3NQJA

Crystal structure of (cenp-a/h4)2 heterotetramer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
MLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3-like centromeric protein A
publication title The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3nqjA00
3AZGB 1P3LA 2CV5A 3W97D 4J8UB 3KUYB 4KGCA 4Z2MH 1P3MC 1P3OC 4ZUXA 3B6GC 1P3BC 5B33B 3W96B 4XZQA 3AZMD 3NQUB 3MVDC 1EQZB 3AN2A 4WU9A 5B31B 3AV2C 5E5AA 1P3PA 1KX4C 2PYOA 1N1JB 4R8PD 4HGAB 5B24C 5AVBC 2AROB 4EO5B 5B0ZD 5GT0D 1M1AB 2NQBB 1P3AD 3AZIA 1BH8A 3REJA 3UT9A 1F66C 3AZGC 3C1CD 3KUYC 4J8UC 4J8XB 2HIOA 3REHD 1TZYD 1KX3B 3O62D 5B33C 4WNNA 3W96C 4ZBJB 5B0YD 4Z66A 4CAYA 4WU8D 5CPKA 1EQZC 3X1VA 4QLCD 5B31C 5JRGB 3LELA 4HGAC 4Z2MG 5AV5D 3AZJD 2AROC 4EO5C 1M1AC 2NQBC 3MNND 1P3IC 3AFAB 4KUDB 2BYKA 5B2JD 3TU4B 4H9NA 3MGPD 3AZMA 1U35B 3KXBB 4JJNB 3REKD 1M18A 4J8VB 4J8XC 3V9RB 3W98B 5CP6D 1KX3C 3WKJD 5GSUD 2YFWB 3WAAB 3LJAA 2BYMB 5GT0A 5AV9D 3UTAA 1ID3D 1P3GB 4Z5TD 2YFVB 5CPJD 4X23D 3AZKB 1B6WA 5JRGC 3AZLD 4YM6B 4WV4B 2L5AA 5JA4B 3AZNB 5C3IB 4J8WD 3AFAC 3REHA 3WTPD 4KUDC 4UUZA 3AZHD 1BFMA 3O62A 3RELA 1Q9CA 5AVCA 3TU4C 3MGRD 3AZED 3W99D 1P3KB 1H3OB 1U35C 5BS7C 3B6GA 3KXBC 1P3BA 1ZLAB 5B31G 4JJNC 1WWSA 4QLCA 4J8VC 4KHAB 2CV5D 3W98C 4KGCD 3WAAC 5AV5A 4H9RA 3MNNA 4ZUXD 1BH9A 4H9QB 1P3GC 3NQJA 5B2JA 5AV6D 4XZQD 5AVBA 5CHLB 2NZDD 3WA9B 5DNMD 3AZKC 1S32B 2IO5B 3AN2D 4YM6C 1P3PD 5E5AD 3X1UB 3REKA 3AZNC 3REIB 5C3IC 5GT3A 5CP6A 3AZGA 4J8UA 2RVQD 1P3KC 3AV1B 1ID3A 3REJD 3UT9D 5B0ZB 1ZLAC 4NE6A 5AV8D 1B67A 3NQUA 2FJ7D 3A6ND 5B31A 4H9OB 4E45A 3WTPA 1KX5B 5B1LD 3AZHA 2AROA 5B2IB 2NQBA 3WA9C 1P3IA 3W99A 1S32C 2IO5C 4G91B 4LD9D 5B32B 3X1VD 5AY8B 3X1UC 5F99A 3AYWB 3REIC 1P3FB 2F8NH 4J8XA 3AV1C 1KX3A 5AV6A 5B0ZC 4H9PA 3UTBC 5DNMA 2NZDA 4YS3B 3R45B 3B0BA 1M18D 5BNVB 5BO0B 3MGPB 3B6FB 3LJAD 1KX5C 3UTAD 1AOID 5B2IC 3AFAA 4G91C 5B32C 3X1SA 5AY8C 3MGQB 5AV8A 4Z5TB 3AYWC 1P34B 3AZFD 5DNNB 2FJ7A 3A6NA 1P3FC 4X23B 5CPJB 4JJNA 2F8ND 4J8VA 1M19B 2LY8A 3MGSB 3AZLB 4XUJA 3KSYA 3RELD 2YFWA 5AVCD 1P3MD 5B1LA 1HQ3B 3B6GD 4YS3C 1P3BD 2YFVA 4LD9A 3AZKA 3MGPC 2F8NG 5KDMA 3X1TB 3B6FC 3MVDD 3AV2D 5GXQA 1KX4D 5JA4A 5G49B 4CSRB 1P3LB 1KU5A 5B24D 5AVBD 1P3KA 3MGQC 4Z5TC 1P34C 5DNNC 1F66D 4X23C 5CPJC 5GT3D 3AZGD 1M19C 3MGSC 3AZLC 4WU9B 4J8UD 3KUYD 5E5AB 2PYOB 1AOIA 4ZBJC 1HQ3C 5B1MB 5B33D 3W96D 3LZ0B 3AZIB 1S32A 2CWEA 1BH8B 3X1TC 3UT9B 5B40B 3AZFA 1EQZD 5B31D 1TAFA 5CPIA 3X1UA 2F8NA 3REIA 1P3LC 1M1AD 2AROD 2NQBD 2HIOB 1P3ID 1P3MA 1P3OA 5BNXA 4H9SC 5FUGB 3KWQB 5F99D 4Z66B 5BT1C 3UTBA 5CPKB 4AWLB 3C1BB 3MVDA 3X1VB 4WU9C 4M6BA 5E5AC 3AV2A 2PYOC 4J8XD 1KX4A 4H9OA 3LELB 1KX3D 3LZ1B 5B1MC 5B24A 3W97B 1KX5A 3LZ0C 2BYKB 5B2IA 3AZIC 3UT9C 1R4VA 5B40C 1F66A 3AZMB 5AY8A 5JRGD 3AYWA 3KUYA 2HIOC 3AFAD 4R8PB 5GT0B 5B33A 3X1SD 3W96A 3KWQC 1P3AB 4Z66C 1U35D 4YS3A 3KXBD 5CPKC 4AWLC 1JFIB 3C1BC 3X1VC 1EQZA 4JJND 4J8VD 5BNVA 5BO0A 3LELC 1N1JA 3W98D 4XUJD 3VH6T 3LZ1C 3B6FA 3B0CT 3W97C 3WAAD 3C1CB 1M1AA 3REHB 1TZYB 1P3GD 4UUZB 3O62B 3RELB 5AVCB 3AZKD 1HTAA 5B0YB 3AZMC 4WU8B 4YM6D 5GXQD 5DNNA 4QLCB 4R8PC 1M19A 1F1EA 5AV5B 3AZJB 5GT0C 4H9RB 3MNNB 1P3KD 1P3AC 1BH9B 3NQJB 5B2JB 1ZLAD 3VH5T 5JRGA 3X1TA 1WWIA 3REKB 3C1CC 5GT3B 3REHC 1TZYC 5CP6B 3WKJB 4KUDA 5GSUB 3O62C 3RELC 5AVCC 3TU4A 5AV9B 3WA9D 1ID3B 1S32D 5B0YC 1U35A 4WU8C 5BS7A 3KXBA 4E44A 4H9SA 5CPID 3X1UD 4QLCC 4DRBA 3REID 3V9RA 3W98A 2HUEB 3WAAA 2BYMA 5AV5C 3AZJC 4J8WB 3MNNC 3AV1D 1P3OD 3WTPB 1P3GA 5B1MA 5B2JC 3AZHB 3VH6A 3LZ0A 3AZEB 1P3IB 3MGRB 1A7WA 3UTBD 3W99B 4YM6A 5B40A 5F99B 3REKC 3AZNA 5GT3C 2CV5B 5CP6C 3WKJC 5GSUC 1KX5D 4KGCB 5B2ID 5AV9C 1ID3C 4ZUXB 1H3OA 5B32D 4XZQB 5AV6B 1ZLAA 4H9PB 5FUGA 5AY8D 3KWQA 5DNMB 2NZDB 3AYWD 4KHAA 4G92B 3AN2B 2HUEC 1P3FD 1P3PB 3C1BA 4J8WC 3LZ1A 3WTPC 4H9QA 3VH5A 3W97A 3AZHC 5B32G 3AZEC 3MGRC 3WA9A 3W99C 4YS3D 3REJB 3X1SB 5F99C 5AV8B 3B6FD 2CV5C 3A6NB 2FJ7B 4KGCC 4R8PA 3AV1A 4XUJB 4ZUXC 4WNNB 5B1LB 4XZQC 5AV6C 5B0ZA 2NZDC 4NE3A 4DRAA 4CAYB 5DNMC 3B0DB 4WZSB 3MGQD 1P3AA 1P34D 5DNND 4G92C 4LD9B 3AN2C 1JFIA 1P3PC 4NFTA 5KDMB 1M19D 3MGSD 5GXQB 3WTPE 3C1CA 2RVQC 1HQ3D 1TZYA 3REJC 5B32A 4H9NB 3X1SC 5AV8C 5B0YA 3X1TD 4WU8A 2FJ7C 3A6NC 1M18B 1P3FA 4KUDD 1P3LD 4XUJC 3LJAB 3TU4D 3UTAB 5B1LC 1AOIB 3LZ1D 3AZJA 3B0DC 3R45A 4LD9C 5BT1D 3MGPA 3AZFB 3VH6W 4WU9D 3B0CW 1TAFB 5GXQC 5CPIB 2PYOD 2F8NB 5B1MD 3WKJA 5GSUA 3LZ0D 1P3MB 2F8NK 5AV9A 1P3OB 3AZID 5BNXB 3MGQA 3B6GB 1P3BB 4Z5TA 1ULYA 1P34A 5B40D 3AZND 3UTBB 1M18C 4X23A 5CPJA 3MGSA 3MVDB 3AZLA 3LJAC 3AV2B 1KX4B 2HIOD 3UTAC 1AOIC 2JSSA 4J8WA 1HQ3A 5B24B 5AVBB 3KWQD 4NE5A 4Z66D 3AZEA 3MGRA 5CPKD 3VH5W 3AZFC 3C1BD 1F66B 5CPIC 3LELD 5G49A 4CSRA
chains in the Genus database with same CATH superfamily
3AZGB 1P3LA 2CV5A 3W97D 4J8UB 3KUYB 4KGCA 4Z2MH 1P3MC 3FDDA 1P3OC 4ZUXA 3B6GC 1P3BC 5B33B 3W96B 4XZQA 3AZMD 3NQUB 2BG1A 3MVDC 1EQZB 3AN2A 4WU9A 5B31B 3AV2C 5E5AA 1P3PA 1KX4C 2PYOA 1N1JB 4R8PD 4HGAB 5B24C 5AVBC 2AROB 4EO5B 5B0ZD 5GT0D 1M1AB 2NQBB 1P3AD 3AZIA 1BH8A 3REJA 3UT9A 1F66C 3AZGC 3C1CD 3KUYC 4J8UC 4J8XB 2HIOA 3REHD 1TZYD 1KX3B 3O62D 5B33C 4WNNA 3W96C 4ZBJB 5B0YD 4Z66A 4CAYA 4WU8D 5CPKA 1EQZC 3X1VA 4QLCD 5B31C 5JRGB 3LELA 4HGAC 4Z2MG 1PZRA 5AV5D 2AROC 4EO5C 3AZJD 1M1AC 3MNND 2NQBC 1P3IC 3AFAB 4KUDB 2BYKA 5B2JD 3TU4B 4H9NA 3MGPD 3AZMA 1U35B 3KXBB 4JJNB 3REKD 1M18A 4J8VB 4J8XC 3V9RB 3W98B 5CP6D 1KX3C 3WKJD 3EPHA 5GSUD 2YFWB 3WAAB 3LJAA 2BYMB 2XD1A 5GT0A 5AV9D 3UTAA 1ID3D 1P3GB 4Z5TD 2YFVB 5CPJD 4X23D 3AZKB 1B6WA 2Y2LA 5JRGC 3AZLD 4YM6B 4WV4B 2L5AA 5JA4B 2J8PA 3AZNB 3EPLA 5C3IB 4J8WD 3AFAC 3REHA 3WTPD 4KUDC 4UUZA 3AZHD 1BFMA 3O62A 3RELA 1Q9CA 5AVCA 3TU4C 3MGRD 3AZED 3W99D 2Y2IA 1P3KB 1H3OB 1U35C 5BS7C 3B6GA 3KXBC 1P3BA 1ZLAB 5B31G 4JJNC 1WWSA 4QLCA 4J8VC 3EG5B 4KHAB 2CV5D 3W98C 4KGCD 3WAAC 5AV5A 4H9RA 3MNNA 4ZUXD 1BH9A 4H9QB 1P3GC 3NQJA 5B2JA 5AV6D 4XZQD 2ZM5A 5AVBA 5CHLB 2NZDD 3WA9B 5DNMD 3AZKC 1S32B 2IO5B 3AN2D 4YM6C 1P3PD 5E5AD 3X1UB 3REKA 3AZNC 3REIB 5C3IC 5GT3A 5CP6A 3AZGA 4J8UA 2RVQD 1P3KC 3AV1B 1ID3A 3REJD 3UT9D 5B0ZB 1ZLAC 4NE6A 5AV8D 1B67A 3NQUA 2FJ7D 3A6ND 5B31A 4H9OB 4E45A 3WTPA 1KX5B 5B1LD 3AZHA 2AROA 5B2IB 2NQBA 3WA9C 1P3IA 3W99A 1S32C 2IO5C 4G91B 4LD9D 5B32B 3X1VD 5AY8B 3X1UC 5F99A 3AYWB 3REIC 1P3FB 2F8NH 2Y2NA 4J8XA 2Y2JA 3AV1C 1KX3A 5AV6A 5B0ZC 4H9PA 3UTBC 5DNMA 2NZDA 4YS3B 3R45B 3B0BA 1M18D 5BNVB 5BO0B 3MGPB 3B6FB 2Y2GA 3LJAD 1KX5C 3UTAD 2VQRA 1AOID 5B2IC 3AFAA 4G91C 5B32C 3X1SA 5AY8C 3MGQB 5AV8A 4Z5TB 3AYWC 1P34B 2RIQA 3AZFD 5DNNB 2FJ7A 3A6NA 1P3FC 4X23B 5CPJB 4JJNA 2F8ND 4J8VA 1M19B 2LY8A 3MGSB 3AZLB 4XUJA 2Y2KA 3KSYA 3RELD 2YFWA 2FFFB 5AVCD 1P3MD 5B1LA 1HQ3B 3B6GD 4YS3C 1P3BD 4WJ3C 2YFVA 4LD9A 3P5JB 3AZKA 3MGPC 2F8NG 5KDMA 3X1TB 3B6FC 3MVDD 3AV2D 5GXQA 1KX4D 2DQNC 5JA4A 5G49B 4CSRB 1P3LB 1KU5A 5B24D 5AVBD 3AL0C 2Y2HA 1P3KA 4DQYB 3MGQC 4Z5TC 1P34C 5DNNC 1F66D 2JE5A 4X23C 5CPJC 5GT3D 3AZGD 1M19C 3MGSC 3AZLC 4WU9B 4J8UD 3KUYD 5E5AB 2PYOB 1AOIA 4ZBJC 1HQ3C 5B1MB 5B33D 3W96D 3LZ0B 3AZIB 1S32A 2CWEA 1BH8B 3X1TC 3UT9B 5B40B 3AZFA 1EQZD 5B31D 1TAFA 5CPIA 3X1UA 2F8NA 3REIA 1P3LC 2ZY2A 1M1AD 2AROD 2NQBD 2HIOB 1P3ID 1P3MA 1P3OA 5BNXA 4H9SC 5FUGB 3KWQB 5F99D 4Z66B 5BT1C 3UTBA 3KFUG 5CPKB 4AWLB 3C1BB 3MVDA 3X1VB 4WU9C 4M6BA 5E5AC 3AV2A 2PYOC 4J8XD 1KX4A 4H9OA 3LELB 1KX3D 3LZ1B 5B1MC 5B24A 3W97B 1KX5A 3LZ0C 2BYKB 5B2IA 3H0MC 3AZIC 3UT9C 1R4VA 5B40C 1F66A 3AZMB 5AY8A 5JRGD 3AYWA 3KUYA 1W2EA 2HIOC 3AFAD 4R8PB 5GT0B 5B33A 3W96A 3X1SD 2JCHA 3KWQC 1P3AB 4Z66C 1U35D 4YS3A 3KXBD 5CPKC 2UWXA 4AWLC 1JFIB 2F2AC 3C1BC 3X1VC 1EQZA 4JJND 4J8VD 5BNVA 5BO0A 3LELC 1N1JA 3W98D 4XUJD 3VH6T 3LZ1C 3B6FA 3B0CT 3W97C 3WAAD 3C1CB 1M1AA 3REHB 1TZYB 1P3GD 4UUZB 3O62B 3RELB 5AVCB 3AZKD 1HTAA 5B0YB 3AZMC 2DF4C 2Y2MA 4WU8B 4YM6D 5GXQD 5DNNA 4QLCB 4R8PC 1M19A 1F1EA 5AV5B 3AZJB 5GT0C 4H9RB 3MNNB 1P3KD 1P3AC 1BH9B 3NQJB 5B2JB 1ZLAD 3VH5T 5JRGA 3X1TA 1WWIA 3REKB 3C1CC 2ZY5A 5GT3B 3REHC 1TZYC 5CP6B 3WKJB 4KUDA 5GSUB 2G5IC 3O62C 3RELC 5AVCC 3TU4A 5AV9B 3WA9D 1ID3B 1S32D 3A1IA 5B0YC 3EPKA 1U35A 4WU8C 5BS7A 3KXBA 4E44A 4H9SA 5CPID 3X1UD 4QLCC 4DRBA 3REID 3V9RA 3W98A 2HUEB 3WAAA 2BYMA 5AV5C 3AZJC 4J8WB 3MNNC 3AV1D 1P3OD 3WTPB 1P3GA 5B1MA 5B2JC 3AZHB 3VH6A 3LZ0A 3AZEB 1P3IB 3MGRB 1A7WA 3UTBD 3W99B 1Z2CB 4YM6A 5B40A 5F99B 3REKC 3AZNA 3EPJA 5GT3C 2CV5B 2G5HC 5CP6C 3WKJC 5GSUC 1KX5D 4KGCB 5B2ID 5AV9C 1ID3C 4ZUXB 1H3OA 5B32D 4XZQB 5AV6B 1ZLAA 4H9PB 5FUGA 5AY8D 3KWQA 5DNMB 2NZDB 3AYWD 4KHAA 4G92B 3AN2B 2HUEC 3IP4C 1P3FD 1P3PB 3C1BA 4J8WC 4UPKA 3LZ1A 3WTPC 4H9QA 3VH5A 3W97A 3AZHC 5B32G 3AZEC 3MGRC 3WA9A 3W99C 4YS3D 3REJB 3X1SB 5F99C 5AV8B 3B6FD 2CV5C 3A6NB 2FJ7B 4KGCC 2Y2OA 4R8PA 3AV1A 4XUJB 4ZUXC 4WNNB 5B1LB 4XZQC 5AV6C 5B0ZA 2NZDC 4NE3A 4DRAA 4CAYB 5DNMC 3B0DB 4WZSB 3MGQD 1P3AA 1P34D 5DNND 4G92C 4LD9B 3AN2C 1JFIA 1P3PC 4NFTA 2Y2QA 5KDMB 3H0RC 1M19D 3MGSD 2XD5A 5GXQB 3H0LC 3WTPE 3C1CA 2RVQC 1HQ3D 1TZYA 3REJC 5B32A 4H9NB 3X1SC 5AV8C 5B0YA 2ZY4A 3X1TD 4WU8A 2FJ7C 3A6NC 1M18B 1P3FA 4KUDD 1P3LD 4XUJC 3LJAB 3TU4D 3UTAB 5B1LC 1AOIB 3LZ1D 3AZJA 3B0DC 3F6TA 3R45A 4LD9C 5BT1D 1T3UA 3MGPA 3A1KA 3AZFB 3VH6W 4WU9D 3B0CW 1TAFB 5GXQC 5CPIB 2PYOD 2F8NB 5B1MD 3WKJA 5GSUA 3LZ0D 1P3MB 2F8NK 5AV9A 1P3OB 2ZY3A 5BNXB 3AZID 3MGQA 3B6GB 1P3BB 4Z5TA 1ULYA 1P34A 5B40D 3AZND 3UTBB 1M18C 4X23A 2Y2PA 5CPJA 3MGSA 3MVDB 3AZLA 3LJAC 3AV2B 1KX4B 2HIOD 3UTAC 1AOIC 2JSSA 4J8WA 1HQ3A 5B24B 5AVBB 3KWQD 4NE5A 4Z66D 3AZEA 3MGRA 5CPKD 3VH5W 3AZFC 3C1BD 1F66B 2W8SA 5CPIC 3LELD 5G49A 4CSRA
chains in the Genus database with same CATH topology
3AZGB 1P3LA 2CV5A 3W97D 4J8UB 3KUYB 4KGCA 4Z2MH 1P3MC 3FDDA 1P3OC 4ZUXA 3B6GC 1P3BC 5B33B 3W96B 4XZQA 3AZMD 3NQUB 2BG1A 3MVDC 1EQZB 3AN2A 4WU9A 5B31B 3AV2C 5E5AA 1P3PA 1KX4C 2PYOA 1N1JB 4R8PD 4HGAB 5B24C 5AVBC 2AROB 4EO5B 5B0ZD 5GT0D 1M1AB 2NQBB 1P3AD 3AZIA 1BH8A 3REJA 3UT9A 1F66C 3AZGC 3C1CD 3KUYC 4J8UC 4J8XB 2HIOA 3REHD 1TZYD 1KX3B 3O62D 5B33C 4WNNA 3W96C 4ZBJB 5B0YD 4Z66A 4CAYA 4WU8D 5CPKA 1EQZC 3X1VA 4QLCD 5B31C 5JRGB 3LELA 4HGAC 4Z2MG 1PZRA 5AV5D 2AROC 4EO5C 3AZJD 1M1AC 3MNND 2NQBC 1P3IC 3AFAB 4KUDB 2BYKA 5B2JD 3TU4B 4H9NA 3MGPD 3AZMA 1U35B 3KXBB 4JJNB 3REKD 1M18A 4J8VB 4J8XC 3V9RB 3W98B 5CP6D 1KX3C 3WKJD 3EPHA 5GSUD 2YFWB 3WAAB 3LJAA 2BYMB 2XD1A 5GT0A 5AV9D 3UTAA 1ID3D 1P3GB 4Z5TD 2YFVB 5CPJD 4X23D 3AZKB 1B6WA 2Y2LA 5JRGC 3AZLD 4YM6B 4WV4B 2L5AA 5JA4B 2J8PA 3AZNB 3EPLA 5C3IB 4J8WD 3AFAC 3REHA 3WTPD 4KUDC 4UUZA 3AZHD 1BFMA 3O62A 3RELA 1Q9CA 5AVCA 3TU4C 3MGRD 3AZED 3W99D 2Y2IA 1P3KB 1H3OB 1U35C 5BS7C 3B6GA 3KXBC 1P3BA 1ZLAB 5B31G 4JJNC 1WWSA 4QLCA 4J8VC 3EG5B 4KHAB 2CV5D 3W98C 4KGCD 3WAAC 5AV5A 4H9RA 3MNNA 4ZUXD 1BH9A 4H9QB 1P3GC 3NQJA 5B2JA 5AV6D 4XZQD 2ZM5A 5AVBA 5CHLB 2NZDD 3WA9B 5DNMD 3AZKC 1S32B 2IO5B 3AN2D 4YM6C 1P3PD 5E5AD 3X1UB 3REKA 3AZNC 3REIB 5C3IC 5GT3A 5CP6A 3AZGA 4J8UA 2RVQD 1P3KC 3AV1B 1ID3A 3REJD 3UT9D 5B0ZB 1ZLAC 4NE6A 5AV8D 1B67A 3NQUA 2FJ7D 3A6ND 5B31A 4H9OB 4E45A 3WTPA 1KX5B 5B1LD 3AZHA 2AROA 5B2IB 2NQBA 3WA9C 1P3IA 3W99A 1S32C 2IO5C 4G91B 4LD9D 5B32B 3X1VD 5AY8B 3X1UC 5F99A 3AYWB 3REIC 1P3FB 2F8NH 2Y2NA 4J8XA 2Y2JA 3AV1C 1KX3A 5AV6A 5B0ZC 4H9PA 3UTBC 5DNMA 2NZDA 4YS3B 3R45B 3B0BA 1M18D 5BNVB 5BO0B 3MGPB 3B6FB 2Y2GA 3LJAD 1KX5C 3UTAD 2VQRA 1AOID 5B2IC 3AFAA 4G91C 5B32C 3X1SA 5AY8C 3MGQB 5AV8A 4Z5TB 3AYWC 1P34B 2RIQA 3AZFD 5DNNB 2FJ7A 3A6NA 1P3FC 4X23B 5CPJB 4JJNA 2F8ND 4J8VA 1M19B 2LY8A 3MGSB 3AZLB 4XUJA 2Y2KA 3KSYA 3RELD 2YFWA 2FFFB 5AVCD 1P3MD 5B1LA 1HQ3B 3B6GD 4YS3C 1P3BD 4WJ3C 2YFVA 4LD9A 3P5JB 3AZKA 3MGPC 2F8NG 5KDMA 3X1TB 3B6FC 3MVDD 3AV2D 5GXQA 1KX4D 2DQNC 5JA4A 5G49B 4CSRB 1P3LB 1KU5A 5B24D 5AVBD 3AL0C 2Y2HA 1P3KA 4DQYB 3MGQC 4Z5TC 1P34C 5DNNC 1F66D 2JE5A 4X23C 5CPJC 5GT3D 3AZGD 1M19C 3MGSC 3AZLC 4WU9B 4J8UD 3KUYD 5E5AB 2PYOB 1AOIA 4ZBJC 1HQ3C 5B1MB 5B33D 3W96D 3LZ0B 3AZIB 1S32A 2CWEA 1BH8B 3X1TC 3UT9B 5B40B 3AZFA 1EQZD 5B31D 1TAFA 5CPIA 3X1UA 2F8NA 3REIA 1P3LC 2ZY2A 1M1AD 2AROD 2NQBD 2HIOB 1P3ID 1P3MA 1P3OA 5BNXA 4H9SC 5FUGB 3KWQB 5F99D 4Z66B 5BT1C 3UTBA 3KFUG 5CPKB 4AWLB 3C1BB 3MVDA 3X1VB 4WU9C 4M6BA 5E5AC 3AV2A 2PYOC 4J8XD 1KX4A 4H9OA 3LELB 1KX3D 3LZ1B 5B1MC 5B24A 3W97B 1KX5A 3LZ0C 2BYKB 5B2IA 3H0MC 3AZIC 3UT9C 1R4VA 5B40C 1F66A 3AZMB 5AY8A 5JRGD 3AYWA 3KUYA 1W2EA 2HIOC 3AFAD 4R8PB 5GT0B 5B33A 3W96A 3X1SD 2JCHA 3KWQC 1P3AB 4Z66C 1U35D 4YS3A 3KXBD 5CPKC 2UWXA 4AWLC 1JFIB 2F2AC 3C1BC 3X1VC 1EQZA 4JJND 4J8VD 5BNVA 5BO0A 3LELC 1N1JA 3W98D 4XUJD 3VH6T 3LZ1C 3B6FA 3B0CT 3W97C 3WAAD 3C1CB 1M1AA 3REHB 1TZYB 1P3GD 4UUZB 3O62B 3RELB 5AVCB 3AZKD 1HTAA 5B0YB 3AZMC 2DF4C 2Y2MA 4WU8B 4YM6D 5GXQD 5DNNA 4QLCB 4R8PC 1M19A 1F1EA 5AV5B 3AZJB 5GT0C 4H9RB 3MNNB 1P3KD 1P3AC 1BH9B 3NQJB 5B2JB 1ZLAD 3VH5T 5JRGA 3X1TA 1WWIA 3REKB 3C1CC 2ZY5A 5GT3B 3REHC 1TZYC 5CP6B 3WKJB 4KUDA 5GSUB 2G5IC 3O62C 3RELC 5AVCC 3TU4A 5AV9B 3WA9D 1ID3B 1S32D 3A1IA 5B0YC 3EPKA 1U35A 4WU8C 5BS7A 3KXBA 4E44A 4H9SA 5CPID 3X1UD 4QLCC 4DRBA 3REID 3V9RA 3W98A 2HUEB 3WAAA 2BYMA 5AV5C 3AZJC 4J8WB 3MNNC 3AV1D 1P3OD 3WTPB 1P3GA 5B1MA 5B2JC 3AZHB 3VH6A 3LZ0A 3AZEB 1P3IB 3MGRB 1A7WA 3UTBD 3W99B 1Z2CB 4YM6A 5B40A 5F99B 3REKC 3AZNA 3EPJA 5GT3C 2CV5B 2G5HC 5CP6C 3WKJC 5GSUC 1KX5D 4KGCB 5B2ID 5AV9C 1ID3C 4ZUXB 1H3OA 5B32D 4XZQB 5AV6B 1ZLAA 4H9PB 5FUGA 5AY8D 3KWQA 5DNMB 2NZDB 3AYWD 4KHAA 4G92B 3AN2B 2HUEC 3IP4C 1P3FD 1P3PB 3C1BA 4J8WC 4UPKA 3LZ1A 3WTPC 4H9QA 3VH5A 3W97A 3AZHC 5B32G 3AZEC 3MGRC 3WA9A 3W99C 4YS3D 3REJB 3X1SB 5F99C 5AV8B 3B6FD 2CV5C 3A6NB 2FJ7B 4KGCC 2Y2OA 4R8PA 3AV1A 4XUJB 4ZUXC 4WNNB 5B1LB 4XZQC 5AV6C 5B0ZA 2NZDC 4NE3A 4DRAA 4CAYB 5DNMC 3B0DB 4WZSB 3MGQD 1P3AA 1P34D 5DNND 4G92C 4LD9B 3AN2C 1JFIA 1P3PC 4NFTA 2Y2QA 5KDMB 3H0RC 1M19D 3MGSD 2XD5A 5GXQB 3H0LC 3WTPE 3C1CA 2RVQC 1HQ3D 1TZYA 3REJC 5B32A 4H9NB 3X1SC 5AV8C 5B0YA 2ZY4A 3X1TD 4WU8A 2FJ7C 3A6NC 1M18B 1P3FA 4KUDD 1P3LD 4XUJC 3LJAB 3TU4D 3UTAB 5B1LC 1AOIB 3LZ1D 3AZJA 3B0DC 3F6TA 3R45A 4LD9C 5BT1D 1T3UA 3MGPA 3A1KA 3AZFB 3VH6W 4WU9D 3B0CW 1TAFB 5GXQC 5CPIB 2PYOD 2F8NB 5B1MD 3WKJA 5GSUA 3LZ0D 1P3MB 2F8NK 5AV9A 1P3OB 2ZY3A 5BNXB 3AZID 3MGQA 3B6GB 1P3BB 4Z5TA 1ULYA 1P34A 5B40D 3AZND 3UTBB 1M18C 4X23A 2Y2PA 5CPJA 3MGSA 3MVDB 3AZLA 3LJAC 3AV2B 1KX4B 2HIOD 3UTAC 1AOIC 2JSSA 4J8WA 1HQ3A 5B24B 5AVBB 3KWQD 4NE5A 4Z66D 3AZEA 3MGRA 5CPKD 3VH5W 3AZFC 3C1BD 1F66B 2W8SA 5CPIC 3LELD 5G49A 4CSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZG B;  1P3L A;  2CV5 A;  3W97 D;  4J8U B;  3KUY B;  4KGC A;  4Z2M H;  1P3M C;  1P3O C;  4ZUX A;  3B6G C;  1P3B C;  5B33 B;  3W96 B;  4XZQ A;  3AZM D;  3NQU B;  3MVD C;  1EQZ B;  3AN2 A;  4WU9 A;  5B31 B;  3AV2 C;  5E5A A;  1P3P A;  1KX4 C;  2PYO A;  1N1J B;  4R8P D;  4HGA B;  5B24 C;  5AVB C;  2ARO B;  4EO5 B;  5B0Z D;  5GT0 D;  1M1A B;  2NQB B;  1P3A D;  3AZI A;  1BH8 A;  3REJ A;  3UT9 A;  1F66 C;  3AZG C;  3C1C D;  3KUY C;  4J8U C;  4J8X B;  2HIO A;  3REH D;  1TZY D;  1KX3 B;  3O62 D;  5B33 C;  4WNN A;  3W96 C;  4ZBJ B;  5B0Y D;  4Z66 A;  4CAY A;  4WU8 D;  5CPK A;  1EQZ C;  3X1V A;  4QLC D;  5B31 C;  5JRG B;  3LEL A;  4HGA C;  4Z2M G;  5AV5 D;  3AZJ D;  2ARO C;  4EO5 C;  1M1A C;  2NQB C;  3MNN D;  1P3I C;  3AFA B;  4KUD B;  2BYK A;  5B2J D;  3TU4 B;  4H9N A;  3MGP D;  3AZM A;  1U35 B;  3KXB B;  4JJN B;  3REK D;  1M18 A;  4J8V B;  4J8X C;  3V9R B;  3W98 B;  5CP6 D;  1KX3 C;  3WKJ D;  5GSU D;  2YFW B;  3WAA B;  3LJA A;  2BYM B;  5GT0 A;  5AV9 D;  3UTA A;  1ID3 D;  1P3G B;  4Z5T D;  2YFV B;  5CPJ D;  4X23 D;  3AZK B;  1B6W A;  5JRG C;  3AZL D;  4YM6 B;  4WV4 B;  2L5A A;  5JA4 B;  3AZN B;  5C3I B;  4J8W D;  3AFA C;  3REH A;  3WTP D;  4KUD C;  4UUZ A;  3AZH D;  1BFM A;  3O62 A;  3REL A;  1Q9C A;  5AVC A;  3TU4 C;  3MGR D;  3AZE D;  3W99 D;  1P3K B;  1H3O B;  1U35 C;  5BS7 C;  3B6G A;  3KXB C;  1P3B A;  1ZLA B;  5B31 G;  4JJN C;  1WWS A;  4QLC A;  4J8V C;  4KHA B;  2CV5 D;  3W98 C;  4KGC D;  3WAA C;  5AV5 A;  4H9R A;  3MNN A;  4ZUX D;  1BH9 A;  4H9Q B;  1P3G C;  3NQJ A;  5B2J A;  5AV6 D;  4XZQ D;  5AVB A;  5CHL B;  2NZD D;  3WA9 B;  5DNM D;  3AZK C;  1S32 B;  2IO5 B;  3AN2 D;  4YM6 C;  1P3P D;  5E5A D;  3X1U B;  3REK A;  3AZN C;  3REI B;  5C3I C;  5GT3 A;  5CP6 A;  3AZG A;  4J8U A;  2RVQ D;  1P3K C;  3AV1 B;  1ID3 A;  3REJ D;  3UT9 D;  5B0Z B;  1ZLA C;  4NE6 A;  5AV8 D;  1B67 A;  3NQU A;  2FJ7 D;  3A6N D;  5B31 A;  4H9O B;  4E45 A;  3WTP A;  1KX5 B;  5B1L D;  3AZH A;  2ARO A;  5B2I B;  2NQB A;  3WA9 C;  1P3I A;  3W99 A;  1S32 C;  2IO5 C;  4G91 B;  4LD9 D;  5B32 B;  3X1V D;  5AY8 B;  3X1U C;  5F99 A;  3AYW B;  3REI C;  1P3F B;  2F8N H;  4J8X A;  3AV1 C;  1KX3 A;  5AV6 A;  5B0Z C;  4H9P A;  3UTB C;  5DNM A;  2NZD A;  4YS3 B;  3R45 B;  3B0B A;  1M18 D;  5BNV B;  5BO0 B;  3MGP B;  3B6F B;  3LJA D;  1KX5 C;  3UTA D;  1AOI D;  5B2I C;  3AFA A;  4G91 C;  5B32 C;  3X1S A;  5AY8 C;  3MGQ B;  5AV8 A;  4Z5T B;  3AYW C;  1P34 B;  3AZF D;  5DNN B;  2FJ7 A;  3A6N A;  1P3F C;  4X23 B;  5CPJ B;  4JJN A;  2F8N D;  4J8V A;  1M19 B;  2LY8 A;  3MGS B;  3AZL B;  4XUJ A;  3KSY A;  3REL D;  2YFW A;  5AVC D;  1P3M D;  5B1L A;  1HQ3 B;  3B6G D;  4YS3 C;  1P3B D;  2YFV A;  4LD9 A;  3AZK A;  3MGP C;  2F8N G;  5KDM A;  3X1T B;  3B6F C;  3MVD D;  3AV2 D;  5GXQ A;  1KX4 D;  5JA4 A;  5G49 B;  4CSR B;  1P3L B;  1KU5 A;  5B24 D;  5AVB D;  1P3K A;  3MGQ C;  4Z5T C;  1P34 C;  5DNN C;  1F66 D;  4X23 C;  5CPJ C;  5GT3 D;  3AZG D;  1M19 C;  3MGS C;  3AZL C;  4WU9 B;  4J8U D;  3KUY D;  5E5A B;  2PYO B;  1AOI A;  4ZBJ C;  1HQ3 C;  5B1M B;  5B33 D;  3W96 D;  3LZ0 B;  3AZI B;  1S32 A;  2CWE A;  1BH8 B;  3X1T C;  3UT9 B;  5B40 B;  3AZF A;  1EQZ D;  5B31 D;  1TAF A;  5CPI A;  3X1U A;  2F8N A;  3REI A;  1P3L C;  1M1A D;  2ARO D;  2NQB D;  2HIO B;  1P3I D;  1P3M A;  1P3O A;  5BNX A;  4H9S C;  5FUG B;  3KWQ B;  5F99 D;  4Z66 B;  5BT1 C;  3UTB A;  5CPK B;  4AWL B;  3C1B B;  3MVD A;  3X1V B;  4WU9 C;  4M6B A;  5E5A C;  3AV2 A;  2PYO C;  4J8X D;  1KX4 A;  4H9O A;  3LEL B;  1KX3 D;  3LZ1 B;  5B1M C;  5B24 A;  3W97 B;  1KX5 A;  3LZ0 C;  2BYK B;  5B2I A;  3AZI C;  3UT9 C;  1R4V A;  5B40 C;  1F66 A;  3AZM B;  5AY8 A;  5JRG D;  3AYW A;  3KUY A;  2HIO C;  3AFA D;  4R8P B;  5GT0 B;  5B33 A;  3X1S D;  3W96 A;  3KWQ C;  1P3A B;  4Z66 C;  1U35 D;  4YS3 A;  3KXB D;  5CPK C;  4AWL C;  1JFI B;  3C1B C;  3X1V C;  1EQZ A;  4JJN D;  4J8V D;  5BNV A;  5BO0 A;  3LEL C;  1N1J A;  3W98 D;  4XUJ D;  3VH6 T;  3LZ1 C;  3B6F A;  3B0C T;  3W97 C;  3WAA D;  3C1C B;  1M1A A;  3REH B;  1TZY B;  1P3G D;  4UUZ B;  3O62 B;  3REL B;  5AVC B;  3AZK D;  1HTA A;  5B0Y B;  3AZM C;  4WU8 B;  4YM6 D;  5GXQ D;  5DNN A;  4QLC B;  4R8P C;  1M19 A;  1F1E A;  5AV5 B;  3AZJ B;  5GT0 C;  4H9R B;  3MNN B;  1P3K D;  1P3A C;  1BH9 B;  3NQJ B;  5B2J B;  1ZLA D;  3VH5 T;  5JRG A;  3X1T A;  1WWI A;  3REK B;  3C1C C;  5GT3 B;  3REH C;  1TZY C;  5CP6 B;  3WKJ B;  4KUD A;  5GSU B;  3O62 C;  3REL C;  5AVC C;  3TU4 A;  5AV9 B;  3WA9 D;  1ID3 B;  1S32 D;  5B0Y C;  1U35 A;  4WU8 C;  5BS7 A;  3KXB A;  4E44 A;  4H9S A;  5CPI D;  3X1U D;  4QLC C;  4DRB A;  3REI D;  3V9R A;  3W98 A;  2HUE B;  3WAA A;  2BYM A;  5AV5 C;  3AZJ C;  4J8W B;  3MNN C;  3AV1 D;  1P3O D;  3WTP B;  1P3G A;  5B1M A;  5B2J C;  3AZH B;  3VH6 A;  3LZ0 A;  3AZE B;  1P3I B;  3MGR B;  1A7W A;  3UTB D;  3W99 B;  4YM6 A;  5B40 A;  5F99 B;  3REK C;  3AZN A;  5GT3 C;  2CV5 B;  5CP6 C;  3WKJ C;  5GSU C;  1KX5 D;  4KGC B;  5B2I D;  5AV9 C;  1ID3 C;  4ZUX B;  1H3O A;  5B32 D;  4XZQ B;  5AV6 B;  1ZLA A;  4H9P B;  5FUG A;  5AY8 D;  3KWQ A;  5DNM B;  2NZD B;  3AYW D;  4KHA A;  4G92 B;  3AN2 B;  2HUE C;  1P3F D;  1P3P B;  3C1B A;  4J8W C;  3LZ1 A;  3WTP C;  4H9Q A;  3VH5 A;  3W97 A;  3AZH C;  5B32 G;  3AZE C;  3MGR C;  3WA9 A;  3W99 C;  4YS3 D;  3REJ B;  3X1S B;  5F99 C;  5AV8 B;  3B6F D;  2CV5 C;  3A6N B;  2FJ7 B;  4KGC C;  4R8P A;  3AV1 A;  4XUJ B;  4ZUX C;  4WNN B;  5B1L B;  4XZQ C;  5AV6 C;  5B0Z A;  2NZD C;  4NE3 A;  4DRA A;  4CAY B;  5DNM C;  3B0D B;  4WZS B;  3MGQ D;  1P3A A;  1P34 D;  5DNN D;  4G92 C;  4LD9 B;  3AN2 C;  1JFI A;  1P3P C;  4NFT A;  5KDM B;  1M19 D;  3MGS D;  5GXQ B;  3WTP E;  3C1C A;  2RVQ C;  1HQ3 D;  1TZY A;  3REJ C;  5B32 A;  4H9N B;  3X1S C;  5AV8 C;  5B0Y A;  3X1T D;  4WU8 A;  2FJ7 C;  3A6N C;  1M18 B;  1P3F A;  4KUD D;  1P3L D;  4XUJ C;  3LJA B;  3TU4 D;  3UTA B;  5B1L C;  1AOI B;  3LZ1 D;  3AZJ A;  3B0D C;  3R45 A;  4LD9 C;  5BT1 D;  3MGP A;  3AZF B;  3VH6 W;  4WU9 D;  3B0C W;  1TAF B;  5GXQ C;  5CPI B;  2PYO D;  2F8N B;  5B1M D;  3WKJ A;  5GSU A;  3LZ0 D;  1P3M B;  2F8N K;  5AV9 A;  1P3O B;  3AZI D;  5BNX B;  3MGQ A;  3B6G B;  1P3B B;  4Z5T A;  1ULY A;  1P34 A;  5B40 D;  3AZN D;  3UTB B;  1M18 C;  4X23 A;  5CPJ A;  3MGS A;  3MVD B;  3AZL A;  3LJA C;  3AV2 B;  1KX4 B;  2HIO D;  3UTA C;  1AOI C;  2JSS A;  4J8W A;  1HQ3 A;  5B24 B;  5AVB B;  3KWQ D;  4NE5 A;  4Z66 D;  3AZE A;  3MGR A;  5CPK D;  3VH5 W;  3AZF C;  3C1B D;  1F66 B;  5CPI C;  3LEL D;  5G49 A;  4CSR A; 
#chains in the Genus database with same CATH topology
 3AZG B;  1P3L A;  2CV5 A;  3W97 D;  4J8U B;  3KUY B;  4KGC A;  4Z2M H;  1P3M C;  3FDD A;  1P3O C;  4ZUX A;  3B6G C;  1P3B C;  5B33 B;  3W96 B;  4XZQ A;  3AZM D;  3NQU B;  2BG1 A;  3MVD C;  1EQZ B;  3AN2 A;  4WU9 A;  5B31 B;  3AV2 C;  5E5A A;  1P3P A;  1KX4 C;  2PYO A;  1N1J B;  4R8P D;  4HGA B;  5B24 C;  5AVB C;  2ARO B;  4EO5 B;  5B0Z D;  5GT0 D;  1M1A B;  2NQB B;  1P3A D;  3AZI A;  1BH8 A;  3REJ A;  3UT9 A;  1F66 C;  3AZG C;  3C1C D;  3KUY C;  4J8U C;  4J8X B;  2HIO A;  3REH D;  1TZY D;  1KX3 B;  3O62 D;  5B33 C;  4WNN A;  3W96 C;  4ZBJ B;  5B0Y D;  4Z66 A;  4CAY A;  4WU8 D;  5CPK A;  1EQZ C;  3X1V A;  4QLC D;  5B31 C;  5JRG B;  3LEL A;  4HGA C;  4Z2M G;  1PZR A;  5AV5 D;  2ARO C;  4EO5 C;  3AZJ D;  1M1A C;  3MNN D;  2NQB C;  1P3I C;  3AFA B;  4KUD B;  2BYK A;  5B2J D;  3TU4 B;  4H9N A;  3MGP D;  3AZM A;  1U35 B;  3KXB B;  4JJN B;  3REK D;  1M18 A;  4J8V B;  4J8X C;  3V9R B;  3W98 B;  5CP6 D;  1KX3 C;  3WKJ D;  3EPH A;  5GSU D;  2YFW B;  3WAA B;  3LJA A;  2BYM B;  2XD1 A;  5GT0 A;  5AV9 D;  3UTA A;  1ID3 D;  1P3G B;  4Z5T D;  2YFV B;  5CPJ D;  4X23 D;  3AZK B;  1B6W A;  2Y2L A;  5JRG C;  3AZL D;  4YM6 B;  4WV4 B;  2L5A A;  5JA4 B;  2J8P A;  3AZN B;  3EPL A;  5C3I B;  4J8W D;  3AFA C;  3REH A;  3WTP D;  4KUD C;  4UUZ A;  3AZH D;  1BFM A;  3O62 A;  3REL A;  1Q9C A;  5AVC A;  3TU4 C;  3MGR D;  3AZE D;  3W99 D;  2Y2I A;  1P3K B;  1H3O B;  1U35 C;  5BS7 C;  3B6G A;  3KXB C;  1P3B A;  1ZLA B;  5B31 G;  4JJN C;  1WWS A;  4QLC A;  4J8V C;  3EG5 B;  4KHA B;  2CV5 D;  3W98 C;  4KGC D;  3WAA C;  5AV5 A;  4H9R A;  3MNN A;  4ZUX D;  1BH9 A;  4H9Q B;  1P3G C;  3NQJ A;  5B2J A;  5AV6 D;  4XZQ D;  2ZM5 A;  5AVB A;  5CHL B;  2NZD D;  3WA9 B;  5DNM D;  3AZK C;  1S32 B;  2IO5 B;  3AN2 D;  4YM6 C;  1P3P D;  5E5A D;  3X1U B;  3REK A;  3AZN C;  3REI B;  5C3I C;  5GT3 A;  5CP6 A;  3AZG A;  4J8U A;  2RVQ D;  1P3K C;  3AV1 B;  1ID3 A;  3REJ D;  3UT9 D;  5B0Z B;  1ZLA C;  4NE6 A;  5AV8 D;  1B67 A;  3NQU A;  2FJ7 D;  3A6N D;  5B31 A;  4H9O B;  4E45 A;  3WTP A;  1KX5 B;  5B1L D;  3AZH A;  2ARO A;  5B2I B;  2NQB A;  3WA9 C;  1P3I A;  3W99 A;  1S32 C;  2IO5 C;  4G91 B;  4LD9 D;  5B32 B;  3X1V D;  5AY8 B;  3X1U C;  5F99 A;  3AYW B;  3REI C;  1P3F B;  2F8N H;  2Y2N A;  4J8X A;  2Y2J A;  3AV1 C;  1KX3 A;  5AV6 A;  5B0Z C;  4H9P A;  3UTB C;  5DNM A;  2NZD A;  4YS3 B;  3R45 B;  3B0B A;  1M18 D;  5BNV B;  5BO0 B;  3MGP B;  3B6F B;  2Y2G A;  3LJA D;  1KX5 C;  3UTA D;  2VQR A;  1AOI D;  5B2I C;  3AFA A;  4G91 C;  5B32 C;  3X1S A;  5AY8 C;  3MGQ B;  5AV8 A;  4Z5T B;  3AYW C;  1P34 B;  2RIQ A;  3AZF D;  5DNN B;  2FJ7 A;  3A6N A;  1P3F C;  4X23 B;  5CPJ B;  4JJN A;  2F8N D;  4J8V A;  1M19 B;  2LY8 A;  3MGS B;  3AZL B;  4XUJ A;  2Y2K A;  3KSY A;  3REL D;  2YFW A;  2FFF B;  5AVC D;  1P3M D;  5B1L A;  1HQ3 B;  3B6G D;  4YS3 C;  1P3B D;  4WJ3 C;  2YFV A;  4LD9 A;  3P5J B;  3AZK A;  3MGP C;  2F8N G;  5KDM A;  3X1T B;  3B6F C;  3MVD D;  3AV2 D;  5GXQ A;  1KX4 D;  2DQN C;  5JA4 A;  5G49 B;  4CSR B;  1P3L B;  1KU5 A;  5B24 D;  5AVB D;  3AL0 C;  2Y2H A;  1P3K A;  4DQY B;  3MGQ C;  4Z5T C;  1P34 C;  5DNN C;  1F66 D;  2JE5 A;  4X23 C;  5CPJ C;  5GT3 D;  3AZG D;  1M19 C;  3MGS C;  3AZL C;  4WU9 B;  4J8U D;  3KUY D;  5E5A B;  2PYO B;  1AOI A;  4ZBJ C;  1HQ3 C;  5B1M B;  5B33 D;  3W96 D;  3LZ0 B;  3AZI B;  1S32 A;  2CWE A;  1BH8 B;  3X1T C;  3UT9 B;  5B40 B;  3AZF A;  1EQZ D;  5B31 D;  1TAF A;  5CPI A;  3X1U A;  2F8N A;  3REI A;  1P3L C;  2ZY2 A;  1M1A D;  2ARO D;  2NQB D;  2HIO B;  1P3I D;  1P3M A;  1P3O A;  5BNX A;  4H9S C;  5FUG B;  3KWQ B;  5F99 D;  4Z66 B;  5BT1 C;  3UTB A;  3KFU G;  5CPK B;  4AWL B;  3C1B B;  3MVD A;  3X1V B;  4WU9 C;  4M6B A;  5E5A C;  3AV2 A;  2PYO C;  4J8X D;  1KX4 A;  4H9O A;  3LEL B;  1KX3 D;  3LZ1 B;  5B1M C;  5B24 A;  3W97 B;  1KX5 A;  3LZ0 C;  2BYK B;  5B2I A;  3H0M C;  3AZI C;  3UT9 C;  1R4V A;  5B40 C;  1F66 A;  3AZM B;  5AY8 A;  5JRG D;  3AYW A;  3KUY A;  1W2E A;  2HIO C;  3AFA D;  4R8P B;  5GT0 B;  5B33 A;  3W96 A;  3X1S D;  2JCH A;  3KWQ C;  1P3A B;  4Z66 C;  1U35 D;  4YS3 A;  3KXB D;  5CPK C;  2UWX A;  4AWL C;  1JFI B;  2F2A C;  3C1B C;  3X1V C;  1EQZ A;  4JJN D;  4J8V D;  5BNV A;  5BO0 A;  3LEL C;  1N1J A;  3W98 D;  4XUJ D;  3VH6 T;  3LZ1 C;  3B6F A;  3B0C T;  3W97 C;  3WAA D;  3C1C B;  1M1A A;  3REH B;  1TZY B;  1P3G D;  4UUZ B;  3O62 B;  3REL B;  5AVC B;  3AZK D;  1HTA A;  5B0Y B;  3AZM C;  2DF4 C;  2Y2M A;  4WU8 B;  4YM6 D;  5GXQ D;  5DNN A;  4QLC B;  4R8P C;  1M19 A;  1F1E A;  5AV5 B;  3AZJ B;  5GT0 C;  4H9R B;  3MNN B;  1P3K D;  1P3A C;  1BH9 B;  3NQJ B;  5B2J B;  1ZLA D;  3VH5 T;  5JRG A;  3X1T A;  1WWI A;  3REK B;  3C1C C;  2ZY5 A;  5GT3 B;  3REH C;  1TZY C;  5CP6 B;  3WKJ B;  4KUD A;  5GSU B;  2G5I C;  3O62 C;  3REL C;  5AVC C;  3TU4 A;  5AV9 B;  3WA9 D;  1ID3 B;  1S32 D;  3A1I A;  5B0Y C;  3EPK A;  1U35 A;  4WU8 C;  5BS7 A;  3KXB A;  4E44 A;  4H9S A;  5CPI D;  3X1U D;  4QLC C;  4DRB A;  3REI D;  3V9R A;  3W98 A;  2HUE B;  3WAA A;  2BYM A;  5AV5 C;  3AZJ C;  4J8W B;  3MNN C;  3AV1 D;  1P3O D;  3WTP B;  1P3G A;  5B1M A;  5B2J C;  3AZH B;  3VH6 A;  3LZ0 A;  3AZE B;  1P3I B;  3MGR B;  1A7W A;  3UTB D;  3W99 B;  1Z2C B;  4YM6 A;  5B40 A;  5F99 B;  3REK C;  3AZN A;  3EPJ A;  5GT3 C;  2CV5 B;  2G5H C;  5CP6 C;  3WKJ C;  5GSU C;  1KX5 D;  4KGC B;  5B2I D;  5AV9 C;  1ID3 C;  4ZUX B;  1H3O A;  5B32 D;  4XZQ B;  5AV6 B;  1ZLA A;  4H9P B;  5FUG A;  5AY8 D;  3KWQ A;  5DNM B;  2NZD B;  3AYW D;  4KHA A;  4G92 B;  3AN2 B;  2HUE C;  3IP4 C;  1P3F D;  1P3P B;  3C1B A;  4J8W C;  4UPK A;  3LZ1 A;  3WTP C;  4H9Q A;  3VH5 A;  3W97 A;  3AZH C;  5B32 G;  3AZE C;  3MGR C;  3WA9 A;  3W99 C;  4YS3 D;  3REJ B;  3X1S B;  5F99 C;  5AV8 B;  3B6F D;  2CV5 C;  3A6N B;  2FJ7 B;  4KGC C;  2Y2O A;  4R8P A;  3AV1 A;  4XUJ B;  4ZUX C;  4WNN B;  5B1L B;  4XZQ C;  5AV6 C;  5B0Z A;  2NZD C;  4NE3 A;  4DRA A;  4CAY B;  5DNM C;  3B0D B;  4WZS B;  3MGQ D;  1P3A A;  1P34 D;  5DNN D;  4G92 C;  4LD9 B;  3AN2 C;  1JFI A;  1P3P C;  4NFT A;  2Y2Q A;  5KDM B;  3H0R C;  1M19 D;  3MGS D;  2XD5 A;  5GXQ B;  3H0L C;  3WTP E;  3C1C A;  2RVQ C;  1HQ3 D;  1TZY A;  3REJ C;  5B32 A;  4H9N B;  3X1S C;  5AV8 C;  5B0Y A;  2ZY4 A;  3X1T D;  4WU8 A;  2FJ7 C;  3A6N C;  1M18 B;  1P3F A;  4KUD D;  1P3L D;  4XUJ C;  3LJA B;  3TU4 D;  3UTA B;  5B1L C;  1AOI B;  3LZ1 D;  3AZJ A;  3B0D C;  3F6T A;  3R45 A;  4LD9 C;  5BT1 D;  1T3U A;  3MGP A;  3A1K A;  3AZF B;  3VH6 W;  4WU9 D;  3B0C W;  1TAF B;  5GXQ C;  5CPI B;  2PYO D;  2F8N B;  5B1M D;  3WKJ A;  5GSU A;  3LZ0 D;  1P3M B;  2F8N K;  5AV9 A;  1P3O B;  2ZY3 A;  5BNX B;  3AZI D;  3MGQ A;  3B6G B;  1P3B B;  4Z5T A;  1ULY A;  1P34 A;  5B40 D;  3AZN D;  3UTB B;  1M18 C;  4X23 A;  2Y2P A;  5CPJ A;  3MGS A;  3MVD B;  3AZL A;  3LJA C;  3AV2 B;  1KX4 B;  2HIO D;  3UTA C;  1AOI C;  2JSS A;  4J8W A;  1HQ3 A;  5B24 B;  5AVB B;  3KWQ D;  4NE5 A;  4Z66 D;  3AZE A;  3MGR A;  5CPK D;  3VH5 W;  3AZF C;  3C1B D;  1F66 B;  2W8S A;  5CPI C;  3LEL D;  5G49 A;  4CSR A; 
#chains in the Genus database with same CATH homology
 3AZG B;  1P3L A;  2CV5 A;  3W97 D;  4J8U B;  3KUY B;  4KGC A;  4Z2M H;  1P3M C;  3FDD A;  1P3O C;  4ZUX A;  3B6G C;  1P3B C;  5B33 B;  3W96 B;  4XZQ A;  3AZM D;  3NQU B;  2BG1 A;  3MVD C;  1EQZ B;  3AN2 A;  4WU9 A;  5B31 B;  3AV2 C;  5E5A A;  1P3P A;  1KX4 C;  2PYO A;  1N1J B;  4R8P D;  4HGA B;  5B24 C;  5AVB C;  2ARO B;  4EO5 B;  5B0Z D;  5GT0 D;  1M1A B;  2NQB B;  1P3A D;  3AZI A;  1BH8 A;  3REJ A;  3UT9 A;  1F66 C;  3AZG C;  3C1C D;  3KUY C;  4J8U C;  4J8X B;  2HIO A;  3REH D;  1TZY D;  1KX3 B;  3O62 D;  5B33 C;  4WNN A;  3W96 C;  4ZBJ B;  5B0Y D;  4Z66 A;  4CAY A;  4WU8 D;  5CPK A;  1EQZ C;  3X1V A;  4QLC D;  5B31 C;  5JRG B;  3LEL A;  4HGA C;  4Z2M G;  1PZR A;  5AV5 D;  2ARO C;  4EO5 C;  3AZJ D;  1M1A C;  3MNN D;  2NQB C;  1P3I C;  3AFA B;  4KUD B;  2BYK A;  5B2J D;  3TU4 B;  4H9N A;  3MGP D;  3AZM A;  1U35 B;  3KXB B;  4JJN B;  3REK D;  1M18 A;  4J8V B;  4J8X C;  3V9R B;  3W98 B;  5CP6 D;  1KX3 C;  3WKJ D;  3EPH A;  5GSU D;  2YFW B;  3WAA B;  3LJA A;  2BYM B;  2XD1 A;  5GT0 A;  5AV9 D;  3UTA A;  1ID3 D;  1P3G B;  4Z5T D;  2YFV B;  5CPJ D;  4X23 D;  3AZK B;  1B6W A;  2Y2L A;  5JRG C;  3AZL D;  4YM6 B;  4WV4 B;  2L5A A;  5JA4 B;  2J8P A;  3AZN B;  3EPL A;  5C3I B;  4J8W D;  3AFA C;  3REH A;  3WTP D;  4KUD C;  4UUZ A;  3AZH D;  1BFM A;  3O62 A;  3REL A;  1Q9C A;  5AVC A;  3TU4 C;  3MGR D;  3AZE D;  3W99 D;  2Y2I A;  1P3K B;  1H3O B;  1U35 C;  5BS7 C;  3B6G A;  3KXB C;  1P3B A;  1ZLA B;  5B31 G;  4JJN C;  1WWS A;  4QLC A;  4J8V C;  3EG5 B;  4KHA B;  2CV5 D;  3W98 C;  4KGC D;  3WAA C;  5AV5 A;  4H9R A;  3MNN A;  4ZUX D;  1BH9 A;  4H9Q B;  1P3G C;  3NQJ A;  5B2J A;  5AV6 D;  4XZQ D;  2ZM5 A;  5AVB A;  5CHL B;  2NZD D;  3WA9 B;  5DNM D;  3AZK C;  1S32 B;  2IO5 B;  3AN2 D;  4YM6 C;  1P3P D;  5E5A D;  3X1U B;  3REK A;  3AZN C;  3REI B;  5C3I C;  5GT3 A;  5CP6 A;  3AZG A;  4J8U A;  2RVQ D;  1P3K C;  3AV1 B;  1ID3 A;  3REJ D;  3UT9 D;  5B0Z B;  1ZLA C;  4NE6 A;  5AV8 D;  1B67 A;  3NQU A;  2FJ7 D;  3A6N D;  5B31 A;  4H9O B;  4E45 A;  3WTP A;  1KX5 B;  5B1L D;  3AZH A;  2ARO A;  5B2I B;  2NQB A;  3WA9 C;  1P3I A;  3W99 A;  1S32 C;  2IO5 C;  4G91 B;  4LD9 D;  5B32 B;  3X1V D;  5AY8 B;  3X1U C;  5F99 A;  3AYW B;  3REI C;  1P3F B;  2F8N H;  2Y2N A;  4J8X A;  2Y2J A;  3AV1 C;  1KX3 A;  5AV6 A;  5B0Z C;  4H9P A;  3UTB C;  5DNM A;  2NZD A;  4YS3 B;  3R45 B;  3B0B A;  1M18 D;  5BNV B;  5BO0 B;  3MGP B;  3B6F B;  2Y2G A;  3LJA D;  1KX5 C;  3UTA D;  2VQR A;  1AOI D;  5B2I C;  3AFA A;  4G91 C;  5B32 C;  3X1S A;  5AY8 C;  3MGQ B;  5AV8 A;  4Z5T B;  3AYW C;  1P34 B;  2RIQ A;  3AZF D;  5DNN B;  2FJ7 A;  3A6N A;  1P3F C;  4X23 B;  5CPJ B;  4JJN A;  2F8N D;  4J8V A;  1M19 B;  2LY8 A;  3MGS B;  3AZL B;  4XUJ A;  2Y2K A;  3KSY A;  3REL D;  2YFW A;  2FFF B;  5AVC D;  1P3M D;  5B1L A;  1HQ3 B;  3B6G D;  4YS3 C;  1P3B D;  4WJ3 C;  2YFV A;  4LD9 A;  3P5J B;  3AZK A;  3MGP C;  2F8N G;  5KDM A;  3X1T B;  3B6F C;  3MVD D;  3AV2 D;  5GXQ A;  1KX4 D;  2DQN C;  5JA4 A;  5G49 B;  4CSR B;  1P3L B;  1KU5 A;  5B24 D;  5AVB D;  3AL0 C;  2Y2H A;  1P3K A;  4DQY B;  3MGQ C;  4Z5T C;  1P34 C;  5DNN C;  1F66 D;  2JE5 A;  4X23 C;  5CPJ C;  5GT3 D;  3AZG D;  1M19 C;  3MGS C;  3AZL C;  4WU9 B;  4J8U D;  3KUY D;  5E5A B;  2PYO B;  1AOI A;  4ZBJ C;  1HQ3 C;  5B1M B;  5B33 D;  3W96 D;  3LZ0 B;  3AZI B;  1S32 A;  2CWE A;  1BH8 B;  3X1T C;  3UT9 B;  5B40 B;  3AZF A;  1EQZ D;  5B31 D;  1TAF A;  5CPI A;  3X1U A;  2F8N A;  3REI A;  1P3L C;  2ZY2 A;  1M1A D;  2ARO D;  2NQB D;  2HIO B;  1P3I D;  1P3M A;  1P3O A;  5BNX A;  4H9S C;  5FUG B;  3KWQ B;  5F99 D;  4Z66 B;  5BT1 C;  3UTB A;  3KFU G;  5CPK B;  4AWL B;  3C1B B;  3MVD A;  3X1V B;  4WU9 C;  4M6B A;  5E5A C;  3AV2 A;  2PYO C;  4J8X D;  1KX4 A;  4H9O A;  3LEL B;  1KX3 D;  3LZ1 B;  5B1M C;  5B24 A;  3W97 B;  1KX5 A;  3LZ0 C;  2BYK B;  5B2I A;  3H0M C;  3AZI C;  3UT9 C;  1R4V A;  5B40 C;  1F66 A;  3AZM B;  5AY8 A;  5JRG D;  3AYW A;  3KUY A;  1W2E A;  2HIO C;  3AFA D;  4R8P B;  5GT0 B;  5B33 A;  3W96 A;  3X1S D;  2JCH A;  3KWQ C;  1P3A B;  4Z66 C;  1U35 D;  4YS3 A;  3KXB D;  5CPK C;  2UWX A;  4AWL C;  1JFI B;  2F2A C;  3C1B C;  3X1V C;  1EQZ A;  4JJN D;  4J8V D;  5BNV A;  5BO0 A;  3LEL C;  1N1J A;  3W98 D;  4XUJ D;  3VH6 T;  3LZ1 C;  3B6F A;  3B0C T;  3W97 C;  3WAA D;  3C1C B;  1M1A A;  3REH B;  1TZY B;  1P3G D;  4UUZ B;  3O62 B;  3REL B;  5AVC B;  3AZK D;  1HTA A;  5B0Y B;  3AZM C;  2DF4 C;  2Y2M A;  4WU8 B;  4YM6 D;  5GXQ D;  5DNN A;  4QLC B;  4R8P C;  1M19 A;  1F1E A;  5AV5 B;  3AZJ B;  5GT0 C;  4H9R B;  3MNN B;  1P3K D;  1P3A C;  1BH9 B;  3NQJ B;  5B2J B;  1ZLA D;  3VH5 T;  5JRG A;  3X1T A;  1WWI A;  3REK B;  3C1C C;  2ZY5 A;  5GT3 B;  3REH C;  1TZY C;  5CP6 B;  3WKJ B;  4KUD A;  5GSU B;  2G5I C;  3O62 C;  3REL C;  5AVC C;  3TU4 A;  5AV9 B;  3WA9 D;  1ID3 B;  1S32 D;  3A1I A;  5B0Y C;  3EPK A;  1U35 A;  4WU8 C;  5BS7 A;  3KXB A;  4E44 A;  4H9S A;  5CPI D;  3X1U D;  4QLC C;  4DRB A;  3REI D;  3V9R A;  3W98 A;  2HUE B;  3WAA A;  2BYM A;  5AV5 C;  3AZJ C;  4J8W B;  3MNN C;  3AV1 D;  1P3O D;  3WTP B;  1P3G A;  5B1M A;  5B2J C;  3AZH B;  3VH6 A;  3LZ0 A;  3AZE B;  1P3I B;  3MGR B;  1A7W A;  3UTB D;  3W99 B;  1Z2C B;  4YM6 A;  5B40 A;  5F99 B;  3REK C;  3AZN A;  3EPJ A;  5GT3 C;  2CV5 B;  2G5H C;  5CP6 C;  3WKJ C;  5GSU C;  1KX5 D;  4KGC B;  5B2I D;  5AV9 C;  1ID3 C;  4ZUX B;  1H3O A;  5B32 D;  4XZQ B;  5AV6 B;  1ZLA A;  4H9P B;  5FUG A;  5AY8 D;  3KWQ A;  5DNM B;  2NZD B;  3AYW D;  4KHA A;  4G92 B;  3AN2 B;  2HUE C;  3IP4 C;  1P3F D;  1P3P B;  3C1B A;  4J8W C;  4UPK A;  3LZ1 A;  3WTP C;  4H9Q A;  3VH5 A;  3W97 A;  3AZH C;  5B32 G;  3AZE C;  3MGR C;  3WA9 A;  3W99 C;  4YS3 D;  3REJ B;  3X1S B;  5F99 C;  5AV8 B;  3B6F D;  2CV5 C;  3A6N B;  2FJ7 B;  4KGC C;  2Y2O A;  4R8P A;  3AV1 A;  4XUJ B;  4ZUX C;  4WNN B;  5B1L B;  4XZQ C;  5AV6 C;  5B0Z A;  2NZD C;  4NE3 A;  4DRA A;  4CAY B;  5DNM C;  3B0D B;  4WZS B;  3MGQ D;  1P3A A;  1P34 D;  5DNN D;  4G92 C;  4LD9 B;  3AN2 C;  1JFI A;  1P3P C;  4NFT A;  2Y2Q A;  5KDM B;  3H0R C;  1M19 D;  3MGS D;  2XD5 A;  5GXQ B;  3H0L C;  3WTP E;  3C1C A;  2RVQ C;  1HQ3 D;  1TZY A;  3REJ C;  5B32 A;  4H9N B;  3X1S C;  5AV8 C;  5B0Y A;  2ZY4 A;  3X1T D;  4WU8 A;  2FJ7 C;  3A6N C;  1M18 B;  1P3F A;  4KUD D;  1P3L D;  4XUJ C;  3LJA B;  3TU4 D;  3UTA B;  5B1L C;  1AOI B;  3LZ1 D;  3AZJ A;  3B0D C;  3F6T A;  3R45 A;  4LD9 C;  5BT1 D;  1T3U A;  3MGP A;  3A1K A;  3AZF B;  3VH6 W;  4WU9 D;  3B0C W;  1TAF B;  5GXQ C;  5CPI B;  2PYO D;  2F8N B;  5B1M D;  3WKJ A;  5GSU A;  3LZ0 D;  1P3M B;  2F8N K;  5AV9 A;  1P3O B;  2ZY3 A;  5BNX B;  3AZI D;  3MGQ A;  3B6G B;  1P3B B;  4Z5T A;  1ULY A;  1P34 A;  5B40 D;  3AZN D;  3UTB B;  1M18 C;  4X23 A;  2Y2P A;  5CPJ A;  3MGS A;  3MVD B;  3AZL A;  3LJA C;  3AV2 B;  1KX4 B;  2HIO D;  3UTA C;  1AOI C;  2JSS A;  4J8W A;  1HQ3 A;  5B24 B;  5AVB B;  3KWQ D;  4NE5 A;  4Z66 D;  3AZE A;  3MGR A;  5CPK D;  3VH5 W;  3AZF C;  3C1B D;  1F66 B;  2W8S A;  5CPI C;  3LEL D;  5G49 A;  4CSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...