1ZLAC

X-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNWERDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human alpha-Satellite DNA fragment
publication title The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/virus/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1zlaC00
2HIOC 5FUGB 5AVBD 3REJC 2AROC 3WTPD 5F99A 1P3AA 5B0ZA 5AY8C 1P3FA 4XZQA 3O62A 3C1BC 5C3IC 3X1TB 4Z5TA 3AZMB 4KHAB 1KX4D 5JRGB 3W98B 4XUJD 4EO5C 3LJAA 5CP6A 1EQZB 1S32B 3LELB 1HQ3B 4G92C 4H9NB 3KUYD 5BNVB 2RVQD 5F99C 1JFIB 2L5AA 3AYWD 1P3AC 1ID3A 5E5AA 3AFAA 4LD9D 1P3FC 4XZQC 3O62C 4WU9A 5AVCB 5B1LB 1U35B 3KXBD 4JJND 4Z5TC 4QLCB 3LJAC 5CP6C 4J8XB 3WTPE 4J8UB 5GT0B 4G91B 3AZKD 3REKA 4WNNA 1P3BA 5B31B 1KX5C 4Z66D 5E5AC 3LZ0D 4CAYA 3AFAC 2CWEA 5GT3A 3B6GA 3X1SA 3MGQA 3UT9B 3MGSD 4WU9C 2F8NB 4AWLB 4DRAA 5GXQB 1P3PD 5GSUD 1P3LC 1AOID 3AZND 3AZFD 2NZDB 5B33B 3WKJD 3MGPC 4NE5A 5B2JC 1P3BC 2CV5D 4J8WA 1KX3A 5GT3C 3B6GC 4YS3B 5B24A 2NQBA 5B2IB 5B32A 1TZYC 3W99C 1P3OA 2IO5B 3AZJD 2PYOD 4KGCD 3X1VD 3AZGC 2YFVA 4XUJB 5B1MD 3AZLA 3WAAD 1F66B 3AN2B 3KUYB 3X1UD 3AZIA 3W97B 5B24C 2NQBC 5B32C 1P3MB 1P3OC 3AZHA 4ZBJB 4KUDD 5DNND 1ZLAD 3REHA 5DNMD 4J8VA 3WA9B 3AZLC 1BH9A 5BNXB 3AZKB 5AV9B 3AZEA 3B0BA 4WU8D 5CPKA 2HIOD 4YM6A 3A6NB 4Z66B 1H3OB 4H9PB 3REJD 2AROD 3AZHC 1F1EA 1A7WA 1M19A 5AV8C 4H9SA 1P3KB 1TAFB 3UTAD 3B6FA 4X23C 4R8PB 3VH5W 5AV6A 4J8VC 5AY8D 3UTBA 1P3GA 3AZNB 3AZFB 4HGAC 3MVDC 3TU4A 3AZEC 3REIA 3AV1C 5AV5A 4UUZA 5CPIA 2CV5B 2BYMB 3C1CB 3LZ1A 1M19C 4WZSB 5F99D 1HTAA 5B40A 1P3AD 3B6FC 5B0ZD 3UTBC 1P3GC 1P3FD 4XZQD 3O62D 3TU4C 1P34A 3X1VB 4Z5TD 3REIC 4ZUXB 5AV5C 5CPIC 5CP6D 3LJAD 3MGRC 3WAAB 1M18A 5CPJB 3X1UB 3RELA 4NE3A 5FUGA 5B40C 3C1BA 1ID3D 5E5AD 3AFAD 1Q9CA 4KUDB 4WU9D 3W96B 1P34C 2YFWB 3KWQC 1M18C 4H9OA 4DRBA 1R4VA 3RELC 4WU8B 3REKD 3X1TA 3AZMA 1P3BD 3KSYA 5GT3D 1ULYA 5B0YB 1S32A 3MNNB 3LELA 3B6GD 4H9NA 5G49B 3X1SD 3MGQD 1P3IB 5BNVA 3UTAB 2BYKB 2F8NK 1KX5A 5AVCA 5B1LA 1U35A 3NQUB 3X1TC 3AZMC 4QLCA 3W98C 5JRGC 4J8WD 1KX3D 1EQZC 5GT0A 1S32C 3LELC 1HQ3C 1P3LA 5B24D 3AV2B 2NQBD 5B31A 5B32D 5B0ZB 5BS7A 1P3OD 4M6BA 3MGPA 5B2JA 3UT9A 5AVCC 5B1LC 1U35C 5JA4A 4QLCC 3LJAB 3AZLD 4J8XC 3NQJB 4J8UC 5GT0C 4G91C 1TZYA 5B33A 3AZID 3W99A 1ID3B 5B31C 3AFAB 5BS7C 3AZGA 3AZHD 4YS3A 5AVBB 3UT9C 3REHD 4AWLC 4J8VD 5B2IA 3WTPB 5GXQC 4H9RB 5B33C 3AZED 3REKB 4WNNB 5CPKD 4YM6D 2JSSA 1F66A 3AN2A 4CSRB 1KX4B 1WWSA 3X1SB 3MGQB 1M19D 2FJ7A 4YS3C 3W97A 5B32G 3B6FD 3UTBD 5B2IC 1BFMA 5AV6D 1P3GD 5BO0A 1P3MA 2IO5C 3AYWB 1N1JB 3TU4D 4LD9B 3REID 4NFTA 5AV5D 4XUJC 5AV8A 4J8WB 3KXBB 5CPID 3WA9A 1KX3B 5BNXA 4JJNB 1F66C 3AN2C 4X23A 5AV9A 3B0CT 3LZ1D 3KUYC 2FJ7C 5B40D 3W97C 3A6NA 3MVDA 1H3OA 1P3MC 3VH5T 3AV1A 2LY8A 4ZBJC 1P34D 3LZ0B 1P3KA 3VH6W 4R8PA 3MGSB 3WA9C 1M18D 1P3PB 5GSUB 3AZIB 3RELD 3AZKC 5AV9C 1AOIB 3A6NC 3C1BD 4Z66C 3WKJB 3C1CA 3MGRA 3REHB 1P3KC 4R8PC 4H9QB 1BH9B 5BT1C 3AZNC 3AZFC 4Z2MH 1M1AA 5CPKB 4YM6B 3X1TD 3AZMD 4ZUXA 3AZJB 2PYOB 4KGCB 2CV5C 1BH8B 3C1CC 5CPJA 3V9RA 3KWQA 3LELD 1S32D 1B67A 5B1MB 5KDMB 3R45B 1B6WA 5AV6B 1WWIA 1KX5D 3W96A 5AVCD 5B1LD 1U35D 3X1VC 1M1AC 4WV4B 4QLCD 4ZUXC 5DNNB 1ZLAB 3WAAC 2HUEB 5DNMB 5GT0D 3VH6A 5CPJC 3LZ1B 1P3LD 3B0DB 5B31D 3VH5A 2HIOB 3MGPD 5B2JD 5B0YA 4KHAA 3MNNA 5JRGA 3W98A 4KUDC 3UT9D 1KU5A 3W96C 3REJB 1P3IA 2F8NH 1EQZA 2AROB 2BYKA 4E44A 1HQ3A 1JFIA 1TZYD 3W99D 5B33D 5AY8B 4WU8C 3NQUA 3C1BB 5C3IB 3AZGD 4EO5B 5B0YC 3MNNC 4YS3D 4J8XA 1P3IC 4J8UA 3UTAC 3AV2A 4G92B 5B2ID 5F99B 4H9OB 1P3AB 1P3FB 4XZQB 3O62B 4Z5TB 3NQJA 1F66D 3AN2D 2F8NA 5GXQA 2FJ7D 5CP6B 3W97D 5B31G 3AV2C 5B0ZC 2NZDA 1P3MD 1KX5B 5E5AB 2F8NG 5AVBA 3WTPA 4WU9B 5AV8D 3WA9D 4X23D 1P3LB 5AV9D 4H9RA 4NE6A 3A6ND 3MVDD 1ID3C 5CHLB 2NZDC 3MGPB 3AV1D 5B2JB 4CSRA 1P3BB 1KX4A 4XUJA 5AVBC 5JA4B 4CAYB 1P3KD 5GT3B 3B6GB 4R8PD 3WTPC 3KUYA 5BT1D 3AYWA 1N1JA 1TZYB 3W99B 4LD9A 3REKC 3KXBA 3AZGB 4JJNA 3C1CD 1KX4C 3MGQC 3X1SC 3MGRD 3AZKA 3VH6T 5B24B 2NQBB 2RVQC 3AYWC 5B32B 4Z66A 3LZ0A 1P3OB 1M1AD 4H9PA 4LD9C 4ZUXD 3MGSA 4J8WC 3KXBC 1KX3C 4JJNC 1TAFA 5CPJD 2YFVB 3KWQD 1P3PA 5GSUA 2FJ7B 3AZLB 1AOIA 3AZNA 3AZFA 5BO0B 3WKJA 2CV5A 3W96D 2BYMA 3LZ0C 3AZHB 5AV8B 4H9QA 3MGSC 4X23B 4J8VB 4E45A 1P3PC 5GSUC 3AZIC 1AOIC 4HGAB 3MVDB 3AZJA 2PYOA 4KGCA 3AZEB 3X1VA 3WKJC 3B0CW 3AV1B 1BH8A 5B0YD 3W98D 3MNND 5JRGD 5B1MA 1P3ID 3WAAA 5KDMA 3REHC 1EQZD 3R45A 1M19B 1HQ3D 3X1UA 3B6FB 3UTBB 1P3GB 5CPKC 4YM6C 3TU4B 4KUDA 3AZJC 5DNNA 1ZLAA 2PYOC 4KGCC 2YFWA 5DNMA 3REIB 5AV5B 4UUZB 5CPIB 5B1MC 4H9SC 3MGRB 4J8XD 4J8UD 3AV2D 5AV6C 3X1UC 4WU8A 2HIOA 5B40B 1M1AB 3REJA 2AROA 1P34B 5G49A 5DNNC 1ZLAC 3UTAA 2HUEC 2F8ND 3V9RB 5DNMC 3KWQB 5GXQD 5AY8A 3LZ1C 1M18B 3B0DC 3RELB 2NZDD 4Z2MG
chains in the Genus database with same CATH superfamily
2HIOC 5FUGB 5AVBD 2DF4C 3REJC 2AROC 3WTPD 3B6GD 1PZRA 5F99A 3AL0C 1P3AA 5B0ZA 5AY8C 1P3FA 4XZQA 3O62A 3C1BC 5C3IC 3X1TB 4Z5TA 3AZMB 3A1KA 4KHAB 2JCHA 5JRGB 1KX4D 4XUJD 4EO5C 3W98B 3LJAA 5CP6A 1EQZB 2ZY4A 1S32B 3LELB 1HQ3B 4G92C 4H9NB 3KUYD 5BNVB 2RVQD 5F99C 1JFIB 2L5AA 3AYWD 1P3AC 1ID3A 5E5AA 3AFAA 4LD9D 1P3FC 4XZQC 3O62C 4WU9A 5AVCB 5B1LB 1U35B 3KXBD 3KFUG 4JJND 4Z5TC 4QLCB 3LJAC 5CP6C 4J8XB 3WTPE 4J8UB 5GT0B 4G91B 3AZKD 3REKA 4WNNA 1P3BA 5B31B 1KX5C 4Z66D 5E5AC 3LZ0D 2Y2JA 4CAYA 2CWEA 2Y2KA 5GT3A 3AFAC 3B6GA 3X1SA 3MGQA 3UT9B 3MGSD 4WU9C 2F8NB 4AWLB 4DRAA 5GXQB 1P3PD 5GSUD 1P3LC 1AOID 3AZND 3AZFD 2NZDB 5B33B 3WKJD 3MGPC 2UWXA 4NE5A 5B2JC 1P3BC 2CV5D 4J8WA 1KX3A 5GT3C 3B6GC 4YS3B 5B24A 2NQBA 5B2IB 5B32A 1TZYC 3W99C 1P3OA 2IO5B 3AZJD 2PYOD 4KGCD 3X1VD 3AZGC 4XUJB 2YFVA 5B1MD 3AZLA 3WAAD 1F66B 3AN2B 3KUYB 3X1UD 3AZIA 3W97B 5B24C 2NQBC 5B32C 1P3MB 1P3OC 3AZHA 4ZBJB 4KUDD 5DNND 1ZLAD 3REHA 2XD1A 5DNMD 4J8VA 3WA9B 3AZLC 1BH9A 5BNXB 3AZKB 5AV9B 3AZEA 3B0BA 4WU8D 5CPKA 2HIOD 4YM6A 3A6NB 4Z66B 1H3OB 4H9PB 3REJD 2AROD 3AZHC 1F1EA 1A7WA 1M19A 5AV8C 4H9SA 1P3KB 1TAFB 3UTAD 3B6FA 4X23C 4R8PB 3VH5W 5AV6A 4J8VC 5AY8D 3UTBA 1P3GA 3AZNB 3AZFB 4HGAC 3MVDC 3TU4A 2ZY2A 3AZEC 2ZY3A 3REIA 3AV1C 5AV5A 3H0RC 4UUZA 5CPIA 2CV5B 2BYMB 3C1CB 3LZ1A 1M19C 4UPKA 5F99D 4WZSB 1HTAA 5B40A 1P3AD 3B6FC 5B0ZD 3UTBC 1P3GC 2F2AC 1P3FD 4XZQD 3O62D 3TU4C 2Y2NA 1P34A 3X1VB 4Z5TD 3REIC 4ZUXB 5AV5C 5CPIC 5CP6D 3LJAD 2G5IC 3MGRC 1M18A 3WAAB 5CPJB 3X1UB 3RELA 4NE3A 5FUGA 5B40C 3C1BA 1ID3D 5E5AD 3AFAD 1Q9CA 4KUDB 4WU9D 3W96B 1P34C 2YFWB 3KWQC 1M18C 4H9OA 4DRBA 1R4VA 3RELC 4WU8B 3REKD 3X1TA 3AZMA 1P3BD 3KSYA 5GT3D 1ULYA 2Y2OA 5B0YB 3MNNB 3H0MC 3LELA 4H9NA 5G49B 3X1SD 3MGQD 1S32A 1P3IB 5BNVA 3UTAB 2BYKB 2Y2MA 2Y2IA 2F8NK 1KX5A 5AVCA 1T3UA 5B1LA 1U35A 3NQUB 3X1TC 3AZMC 4QLCA 3W98C 5JRGC 4J8WD 1KX3D 1EQZC 5GT0A 1S32C 3LELC 1HQ3C 1P3LA 5B24D 3AV2B 2NQBD 5B31A 5B32D 1W2EA 2BG1A 5B0ZB 5BS7A 1P3OD 4M6BA 3MGPA 5B2JA 3UT9A 5AVCC 5B1LC 1U35C 5JA4A 4QLCC 3IP4C 3P5JB 3LJAB 3AZLD 4J8XC 3NQJB 4J8UC 5GT0C 4G91C 1TZYA 5B33A 3AZID 3W99A 1ID3B 5B31C 3AFAB 5BS7C 3AZGA 3AZHD 4YS3A 5AVBB 3UT9C 3REHD 4AWLC 4J8VD 5B2IA 3WTPB 5GXQC 4H9RB 5B33C 3AZED 3REKB 4WNNB 5CPKD 4YM6D 2Y2QA 2Y2LA 2JSSA 1F66A 3AN2A 4CSRB 1KX4B 1WWSA 3X1SB 3MGQB 1M19D 2FJ7A 4YS3C 3W97A 5B32G 3B6FD 3UTBD 5B2IC 1BFMA 5AV6D 1P3GD 5BO0A 1P3MA 2IO5C 3AYWB 1N1JB 3TU4D 4LD9B 3REID 4NFTA 5AV5D 4XUJC 5AV8A 4J8WB 3KXBB 5CPID 3WA9A 1KX3B 5BNXA 4JJNB 1F66C 3AN2C 4X23A 5AV9A 3B0CT 3LZ1D 3KUYC 2FJ7C 5B40D 3W97C 3A6NA 3MVDA 1H3OA 1P3MC 2FFFB 3VH5T 3AV1A 2LY8A 4ZBJC 1P34D 3LZ0B 1P3KA 2Y2HA 3VH6W 4R8PA 3EG5B 3MGSB 3WA9C 1M18D 2ZY5A 1P3PB 5GSUB 3AZIB 3RELD 3AZKC 5AV9C 1AOIB 3A6NC 3C1BD 4Z66C 3WKJB 3C1CA 3MGRA 3REHB 1P3KC 4R8PC 4H9QB 1BH9B 5BT1C 3F6TA 3EPHA 3AZNC 3AZFC 4Z2MH 1M1AA 5CPKB 4YM6B 3X1TD 3AZMD 4ZUXA 3AZJB 2PYOB 4KGCB 2CV5C 1BH8B 3C1CC 2VQRA 5CPJA 3V9RA 3KWQA 3LELD 1S32D 1B67A 5B1MB 5KDMB 3R45B 1B6WA 2JE5A 5AV6B 1WWIA 2Y2PA 2G5HC 1KX5D 3W96A 5AVCD 5B1LD 1U35D 3X1VC 1M1AC 4WV4B 4QLCD 4ZUXC 5DNNB 1ZLAB 3WAAC 2HUEB 5DNMB 5GT0D 3VH6A 5CPJC 3LZ1B 1P3LD 3B0DB 5B31D 3VH5A 2HIOB 3MGPD 5B2JD 5B0YA 4KHAA 3MNNA 5JRGA 3W98A 4KUDC 3UT9D 1KU5A 2Y2GA 3W96C 3REJB 1P3IA 1EQZA 2AROB 2F8NH 2BYKA 4E44A 1HQ3A 1JFIA 2DQNC 1TZYD 3W99D 5B33D 5AY8B 4DQYB 4WU8C 3FDDA 3NQUA 3C1BB 5C3IB 3AZGD 4EO5B 5B0YC 3MNNC 4YS3D 4J8XA 1P3IC 4J8UA 3UTAC 3EPKA 3AV2A 4G92B 5B2ID 5F99B 4H9OB 1P3AB 1P3FB 4XZQB 3O62B 4Z5TB 3NQJA 1F66D 3AN2D 2F8NA 5GXQA 2FJ7D 5CP6B 3W97D 5B31G 3AV2C 5B0ZC 2NZDA 1P3MD 1KX5B 5E5AB 2F8NG 5AVBA 3WTPA 4WU9B 5AV8D 3WA9D 4X23D 1P3LB 5AV9D 4H9RA 4NE6A 3A1IA 3A6ND 3MVDD 1ID3C 5CHLB 2NZDC 3MGPB 3AV1D 5B2JB 4CSRA 1P3BB 1KX4A 4XUJA 5AVBC 5JA4B 4CAYB 1P3KD 5GT3B 3B6GB 4R8PD 3WTPC 2ZM5A 3KUYA 5BT1D 3AYWA 3H0LC 1N1JA 1TZYB 3W99B 4LD9A 3REKC 3KXBA 3AZGB 4JJNA 3C1CD 1KX4C 3MGQC 3X1SC 3MGRD 2XD5A 4WJ3C 2J8PA 3AZKA 3VH6T 5B24B 2NQBB 2RVQC 3AYWC 5B32B 4Z66A 3LZ0A 1P3OB 1M1AD 4H9PA 4LD9C 4ZUXD 3MGSA 4J8WC 3KXBC 1KX3C 4JJNC 1TAFA 5CPJD 2YFVB 3KWQD 1P3PA 5GSUA 2FJ7B 3AZLB 1AOIA 3AZNA 3AZFA 5BO0B 3WKJA 2CV5A 3W96D 3EPLA 2BYMA 3LZ0C 3AZHB 5AV8B 4H9QA 3MGSC 4X23B 4J8VB 1Z2CB 4E45A 1P3PC 5GSUC 3AZIC 1AOIC 2RIQA 4HGAB 3MVDB 3AZJA 2PYOA 4KGCA 3AZEB 3X1VA 3WKJC 3B0CW 3AV1B 1BH8A 5B0YD 3W98D 3MNND 5JRGD 5B1MA 3EPJA 1P3ID 3WAAA 5KDMA 3REHC 1EQZD 3R45A 1M19B 1HQ3D 3X1UA 3B6FB 3UTBB 1P3GB 5CPKC 4YM6C 3TU4B 4KUDA 3AZJC 5DNNA 1ZLAA 2PYOC 4KGCC 2YFWA 5DNMA 3REIB 5AV5B 4UUZB 5CPIB 5B1MC 4H9SC 3MGRB 4J8XD 4J8UD 3AV2D 5AV6C 3X1UC 4WU8A 2HIOA 5B40B 1M1AB 3REJA 2AROA 1P34B 5G49A 5DNNC 1ZLAC 2W8SA 3UTAA 2HUEC 2F8ND 3V9RB 5DNMC 3KWQB 5GXQD 5AY8A 3LZ1C 1M18B 3B0DC 3RELB 2NZDD 4Z2MG
chains in the Genus database with same CATH topology
2HIOC 5FUGB 5AVBD 2DF4C 3REJC 2AROC 3WTPD 3B6GD 1PZRA 5F99A 3AL0C 1P3AA 5B0ZA 5AY8C 1P3FA 4XZQA 3O62A 3C1BC 5C3IC 3X1TB 4Z5TA 3AZMB 3A1KA 4KHAB 2JCHA 5JRGB 1KX4D 4XUJD 4EO5C 3W98B 3LJAA 5CP6A 1EQZB 2ZY4A 1S32B 3LELB 1HQ3B 4G92C 4H9NB 3KUYD 5BNVB 2RVQD 5F99C 1JFIB 2L5AA 3AYWD 1P3AC 1ID3A 5E5AA 3AFAA 4LD9D 1P3FC 4XZQC 3O62C 4WU9A 5AVCB 5B1LB 1U35B 3KXBD 3KFUG 4JJND 4Z5TC 4QLCB 3LJAC 5CP6C 4J8XB 3WTPE 4J8UB 5GT0B 4G91B 3AZKD 3REKA 4WNNA 1P3BA 5B31B 1KX5C 4Z66D 5E5AC 3LZ0D 2Y2JA 4CAYA 2CWEA 2Y2KA 5GT3A 3AFAC 3B6GA 3X1SA 3MGQA 3UT9B 3MGSD 4WU9C 2F8NB 4AWLB 4DRAA 5GXQB 1P3PD 5GSUD 1P3LC 1AOID 3AZND 3AZFD 2NZDB 5B33B 3WKJD 3MGPC 2UWXA 4NE5A 5B2JC 1P3BC 2CV5D 4J8WA 1KX3A 5GT3C 3B6GC 4YS3B 5B24A 2NQBA 5B2IB 5B32A 1TZYC 3W99C 1P3OA 2IO5B 3AZJD 2PYOD 4KGCD 3X1VD 3AZGC 4XUJB 2YFVA 5B1MD 3AZLA 3WAAD 1F66B 3AN2B 3KUYB 3X1UD 3AZIA 3W97B 5B24C 2NQBC 5B32C 1P3MB 1P3OC 3AZHA 4ZBJB 4KUDD 5DNND 1ZLAD 3REHA 2XD1A 5DNMD 4J8VA 3WA9B 3AZLC 1BH9A 5BNXB 3AZKB 5AV9B 3AZEA 3B0BA 4WU8D 5CPKA 2HIOD 4YM6A 3A6NB 4Z66B 1H3OB 4H9PB 3REJD 2AROD 3AZHC 1F1EA 1A7WA 1M19A 5AV8C 4H9SA 1P3KB 1TAFB 3UTAD 3B6FA 4X23C 4R8PB 3VH5W 5AV6A 4J8VC 5AY8D 3UTBA 1P3GA 3AZNB 3AZFB 4HGAC 3MVDC 3TU4A 2ZY2A 3AZEC 2ZY3A 3REIA 3AV1C 5AV5A 3H0RC 4UUZA 5CPIA 2CV5B 2BYMB 3C1CB 3LZ1A 1M19C 4UPKA 5F99D 4WZSB 1HTAA 5B40A 1P3AD 3B6FC 5B0ZD 3UTBC 1P3GC 2F2AC 1P3FD 4XZQD 3O62D 3TU4C 2Y2NA 1P34A 3X1VB 4Z5TD 3REIC 4ZUXB 5AV5C 5CPIC 5CP6D 3LJAD 2G5IC 3MGRC 1M18A 3WAAB 5CPJB 3X1UB 3RELA 4NE3A 5FUGA 5B40C 3C1BA 1ID3D 5E5AD 3AFAD 1Q9CA 4KUDB 4WU9D 3W96B 1P34C 2YFWB 3KWQC 1M18C 4H9OA 4DRBA 1R4VA 3RELC 4WU8B 3REKD 3X1TA 3AZMA 1P3BD 3KSYA 5GT3D 1ULYA 2Y2OA 5B0YB 3MNNB 3H0MC 3LELA 4H9NA 5G49B 3X1SD 3MGQD 1S32A 1P3IB 5BNVA 3UTAB 2BYKB 2Y2MA 2Y2IA 2F8NK 1KX5A 5AVCA 1T3UA 5B1LA 1U35A 3NQUB 3X1TC 3AZMC 4QLCA 3W98C 5JRGC 4J8WD 1KX3D 1EQZC 5GT0A 1S32C 3LELC 1HQ3C 1P3LA 5B24D 3AV2B 2NQBD 5B31A 5B32D 1W2EA 2BG1A 5B0ZB 5BS7A 1P3OD 4M6BA 3MGPA 5B2JA 3UT9A 5AVCC 5B1LC 1U35C 5JA4A 4QLCC 3IP4C 3P5JB 3LJAB 3AZLD 4J8XC 3NQJB 4J8UC 5GT0C 4G91C 1TZYA 5B33A 3AZID 3W99A 1ID3B 5B31C 3AFAB 5BS7C 3AZGA 3AZHD 4YS3A 5AVBB 3UT9C 3REHD 4AWLC 4J8VD 5B2IA 3WTPB 5GXQC 4H9RB 5B33C 3AZED 3REKB 4WNNB 5CPKD 4YM6D 2Y2QA 2Y2LA 2JSSA 1F66A 3AN2A 4CSRB 1KX4B 1WWSA 3X1SB 3MGQB 1M19D 2FJ7A 4YS3C 3W97A 5B32G 3B6FD 3UTBD 5B2IC 1BFMA 5AV6D 1P3GD 5BO0A 1P3MA 2IO5C 3AYWB 1N1JB 3TU4D 4LD9B 3REID 4NFTA 5AV5D 4XUJC 5AV8A 4J8WB 3KXBB 5CPID 3WA9A 1KX3B 5BNXA 4JJNB 1F66C 3AN2C 4X23A 5AV9A 3B0CT 3LZ1D 3KUYC 2FJ7C 5B40D 3W97C 3A6NA 3MVDA 1H3OA 1P3MC 2FFFB 3VH5T 3AV1A 2LY8A 4ZBJC 1P34D 3LZ0B 1P3KA 2Y2HA 3VH6W 4R8PA 3EG5B 3MGSB 3WA9C 1M18D 2ZY5A 1P3PB 5GSUB 3AZIB 3RELD 3AZKC 5AV9C 1AOIB 3A6NC 3C1BD 4Z66C 3WKJB 3C1CA 3MGRA 3REHB 1P3KC 4R8PC 4H9QB 1BH9B 5BT1C 3F6TA 3EPHA 3AZNC 3AZFC 4Z2MH 1M1AA 5CPKB 4YM6B 3X1TD 3AZMD 4ZUXA 3AZJB 2PYOB 4KGCB 2CV5C 1BH8B 3C1CC 2VQRA 5CPJA 3V9RA 3KWQA 3LELD 1S32D 1B67A 5B1MB 5KDMB 3R45B 1B6WA 2JE5A 5AV6B 1WWIA 2Y2PA 2G5HC 1KX5D 3W96A 5AVCD 5B1LD 1U35D 3X1VC 1M1AC 4WV4B 4QLCD 4ZUXC 5DNNB 1ZLAB 3WAAC 2HUEB 5DNMB 5GT0D 3VH6A 5CPJC 3LZ1B 1P3LD 3B0DB 5B31D 3VH5A 2HIOB 3MGPD 5B2JD 5B0YA 4KHAA 3MNNA 5JRGA 3W98A 4KUDC 3UT9D 1KU5A 2Y2GA 3W96C 3REJB 1P3IA 1EQZA 2AROB 2F8NH 2BYKA 4E44A 1HQ3A 1JFIA 2DQNC 1TZYD 3W99D 5B33D 5AY8B 4DQYB 4WU8C 3FDDA 3NQUA 3C1BB 5C3IB 3AZGD 4EO5B 5B0YC 3MNNC 4YS3D 4J8XA 1P3IC 4J8UA 3UTAC 3EPKA 3AV2A 4G92B 5B2ID 5F99B 4H9OB 1P3AB 1P3FB 4XZQB 3O62B 4Z5TB 3NQJA 1F66D 3AN2D 2F8NA 5GXQA 2FJ7D 5CP6B 3W97D 5B31G 3AV2C 5B0ZC 2NZDA 1P3MD 1KX5B 5E5AB 2F8NG 5AVBA 3WTPA 4WU9B 5AV8D 3WA9D 4X23D 1P3LB 5AV9D 4H9RA 4NE6A 3A1IA 3A6ND 3MVDD 1ID3C 5CHLB 2NZDC 3MGPB 3AV1D 5B2JB 4CSRA 1P3BB 1KX4A 4XUJA 5AVBC 5JA4B 4CAYB 1P3KD 5GT3B 3B6GB 4R8PD 3WTPC 2ZM5A 3KUYA 5BT1D 3AYWA 3H0LC 1N1JA 1TZYB 3W99B 4LD9A 3REKC 3KXBA 3AZGB 4JJNA 3C1CD 1KX4C 3MGQC 3X1SC 3MGRD 2XD5A 4WJ3C 2J8PA 3AZKA 3VH6T 5B24B 2NQBB 2RVQC 3AYWC 5B32B 4Z66A 3LZ0A 1P3OB 1M1AD 4H9PA 4LD9C 4ZUXD 3MGSA 4J8WC 3KXBC 1KX3C 4JJNC 1TAFA 5CPJD 2YFVB 3KWQD 1P3PA 5GSUA 2FJ7B 3AZLB 1AOIA 3AZNA 3AZFA 5BO0B 3WKJA 2CV5A 3W96D 3EPLA 2BYMA 3LZ0C 3AZHB 5AV8B 4H9QA 3MGSC 4X23B 4J8VB 1Z2CB 4E45A 1P3PC 5GSUC 3AZIC 1AOIC 2RIQA 4HGAB 3MVDB 3AZJA 2PYOA 4KGCA 3AZEB 3X1VA 3WKJC 3B0CW 3AV1B 1BH8A 5B0YD 3W98D 3MNND 5JRGD 5B1MA 3EPJA 1P3ID 3WAAA 5KDMA 3REHC 1EQZD 3R45A 1M19B 1HQ3D 3X1UA 3B6FB 3UTBB 1P3GB 5CPKC 4YM6C 3TU4B 4KUDA 3AZJC 5DNNA 1ZLAA 2PYOC 4KGCC 2YFWA 5DNMA 3REIB 5AV5B 4UUZB 5CPIB 5B1MC 4H9SC 3MGRB 4J8XD 4J8UD 3AV2D 5AV6C 3X1UC 4WU8A 2HIOA 5B40B 1M1AB 3REJA 2AROA 1P34B 5G49A 5DNNC 1ZLAC 2W8SA 3UTAA 2HUEC 2F8ND 3V9RB 5DNMC 3KWQB 5GXQD 5AY8A 3LZ1C 1M18B 3B0DC 3RELB 2NZDD 4Z2MG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO C;  5FUG B;  5AVB D;  3REJ C;  2ARO C;  3WTP D;  5F99 A;  1P3A A;  5B0Z A;  5AY8 C;  1P3F A;  4XZQ A;  3O62 A;  3C1B C;  5C3I C;  3X1T B;  4Z5T A;  3AZM B;  4KHA B;  1KX4 D;  5JRG B;  3W98 B;  4XUJ D;  4EO5 C;  3LJA A;  5CP6 A;  1EQZ B;  1S32 B;  3LEL B;  1HQ3 B;  4G92 C;  4H9N B;  3KUY D;  5BNV B;  2RVQ D;  5F99 C;  1JFI B;  2L5A A;  3AYW D;  1P3A C;  1ID3 A;  5E5A A;  3AFA A;  4LD9 D;  1P3F C;  4XZQ C;  3O62 C;  4WU9 A;  5AVC B;  5B1L B;  1U35 B;  3KXB D;  4JJN D;  4Z5T C;  4QLC B;  3LJA C;  5CP6 C;  4J8X B;  3WTP E;  4J8U B;  5GT0 B;  4G91 B;  3AZK D;  3REK A;  4WNN A;  1P3B A;  5B31 B;  1KX5 C;  4Z66 D;  5E5A C;  3LZ0 D;  4CAY A;  3AFA C;  2CWE A;  5GT3 A;  3B6G A;  3X1S A;  3MGQ A;  3UT9 B;  3MGS D;  4WU9 C;  2F8N B;  4AWL B;  4DRA A;  5GXQ B;  1P3P D;  5GSU D;  1P3L C;  1AOI D;  3AZN D;  3AZF D;  2NZD B;  5B33 B;  3WKJ D;  3MGP C;  4NE5 A;  5B2J C;  1P3B C;  2CV5 D;  4J8W A;  1KX3 A;  5GT3 C;  3B6G C;  4YS3 B;  5B24 A;  2NQB A;  5B2I B;  5B32 A;  1TZY C;  3W99 C;  1P3O A;  2IO5 B;  3AZJ D;  2PYO D;  4KGC D;  3X1V D;  3AZG C;  2YFV A;  4XUJ B;  5B1M D;  3AZL A;  3WAA D;  1F66 B;  3AN2 B;  3KUY B;  3X1U D;  3AZI A;  3W97 B;  5B24 C;  2NQB C;  5B32 C;  1P3M B;  1P3O C;  3AZH A;  4ZBJ B;  4KUD D;  5DNN D;  1ZLA D;  3REH A;  5DNM D;  4J8V A;  3WA9 B;  3AZL C;  1BH9 A;  5BNX B;  3AZK B;  5AV9 B;  3AZE A;  3B0B A;  4WU8 D;  5CPK A;  2HIO D;  4YM6 A;  3A6N B;  4Z66 B;  1H3O B;  4H9P B;  3REJ D;  2ARO D;  3AZH C;  1F1E A;  1A7W A;  1M19 A;  5AV8 C;  4H9S A;  1P3K B;  1TAF B;  3UTA D;  3B6F A;  4X23 C;  4R8P B;  3VH5 W;  5AV6 A;  4J8V C;  5AY8 D;  3UTB A;  1P3G A;  3AZN B;  3AZF B;  4HGA C;  3MVD C;  3TU4 A;  3AZE C;  3REI A;  3AV1 C;  5AV5 A;  4UUZ A;  5CPI A;  2CV5 B;  2BYM B;  3C1C B;  3LZ1 A;  1M19 C;  4WZS B;  5F99 D;  1HTA A;  5B40 A;  1P3A D;  3B6F C;  5B0Z D;  3UTB C;  1P3G C;  1P3F D;  4XZQ D;  3O62 D;  3TU4 C;  1P34 A;  3X1V B;  4Z5T D;  3REI C;  4ZUX B;  5AV5 C;  5CPI C;  5CP6 D;  3LJA D;  3MGR C;  3WAA B;  1M18 A;  5CPJ B;  3X1U B;  3REL A;  4NE3 A;  5FUG A;  5B40 C;  3C1B A;  1ID3 D;  5E5A D;  3AFA D;  1Q9C A;  4KUD B;  4WU9 D;  3W96 B;  1P34 C;  2YFW B;  3KWQ C;  1M18 C;  4H9O A;  4DRB A;  1R4V A;  3REL C;  4WU8 B;  3REK D;  3X1T A;  3AZM A;  1P3B D;  3KSY A;  5GT3 D;  1ULY A;  5B0Y B;  1S32 A;  3MNN B;  3LEL A;  3B6G D;  4H9N A;  5G49 B;  3X1S D;  3MGQ D;  1P3I B;  5BNV A;  3UTA B;  2BYK B;  2F8N K;  1KX5 A;  5AVC A;  5B1L A;  1U35 A;  3NQU B;  3X1T C;  3AZM C;  4QLC A;  3W98 C;  5JRG C;  4J8W D;  1KX3 D;  1EQZ C;  5GT0 A;  1S32 C;  3LEL C;  1HQ3 C;  1P3L A;  5B24 D;  3AV2 B;  2NQB D;  5B31 A;  5B32 D;  5B0Z B;  5BS7 A;  1P3O D;  4M6B A;  3MGP A;  5B2J A;  3UT9 A;  5AVC C;  5B1L C;  1U35 C;  5JA4 A;  4QLC C;  3LJA B;  3AZL D;  4J8X C;  3NQJ B;  4J8U C;  5GT0 C;  4G91 C;  1TZY A;  5B33 A;  3AZI D;  3W99 A;  1ID3 B;  5B31 C;  3AFA B;  5BS7 C;  3AZG A;  3AZH D;  4YS3 A;  5AVB B;  3UT9 C;  3REH D;  4AWL C;  4J8V D;  5B2I A;  3WTP B;  5GXQ C;  4H9R B;  5B33 C;  3AZE D;  3REK B;  4WNN B;  5CPK D;  4YM6 D;  2JSS A;  1F66 A;  3AN2 A;  4CSR B;  1KX4 B;  1WWS A;  3X1S B;  3MGQ B;  1M19 D;  2FJ7 A;  4YS3 C;  3W97 A;  5B32 G;  3B6F D;  3UTB D;  5B2I C;  1BFM A;  5AV6 D;  1P3G D;  5BO0 A;  1P3M A;  2IO5 C;  3AYW B;  1N1J B;  3TU4 D;  4LD9 B;  3REI D;  4NFT A;  5AV5 D;  4XUJ C;  5AV8 A;  4J8W B;  3KXB B;  5CPI D;  3WA9 A;  1KX3 B;  5BNX A;  4JJN B;  1F66 C;  3AN2 C;  4X23 A;  5AV9 A;  3B0C T;  3LZ1 D;  3KUY C;  2FJ7 C;  5B40 D;  3W97 C;  3A6N A;  3MVD A;  1H3O A;  1P3M C;  3VH5 T;  3AV1 A;  2LY8 A;  4ZBJ C;  1P34 D;  3LZ0 B;  1P3K A;  3VH6 W;  4R8P A;  3MGS B;  3WA9 C;  1M18 D;  1P3P B;  5GSU B;  3AZI B;  3REL D;  3AZK C;  5AV9 C;  1AOI B;  3A6N C;  3C1B D;  4Z66 C;  3WKJ B;  3C1C A;  3MGR A;  3REH B;  1P3K C;  4R8P C;  4H9Q B;  1BH9 B;  5BT1 C;  3AZN C;  3AZF C;  4Z2M H;  1M1A A;  5CPK B;  4YM6 B;  3X1T D;  3AZM D;  4ZUX A;  3AZJ B;  2PYO B;  4KGC B;  2CV5 C;  1BH8 B;  3C1C C;  5CPJ A;  3V9R A;  3KWQ A;  3LEL D;  1S32 D;  1B67 A;  5B1M B;  5KDM B;  3R45 B;  1B6W A;  5AV6 B;  1WWI A;  1KX5 D;  3W96 A;  5AVC D;  5B1L D;  1U35 D;  3X1V C;  1M1A C;  4WV4 B;  4QLC D;  4ZUX C;  5DNN B;  1ZLA B;  3WAA C;  2HUE B;  5DNM B;  5GT0 D;  3VH6 A;  5CPJ C;  3LZ1 B;  1P3L D;  3B0D B;  5B31 D;  3VH5 A;  2HIO B;  3MGP D;  5B2J D;  5B0Y A;  4KHA A;  3MNN A;  5JRG A;  3W98 A;  4KUD C;  3UT9 D;  1KU5 A;  3W96 C;  3REJ B;  1P3I A;  2F8N H;  1EQZ A;  2ARO B;  2BYK A;  4E44 A;  1HQ3 A;  1JFI A;  1TZY D;  3W99 D;  5B33 D;  5AY8 B;  4WU8 C;  3NQU A;  3C1B B;  5C3I B;  3AZG D;  4EO5 B;  5B0Y C;  3MNN C;  4YS3 D;  4J8X A;  1P3I C;  4J8U A;  3UTA C;  3AV2 A;  4G92 B;  5B2I D;  5F99 B;  4H9O B;  1P3A B;  1P3F B;  4XZQ B;  3O62 B;  4Z5T B;  3NQJ A;  1F66 D;  3AN2 D;  2F8N A;  5GXQ A;  2FJ7 D;  5CP6 B;  3W97 D;  5B31 G;  3AV2 C;  5B0Z C;  2NZD A;  1P3M D;  1KX5 B;  5E5A B;  2F8N G;  5AVB A;  3WTP A;  4WU9 B;  5AV8 D;  3WA9 D;  4X23 D;  1P3L B;  5AV9 D;  4H9R A;  4NE6 A;  3A6N D;  3MVD D;  1ID3 C;  5CHL B;  2NZD C;  3MGP B;  3AV1 D;  5B2J B;  4CSR A;  1P3B B;  1KX4 A;  4XUJ A;  5AVB C;  5JA4 B;  4CAY B;  1P3K D;  5GT3 B;  3B6G B;  4R8P D;  3WTP C;  3KUY A;  5BT1 D;  3AYW A;  1N1J A;  1TZY B;  3W99 B;  4LD9 A;  3REK C;  3KXB A;  3AZG B;  4JJN A;  3C1C D;  1KX4 C;  3MGQ C;  3X1S C;  3MGR D;  3AZK A;  3VH6 T;  5B24 B;  2NQB B;  2RVQ C;  3AYW C;  5B32 B;  4Z66 A;  3LZ0 A;  1P3O B;  1M1A D;  4H9P A;  4LD9 C;  4ZUX D;  3MGS A;  4J8W C;  3KXB C;  1KX3 C;  4JJN C;  1TAF A;  5CPJ D;  2YFV B;  3KWQ D;  1P3P A;  5GSU A;  2FJ7 B;  3AZL B;  1AOI A;  3AZN A;  3AZF A;  5BO0 B;  3WKJ A;  2CV5 A;  3W96 D;  2BYM A;  3LZ0 C;  3AZH B;  5AV8 B;  4H9Q A;  3MGS C;  4X23 B;  4J8V B;  4E45 A;  1P3P C;  5GSU C;  3AZI C;  1AOI C;  4HGA B;  3MVD B;  3AZJ A;  2PYO A;  4KGC A;  3AZE B;  3X1V A;  3WKJ C;  3B0C W;  3AV1 B;  1BH8 A;  5B0Y D;  3W98 D;  3MNN D;  5JRG D;  5B1M A;  1P3I D;  3WAA A;  5KDM A;  3REH C;  1EQZ D;  3R45 A;  1M19 B;  1HQ3 D;  3X1U A;  3B6F B;  3UTB B;  1P3G B;  5CPK C;  4YM6 C;  3TU4 B;  4KUD A;  3AZJ C;  5DNN A;  1ZLA A;  2PYO C;  4KGC C;  2YFW A;  5DNM A;  3REI B;  5AV5 B;  4UUZ B;  5CPI B;  5B1M C;  4H9S C;  3MGR B;  4J8X D;  4J8U D;  3AV2 D;  5AV6 C;  3X1U C;  4WU8 A;  2HIO A;  5B40 B;  1M1A B;  3REJ A;  2ARO A;  1P34 B;  5G49 A;  5DNN C;  1ZLA C;  3UTA A;  2HUE C;  2F8N D;  3V9R B;  5DNM C;  3KWQ B;  5GXQ D;  5AY8 A;  3LZ1 C;  1M18 B;  3B0D C;  3REL B;  2NZD D;  4Z2M G; 
#chains in the Genus database with same CATH topology
 2HIO C;  5FUG B;  5AVB D;  2DF4 C;  3REJ C;  2ARO C;  3WTP D;  3B6G D;  1PZR A;  5F99 A;  3AL0 C;  1P3A A;  5B0Z A;  5AY8 C;  1P3F A;  4XZQ A;  3O62 A;  3C1B C;  5C3I C;  3X1T B;  4Z5T A;  3AZM B;  3A1K A;  4KHA B;  2JCH A;  5JRG B;  1KX4 D;  4XUJ D;  4EO5 C;  3W98 B;  3LJA A;  5CP6 A;  1EQZ B;  2ZY4 A;  1S32 B;  3LEL B;  1HQ3 B;  4G92 C;  4H9N B;  3KUY D;  5BNV B;  2RVQ D;  5F99 C;  1JFI B;  2L5A A;  3AYW D;  1P3A C;  1ID3 A;  5E5A A;  3AFA A;  4LD9 D;  1P3F C;  4XZQ C;  3O62 C;  4WU9 A;  5AVC B;  5B1L B;  1U35 B;  3KXB D;  3KFU G;  4JJN D;  4Z5T C;  4QLC B;  3LJA C;  5CP6 C;  4J8X B;  3WTP E;  4J8U B;  5GT0 B;  4G91 B;  3AZK D;  3REK A;  4WNN A;  1P3B A;  5B31 B;  1KX5 C;  4Z66 D;  5E5A C;  3LZ0 D;  2Y2J A;  4CAY A;  2CWE A;  2Y2K A;  5GT3 A;  3AFA C;  3B6G A;  3X1S A;  3MGQ A;  3UT9 B;  3MGS D;  4WU9 C;  2F8N B;  4AWL B;  4DRA A;  5GXQ B;  1P3P D;  5GSU D;  1P3L C;  1AOI D;  3AZN D;  3AZF D;  2NZD B;  5B33 B;  3WKJ D;  3MGP C;  2UWX A;  4NE5 A;  5B2J C;  1P3B C;  2CV5 D;  4J8W A;  1KX3 A;  5GT3 C;  3B6G C;  4YS3 B;  5B24 A;  2NQB A;  5B2I B;  5B32 A;  1TZY C;  3W99 C;  1P3O A;  2IO5 B;  3AZJ D;  2PYO D;  4KGC D;  3X1V D;  3AZG C;  4XUJ B;  2YFV A;  5B1M D;  3AZL A;  3WAA D;  1F66 B;  3AN2 B;  3KUY B;  3X1U D;  3AZI A;  3W97 B;  5B24 C;  2NQB C;  5B32 C;  1P3M B;  1P3O C;  3AZH A;  4ZBJ B;  4KUD D;  5DNN D;  1ZLA D;  3REH A;  2XD1 A;  5DNM D;  4J8V A;  3WA9 B;  3AZL C;  1BH9 A;  5BNX B;  3AZK B;  5AV9 B;  3AZE A;  3B0B A;  4WU8 D;  5CPK A;  2HIO D;  4YM6 A;  3A6N B;  4Z66 B;  1H3O B;  4H9P B;  3REJ D;  2ARO D;  3AZH C;  1F1E A;  1A7W A;  1M19 A;  5AV8 C;  4H9S A;  1P3K B;  1TAF B;  3UTA D;  3B6F A;  4X23 C;  4R8P B;  3VH5 W;  5AV6 A;  4J8V C;  5AY8 D;  3UTB A;  1P3G A;  3AZN B;  3AZF B;  4HGA C;  3MVD C;  3TU4 A;  2ZY2 A;  3AZE C;  2ZY3 A;  3REI A;  3AV1 C;  5AV5 A;  3H0R C;  4UUZ A;  5CPI A;  2CV5 B;  2BYM B;  3C1C B;  3LZ1 A;  1M19 C;  4UPK A;  5F99 D;  4WZS B;  1HTA A;  5B40 A;  1P3A D;  3B6F C;  5B0Z D;  3UTB C;  1P3G C;  2F2A C;  1P3F D;  4XZQ D;  3O62 D;  3TU4 C;  2Y2N A;  1P34 A;  3X1V B;  4Z5T D;  3REI C;  4ZUX B;  5AV5 C;  5CPI C;  5CP6 D;  3LJA D;  2G5I C;  3MGR C;  1M18 A;  3WAA B;  5CPJ B;  3X1U B;  3REL A;  4NE3 A;  5FUG A;  5B40 C;  3C1B A;  1ID3 D;  5E5A D;  3AFA D;  1Q9C A;  4KUD B;  4WU9 D;  3W96 B;  1P34 C;  2YFW B;  3KWQ C;  1M18 C;  4H9O A;  4DRB A;  1R4V A;  3REL C;  4WU8 B;  3REK D;  3X1T A;  3AZM A;  1P3B D;  3KSY A;  5GT3 D;  1ULY A;  2Y2O A;  5B0Y B;  3MNN B;  3H0M C;  3LEL A;  4H9N A;  5G49 B;  3X1S D;  3MGQ D;  1S32 A;  1P3I B;  5BNV A;  3UTA B;  2BYK B;  2Y2M A;  2Y2I A;  2F8N K;  1KX5 A;  5AVC A;  1T3U A;  5B1L A;  1U35 A;  3NQU B;  3X1T C;  3AZM C;  4QLC A;  3W98 C;  5JRG C;  4J8W D;  1KX3 D;  1EQZ C;  5GT0 A;  1S32 C;  3LEL C;  1HQ3 C;  1P3L A;  5B24 D;  3AV2 B;  2NQB D;  5B31 A;  5B32 D;  1W2E A;  2BG1 A;  5B0Z B;  5BS7 A;  1P3O D;  4M6B A;  3MGP A;  5B2J A;  3UT9 A;  5AVC C;  5B1L C;  1U35 C;  5JA4 A;  4QLC C;  3IP4 C;  3P5J B;  3LJA B;  3AZL D;  4J8X C;  3NQJ B;  4J8U C;  5GT0 C;  4G91 C;  1TZY A;  5B33 A;  3AZI D;  3W99 A;  1ID3 B;  5B31 C;  3AFA B;  5BS7 C;  3AZG A;  3AZH D;  4YS3 A;  5AVB B;  3UT9 C;  3REH D;  4AWL C;  4J8V D;  5B2I A;  3WTP B;  5GXQ C;  4H9R B;  5B33 C;  3AZE D;  3REK B;  4WNN B;  5CPK D;  4YM6 D;  2Y2Q A;  2Y2L A;  2JSS A;  1F66 A;  3AN2 A;  4CSR B;  1KX4 B;  1WWS A;  3X1S B;  3MGQ B;  1M19 D;  2FJ7 A;  4YS3 C;  3W97 A;  5B32 G;  3B6F D;  3UTB D;  5B2I C;  1BFM A;  5AV6 D;  1P3G D;  5BO0 A;  1P3M A;  2IO5 C;  3AYW B;  1N1J B;  3TU4 D;  4LD9 B;  3REI D;  4NFT A;  5AV5 D;  4XUJ C;  5AV8 A;  4J8W B;  3KXB B;  5CPI D;  3WA9 A;  1KX3 B;  5BNX A;  4JJN B;  1F66 C;  3AN2 C;  4X23 A;  5AV9 A;  3B0C T;  3LZ1 D;  3KUY C;  2FJ7 C;  5B40 D;  3W97 C;  3A6N A;  3MVD A;  1H3O A;  1P3M C;  2FFF B;  3VH5 T;  3AV1 A;  2LY8 A;  4ZBJ C;  1P34 D;  3LZ0 B;  1P3K A;  2Y2H A;  3VH6 W;  4R8P A;  3EG5 B;  3MGS B;  3WA9 C;  1M18 D;  2ZY5 A;  1P3P B;  5GSU B;  3AZI B;  3REL D;  3AZK C;  5AV9 C;  1AOI B;  3A6N C;  3C1B D;  4Z66 C;  3WKJ B;  3C1C A;  3MGR A;  3REH B;  1P3K C;  4R8P C;  4H9Q B;  1BH9 B;  5BT1 C;  3F6T A;  3EPH A;  3AZN C;  3AZF C;  4Z2M H;  1M1A A;  5CPK B;  4YM6 B;  3X1T D;  3AZM D;  4ZUX A;  3AZJ B;  2PYO B;  4KGC B;  2CV5 C;  1BH8 B;  3C1C C;  2VQR A;  5CPJ A;  3V9R A;  3KWQ A;  3LEL D;  1S32 D;  1B67 A;  5B1M B;  5KDM B;  3R45 B;  1B6W A;  2JE5 A;  5AV6 B;  1WWI A;  2Y2P A;  2G5H C;  1KX5 D;  3W96 A;  5AVC D;  5B1L D;  1U35 D;  3X1V C;  1M1A C;  4WV4 B;  4QLC D;  4ZUX C;  5DNN B;  1ZLA B;  3WAA C;  2HUE B;  5DNM B;  5GT0 D;  3VH6 A;  5CPJ C;  3LZ1 B;  1P3L D;  3B0D B;  5B31 D;  3VH5 A;  2HIO B;  3MGP D;  5B2J D;  5B0Y A;  4KHA A;  3MNN A;  5JRG A;  3W98 A;  4KUD C;  3UT9 D;  1KU5 A;  2Y2G A;  3W96 C;  3REJ B;  1P3I A;  1EQZ A;  2ARO B;  2F8N H;  2BYK A;  4E44 A;  1HQ3 A;  1JFI A;  2DQN C;  1TZY D;  3W99 D;  5B33 D;  5AY8 B;  4DQY B;  4WU8 C;  3FDD A;  3NQU A;  3C1B B;  5C3I B;  3AZG D;  4EO5 B;  5B0Y C;  3MNN C;  4YS3 D;  4J8X A;  1P3I C;  4J8U A;  3UTA C;  3EPK A;  3AV2 A;  4G92 B;  5B2I D;  5F99 B;  4H9O B;  1P3A B;  1P3F B;  4XZQ B;  3O62 B;  4Z5T B;  3NQJ A;  1F66 D;  3AN2 D;  2F8N A;  5GXQ A;  2FJ7 D;  5CP6 B;  3W97 D;  5B31 G;  3AV2 C;  5B0Z C;  2NZD A;  1P3M D;  1KX5 B;  5E5A B;  2F8N G;  5AVB A;  3WTP A;  4WU9 B;  5AV8 D;  3WA9 D;  4X23 D;  1P3L B;  5AV9 D;  4H9R A;  4NE6 A;  3A1I A;  3A6N D;  3MVD D;  1ID3 C;  5CHL B;  2NZD C;  3MGP B;  3AV1 D;  5B2J B;  4CSR A;  1P3B B;  1KX4 A;  4XUJ A;  5AVB C;  5JA4 B;  4CAY B;  1P3K D;  5GT3 B;  3B6G B;  4R8P D;  3WTP C;  2ZM5 A;  3KUY A;  5BT1 D;  3AYW A;  3H0L C;  1N1J A;  1TZY B;  3W99 B;  4LD9 A;  3REK C;  3KXB A;  3AZG B;  4JJN A;  3C1C D;  1KX4 C;  3MGQ C;  3X1S C;  3MGR D;  2XD5 A;  4WJ3 C;  2J8P A;  3AZK A;  3VH6 T;  5B24 B;  2NQB B;  2RVQ C;  3AYW C;  5B32 B;  4Z66 A;  3LZ0 A;  1P3O B;  1M1A D;  4H9P A;  4LD9 C;  4ZUX D;  3MGS A;  4J8W C;  3KXB C;  1KX3 C;  4JJN C;  1TAF A;  5CPJ D;  2YFV B;  3KWQ D;  1P3P A;  5GSU A;  2FJ7 B;  3AZL B;  1AOI A;  3AZN A;  3AZF A;  5BO0 B;  3WKJ A;  2CV5 A;  3W96 D;  3EPL A;  2BYM A;  3LZ0 C;  3AZH B;  5AV8 B;  4H9Q A;  3MGS C;  4X23 B;  4J8V B;  1Z2C B;  4E45 A;  1P3P C;  5GSU C;  3AZI C;  1AOI C;  2RIQ A;  4HGA B;  3MVD B;  3AZJ A;  2PYO A;  4KGC A;  3AZE B;  3X1V A;  3WKJ C;  3B0C W;  3AV1 B;  1BH8 A;  5B0Y D;  3W98 D;  3MNN D;  5JRG D;  5B1M A;  3EPJ A;  1P3I D;  3WAA A;  5KDM A;  3REH C;  1EQZ D;  3R45 A;  1M19 B;  1HQ3 D;  3X1U A;  3B6F B;  3UTB B;  1P3G B;  5CPK C;  4YM6 C;  3TU4 B;  4KUD A;  3AZJ C;  5DNN A;  1ZLA A;  2PYO C;  4KGC C;  2YFW A;  5DNM A;  3REI B;  5AV5 B;  4UUZ B;  5CPI B;  5B1M C;  4H9S C;  3MGR B;  4J8X D;  4J8U D;  3AV2 D;  5AV6 C;  3X1U C;  4WU8 A;  2HIO A;  5B40 B;  1M1A B;  3REJ A;  2ARO A;  1P34 B;  5G49 A;  5DNN C;  1ZLA C;  2W8S A;  3UTA A;  2HUE C;  2F8N D;  3V9R B;  5DNM C;  3KWQ B;  5GXQ D;  5AY8 A;  3LZ1 C;  1M18 B;  3B0D C;  3REL B;  2NZD D;  4Z2M G; 
#chains in the Genus database with same CATH homology
 2HIO C;  5FUG B;  5AVB D;  2DF4 C;  3REJ C;  2ARO C;  3WTP D;  3B6G D;  1PZR A;  5F99 A;  3AL0 C;  1P3A A;  5B0Z A;  5AY8 C;  1P3F A;  4XZQ A;  3O62 A;  3C1B C;  5C3I C;  3X1T B;  4Z5T A;  3AZM B;  3A1K A;  4KHA B;  2JCH A;  5JRG B;  1KX4 D;  4XUJ D;  4EO5 C;  3W98 B;  3LJA A;  5CP6 A;  1EQZ B;  2ZY4 A;  1S32 B;  3LEL B;  1HQ3 B;  4G92 C;  4H9N B;  3KUY D;  5BNV B;  2RVQ D;  5F99 C;  1JFI B;  2L5A A;  3AYW D;  1P3A C;  1ID3 A;  5E5A A;  3AFA A;  4LD9 D;  1P3F C;  4XZQ C;  3O62 C;  4WU9 A;  5AVC B;  5B1L B;  1U35 B;  3KXB D;  3KFU G;  4JJN D;  4Z5T C;  4QLC B;  3LJA C;  5CP6 C;  4J8X B;  3WTP E;  4J8U B;  5GT0 B;  4G91 B;  3AZK D;  3REK A;  4WNN A;  1P3B A;  5B31 B;  1KX5 C;  4Z66 D;  5E5A C;  3LZ0 D;  2Y2J A;  4CAY A;  2CWE A;  2Y2K A;  5GT3 A;  3AFA C;  3B6G A;  3X1S A;  3MGQ A;  3UT9 B;  3MGS D;  4WU9 C;  2F8N B;  4AWL B;  4DRA A;  5GXQ B;  1P3P D;  5GSU D;  1P3L C;  1AOI D;  3AZN D;  3AZF D;  2NZD B;  5B33 B;  3WKJ D;  3MGP C;  2UWX A;  4NE5 A;  5B2J C;  1P3B C;  2CV5 D;  4J8W A;  1KX3 A;  5GT3 C;  3B6G C;  4YS3 B;  5B24 A;  2NQB A;  5B2I B;  5B32 A;  1TZY C;  3W99 C;  1P3O A;  2IO5 B;  3AZJ D;  2PYO D;  4KGC D;  3X1V D;  3AZG C;  4XUJ B;  2YFV A;  5B1M D;  3AZL A;  3WAA D;  1F66 B;  3AN2 B;  3KUY B;  3X1U D;  3AZI A;  3W97 B;  5B24 C;  2NQB C;  5B32 C;  1P3M B;  1P3O C;  3AZH A;  4ZBJ B;  4KUD D;  5DNN D;  1ZLA D;  3REH A;  2XD1 A;  5DNM D;  4J8V A;  3WA9 B;  3AZL C;  1BH9 A;  5BNX B;  3AZK B;  5AV9 B;  3AZE A;  3B0B A;  4WU8 D;  5CPK A;  2HIO D;  4YM6 A;  3A6N B;  4Z66 B;  1H3O B;  4H9P B;  3REJ D;  2ARO D;  3AZH C;  1F1E A;  1A7W A;  1M19 A;  5AV8 C;  4H9S A;  1P3K B;  1TAF B;  3UTA D;  3B6F A;  4X23 C;  4R8P B;  3VH5 W;  5AV6 A;  4J8V C;  5AY8 D;  3UTB A;  1P3G A;  3AZN B;  3AZF B;  4HGA C;  3MVD C;  3TU4 A;  2ZY2 A;  3AZE C;  2ZY3 A;  3REI A;  3AV1 C;  5AV5 A;  3H0R C;  4UUZ A;  5CPI A;  2CV5 B;  2BYM B;  3C1C B;  3LZ1 A;  1M19 C;  4UPK A;  5F99 D;  4WZS B;  1HTA A;  5B40 A;  1P3A D;  3B6F C;  5B0Z D;  3UTB C;  1P3G C;  2F2A C;  1P3F D;  4XZQ D;  3O62 D;  3TU4 C;  2Y2N A;  1P34 A;  3X1V B;  4Z5T D;  3REI C;  4ZUX B;  5AV5 C;  5CPI C;  5CP6 D;  3LJA D;  2G5I C;  3MGR C;  1M18 A;  3WAA B;  5CPJ B;  3X1U B;  3REL A;  4NE3 A;  5FUG A;  5B40 C;  3C1B A;  1ID3 D;  5E5A D;  3AFA D;  1Q9C A;  4KUD B;  4WU9 D;  3W96 B;  1P34 C;  2YFW B;  3KWQ C;  1M18 C;  4H9O A;  4DRB A;  1R4V A;  3REL C;  4WU8 B;  3REK D;  3X1T A;  3AZM A;  1P3B D;  3KSY A;  5GT3 D;  1ULY A;  2Y2O A;  5B0Y B;  3MNN B;  3H0M C;  3LEL A;  4H9N A;  5G49 B;  3X1S D;  3MGQ D;  1S32 A;  1P3I B;  5BNV A;  3UTA B;  2BYK B;  2Y2M A;  2Y2I A;  2F8N K;  1KX5 A;  5AVC A;  1T3U A;  5B1L A;  1U35 A;  3NQU B;  3X1T C;  3AZM C;  4QLC A;  3W98 C;  5JRG C;  4J8W D;  1KX3 D;  1EQZ C;  5GT0 A;  1S32 C;  3LEL C;  1HQ3 C;  1P3L A;  5B24 D;  3AV2 B;  2NQB D;  5B31 A;  5B32 D;  1W2E A;  2BG1 A;  5B0Z B;  5BS7 A;  1P3O D;  4M6B A;  3MGP A;  5B2J A;  3UT9 A;  5AVC C;  5B1L C;  1U35 C;  5JA4 A;  4QLC C;  3IP4 C;  3P5J B;  3LJA B;  3AZL D;  4J8X C;  3NQJ B;  4J8U C;  5GT0 C;  4G91 C;  1TZY A;  5B33 A;  3AZI D;  3W99 A;  1ID3 B;  5B31 C;  3AFA B;  5BS7 C;  3AZG A;  3AZH D;  4YS3 A;  5AVB B;  3UT9 C;  3REH D;  4AWL C;  4J8V D;  5B2I A;  3WTP B;  5GXQ C;  4H9R B;  5B33 C;  3AZE D;  3REK B;  4WNN B;  5CPK D;  4YM6 D;  2Y2Q A;  2Y2L A;  2JSS A;  1F66 A;  3AN2 A;  4CSR B;  1KX4 B;  1WWS A;  3X1S B;  3MGQ B;  1M19 D;  2FJ7 A;  4YS3 C;  3W97 A;  5B32 G;  3B6F D;  3UTB D;  5B2I C;  1BFM A;  5AV6 D;  1P3G D;  5BO0 A;  1P3M A;  2IO5 C;  3AYW B;  1N1J B;  3TU4 D;  4LD9 B;  3REI D;  4NFT A;  5AV5 D;  4XUJ C;  5AV8 A;  4J8W B;  3KXB B;  5CPI D;  3WA9 A;  1KX3 B;  5BNX A;  4JJN B;  1F66 C;  3AN2 C;  4X23 A;  5AV9 A;  3B0C T;  3LZ1 D;  3KUY C;  2FJ7 C;  5B40 D;  3W97 C;  3A6N A;  3MVD A;  1H3O A;  1P3M C;  2FFF B;  3VH5 T;  3AV1 A;  2LY8 A;  4ZBJ C;  1P34 D;  3LZ0 B;  1P3K A;  2Y2H A;  3VH6 W;  4R8P A;  3EG5 B;  3MGS B;  3WA9 C;  1M18 D;  2ZY5 A;  1P3P B;  5GSU B;  3AZI B;  3REL D;  3AZK C;  5AV9 C;  1AOI B;  3A6N C;  3C1B D;  4Z66 C;  3WKJ B;  3C1C A;  3MGR A;  3REH B;  1P3K C;  4R8P C;  4H9Q B;  1BH9 B;  5BT1 C;  3F6T A;  3EPH A;  3AZN C;  3AZF C;  4Z2M H;  1M1A A;  5CPK B;  4YM6 B;  3X1T D;  3AZM D;  4ZUX A;  3AZJ B;  2PYO B;  4KGC B;  2CV5 C;  1BH8 B;  3C1C C;  2VQR A;  5CPJ A;  3V9R A;  3KWQ A;  3LEL D;  1S32 D;  1B67 A;  5B1M B;  5KDM B;  3R45 B;  1B6W A;  2JE5 A;  5AV6 B;  1WWI A;  2Y2P A;  2G5H C;  1KX5 D;  3W96 A;  5AVC D;  5B1L D;  1U35 D;  3X1V C;  1M1A C;  4WV4 B;  4QLC D;  4ZUX C;  5DNN B;  1ZLA B;  3WAA C;  2HUE B;  5DNM B;  5GT0 D;  3VH6 A;  5CPJ C;  3LZ1 B;  1P3L D;  3B0D B;  5B31 D;  3VH5 A;  2HIO B;  3MGP D;  5B2J D;  5B0Y A;  4KHA A;  3MNN A;  5JRG A;  3W98 A;  4KUD C;  3UT9 D;  1KU5 A;  2Y2G A;  3W96 C;  3REJ B;  1P3I A;  1EQZ A;  2ARO B;  2F8N H;  2BYK A;  4E44 A;  1HQ3 A;  1JFI A;  2DQN C;  1TZY D;  3W99 D;  5B33 D;  5AY8 B;  4DQY B;  4WU8 C;  3FDD A;  3NQU A;  3C1B B;  5C3I B;  3AZG D;  4EO5 B;  5B0Y C;  3MNN C;  4YS3 D;  4J8X A;  1P3I C;  4J8U A;  3UTA C;  3EPK A;  3AV2 A;  4G92 B;  5B2I D;  5F99 B;  4H9O B;  1P3A B;  1P3F B;  4XZQ B;  3O62 B;  4Z5T B;  3NQJ A;  1F66 D;  3AN2 D;  2F8N A;  5GXQ A;  2FJ7 D;  5CP6 B;  3W97 D;  5B31 G;  3AV2 C;  5B0Z C;  2NZD A;  1P3M D;  1KX5 B;  5E5A B;  2F8N G;  5AVB A;  3WTP A;  4WU9 B;  5AV8 D;  3WA9 D;  4X23 D;  1P3L B;  5AV9 D;  4H9R A;  4NE6 A;  3A1I A;  3A6N D;  3MVD D;  1ID3 C;  5CHL B;  2NZD C;  3MGP B;  3AV1 D;  5B2J B;  4CSR A;  1P3B B;  1KX4 A;  4XUJ A;  5AVB C;  5JA4 B;  4CAY B;  1P3K D;  5GT3 B;  3B6G B;  4R8P D;  3WTP C;  2ZM5 A;  3KUY A;  5BT1 D;  3AYW A;  3H0L C;  1N1J A;  1TZY B;  3W99 B;  4LD9 A;  3REK C;  3KXB A;  3AZG B;  4JJN A;  3C1C D;  1KX4 C;  3MGQ C;  3X1S C;  3MGR D;  2XD5 A;  4WJ3 C;  2J8P A;  3AZK A;  3VH6 T;  5B24 B;  2NQB B;  2RVQ C;  3AYW C;  5B32 B;  4Z66 A;  3LZ0 A;  1P3O B;  1M1A D;  4H9P A;  4LD9 C;  4ZUX D;  3MGS A;  4J8W C;  3KXB C;  1KX3 C;  4JJN C;  1TAF A;  5CPJ D;  2YFV B;  3KWQ D;  1P3P A;  5GSU A;  2FJ7 B;  3AZL B;  1AOI A;  3AZN A;  3AZF A;  5BO0 B;  3WKJ A;  2CV5 A;  3W96 D;  3EPL A;  2BYM A;  3LZ0 C;  3AZH B;  5AV8 B;  4H9Q A;  3MGS C;  4X23 B;  4J8V B;  1Z2C B;  4E45 A;  1P3P C;  5GSU C;  3AZI C;  1AOI C;  2RIQ A;  4HGA B;  3MVD B;  3AZJ A;  2PYO A;  4KGC A;  3AZE B;  3X1V A;  3WKJ C;  3B0C W;  3AV1 B;  1BH8 A;  5B0Y D;  3W98 D;  3MNN D;  5JRG D;  5B1M A;  3EPJ A;  1P3I D;  3WAA A;  5KDM A;  3REH C;  1EQZ D;  3R45 A;  1M19 B;  1HQ3 D;  3X1U A;  3B6F B;  3UTB B;  1P3G B;  5CPK C;  4YM6 C;  3TU4 B;  4KUD A;  3AZJ C;  5DNN A;  1ZLA A;  2PYO C;  4KGC C;  2YFW A;  5DNM A;  3REI B;  5AV5 B;  4UUZ B;  5CPI B;  5B1M C;  4H9S C;  3MGR B;  4J8X D;  4J8U D;  3AV2 D;  5AV6 C;  3X1U C;  4WU8 A;  2HIO A;  5B40 B;  1M1A B;  3REJ A;  2ARO A;  1P34 B;  5G49 A;  5DNN C;  1ZLA C;  2W8S A;  3UTA A;  2HUE C;  2F8N D;  3V9R B;  5DNM C;  3KWQ B;  5GXQ D;  5AY8 A;  3LZ1 C;  1M18 B;  3B0D C;  3REL B;  2NZD D;  4Z2M G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...