1TAF B;  3REH A;  5AV8 C;  1HQ3 A;  3WTP C;  3X1V B;  1P34 B;  3MVD D;  3UTA D;  3AZF A;  5B31 G;  2YFV A;  5AV9 A;  3REL D;  5BNV B;  3NQU B;  5DNM A;  4AWL C;  3X1S C;  4J8W B;  3B6F A;  5GT3 A;  1M1A B;  3MGP D;  4Z66 B;  3IP4 C;  4H9R B;  2ZY3 A;  5CP6 D;  3AZK C;  2Y2L A;  4ZUX A;  5AVB D;  3C1C C;  3MGQ A;  2J8P A;  3WAA D;  5AV6 D;  4LD9 C;  2Y2M A;  4YS3 D;  5B2J C;  1F66 A;  3KWQ B;  4DQY B;  3VH5 T;  4XUJ C;  4X23 B;  3AZE B;  3O62 D;  1P3P C;  5AV5 C;  1KX5 A;  3REI B;  1ID3 C;  5B33 D;  5JRG D;  1KX4 C;  2CV5 A;  5AY8 D;  3A6N A;  1AOI C;  1H3O B;  5CPJ A;  3W97 B;  5B0Z D;  1N1J A;  3AV1 C;  3AZG A;  5B24 B;  1P3O B;  5DNN B;  5CPK B;  3UTB D; 
#chains in the Genus database with same CATH homology
 3AFA B;  4KUD C;  3B6G C;  3EPL A;  3MNN C;  5B0Y A;  5AV6 B;  4WZS B;  3W96 C;  3LJA C;  1P3L B;  5GXQ C;  3KUY B;  4ZBJ C;  1S32 B;  3A1I A;  2PYO B;  1P3G A;  3A1K A;  3X1U D;  4WU8 D;  4H9P B;  1P3F A;  5GSU A;  1ZLA B;  3H0R C;  5AY8 B;  5CPI A;  3TU4 D;  1M19 C;  2Y2P A;  1U35 A;  3WKJ D;  3MGR C;  5F99 C;  3F6T A;  3AZM C;  5B1L A;  3AZK A;  2Y2J A;  4NE5 A;  3REH B;  3V9R A;  2HIO D;  4NE3 A;  1EQZ D;  5JA4 B;  5B32 A;  4QLC B;  5FUG A;  3AZL A;  1HQ3 B;  4KGC A;  3AZJ A;  2XD5 A;  4JJN C;  4J8U D;  1ZLA C;  2BYM B;  3KSY A;  3AZF B;  4J8V A;  3AZH D;  2LY8 A;  1ID3 A;  2YFV B;  4EO5 C;  5AV9 B;  4WU8 B;  1P3I D;  1PZR A;  3LZ1 D;  3AYW C;  5GT3 B;  3LEL C;  4H9O A;  3AV1 A;  2ARO B;  3AN2 A;  1A7W A;  5GT0 A;  2DF4 C;  2BYK A;  3MGQ B;  2FJ7 B;  4KUD A;  3WA9 B;  3VH5 W;  3B6G A;  4Z5T C;  3B0C T;  3WTP D;  3R45 B;  4Z2M H;  5AV9 C;  3AZN B;  2IO5 C;  2Y2Q A;  4WU9 A;  3B6F C;  5DNM C;  5B2I D;  5E5A A;  2NZD A;  5B31 D;  5BNX A;  3NQJ B;  3LZ0 D;  3MGS A;  3X1S D;  1P3B D;  4ZUX C;  3VH6 A;  3MGQ C;  2HUE C;  4R8P A;  3REJ A;  3UT9 C;  3FDD A;  5F99 A;  1KU5 A;  1F66 C;  3X1T C;  4UUZ A;  5AV8 B;  3W98 A;  3X1V D;  1KX5 C;  5BS7 A;  1P34 D;  2CV5 C;  1BH8 B;  2XD1 A;  3A6N C;  5CPJ C;  1B6W A;  3MVD A;  4JJN A;  3W99 C;  2F8N H;  3AZG C;  4J8W D;  3REL A;  1M1A D;  4NE6 A;  3KXB A;  3MGP A;  4AWL B;  3X1S B;  4WNN A;  5CP6 A;  5B0Y C;  5AVB A;  3AZK B;  4WV4 B;  3WAA A;  3KWQ D;  3C1C B;  3AV2 A;  5G49 A;  5FUG B;  4LD9 B;  5B2J B;  4X23 D;  3AZE D;  1P3G C;  3REI D;  4XUJ B;  1P3F C;  3O62 A;  5GSU C;  4Z5T A;  1P3P B;  5CPI C;  2YFW A;  5B33 A;  5AV5 B;  3W97 D;  1ID3 B;  5C3I B;  1P3K A;  1U35 C;  1KX4 B;  5B24 D;  3REK C;  1P3O D;  2Y2G A;  5DNN D;  5CPK D;  1AOI B;  2ZY5 A;  4H9O B;  3AV1 B;  5B1L C;  3AFA D;  2DQN C;  5B40 A;  5BT1 D;  5B32 C;  3H0M C;  1P3M A;  3UT9 A;  1KX3 A;  3AZL C;  4KUD B;  2BG1 A;  4XZQ C;  3B6G B;  4KGC C;  2RIQ A;  3MNN B;  3X1T A;  1P3L D;  3AZJ C;  3B0C W;  3KUY D;  5AVC A;  4UPK A;  1S32 D;  2PYO D;  3LJA B;  3W96 B;  4J8V C;  4H9N B;  5C3I C;  5GXQ B;  1ZLA D;  3X1U A;  4ZBJ B;  4WU9 B;  4CAY A;  3W99 A;  3AN2 C;  2JCH A;  3TU4 A;  1F1E A;  2F8N A;  3WKJ A;  5GT0 C;  3LEL D;  1M19 B;  4DRA A;  4H9S C;  1P3A A;  3MGR B;  3AZI C;  3REH D;  3EG5 B;  5F99 B;  3AZM B;  4QLC D;  5KDM A;  3EPH A;  1HQ3 D;  3W98 B;  5B1M A;  2Y2K A;  4J8U A;  4WU9 C;  3AZF D;  5E5A C;  4JJN B;  5AV9 D;  2NZD C;  1M18 C;  2RVQ D;  4E45 A;  1BH9 A;  3MGS C;  4J8X C;  5GT3 D;  4EO5 B;  2ARO D;  3REK A;  4R8P C;  3REJ C;  3C1B C;  3AYW B;  2NQB A;  3LEL B;  4KHA B;  4H9Q A;  3MGQ D;  2FJ7 D;  5BO0 A;  3VH6 W;  3WA9 D;  4YM6 A;  3W98 C;  2F8N K;  5BS7 C;  5G49 B;  4XZQ A;  4HGA C;  1KX5 D;  3MVD C;  3UTA C;  3AZN D;  4Z5T B;  3REL C;  2Y2I A;  2IO5 B;  3KXB C;  5B2I A;  3MGP C;  3B6F B;  5DNM B;  5B31 A;  1TZY A;  5CP6 C;  3LZ0 A;  1BFM A;  5AVB C;  4CSR A;  4ZUX B;  3WAA C;  1TAF A;  5B0Y D;  3AV2 C;  1KX3 B;  2HUE B;  4H9S A;  4YS3 C;  3UT9 B;  3AZI A;  1P3M B;  5AV8 D;  2F2A C;  1F66 B;  3X1T B;  3X1V A;  3O62 C;  1WWS A;  5AVC B;  1JFI A;  4Z2M G;  1KX5 B;  5B33 C;  1P34 A;  5JRG C;  1T3U A;  1P3K C;  1Q9C A;  3B0D C;  5B0Z C;  2CV5 B;  3A6N B;  1W2E A;  5CPJ B;  4CAY B;  5BNV A;  3W99 B;  1N1J B;  3NQU A;  4G92 C;  1M18 A;  3AZG B;  1M1A A;  4Z66 A;  2F8N B;  4J8X A;  5B40 C;  1B67 A;  3UTB C;  2ZY4 A;  1P3M C;  4G91 C;  5B1L D;  3AZK D;  1P3A B;  3C1B A;  1KX3 C;  2ZY2 A;  5B0Y B;  3C1C D;  3KWQ A;  5AVC C;  4LD9 D;  5B1M B;  5B2J D;  2CWE A;  4XUJ D;  1Z2C B;  4X23 A;  3X1U C;  2ZM5 A;  1P3G B;  5AV5 D;  4J8V D;  1P3P D;  3UTA A;  1ID3 D;  1P3F B;  5GSU B;  1H3O A;  3W97 A;  3TU4 C;  1KX4 D;  2F8N G;  5CPI B;  1AOI D;  1R4V A;  3WKJ C;  5B24 A;  1P3O A;  5DNN A;  3AV1 D;  5CPK A;  1U35 B;  3REK B;  1P3A C;  2G5I C;  4NFT A;  5GT0 D;  3AFA A;  2Y2H A;  2HIO C;  5B1L B;  4KUD D;  1EQZ C;  3V9R B;  3B6G D;  5B1M C;  3VH6 T;  5AV6 A;  3MNN D;  5B32 B;  4YS3 A;  3AZL B;  1P3L A;  4XZQ B;  4KGC B;  3W96 D;  4J8U C;  3LJA D;  3AZJ B;  3KUY A;  1S32 A;  2PYO A;  5GXQ D;  3AZH C;  2Y2N A;  4H9P A;  4WU9 D;  4J8V B;  1P3I C;  5JRG A;  2NZD D;  2W8S A;  5AY8 A;  3LZ1 C;  5B0Z A;  2NQB C;  1M19 D;  3AN2 B;  2JSS A;  4CSR B;  3MGR D;  5CHL B;  3REJ D;  4YM6 C;  5F99 D;  3UTB A;  5GT0 B;  5B32 G;  4M6B A;  2BYK B;  3AZM D;  3KFU G;  3AZI B;  5JA4 A;  3W98 D;  4QLC A;  1JFI B;  4JJN D;  2BYM A;  5B2I C;  4WU8 A;  5B31 C;  2FFF B;  5E5A B;  2NZD B;  1TZY C;  3LZ0 C;  1M18 B;  5BNX B;  3KXB D;  1P3B C;  3MGS B;  4J8X B;  3AYW D;  2ARO A;  1HTA A;  4R8P B;  3REJ B;  3C1B B;  2FJ7 A;  3AV2 D;  3WA9 A;  2HIO A;  4UUZ B;  3X1V C;  1EQZ A;  1P34 C;  3R45 A;  4Z5T D;  4HGA B;  3AZN A;  3MVD B;  3UTA B;  3AZH A;  1P3K D;  4J8W C;  1M1A C;  1P3I A;  3B6F D;  5DNM D;  4Z66 C;  3REL B;  3NQJ A;  3P5J B;  3LZ1 A;  3KXB B;  3MGP B;  5B40 D;  4ZUX D;  4WNN B;  5CP6 B;  1KX3 D;  5AVB B;  3UT9 D;  1P3M D;  3KWQ C;  1F66 D;  3WAA B;  3X1T D;  3AV2 B;  5AV8 A;  4YS3 B;  4X23 C;  3AZE C;  5AVC D;  3REI C;  3AL0 C;  4E44 A;  3WTP A;  1BH8 A;  3O62 B;  4WJ3 C;  1WWI A;  3W97 C;  3B0B A;  2CV5 D;  3A6N D;  2YFW B;  5B33 B;  5CPJ D;  5JRG B;  3W99 D;  5B24 C;  1P3K B;  5DNN C;  3B0D B;  5CPK C;  1P3O C;  5B0Z B;  3AZG D;  2Y2O A;  2F8N D;  3AFA C;  3X1S A;  4G92 B;  1P3B A;  1P3A D;  5BT1 C;  5B40 B;  3UTB B;  5AV6 C;  4DRB A;  4G91 B;  1P3L C;  3C1C A;  5B1M D;  3KUY C;  3EPK A;  4LD9 A;  1S32 C;  5B2J A;  2PYO C;  4XUJ A;  1P3G D;  5AY8 C;  1P3F D;  1P3P A;  5GSU D;  5AV5 A;  3X1U B;  5CPI D;  2UWX A;  1KX4 A;  1AOI A;  4J8W A;  1U35 D;  2L5A A;  3TU4 B;  3REK D;  4H9R A;  1ULY A;  2NQB D;  3WKJ B;  3REH C;  4YM6 D;  4QLC C;  1HQ3 C;  2HIO B;  2VQR A;  5B32 D;  3AZL D;  5KDM B;  3MNN A;  4XZQ D;  1EQZ B;  4KGC D;  3AZJ D;  3W96 A;  3LJA A;  3AZE A;  3AZF C;  3REI A;  4H9N A;  4J8U B;  4WU8 C;  5GXQ A;  2RVQ C;  2G5H C;  3AZH B;  1BH9 B;  5GT3 C;  1P3I B;  3WTP E;  2ARO C;  1TZY D;  3LZ1 B;  3AN2 D;  1M19 A;  2FJ7 C;  2NQB B;  3MGR A;  4H9Q B;  3WA9 C;  5BO0 B;  3AZI D;  4YM6 B;  3AZM A;  3AZN C;  3EPJ A;  3WTP B;  1ZLA A;  5E5A D;  1M18 D;  5B2I B;  3MGS D;  4Z66 D;  5B31 B;  4J8X D;  1TZY B;  3LZ0 B;  1P3B B;  3H0L C;  3AYW A;  2JE5 A;  4R8P D;  3LEL A;  4KHA A;  3C1B D;  3VH5 A;  1TAF B;  3REH A;  5AV8 C;  1HQ3 A;  3WTP C;  3X1V B;  1P34 B;  3MVD D;  3UTA D;  3AZF A;  5B31 G;  2YFV A;  5AV9 A;  3REL D;  5BNV B;  3NQU B;  5DNM A;  4AWL C;  3X1S C;  4J8W B;  3B6F A;  5GT3 A;  1M1A B;  3MGP D;  4Z66 B;  3IP4 C;  4H9R B;  2ZY3 A;  5CP6 D;  3AZK C;  2Y2L A;  4ZUX A;  5AVB D;  3C1C C;  3MGQ A;  2J8P A;  3WAA D;  5AV6 D;  4LD9 C;  2Y2M A;  4YS3 D;  5B2J C;  1F66 A;  3KWQ B;  4DQY B;  3VH5 T;  4XUJ C;  4X23 B;  3AZE B;  3O62 D;  1P3P C;  5AV5 C;  1KX5 A;  3REI B;  1ID3 C;  5B33 D;  5JRG D;  1KX4 C;  2CV5 A;  5AY8 D;  3A6N A;  1AOI C;  1H3O B;  5CPJ A;  3W97 B;  5B0Z D;  1N1J A;  3AV1 C;  3AZG A;  5B24 B;  1P3O B;  5DNN B;  5CPK B;  3UTB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...