3NQJA

Crystal structure of (cenp-a/h4)2 heterotetramer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
MLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 28
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3nqjA00
3AZIC 1BH8B 5F99A 3LZ1B 3NQJB 3WTPD 5B0YC 5GSUA 3AZKB 3B0DB 3KUYB 4Z66B 1P3PA 4KGCA 1P34C 5B33B 2F8NA 3A6NC 1P3BD 1HQ3A 3UTAC 4J8UB 1Q9CA 1KX4D 5JRGB 3AFAB 5E5AA 3AZHA 1P3KA 4H9PA 3AZGB 1AOIA 3X1UD 2JSSA 3WAAC 2AROD 5AVBC 1M1AD 2NQBB 4XUJA 4ZUXC 5B40D 3R45A 4NE6A 1B67A 3REHA 1S32C 5CPKA 2FJ7A 5JA4B 4KUDB 3VH5A 4WNNA 1F1EA 3WA9B 5B1MA 5CPJD 3AZIA 4UUZA 3KWQC 3REJC 1F66B 5GXQB 3X1VB 3LZ0D 5DNNB 5AV5C 1P3MC 5B1LB 5B24B 5BNXB 5B0YA 1KU5A 3NQUA 1A7WA 1P3AC 3AV1D 2CWEA 3B6FB 1KX5B 1P34A 1TZYB 4CSRA 3X1TD 3A6NA 2IO5C 3UTAA 4E45A 4H9NA 5F99B 3MGRD 4JJNC 3B6GD 5CPIC 3MGRC 3WKJC 5GSUB 4Z2MH 4Z66C 4J8XD 4J8XC 1P3PB 4KGCB 1P3OD 4WU9B 3WAAA 5AVBA 4ZUXA 4J8UC 4Z5TD 4H9QA 5JRGC 1S32A 1HQ3B 4Z5TC 5GT0C 3MGQD 3AFAC 1WWSA 5E5AB 3AZHB 1P3KB 3W96D 4H9PB 4AWLB 1EQZC 1ZLAC 3KWQA 1AOIB 3MNNC 3REJA 3AN2D 1M18D 5G49A 4XUJB 5AV5A 1P3MA 3R45B 4ZBJC 3REHB 5AV8D 2FJ7B 5CPKB 1P3AA 4WNNB 5B1MB 3AZFD 4QLCC 4J8VD 3AZIB 4UUZB 5GXQC 5B31C 4X23D 5DNNC 3NQJA 3REKD 4EO5C 4X23C 4JJNA 5CPIA 4YS3D 3MGRA 3WKJA 4Z66A 3B6FC 4WU8D 5C3IC 4CAYA 3LJAC 3AZLC 4J8XA 4WU8C 1P34B 5GT3D 2YFWB 3AZED 4J8UA 3A6NB 1ID3D 3TU4C 1N1JA 4Z5TA 5GT0A 1HTAA 3UTAB 3AFAA 1P3BB 1KX4B 3KXBC 4G91B 5B0ZD 3AZJD 1P3PC 1EQZA 1ZLAA 2BYKB 3MNNA 3MGSD 4WU9C 3B0CW 5KDMA 3X1UB 3AZND 3RELD 3WAAB 5AVBB 5JA4A 2AROB 1TAFA 1M1AB 2NZDC 1S32B 2L5AA 5AV9C 4QLCA 3MVDD 3KWQB 1P3LC 5GXQA 3REJB 1KX3D 5B31A 5DNNA 3AYWC 4X23A 3O62D 5BNXA 4E44A 1P3MB 3B6FA 1P3AB 3LJAA 3AZLA 4WU8A 5B2JC 3C1BD 3MGPD 3UT9D 3TU4A 2IO5B 1ID3A 4JJNB 3W98D 3WTPC 3KXBA 5CPIB 3MGRB 3W98C 3WKJB 4CAYB 4DRAA 4J8XB 4WU9A 1M19D 2BYMB 4YM6D 3REID 4R8PD 4G92C 3AZMD 3AZNA 1P3BC 2NZDA 1KX4C 1N1JB 4G91C 4Z5TB 5GT0B 5AV9A 5BS7C 3MGQB 3LELD 1EQZB 3X1UC 1ZLAB 1P3LA 3MNNB 5KDMB 5AY8D 2AROC 3AYWA 5DNMD 1M1AC 3UTBD 5B40C 1M18B 5DNMC 5B31G 1TAFB 4ZBJB 3UTBC 4NFTA 5AVCD 2F8NK 5B2JA 4QLCB 3AZFB 5CPJC 3MGPA 4J8VB 5B31B 3W99D 3X1SD 4EO5B 4X23B 3LZ0C 3W99C 3WTPA 3W98A 4YS3B 4XZQD 3AV1C 5C3IB 3LJAB 3AZLB 3VH6W 4WU8B 2YFWA 2YFVA 5BT1D 3X1TC 1P3BA 3TU4B 1KX4A 1ID3B 5BS7A 3B6GC 3KXBB 2BYKA 1TZYA 3C1CD 3X1UA 3AZJB 1P3OC 3MGSB 2AROA 1M1AA 5B40A 3AZNB 5DNMA 3RELB 3UTBA 2NZDB 1R4VA 5B2ID 3MGQC 2F8NH 5AV9B 3B0CT 4LD9D 4LD9C 3W96C 5CPJA 4H9OA 2HIOD 1P3LB 3KUYD 1KX3B 3AN2C 1M18C 1P3GD 3AYWB 3LZ0A 2LY8A 3W99A 3O62B 5AV8C 3AV2D 1P3FD 2RVQD 3AV1A 3AV2C 3AZFC 5FUGB 5B2JB 4J8VC 2PYOD 3X1TA 3MGPB 2PYOC 3REKC 3B6GA 3WTPB 4YS3C 1WWIA 2NQBD 3W98B 2BYMA 1P3OA 5GT3C 2YFVB 3WA9D 3AZEC 4G92B 1M19B 1ID3C 4WZSB 4R8PB 3MGQA 1F66D 3W97D 4LD9A 3W97C 3X1VD 5B0ZC 3W96A 3AZJC 3LELB 3B0BA 5B1LD 5B24D 4H9RB 3MGSC 3VH5W 3AZNC 3AN2A 1M18A 3RELC 1KX5D 5B40B 1P3GA 5DNMB 1TZYD 5AV8A 3UTBB 2HUEC 3AV2A 3AZFA 3VH6A 5BO0A 4J8VA 5CPJB 4H9OB 3MVDC 1KX3C 5GSUD 2PYOA 1P3ID 3REKA 3O62C 1P3IC 4KGCD 3LZ0B 3W99B 4YS3A 2F8ND 3AV1B 4NE5A 3C1BC 5GT3A 3MGPC 3AZEA 5E5AD 3AZHD 3UT9C 3X1TB 1P3KD 4KHAB 3VH6T 1AOID 1JFIA 3B6GB 3W97A 5B0ZA 3AZJA 4XUJD 3MGSA 5CPKD 1U35D 1M19C 1P3OB 4HGAC 3REIC 4YM6C 3RELA 4R8PC 5B1MD 3AZMC 1U35C 5B2IB 4LD9B 3LELC 3W96B 3MVDA 5B0YD 1KX3A 5AV6D 5AY8C 5B32D 2HIOB 3V9RA 3AN2B 5AV6C 3O62A 1P3IA 5B32C 2CV5D 5BNVA 1P34D 1P3GB 2CV5C 5AV8B 4M6BA 5AVCC 5FUGA 3AV2B 3A6ND 1P3FB 3UTAD 3C1BA 5BO0B 3UT9A 2PYOB 5CP6D 3X1SC 3REKB 5CP6C 3WAAD 5AVBD 4XZQC 4ZUXD 1S32D 1BFMA 1M19A 5GT3B 3REIA 4YM6A 3AZMA 5BT1C 4R8PA 1U35A 3AZEB 1BH9A 3KWQD 3REJD 1JFIB 4DRBA 4J8WD 3LELA 3W97B 4J8WC 4H9RA 5B0ZB 5AV5D 3C1CC 1P3MD 1P3AD 4Z2MG 5AY8A 5AV6A 5B32A 2CV5A 5B2IC 5AVCA 2HUEB 3VH5T 3LZ1D 4WV4B 3LZ1C 4JJND 3AZKD 5CPID 3AZKC 2F8NG 3B0DC 2HIOC 3MVDB 3WKJD 4Z66D 3KUYC 3X1SA 3V9RB 1P3GC 1P3IB 5CP6A 5B33D 5BNVB 1H3OA 5B33C 1P3FC 2RVQC 4XZQA 4J8UD 5JRGD 2F8NB 5CHLB 5GT0D 3AFAD 3C1BB 3AZGD 4KHAA 3UT9B 3AZGC 1EQZD 1ZLAD 3MNND 3KSYA 2NQBC 4J8WA 4KUDD 3C1CA 4KUDC 3WA9C 4HGAB 3REIB 4YM6B 3AZMB 1U35B 4QLCD 1BH9B 5B2IA 1F66C 5B32G 5GXQD 1BH8A 5B31D 5DNND 3X1VC 3LZ1A 1ULYA 5B1LC 5B24C 3AZKA 2HIOA 4H9SC 3B6FD 3KUYA 5B0YB 5AY8B 3NQUB 3LJAD 3AZLD 1KX5C 5AV6B 5B32B 1TZYC 2CV5B 5B33A 1P3FA 5AVCB 4CSRB 5F99D 3TU4D 5F99C 5JRGA 3KXBD 4H9NB 5GSUC 3AZGA 1P3PD 3X1SB 4KGCC 4WU9D 5CP6B 1H3OB 2NQBA 1HQ3D 4XZQB 4KUDA 1HQ3C 2NZDD 4ZUXB 4H9QB 5AV9D 3WA9A 5E5AC 3AZHC 1P3KC 4AWLC 1B6WA 1AOIC 3WTPE 1F66A 1P3LD 3X1VA 3AYWD 4J8WB 4XUJC 3REHD 2FJ7D 5B1LA 4NE3A 5G49B 5B24A 3C1CB 3REHC 5CPKC 2FJ7C 5AV5B 4H9SA 1KX5A 5B1MC 3AZID 5B2JD
chains in the Genus database with same CATH superfamily
3EPHA 3AZIC 1BH8B 5F99A 3LZ1B 3NQJB 3WTPD 5B0YC 5GSUA 3AZKB 3B0DB 3KUYB 4Z66B 1P3PA 4KGCA 1P34C 5B33B 2F8NA 3A6NC 1P3BD 1HQ3A 3UTAC 3H0RC 1Q9CA 4J8UB 1KX4D 5JRGB 3AFAB 5E5AA 3AZHA 1P3KA 1PZRA 4H9PA 3AZGB 1AOIA 3X1UD 2JSSA 3WAAC 2AROD 5AVBC 1M1AD 2NQBB 4XUJA 4ZUXC 5B40D 3R45A 4NE6A 1B67A 3REHA 1S32C 5CPKA 2FJ7A 5JA4B 4KUDB 3VH5A 4WNNA 1F1EA 3WA9B 5B1MA 5CPJD 3AZIA 4UUZA 3KWQC 3REJC 1F66B 5GXQB 3X1VB 3LZ0D 5DNNB 5AV5C 1P3MC 5B1LB 5B24B 5BNXB 5B0YA 1KU5A 3NQUA 1A7WA 1P3AC 3AV1D 2CWEA 3B6FB 1KX5B 1P34A 1TZYB 4CSRA 3X1TD 3A6NA 2IO5C 3UTAA 4E45A 4H9NA 5F99B 3MGRD 4JJNC 3B6GD 5CPIC 3MGRC 3WKJC 5GSUB 4Z2MH 4Z66C 4J8XD 2ZM5A 4J8XC 1P3PB 4KGCB 1P3OD 4WU9B 3WAAA 5AVBA 3H0LC 4ZUXA 4J8UC 4Z5TD 4H9QA 5JRGC 1S32A 1HQ3B 4Z5TC 5GT0C 3MGQD 3AFAC 1WWSA 2Y2GA 5E5AB 3AZHB 1P3KB 3W96D 4H9PB 4AWLB 1EQZC 1ZLAC 3KWQA 1AOIB 3MNNC 3REJA 3AN2D 3F6TA 1M18D 5G49A 4XUJB 5AV5A 1P3MA 3R45B 4ZBJC 3REHB 5AV8D 2FJ7B 5CPKB 1P3AA 4WNNB 5B1MB 3AZFD 4QLCC 4J8VD 3AZIB 4UUZB 5GXQC 5B31C 4X23D 5DNNC 3NQJA 3REKD 4EO5C 4X23C 4JJNA 5CPIA 4YS3D 3MGRA 3WKJA 2G5IC 4Z66A 3B6FC 4WU8D 5C3IC 4CAYA 3LJAC 3AZLC 2W8SA 4J8XA 4WU8C 1P34B 5GT3D 2YFWB 1Z2CB 3AZED 4J8UA 3A6NB 1ID3D 3TU4C 1N1JA 4Z5TA 5GT0A 1HTAA 3UTAB 3AFAA 1P3BB 1KX4B 3KXBC 4G91B 2XD1A 5B0ZD 3AZJD 1P3PC 1EQZA 1ZLAA 2BYKB 3MNNA 3MGSD 4WU9C 3B0CW 5KDMA 3X1UB 3AZND 2Y2OA 3RELD 3WAAB 5AVBB 5JA4A 2AROB 1TAFA 1M1AB 2NZDC 1S32B 2L5AA 5AV9C 4QLCA 3MVDD 3KWQB 1P3LC 5GXQA 3REJB 1KX3D 5B31A 5DNNA 3AYWC 4X23A 3O62D 5BNXA 4E44A 2G5HC 3EG5B 1P3MB 3B6FA 1P3AB 3LJAA 3AZLA 4WU8A 5B2JC 3C1BD 3MGPD 3EPJA 3UT9D 3TU4A 2IO5B 1ID3A 4JJNB 3W98D 3WTPC 3KXBA 5CPIB 3MGRB 3W98C 2RIQA 3WKJB 4CAYB 4DRAA 4J8XB 4WU9A 1M19D 2BYMB 4YM6D 3REID 4R8PD 4G92C 3AZMD 3AZNA 1P3BC 2NZDA 1KX4C 1N1JB 4G91C 4Z5TB 5GT0B 5AV9A 5BS7C 3MGQB 3LELD 1EQZB 3X1UC 1ZLAB 1P3LA 3MNNB 5KDMB 5AY8D 2AROC 3AYWA 5DNMD 1M1AC 3UTBD 5B40C 1M18B 5DNMC 5B31G 1TAFB 4ZBJB 3UTBC 4NFTA 5AVCD 2F8NK 5B2JA 4QLCB 3AZFB 5CPJC 2Y2JA 3MGPA 4J8VB 2Y2HA 5B31B 3W99D 3X1SD 2ZY3A 4EO5B 4X23B 3LZ0C 3W99C 3WTPA 2Y2IA 3W98A 4YS3B 4XZQD 3AV1C 5C3IB 3LJAB 3AZLB 3VH6W 2ZY2A 4WU8B 2YFWA 2YFVA 5BT1D 3X1TC 3A1KA 1P3BA 2XD5A 3TU4B 1KX4A 1ID3B 5BS7A 3B6GC 3KXBB 3EPLA 2BYKA 1TZYA 3C1CD 3X1UA 3AZJB 1P3OC 3MGSB 2AROA 1M1AA 5B40A 3AZNB 5DNMA 2BG1A 3RELB 3UTBA 2NZDB 1R4VA 5B2ID 3MGQC 2F8NH 5AV9B 3B0CT 4LD9D 4LD9C 3W96C 5CPJA 4H9OA 2JE5A 2HIOD 1P3LB 3FDDA 3KUYD 1KX3B 3AN2C 2ZY5A 1M18C 1P3GD 3AYWB 2DF4C 3LZ0A 2LY8A 3W99A 3O62B 5AV8C 3AV2D 1P3FD 2RVQD 3AV1A 3AV2C 3AZFC 5FUGB 5B2JB 4J8VC 2PYOD 3X1TA 3MGPB 2PYOC 3REKC 3B6GA 3WTPB 4YS3C 1WWIA 2NQBD 3W98B 2BYMA 1P3OA 5GT3C 2YFVB 3WA9D 3AZEC 4G92B 1M19B 1ID3C 4WZSB 4R8PB 3MGQA 1F66D 3W97D 4LD9A 3W97C 3X1VD 5B0ZC 3W96A 3AZJC 2J8PA 2UWXA 3LELB 3B0BA 5B1LD 5B24D 4H9RB 3MGSC 3VH5W 2DQNC 3AZNC 3AN2A 1M18A 3RELC 1KX5D 2Y2LA 5B40B 1P3GA 5DNMB 1TZYD 5AV8A 3UTBB 2HUEC 3AV2A 3P5JB 3AZFA 2VQRA 3EPKA 3VH6A 5BO0A 4J8VA 5CPJB 4H9OB 3MVDC 1KX3C 2JCHA 5GSUD 2PYOA 2Y2PA 1P3ID 3REKA 3O62C 1P3IC 4KGCD 3LZ0B 3W99B 4YS3A 2Y2NA 2F8ND 3AV1B 4NE5A 3C1BC 5GT3A 3MGPC 3AZEA 5E5AD 3AZHD 3UT9C 3X1TB 1P3KD 4KHAB 3VH6T 1AOID 1JFIA 2Y2MA 3B6GB 3W97A 5B0ZA 3AZJA 4XUJD 3MGSA 5CPKD 1U35D 1M19C 1P3OB 4HGAC 3REIC 4YM6C 3RELA 4R8PC 5B1MD 3AZMC 1U35C 3KFUG 2Y2QA 5B2IB 4LD9B 3LELC 3W96B 3MVDA 5B0YD 1KX3A 1T3UA 5AV6D 5AY8C 5B32D 2HIOB 3V9RA 3AN2B 5AV6C 3O62A 1P3IA 5B32C 2CV5D 5BNVA 1P34D 1P3GB 2CV5C 5AV8B 4M6BA 5AVCC 5FUGA 3AV2B 3A6ND 1P3FB 3UTAD 3C1BA 5BO0B 3UT9A 2PYOB 5CP6D 3X1SC 3REKB 5CP6C 3WAAD 5AVBD 4XZQC 4ZUXD 1S32D 1BFMA 1M19A 5GT3B 3REIA 4YM6A 3AZMA 5BT1C 4R8PA 1U35A 3AZEB 1BH9A 3KWQD 3REJD 1JFIB 3A1IA 4DRBA 4J8WD 3LELA 3W97B 4J8WC 4H9RA 5B0ZB 5AV5D 3C1CC 1P3MD 1P3AD 4Z2MG 5AY8A 5AV6A 2FFFB 5B32A 2CV5A 5B2IC 5AVCA 2HUEB 3VH5T 3LZ1D 4WV4B 3IP4C 3LZ1C 4JJND 3AZKD 5CPID 3AZKC 3H0MC 2F8NG 3B0DC 2HIOC 3MVDB 3WKJD 4Z66D 3KUYC 3X1SA 3V9RB 1P3GC 1P3IB 5CP6A 5B33D 5BNVB 1H3OA 5B33C 1P3FC 2F2AC 2RVQC 4XZQA 4J8UD 5JRGD 2F8NB 5CHLB 5GT0D 3AFAD 3C1BB 3AZGD 4KHAA 3UT9B 3AZGC 1EQZD 1ZLAD 3MNND 3KSYA 2NQBC 4J8WA 4KUDD 3C1CA 4KUDC 2ZY4A 3WA9C 4HGAB 3REIB 4YM6B 3AZMB 1U35B 4QLCD 1BH9B 5B2IA 1F66C 5B32G 5GXQD 1BH8A 5B31D 5DNND 3X1VC 3LZ1A 3AL0C 1ULYA 5B1LC 5B24C 3AZKA 2HIOA 2Y2KA 4H9SC 3B6FD 3KUYA 5B0YB 5AY8B 3NQUB 3LJAD 3AZLD 1KX5C 5AV6B 5B32B 4UPKA 1TZYC 2CV5B 5B33A 1P3FA 5AVCB 4CSRB 5F99D 3TU4D 5F99C 5JRGA 3KXBD 4H9NB 5GSUC 4WJ3C 3AZGA 1P3PD 3X1SB 4DQYB 4KGCC 4WU9D 5CP6B 1H3OB 2NQBA 1HQ3D 4XZQB 4KUDA 1HQ3C 2NZDD 4ZUXB 4H9QB 5AV9D 3WA9A 5E5AC 3AZHC 1W2EA 1P3KC 4AWLC 1B6WA 1AOIC 3WTPE 1F66A 1P3LD 3X1VA 3AYWD 4J8WB 4XUJC 3REHD 2FJ7D 5B1LA 4NE3A 5G49B 5B24A 3C1CB 3REHC 5CPKC 2FJ7C 5AV5B 4H9SA 1KX5A 5B1MC 3AZID 5B2JD
chains in the Genus database with same CATH topology
3EPHA 3AZIC 1BH8B 5F99A 3LZ1B 3NQJB 3WTPD 5B0YC 5GSUA 3AZKB 3B0DB 3KUYB 4Z66B 1P3PA 4KGCA 1P34C 5B33B 2F8NA 3A6NC 1P3BD 1HQ3A 3UTAC 3H0RC 1Q9CA 4J8UB 1KX4D 5JRGB 3AFAB 5E5AA 3AZHA 1P3KA 1PZRA 4H9PA 3AZGB 1AOIA 3X1UD 2JSSA 3WAAC 2AROD 5AVBC 1M1AD 2NQBB 4XUJA 4ZUXC 5B40D 3R45A 4NE6A 1B67A 3REHA 1S32C 5CPKA 2FJ7A 5JA4B 4KUDB 3VH5A 4WNNA 1F1EA 3WA9B 5B1MA 5CPJD 3AZIA 4UUZA 3KWQC 3REJC 1F66B 5GXQB 3X1VB 3LZ0D 5DNNB 5AV5C 1P3MC 5B1LB 5B24B 5BNXB 5B0YA 1KU5A 3NQUA 1A7WA 1P3AC 3AV1D 2CWEA 3B6FB 1KX5B 1P34A 1TZYB 4CSRA 3X1TD 3A6NA 2IO5C 3UTAA 4E45A 4H9NA 5F99B 3MGRD 4JJNC 3B6GD 5CPIC 3MGRC 3WKJC 5GSUB 4Z2MH 4Z66C 4J8XD 2ZM5A 4J8XC 1P3PB 4KGCB 1P3OD 4WU9B 3WAAA 5AVBA 3H0LC 4ZUXA 4J8UC 4Z5TD 4H9QA 5JRGC 1S32A 1HQ3B 4Z5TC 5GT0C 3MGQD 3AFAC 1WWSA 2Y2GA 5E5AB 3AZHB 1P3KB 3W96D 4H9PB 4AWLB 1EQZC 1ZLAC 3KWQA 1AOIB 3MNNC 3REJA 3AN2D 3F6TA 1M18D 5G49A 4XUJB 5AV5A 1P3MA 3R45B 4ZBJC 3REHB 5AV8D 2FJ7B 5CPKB 1P3AA 4WNNB 5B1MB 3AZFD 4QLCC 4J8VD 3AZIB 4UUZB 5GXQC 5B31C 4X23D 5DNNC 3NQJA 3REKD 4EO5C 4X23C 4JJNA 5CPIA 4YS3D 3MGRA 3WKJA 2G5IC 4Z66A 3B6FC 4WU8D 5C3IC 4CAYA 3LJAC 3AZLC 2W8SA 4J8XA 4WU8C 1P34B 5GT3D 2YFWB 1Z2CB 3AZED 4J8UA 3A6NB 1ID3D 3TU4C 1N1JA 4Z5TA 5GT0A 1HTAA 3UTAB 3AFAA 1P3BB 1KX4B 3KXBC 4G91B 2XD1A 5B0ZD 3AZJD 1P3PC 1EQZA 1ZLAA 2BYKB 3MNNA 3MGSD 4WU9C 3B0CW 5KDMA 3X1UB 3AZND 2Y2OA 3RELD 3WAAB 5AVBB 5JA4A 2AROB 1TAFA 1M1AB 2NZDC 1S32B 2L5AA 5AV9C 4QLCA 3MVDD 3KWQB 1P3LC 5GXQA 3REJB 1KX3D 5B31A 5DNNA 3AYWC 4X23A 3O62D 5BNXA 4E44A 2G5HC 3EG5B 1P3MB 3B6FA 1P3AB 3LJAA 3AZLA 4WU8A 5B2JC 3C1BD 3MGPD 3EPJA 3UT9D 3TU4A 2IO5B 1ID3A 4JJNB 3W98D 3WTPC 3KXBA 5CPIB 3MGRB 3W98C 2RIQA 3WKJB 4CAYB 4DRAA 4J8XB 4WU9A 1M19D 2BYMB 4YM6D 3REID 4R8PD 4G92C 3AZMD 3AZNA 1P3BC 2NZDA 1KX4C 1N1JB 4G91C 4Z5TB 5GT0B 5AV9A 5BS7C 3MGQB 3LELD 1EQZB 3X1UC 1ZLAB 1P3LA 3MNNB 5KDMB 5AY8D 2AROC 3AYWA 5DNMD 1M1AC 3UTBD 5B40C 1M18B 5DNMC 5B31G 1TAFB 4ZBJB 3UTBC 4NFTA 5AVCD 2F8NK 5B2JA 4QLCB 3AZFB 5CPJC 2Y2JA 3MGPA 4J8VB 2Y2HA 5B31B 3W99D 3X1SD 2ZY3A 4EO5B 4X23B 3LZ0C 3W99C 3WTPA 2Y2IA 3W98A 4YS3B 4XZQD 3AV1C 5C3IB 3LJAB 3AZLB 3VH6W 2ZY2A 4WU8B 2YFWA 2YFVA 5BT1D 3X1TC 3A1KA 1P3BA 2XD5A 3TU4B 1KX4A 1ID3B 5BS7A 3B6GC 3KXBB 3EPLA 2BYKA 1TZYA 3C1CD 3X1UA 3AZJB 1P3OC 3MGSB 2AROA 1M1AA 5B40A 3AZNB 5DNMA 2BG1A 3RELB 3UTBA 2NZDB 1R4VA 5B2ID 3MGQC 2F8NH 5AV9B 3B0CT 4LD9D 4LD9C 3W96C 5CPJA 4H9OA 2JE5A 2HIOD 1P3LB 3FDDA 3KUYD 1KX3B 3AN2C 2ZY5A 1M18C 1P3GD 3AYWB 2DF4C 3LZ0A 2LY8A 3W99A 3O62B 5AV8C 3AV2D 1P3FD 2RVQD 3AV1A 3AV2C 3AZFC 5FUGB 5B2JB 4J8VC 2PYOD 3X1TA 3MGPB 2PYOC 3REKC 3B6GA 3WTPB 4YS3C 1WWIA 2NQBD 3W98B 2BYMA 1P3OA 5GT3C 2YFVB 3WA9D 3AZEC 4G92B 1M19B 1ID3C 4WZSB 4R8PB 3MGQA 1F66D 3W97D 4LD9A 3W97C 3X1VD 5B0ZC 3W96A 3AZJC 2J8PA 2UWXA 3LELB 3B0BA 5B1LD 5B24D 4H9RB 3MGSC 3VH5W 2DQNC 3AZNC 3AN2A 1M18A 3RELC 1KX5D 2Y2LA 5B40B 1P3GA 5DNMB 1TZYD 5AV8A 3UTBB 2HUEC 3AV2A 3P5JB 3AZFA 2VQRA 3EPKA 3VH6A 5BO0A 4J8VA 5CPJB 4H9OB 3MVDC 1KX3C 2JCHA 5GSUD 2PYOA 2Y2PA 1P3ID 3REKA 3O62C 1P3IC 4KGCD 3LZ0B 3W99B 4YS3A 2Y2NA 2F8ND 3AV1B 4NE5A 3C1BC 5GT3A 3MGPC 3AZEA 5E5AD 3AZHD 3UT9C 3X1TB 1P3KD 4KHAB 3VH6T 1AOID 1JFIA 2Y2MA 3B6GB 3W97A 5B0ZA 3AZJA 4XUJD 3MGSA 5CPKD 1U35D 1M19C 1P3OB 4HGAC 3REIC 4YM6C 3RELA 4R8PC 5B1MD 3AZMC 1U35C 3KFUG 2Y2QA 5B2IB 4LD9B 3LELC 3W96B 3MVDA 5B0YD 1KX3A 1T3UA 5AV6D 5AY8C 5B32D 2HIOB 3V9RA 3AN2B 5AV6C 3O62A 1P3IA 5B32C 2CV5D 5BNVA 1P34D 1P3GB 2CV5C 5AV8B 4M6BA 5AVCC 5FUGA 3AV2B 3A6ND 1P3FB 3UTAD 3C1BA 5BO0B 3UT9A 2PYOB 5CP6D 3X1SC 3REKB 5CP6C 3WAAD 5AVBD 4XZQC 4ZUXD 1S32D 1BFMA 1M19A 5GT3B 3REIA 4YM6A 3AZMA 5BT1C 4R8PA 1U35A 3AZEB 1BH9A 3KWQD 3REJD 1JFIB 3A1IA 4DRBA 4J8WD 3LELA 3W97B 4J8WC 4H9RA 5B0ZB 5AV5D 3C1CC 1P3MD 1P3AD 4Z2MG 5AY8A 5AV6A 2FFFB 5B32A 2CV5A 5B2IC 5AVCA 2HUEB 3VH5T 3LZ1D 4WV4B 3IP4C 3LZ1C 4JJND 3AZKD 5CPID 3AZKC 3H0MC 2F8NG 3B0DC 2HIOC 3MVDB 3WKJD 4Z66D 3KUYC 3X1SA 3V9RB 1P3GC 1P3IB 5CP6A 5B33D 5BNVB 1H3OA 5B33C 1P3FC 2F2AC 2RVQC 4XZQA 4J8UD 5JRGD 2F8NB 5CHLB 5GT0D 3AFAD 3C1BB 3AZGD 4KHAA 3UT9B 3AZGC 1EQZD 1ZLAD 3MNND 3KSYA 2NQBC 4J8WA 4KUDD 3C1CA 4KUDC 2ZY4A 3WA9C 4HGAB 3REIB 4YM6B 3AZMB 1U35B 4QLCD 1BH9B 5B2IA 1F66C 5B32G 5GXQD 1BH8A 5B31D 5DNND 3X1VC 3LZ1A 3AL0C 1ULYA 5B1LC 5B24C 3AZKA 2HIOA 2Y2KA 4H9SC 3B6FD 3KUYA 5B0YB 5AY8B 3NQUB 3LJAD 3AZLD 1KX5C 5AV6B 5B32B 4UPKA 1TZYC 2CV5B 5B33A 1P3FA 5AVCB 4CSRB 5F99D 3TU4D 5F99C 5JRGA 3KXBD 4H9NB 5GSUC 4WJ3C 3AZGA 1P3PD 3X1SB 4DQYB 4KGCC 4WU9D 5CP6B 1H3OB 2NQBA 1HQ3D 4XZQB 4KUDA 1HQ3C 2NZDD 4ZUXB 4H9QB 5AV9D 3WA9A 5E5AC 3AZHC 1W2EA 1P3KC 4AWLC 1B6WA 1AOIC 3WTPE 1F66A 1P3LD 3X1VA 3AYWD 4J8WB 4XUJC 3REHD 2FJ7D 5B1LA 4NE3A 5G49B 5B24A 3C1CB 3REHC 5CPKC 2FJ7C 5AV5B 4H9SA 1KX5A 5B1MC 3AZID 5B2JD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZI C;  1BH8 B;  5F99 A;  3LZ1 B;  3NQJ B;  3WTP D;  5B0Y C;  5GSU A;  3AZK B;  3B0D B;  3KUY B;  4Z66 B;  1P3P A;  4KGC A;  1P34 C;  5B33 B;  2F8N A;  3A6N C;  1P3B D;  1HQ3 A;  3UTA C;  4J8U B;  1Q9C A;  1KX4 D;  5JRG B;  3AFA B;  5E5A A;  3AZH A;  1P3K A;  4H9P A;  3AZG B;  1AOI A;  3X1U D;  2JSS A;  3WAA C;  2ARO D;  5AVB C;  1M1A D;  2NQB B;  4XUJ A;  4ZUX C;  5B40 D;  3R45 A;  4NE6 A;  1B67 A;  3REH A;  1S32 C;  5CPK A;  2FJ7 A;  5JA4 B;  4KUD B;  3VH5 A;  4WNN A;  1F1E A;  3WA9 B;  5B1M A;  5CPJ D;  3AZI A;  4UUZ A;  3KWQ C;  3REJ C;  1F66 B;  5GXQ B;  3X1V B;  3LZ0 D;  5DNN B;  5AV5 C;  1P3M C;  5B1L B;  5B24 B;  5BNX B;  5B0Y A;  1KU5 A;  3NQU A;  1A7W A;  1P3A C;  3AV1 D;  2CWE A;  3B6F B;  1KX5 B;  1P34 A;  1TZY B;  4CSR A;  3X1T D;  3A6N A;  2IO5 C;  3UTA A;  4E45 A;  4H9N A;  5F99 B;  3MGR D;  4JJN C;  3B6G D;  5CPI C;  3MGR C;  3WKJ C;  5GSU B;  4Z2M H;  4Z66 C;  4J8X D;  4J8X C;  1P3P B;  4KGC B;  1P3O D;  4WU9 B;  3WAA A;  5AVB A;  4ZUX A;  4J8U C;  4Z5T D;  4H9Q A;  5JRG C;  1S32 A;  1HQ3 B;  4Z5T C;  5GT0 C;  3MGQ D;  3AFA C;  1WWS A;  5E5A B;  3AZH B;  1P3K B;  3W96 D;  4H9P B;  4AWL B;  1EQZ C;  1ZLA C;  3KWQ A;  1AOI B;  3MNN C;  3REJ A;  3AN2 D;  1M18 D;  5G49 A;  4XUJ B;  5AV5 A;  1P3M A;  3R45 B;  4ZBJ C;  3REH B;  5AV8 D;  2FJ7 B;  5CPK B;  1P3A A;  4WNN B;  5B1M B;  3AZF D;  4QLC C;  4J8V D;  3AZI B;  4UUZ B;  5GXQ C;  5B31 C;  4X23 D;  5DNN C;  3NQJ A;  3REK D;  4EO5 C;  4X23 C;  4JJN A;  5CPI A;  4YS3 D;  3MGR A;  3WKJ A;  4Z66 A;  3B6F C;  4WU8 D;  5C3I C;  4CAY A;  3LJA C;  3AZL C;  4J8X A;  4WU8 C;  1P34 B;  5GT3 D;  2YFW B;  3AZE D;  4J8U A;  3A6N B;  1ID3 D;  3TU4 C;  1N1J A;  4Z5T A;  5GT0 A;  1HTA A;  3UTA B;  3AFA A;  1P3B B;  1KX4 B;  3KXB C;  4G91 B;  5B0Z D;  3AZJ D;  1P3P C;  1EQZ A;  1ZLA A;  2BYK B;  3MNN A;  3MGS D;  4WU9 C;  3B0C W;  5KDM A;  3X1U B;  3AZN D;  3REL D;  3WAA B;  5AVB B;  5JA4 A;  2ARO B;  1TAF A;  1M1A B;  2NZD C;  1S32 B;  2L5A A;  5AV9 C;  4QLC A;  3MVD D;  3KWQ B;  1P3L C;  5GXQ A;  3REJ B;  1KX3 D;  5B31 A;  5DNN A;  3AYW C;  4X23 A;  3O62 D;  5BNX A;  4E44 A;  1P3M B;  3B6F A;  1P3A B;  3LJA A;  3AZL A;  4WU8 A;  5B2J C;  3C1B D;  3MGP D;  3UT9 D;  3TU4 A;  2IO5 B;  1ID3 A;  4JJN B;  3W98 D;  3WTP C;  3KXB A;  5CPI B;  3MGR B;  3W98 C;  3WKJ B;  4CAY B;  4DRA A;  4J8X B;  4WU9 A;  1M19 D;  2BYM B;  4YM6 D;  3REI D;  4R8P D;  4G92 C;  3AZM D;  3AZN A;  1P3B C;  2NZD A;  1KX4 C;  1N1J B;  4G91 C;  4Z5T B;  5GT0 B;  5AV9 A;  5BS7 C;  3MGQ B;  3LEL D;  1EQZ B;  3X1U C;  1ZLA B;  1P3L A;  3MNN B;  5KDM B;  5AY8 D;  2ARO C;  3AYW A;  5DNM D;  1M1A C;  3UTB D;  5B40 C;  1M18 B;  5DNM C;  5B31 G;  1TAF B;  4ZBJ B;  3UTB C;  4NFT A;  5AVC D;  2F8N K;  5B2J A;  4QLC B;  3AZF B;  5CPJ C;  3MGP A;  4J8V B;  5B31 B;  3W99 D;  3X1S D;  4EO5 B;  4X23 B;  3LZ0 C;  3W99 C;  3WTP A;  3W98 A;  4YS3 B;  4XZQ D;  3AV1 C;  5C3I B;  3LJA B;  3AZL B;  3VH6 W;  4WU8 B;  2YFW A;  2YFV A;  5BT1 D;  3X1T C;  1P3B A;  3TU4 B;  1KX4 A;  1ID3 B;  5BS7 A;  3B6G C;  3KXB B;  2BYK A;  1TZY A;  3C1C D;  3X1U A;  3AZJ B;  1P3O C;  3MGS B;  2ARO A;  1M1A A;  5B40 A;  3AZN B;  5DNM A;  3REL B;  3UTB A;  2NZD B;  1R4V A;  5B2I D;  3MGQ C;  2F8N H;  5AV9 B;  3B0C T;  4LD9 D;  4LD9 C;  3W96 C;  5CPJ A;  4H9O A;  2HIO D;  1P3L B;  3KUY D;  1KX3 B;  3AN2 C;  1M18 C;  1P3G D;  3AYW B;  3LZ0 A;  2LY8 A;  3W99 A;  3O62 B;  5AV8 C;  3AV2 D;  1P3F D;  2RVQ D;  3AV1 A;  3AV2 C;  3AZF C;  5FUG B;  5B2J B;  4J8V C;  2PYO D;  3X1T A;  3MGP B;  2PYO C;  3REK C;  3B6G A;  3WTP B;  4YS3 C;  1WWI A;  2NQB D;  3W98 B;  2BYM A;  1P3O A;  5GT3 C;  2YFV B;  3WA9 D;  3AZE C;  4G92 B;  1M19 B;  1ID3 C;  4WZS B;  4R8P B;  3MGQ A;  1F66 D;  3W97 D;  4LD9 A;  3W97 C;  3X1V D;  5B0Z C;  3W96 A;  3AZJ C;  3LEL B;  3B0B A;  5B1L D;  5B24 D;  4H9R B;  3MGS C;  3VH5 W;  3AZN C;  3AN2 A;  1M18 A;  3REL C;  1KX5 D;  5B40 B;  1P3G A;  5DNM B;  1TZY D;  5AV8 A;  3UTB B;  2HUE C;  3AV2 A;  3AZF A;  3VH6 A;  5BO0 A;  4J8V A;  5CPJ B;  4H9O B;  3MVD C;  1KX3 C;  5GSU D;  2PYO A;  1P3I D;  3REK A;  3O62 C;  1P3I C;  4KGC D;  3LZ0 B;  3W99 B;  4YS3 A;  2F8N D;  3AV1 B;  4NE5 A;  3C1B C;  5GT3 A;  3MGP C;  3AZE A;  5E5A D;  3AZH D;  3UT9 C;  3X1T B;  1P3K D;  4KHA B;  3VH6 T;  1AOI D;  1JFI A;  3B6G B;  3W97 A;  5B0Z A;  3AZJ A;  4XUJ D;  3MGS A;  5CPK D;  1U35 D;  1M19 C;  1P3O B;  4HGA C;  3REI C;  4YM6 C;  3REL A;  4R8P C;  5B1M D;  3AZM C;  1U35 C;  5B2I B;  4LD9 B;  3LEL C;  3W96 B;  3MVD A;  5B0Y D;  1KX3 A;  5AV6 D;  5AY8 C;  5B32 D;  2HIO B;  3V9R A;  3AN2 B;  5AV6 C;  3O62 A;  1P3I A;  5B32 C;  2CV5 D;  5BNV A;  1P34 D;  1P3G B;  2CV5 C;  5AV8 B;  4M6B A;  5AVC C;  5FUG A;  3AV2 B;  3A6N D;  1P3F B;  3UTA D;  3C1B A;  5BO0 B;  3UT9 A;  2PYO B;  5CP6 D;  3X1S C;  3REK B;  5CP6 C;  3WAA D;  5AVB D;  4XZQ C;  4ZUX D;  1S32 D;  1BFM A;  1M19 A;  5GT3 B;  3REI A;  4YM6 A;  3AZM A;  5BT1 C;  4R8P A;  1U35 A;  3AZE B;  1BH9 A;  3KWQ D;  3REJ D;  1JFI B;  4DRB A;  4J8W D;  3LEL A;  3W97 B;  4J8W C;  4H9R A;  5B0Z B;  5AV5 D;  3C1C C;  1P3M D;  1P3A D;  4Z2M G;  5AY8 A;  5AV6 A;  5B32 A;  2CV5 A;  5B2I C;  5AVC A;  2HUE B;  3VH5 T;  3LZ1 D;  4WV4 B;  3LZ1 C;  4JJN D;  3AZK D;  5CPI D;  3AZK C;  2F8N G;  3B0D C;  2HIO C;  3MVD B;  3WKJ D;  4Z66 D;  3KUY C;  3X1S A;  3V9R B;  1P3G C;  1P3I B;  5CP6 A;  5B33 D;  5BNV B;  1H3O A;  5B33 C;  1P3F C;  2RVQ C;  4XZQ A;  4J8U D;  5JRG D;  2F8N B;  5CHL B;  5GT0 D;  3AFA D;  3C1B B;  3AZG D;  4KHA A;  3UT9 B;  3AZG C;  1EQZ D;  1ZLA D;  3MNN D;  3KSY A;  2NQB C;  4J8W A;  4KUD D;  3C1C A;  4KUD C;  3WA9 C;  4HGA B;  3REI B;  4YM6 B;  3AZM B;  1U35 B;  4QLC D;  1BH9 B;  5B2I A;  1F66 C;  5B32 G;  5GXQ D;  1BH8 A;  5B31 D;  5DNN D;  3X1V C;  3LZ1 A;  1ULY A;  5B1L C;  5B24 C;  3AZK A;  2HIO A;  4H9S C;  3B6F D;  3KUY A;  5B0Y B;  5AY8 B;  3NQU B;  3LJA D;  3AZL D;  1KX5 C;  5AV6 B;  5B32 B;  1TZY C;  2CV5 B;  5B33 A;  1P3F A;  5AVC B;  4CSR B;  5F99 D;  3TU4 D;  5F99 C;  5JRG A;  3KXB D;  4H9N B;  5GSU C;  3AZG A;  1P3P D;  3X1S B;  4KGC C;  4WU9 D;  5CP6 B;  1H3O B;  2NQB A;  1HQ3 D;  4XZQ B;  4KUD A;  1HQ3 C;  2NZD D;  4ZUX B;  4H9Q B;  5AV9 D;  3WA9 A;  5E5A C;  3AZH C;  1P3K C;  4AWL C;  1B6W A;  1AOI C;  3WTP E;  1F66 A;  1P3L D;  3X1V A;  3AYW D;  4J8W B;  4XUJ C;  3REH D;  2FJ7 D;  5B1L A;  4NE3 A;  5G49 B;  5B24 A;  3C1C B;  3REH C;  5CPK C;  2FJ7 C;  5AV5 B;  4H9S A;  1KX5 A;  5B1M C;  3AZI D;  5B2J D; 
#chains in the Genus database with same CATH topology
 3EPH A;  3AZI C;  1BH8 B;  5F99 A;  3LZ1 B;  3NQJ B;  3WTP D;  5B0Y C;  5GSU A;  3AZK B;  3B0D B;  3KUY B;  4Z66 B;  1P3P A;  4KGC A;  1P34 C;  5B33 B;  2F8N A;  3A6N C;  1P3B D;  1HQ3 A;  3UTA C;  3H0R C;  1Q9C A;  4J8U B;  1KX4 D;  5JRG B;  3AFA B;  5E5A A;  3AZH A;  1P3K A;  1PZR A;  4H9P A;  3AZG B;  1AOI A;  3X1U D;  2JSS A;  3WAA C;  2ARO D;  5AVB C;  1M1A D;  2NQB B;  4XUJ A;  4ZUX C;  5B40 D;  3R45 A;  4NE6 A;  1B67 A;  3REH A;  1S32 C;  5CPK A;  2FJ7 A;  5JA4 B;  4KUD B;  3VH5 A;  4WNN A;  1F1E A;  3WA9 B;  5B1M A;  5CPJ D;  3AZI A;  4UUZ A;  3KWQ C;  3REJ C;  1F66 B;  5GXQ B;  3X1V B;  3LZ0 D;  5DNN B;  5AV5 C;  1P3M C;  5B1L B;  5B24 B;  5BNX B;  5B0Y A;  1KU5 A;  3NQU A;  1A7W A;  1P3A C;  3AV1 D;  2CWE A;  3B6F B;  1KX5 B;  1P34 A;  1TZY B;  4CSR A;  3X1T D;  3A6N A;  2IO5 C;  3UTA A;  4E45 A;  4H9N A;  5F99 B;  3MGR D;  4JJN C;  3B6G D;  5CPI C;  3MGR C;  3WKJ C;  5GSU B;  4Z2M H;  4Z66 C;  4J8X D;  2ZM5 A;  4J8X C;  1P3P B;  4KGC B;  1P3O D;  4WU9 B;  3WAA A;  5AVB A;  3H0L C;  4ZUX A;  4J8U C;  4Z5T D;  4H9Q A;  5JRG C;  1S32 A;  1HQ3 B;  4Z5T C;  5GT0 C;  3MGQ D;  3AFA C;  1WWS A;  2Y2G A;  5E5A B;  3AZH B;  1P3K B;  3W96 D;  4H9P B;  4AWL B;  1EQZ C;  1ZLA C;  3KWQ A;  1AOI B;  3MNN C;  3REJ A;  3AN2 D;  3F6T A;  1M18 D;  5G49 A;  4XUJ B;  5AV5 A;  1P3M A;  3R45 B;  4ZBJ C;  3REH B;  5AV8 D;  2FJ7 B;  5CPK B;  1P3A A;  4WNN B;  5B1M B;  3AZF D;  4QLC C;  4J8V D;  3AZI B;  4UUZ B;  5GXQ C;  5B31 C;  4X23 D;  5DNN C;  3NQJ A;  3REK D;  4EO5 C;  4X23 C;  4JJN A;  5CPI A;  4YS3 D;  3MGR A;  3WKJ A;  2G5I C;  4Z66 A;  3B6F C;  4WU8 D;  5C3I C;  4CAY A;  3LJA C;  3AZL C;  2W8S A;  4J8X A;  4WU8 C;  1P34 B;  5GT3 D;  2YFW B;  1Z2C B;  3AZE D;  4J8U A;  3A6N B;  1ID3 D;  3TU4 C;  1N1J A;  4Z5T A;  5GT0 A;  1HTA A;  3UTA B;  3AFA A;  1P3B B;  1KX4 B;  3KXB C;  4G91 B;  2XD1 A;  5B0Z D;  3AZJ D;  1P3P C;  1EQZ A;  1ZLA A;  2BYK B;  3MNN A;  3MGS D;  4WU9 C;  3B0C W;  5KDM A;  3X1U B;  3AZN D;  2Y2O A;  3REL D;  3WAA B;  5AVB B;  5JA4 A;  2ARO B;  1TAF A;  1M1A B;  2NZD C;  1S32 B;  2L5A A;  5AV9 C;  4QLC A;  3MVD D;  3KWQ B;  1P3L C;  5GXQ A;  3REJ B;  1KX3 D;  5B31 A;  5DNN A;  3AYW C;  4X23 A;  3O62 D;  5BNX A;  4E44 A;  2G5H C;  3EG5 B;  1P3M B;  3B6F A;  1P3A B;  3LJA A;  3AZL A;  4WU8 A;  5B2J C;  3C1B D;  3MGP D;  3EPJ A;  3UT9 D;  3TU4 A;  2IO5 B;  1ID3 A;  4JJN B;  3W98 D;  3WTP C;  3KXB A;  5CPI B;  3MGR B;  3W98 C;  2RIQ A;  3WKJ B;  4CAY B;  4DRA A;  4J8X B;  4WU9 A;  1M19 D;  2BYM B;  4YM6 D;  3REI D;  4R8P D;  4G92 C;  3AZM D;  3AZN A;  1P3B C;  2NZD A;  1KX4 C;  1N1J B;  4G91 C;  4Z5T B;  5GT0 B;  5AV9 A;  5BS7 C;  3MGQ B;  3LEL D;  1EQZ B;  3X1U C;  1ZLA B;  1P3L A;  3MNN B;  5KDM B;  5AY8 D;  2ARO C;  3AYW A;  5DNM D;  1M1A C;  3UTB D;  5B40 C;  1M18 B;  5DNM C;  5B31 G;  1TAF B;  4ZBJ B;  3UTB C;  4NFT A;  5AVC D;  2F8N K;  5B2J A;  4QLC B;  3AZF B;  5CPJ C;  2Y2J A;  3MGP A;  4J8V B;  2Y2H A;  5B31 B;  3W99 D;  3X1S D;  2ZY3 A;  4EO5 B;  4X23 B;  3LZ0 C;  3W99 C;  3WTP A;  2Y2I A;  3W98 A;  4YS3 B;  4XZQ D;  3AV1 C;  5C3I B;  3LJA B;  3AZL B;  3VH6 W;  2ZY2 A;  4WU8 B;  2YFW A;  2YFV A;  5BT1 D;  3X1T C;  3A1K A;  1P3B A;  2XD5 A;  3TU4 B;  1KX4 A;  1ID3 B;  5BS7 A;  3B6G C;  3KXB B;  3EPL A;  2BYK A;  1TZY A;  3C1C D;  3X1U A;  3AZJ B;  1P3O C;  3MGS B;  2ARO A;  1M1A A;  5B40 A;  3AZN B;  5DNM A;  2BG1 A;  3REL B;  3UTB A;  2NZD B;  1R4V A;  5B2I D;  3MGQ C;  2F8N H;  5AV9 B;  3B0C T;  4LD9 D;  4LD9 C;  3W96 C;  5CPJ A;  4H9O A;  2JE5 A;  2HIO D;  1P3L B;  3FDD A;  3KUY D;  1KX3 B;  3AN2 C;  2ZY5 A;  1M18 C;  1P3G D;  3AYW B;  2DF4 C;  3LZ0 A;  2LY8 A;  3W99 A;  3O62 B;  5AV8 C;  3AV2 D;  1P3F D;  2RVQ D;  3AV1 A;  3AV2 C;  3AZF C;  5FUG B;  5B2J B;  4J8V C;  2PYO D;  3X1T A;  3MGP B;  2PYO C;  3REK C;  3B6G A;  3WTP B;  4YS3 C;  1WWI A;  2NQB D;  3W98 B;  2BYM A;  1P3O A;  5GT3 C;  2YFV B;  3WA9 D;  3AZE C;  4G92 B;  1M19 B;  1ID3 C;  4WZS B;  4R8P B;  3MGQ A;  1F66 D;  3W97 D;  4LD9 A;  3W97 C;  3X1V D;  5B0Z C;  3W96 A;  3AZJ C;  2J8P A;  2UWX A;  3LEL B;  3B0B A;  5B1L D;  5B24 D;  4H9R B;  3MGS C;  3VH5 W;  2DQN C;  3AZN C;  3AN2 A;  1M18 A;  3REL C;  1KX5 D;  2Y2L A;  5B40 B;  1P3G A;  5DNM B;  1TZY D;  5AV8 A;  3UTB B;  2HUE C;  3AV2 A;  3P5J B;  3AZF A;  2VQR A;  3EPK A;  3VH6 A;  5BO0 A;  4J8V A;  5CPJ B;  4H9O B;  3MVD C;  1KX3 C;  2JCH A;  5GSU D;  2PYO A;  2Y2P A;  1P3I D;  3REK A;  3O62 C;  1P3I C;  4KGC D;  3LZ0 B;  3W99 B;  4YS3 A;  2Y2N A;  2F8N D;  3AV1 B;  4NE5 A;  3C1B C;  5GT3 A;  3MGP C;  3AZE A;  5E5A D;  3AZH D;  3UT9 C;  3X1T B;  1P3K D;  4KHA B;  3VH6 T;  1AOI D;  1JFI A;  2Y2M A;  3B6G B;  3W97 A;  5B0Z A;  3AZJ A;  4XUJ D;  3MGS A;  5CPK D;  1U35 D;  1M19 C;  1P3O B;  4HGA C;  3REI C;  4YM6 C;  3REL A;  4R8P C;  5B1M D;  3AZM C;  1U35 C;  3KFU G;  2Y2Q A;  5B2I B;  4LD9 B;  3LEL C;  3W96 B;  3MVD A;  5B0Y D;  1KX3 A;  1T3U A;  5AV6 D;  5AY8 C;  5B32 D;  2HIO B;  3V9R A;  3AN2 B;  5AV6 C;  3O62 A;  1P3I A;  5B32 C;  2CV5 D;  5BNV A;  1P34 D;  1P3G B;  2CV5 C;  5AV8 B;  4M6B A;  5AVC C;  5FUG A;  3AV2 B;  3A6N D;  1P3F B;  3UTA D;  3C1B A;  5BO0 B;  3UT9 A;  2PYO B;  5CP6 D;  3X1S C;  3REK B;  5CP6 C;  3WAA D;  5AVB D;  4XZQ C;  4ZUX D;  1S32 D;  1BFM A;  1M19 A;  5GT3 B;  3REI A;  4YM6 A;  3AZM A;  5BT1 C;  4R8P A;  1U35 A;  3AZE B;  1BH9 A;  3KWQ D;  3REJ D;  1JFI B;  3A1I A;  4DRB A;  4J8W D;  3LEL A;  3W97 B;  4J8W C;  4H9R A;  5B0Z B;  5AV5 D;  3C1C C;  1P3M D;  1P3A D;  4Z2M G;  5AY8 A;  5AV6 A;  2FFF B;  5B32 A;  2CV5 A;  5B2I C;  5AVC A;  2HUE B;  3VH5 T;  3LZ1 D;  4WV4 B;  3IP4 C;  3LZ1 C;  4JJN D;  3AZK D;  5CPI D;  3AZK C;  3H0M C;  2F8N G;  3B0D C;  2HIO C;  3MVD B;  3WKJ D;  4Z66 D;  3KUY C;  3X1S A;  3V9R B;  1P3G C;  1P3I B;  5CP6 A;  5B33 D;  5BNV B;  1H3O A;  5B33 C;  1P3F C;  2F2A C;  2RVQ C;  4XZQ A;  4J8U D;  5JRG D;  2F8N B;  5CHL B;  5GT0 D;  3AFA D;  3C1B B;  3AZG D;  4KHA A;  3UT9 B;  3AZG C;  1EQZ D;  1ZLA D;  3MNN D;  3KSY A;  2NQB C;  4J8W A;  4KUD D;  3C1C A;  4KUD C;  2ZY4 A;  3WA9 C;  4HGA B;  3REI B;  4YM6 B;  3AZM B;  1U35 B;  4QLC D;  1BH9 B;  5B2I A;  1F66 C;  5B32 G;  5GXQ D;  1BH8 A;  5B31 D;  5DNN D;  3X1V C;  3LZ1 A;  3AL0 C;  1ULY A;  5B1L C;  5B24 C;  3AZK A;  2HIO A;  2Y2K A;  4H9S C;  3B6F D;  3KUY A;  5B0Y B;  5AY8 B;  3NQU B;  3LJA D;  3AZL D;  1KX5 C;  5AV6 B;  5B32 B;  4UPK A;  1TZY C;  2CV5 B;  5B33 A;  1P3F A;  5AVC B;  4CSR B;  5F99 D;  3TU4 D;  5F99 C;  5JRG A;  3KXB D;  4H9N B;  5GSU C;  4WJ3 C;  3AZG A;  1P3P D;  3X1S B;  4DQY B;  4KGC C;  4WU9 D;  5CP6 B;  1H3O B;  2NQB A;  1HQ3 D;  4XZQ B;  4KUD A;  1HQ3 C;  2NZD D;  4ZUX B;  4H9Q B;  5AV9 D;  3WA9 A;  5E5A C;  3AZH C;  1W2E A;  1P3K C;  4AWL C;  1B6W A;  1AOI C;  3WTP E;  1F66 A;  1P3L D;  3X1V A;  3AYW D;  4J8W B;  4XUJ C;  3REH D;  2FJ7 D;  5B1L A;  4NE3 A;  5G49 B;  5B24 A;  3C1C B;  3REH C;  5CPK C;  2FJ7 C;  5AV5 B;  4H9S A;  1KX5 A;  5B1M C;  3AZI D;  5B2J D; 
#chains in the Genus database with same CATH homology
 3EPH A;  3AZI C;  1BH8 B;  5F99 A;  3LZ1 B;  3NQJ B;  3WTP D;  5B0Y C;  5GSU A;  3AZK B;  3B0D B;  3KUY B;  4Z66 B;  1P3P A;  4KGC A;  1P34 C;  5B33 B;  2F8N A;  3A6N C;  1P3B D;  1HQ3 A;  3UTA C;  3H0R C;  1Q9C A;  4J8U B;  1KX4 D;  5JRG B;  3AFA B;  5E5A A;  3AZH A;  1P3K A;  1PZR A;  4H9P A;  3AZG B;  1AOI A;  3X1U D;  2JSS A;  3WAA C;  2ARO D;  5AVB C;  1M1A D;  2NQB B;  4XUJ A;  4ZUX C;  5B40 D;  3R45 A;  4NE6 A;  1B67 A;  3REH A;  1S32 C;  5CPK A;  2FJ7 A;  5JA4 B;  4KUD B;  3VH5 A;  4WNN A;  1F1E A;  3WA9 B;  5B1M A;  5CPJ D;  3AZI A;  4UUZ A;  3KWQ C;  3REJ C;  1F66 B;  5GXQ B;  3X1V B;  3LZ0 D;  5DNN B;  5AV5 C;  1P3M C;  5B1L B;  5B24 B;  5BNX B;  5B0Y A;  1KU5 A;  3NQU A;  1A7W A;  1P3A C;  3AV1 D;  2CWE A;  3B6F B;  1KX5 B;  1P34 A;  1TZY B;  4CSR A;  3X1T D;  3A6N A;  2IO5 C;  3UTA A;  4E45 A;  4H9N A;  5F99 B;  3MGR D;  4JJN C;  3B6G D;  5CPI C;  3MGR C;  3WKJ C;  5GSU B;  4Z2M H;  4Z66 C;  4J8X D;  2ZM5 A;  4J8X C;  1P3P B;  4KGC B;  1P3O D;  4WU9 B;  3WAA A;  5AVB A;  3H0L C;  4ZUX A;  4J8U C;  4Z5T D;  4H9Q A;  5JRG C;  1S32 A;  1HQ3 B;  4Z5T C;  5GT0 C;  3MGQ D;  3AFA C;  1WWS A;  2Y2G A;  5E5A B;  3AZH B;  1P3K B;  3W96 D;  4H9P B;  4AWL B;  1EQZ C;  1ZLA C;  3KWQ A;  1AOI B;  3MNN C;  3REJ A;  3AN2 D;  3F6T A;  1M18 D;  5G49 A;  4XUJ B;  5AV5 A;  1P3M A;  3R45 B;  4ZBJ C;  3REH B;  5AV8 D;  2FJ7 B;  5CPK B;  1P3A A;  4WNN B;  5B1M B;  3AZF D;  4QLC C;  4J8V D;  3AZI B;  4UUZ B;  5GXQ C;  5B31 C;  4X23 D;  5DNN C;  3NQJ A;  3REK D;  4EO5 C;  4X23 C;  4JJN A;  5CPI A;  4YS3 D;  3MGR A;  3WKJ A;  2G5I C;  4Z66 A;  3B6F C;  4WU8 D;  5C3I C;  4CAY A;  3LJA C;  3AZL C;  2W8S A;  4J8X A;  4WU8 C;  1P34 B;  5GT3 D;  2YFW B;  1Z2C B;  3AZE D;  4J8U A;  3A6N B;  1ID3 D;  3TU4 C;  1N1J A;  4Z5T A;  5GT0 A;  1HTA A;  3UTA B;  3AFA A;  1P3B B;  1KX4 B;  3KXB C;  4G91 B;  2XD1 A;  5B0Z D;  3AZJ D;  1P3P C;  1EQZ A;  1ZLA A;  2BYK B;  3MNN A;  3MGS D;  4WU9 C;  3B0C W;  5KDM A;  3X1U B;  3AZN D;  2Y2O A;  3REL D;  3WAA B;  5AVB B;  5JA4 A;  2ARO B;  1TAF A;  1M1A B;  2NZD C;  1S32 B;  2L5A A;  5AV9 C;  4QLC A;  3MVD D;  3KWQ B;  1P3L C;  5GXQ A;  3REJ B;  1KX3 D;  5B31 A;  5DNN A;  3AYW C;  4X23 A;  3O62 D;  5BNX A;  4E44 A;  2G5H C;  3EG5 B;  1P3M B;  3B6F A;  1P3A B;  3LJA A;  3AZL A;  4WU8 A;  5B2J C;  3C1B D;  3MGP D;  3EPJ A;  3UT9 D;  3TU4 A;  2IO5 B;  1ID3 A;  4JJN B;  3W98 D;  3WTP C;  3KXB A;  5CPI B;  3MGR B;  3W98 C;  2RIQ A;  3WKJ B;  4CAY B;  4DRA A;  4J8X B;  4WU9 A;  1M19 D;  2BYM B;  4YM6 D;  3REI D;  4R8P D;  4G92 C;  3AZM D;  3AZN A;  1P3B C;  2NZD A;  1KX4 C;  1N1J B;  4G91 C;  4Z5T B;  5GT0 B;  5AV9 A;  5BS7 C;  3MGQ B;  3LEL D;  1EQZ B;  3X1U C;  1ZLA B;  1P3L A;  3MNN B;  5KDM B;  5AY8 D;  2ARO C;  3AYW A;  5DNM D;  1M1A C;  3UTB D;  5B40 C;  1M18 B;  5DNM C;  5B31 G;  1TAF B;  4ZBJ B;  3UTB C;  4NFT A;  5AVC D;  2F8N K;  5B2J A;  4QLC B;  3AZF B;  5CPJ C;  2Y2J A;  3MGP A;  4J8V B;  2Y2H A;  5B31 B;  3W99 D;  3X1S D;  2ZY3 A;  4EO5 B;  4X23 B;  3LZ0 C;  3W99 C;  3WTP A;  2Y2I A;  3W98 A;  4YS3 B;  4XZQ D;  3AV1 C;  5C3I B;  3LJA B;  3AZL B;  3VH6 W;  2ZY2 A;  4WU8 B;  2YFW A;  2YFV A;  5BT1 D;  3X1T C;  3A1K A;  1P3B A;  2XD5 A;  3TU4 B;  1KX4 A;  1ID3 B;  5BS7 A;  3B6G C;  3KXB B;  3EPL A;  2BYK A;  1TZY A;  3C1C D;  3X1U A;  3AZJ B;  1P3O C;  3MGS B;  2ARO A;  1M1A A;  5B40 A;  3AZN B;  5DNM A;  2BG1 A;  3REL B;  3UTB A;  2NZD B;  1R4V A;  5B2I D;  3MGQ C;  2F8N H;  5AV9 B;  3B0C T;  4LD9 D;  4LD9 C;  3W96 C;  5CPJ A;  4H9O A;  2JE5 A;  2HIO D;  1P3L B;  3FDD A;  3KUY D;  1KX3 B;  3AN2 C;  2ZY5 A;  1M18 C;  1P3G D;  3AYW B;  2DF4 C;  3LZ0 A;  2LY8 A;  3W99 A;  3O62 B;  5AV8 C;  3AV2 D;  1P3F D;  2RVQ D;  3AV1 A;  3AV2 C;  3AZF C;  5FUG B;  5B2J B;  4J8V C;  2PYO D;  3X1T A;  3MGP B;  2PYO C;  3REK C;  3B6G A;  3WTP B;  4YS3 C;  1WWI A;  2NQB D;  3W98 B;  2BYM A;  1P3O A;  5GT3 C;  2YFV B;  3WA9 D;  3AZE C;  4G92 B;  1M19 B;  1ID3 C;  4WZS B;  4R8P B;  3MGQ A;  1F66 D;  3W97 D;  4LD9 A;  3W97 C;  3X1V D;  5B0Z C;  3W96 A;  3AZJ C;  2J8P A;  2UWX A;  3LEL B;  3B0B A;  5B1L D;  5B24 D;  4H9R B;  3MGS C;  3VH5 W;  2DQN C;  3AZN C;  3AN2 A;  1M18 A;  3REL C;  1KX5 D;  2Y2L A;  5B40 B;  1P3G A;  5DNM B;  1TZY D;  5AV8 A;  3UTB B;  2HUE C;  3AV2 A;  3P5J B;  3AZF A;  2VQR A;  3EPK A;  3VH6 A;  5BO0 A;  4J8V A;  5CPJ B;  4H9O B;  3MVD C;  1KX3 C;  2JCH A;  5GSU D;  2PYO A;  2Y2P A;  1P3I D;  3REK A;  3O62 C;  1P3I C;  4KGC D;  3LZ0 B;  3W99 B;  4YS3 A;  2Y2N A;  2F8N D;  3AV1 B;  4NE5 A;  3C1B C;  5GT3 A;  3MGP C;  3AZE A;  5E5A D;  3AZH D;  3UT9 C;  3X1T B;  1P3K D;  4KHA B;  3VH6 T;  1AOI D;  1JFI A;  2Y2M A;  3B6G B;  3W97 A;  5B0Z A;  3AZJ A;  4XUJ D;  3MGS A;  5CPK D;  1U35 D;  1M19 C;  1P3O B;  4HGA C;  3REI C;  4YM6 C;  3REL A;  4R8P C;  5B1M D;  3AZM C;  1U35 C;  3KFU G;  2Y2Q A;  5B2I B;  4LD9 B;  3LEL C;  3W96 B;  3MVD A;  5B0Y D;  1KX3 A;  1T3U A;  5AV6 D;  5AY8 C;  5B32 D;  2HIO B;  3V9R A;  3AN2 B;  5AV6 C;  3O62 A;  1P3I A;  5B32 C;  2CV5 D;  5BNV A;  1P34 D;  1P3G B;  2CV5 C;  5AV8 B;  4M6B A;  5AVC C;  5FUG A;  3AV2 B;  3A6N D;  1P3F B;  3UTA D;  3C1B A;  5BO0 B;  3UT9 A;  2PYO B;  5CP6 D;  3X1S C;  3REK B;  5CP6 C;  3WAA D;  5AVB D;  4XZQ C;  4ZUX D;  1S32 D;  1BFM A;  1M19 A;  5GT3 B;  3REI A;  4YM6 A;  3AZM A;  5BT1 C;  4R8P A;  1U35 A;  3AZE B;  1BH9 A;  3KWQ D;  3REJ D;  1JFI B;  3A1I A;  4DRB A;  4J8W D;  3LEL A;  3W97 B;  4J8W C;  4H9R A;  5B0Z B;  5AV5 D;  3C1C C;  1P3M D;  1P3A D;  4Z2M G;  5AY8 A;  5AV6 A;  2FFF B;  5B32 A;  2CV5 A;  5B2I C;  5AVC A;  2HUE B;  3VH5 T;  3LZ1 D;  4WV4 B;  3IP4 C;  3LZ1 C;  4JJN D;  3AZK D;  5CPI D;  3AZK C;  3H0M C;  2F8N G;  3B0D C;  2HIO C;  3MVD B;  3WKJ D;  4Z66 D;  3KUY C;  3X1S A;  3V9R B;  1P3G C;  1P3I B;  5CP6 A;  5B33 D;  5BNV B;  1H3O A;  5B33 C;  1P3F C;  2F2A C;  2RVQ C;  4XZQ A;  4J8U D;  5JRG D;  2F8N B;  5CHL B;  5GT0 D;  3AFA D;  3C1B B;  3AZG D;  4KHA A;  3UT9 B;  3AZG C;  1EQZ D;  1ZLA D;  3MNN D;  3KSY A;  2NQB C;  4J8W A;  4KUD D;  3C1C A;  4KUD C;  2ZY4 A;  3WA9 C;  4HGA B;  3REI B;  4YM6 B;  3AZM B;  1U35 B;  4QLC D;  1BH9 B;  5B2I A;  1F66 C;  5B32 G;  5GXQ D;  1BH8 A;  5B31 D;  5DNN D;  3X1V C;  3LZ1 A;  3AL0 C;  1ULY A;  5B1L C;  5B24 C;  3AZK A;  2HIO A;  2Y2K A;  4H9S C;  3B6F D;  3KUY A;  5B0Y B;  5AY8 B;  3NQU B;  3LJA D;  3AZL D;  1KX5 C;  5AV6 B;  5B32 B;  4UPK A;  1TZY C;  2CV5 B;  5B33 A;  1P3F A;  5AVC B;  4CSR B;  5F99 D;  3TU4 D;  5F99 C;  5JRG A;  3KXB D;  4H9N B;  5GSU C;  4WJ3 C;  3AZG A;  1P3P D;  3X1S B;  4DQY B;  4KGC C;  4WU9 D;  5CP6 B;  1H3O B;  2NQB A;  1HQ3 D;  4XZQ B;  4KUD A;  1HQ3 C;  2NZD D;  4ZUX B;  4H9Q B;  5AV9 D;  3WA9 A;  5E5A C;  3AZH C;  1W2E A;  1P3K C;  4AWL C;  1B6W A;  1AOI C;  3WTP E;  1F66 A;  1P3L D;  3X1V A;  3AYW D;  4J8W B;  4XUJ C;  3REH D;  2FJ7 D;  5B1L A;  4NE3 A;  5G49 B;  5B24 A;  3C1C B;  3REH C;  5CPK C;  2FJ7 C;  5AV5 B;  4H9S A;  1KX5 A;  5B1M C;  3AZI D;  5B2J D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...