4KGCA

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcA00
3MGRB 3REIA 5DNNB 3UTBB 1P3PC 1P3KA 1P3AD 4E45A 5B2JA 4G92B 3AN2B 5AV5D 5CPIC 5B1LB 3KXBA 1KX3B 3LZ1A 1U35C 2FJ7D 5KDMA 5CPJC 5B0ZB 3AYWB 4HGAB 3REHA 5AV6B 4R8PC 4KUDC 5B1MA 3UTAC 4ZUXB 3REKC 5AY8C 4YS3B 3AV1B 4CSRA 4Z2MH 2AROD 4Z5TC 4KGCB 3AFAA 5GT0B 3WTPD 3TU4A 4CAYA 3AN2C 5AVBC 4EO5C 3WKJC 5B24A 2RVQC 3REJB 3WA9A 4XUJB 3MVDC 3RELD 4J8XC 1KX3C 1KX4B 5AVCD 5B32C 3O62D 5E5AB 3AZLD 2NQBB 4X23D 3MNNB 5BNXA 2F8NK 4WU9D 5AV6C 1JFIB 2PYOD 3LJAB 3AZIB 1BH8B 5GSUD 1M19B 4KGCC 5C3IB 4J8WB 2JSSA 5BNVA 3KWQD 5GT0C 5CPJA 3X1TA 3R45A 4R8PA 3LZ0B 3REKA 5AY8A 5DNMB 3MGQB 3X1UD 4XZQD 4Z5TA 4WNNB 3AZGD 1BH9A 3LELD 1P34C 5AVBA 3WKJA 1P3AB 1P3OD 3MVDA 4J8XA 5AV5B 4JJNC 3AZIC 1N1JB 4UUZA 1F1EA 5F99D 5B32A 1P3FD 4NFTA 4J8UC 3W98D 1S32B 4LD9B 1B6WA 4YM6A 3NQJB 2FJ7B 5GXQD 3C1BC 3LZ0C 4Z66C 2F8NA 3A6NA 5CHLB 5B40D 5DNMC 3MGQC 2AROB 1P3LC 3MGPD 1ZLAC 3WTPB 3AZMD 3WAAD 5B2ID 5AV5C 3AZHD 3B6GD 3RELB 5B31C 2IO5C 5B33D 3O62B 5AV9D 1P34A 4H9PB 2FJ7C 3V9RB 3AZLB 3AV2D 4X23B 1M1AA 4WU9B 1H3OB 5BT1D 4JJNA 3AZEC 2PYOB 1B67A 5GT3D 4J8UA 5GSUB 1KX5D 3AZJD 1ID3A 3KWQB 3C1BA 3W97C 4Z66A 3KUYA 2HIOD 4QLCD 5JA4A 4H9RA 3X1SA 1HQ3A 3B0DB 5AV8D 1EQZD 3X1UB 4XZQB 3RELC 3AZND 1P3LA 3MGSC 1F66B 1ZLAA 5AVCC 3AZGB 1P3IA 1P3MA 4ZBJB 5CP6D 5CPKA 3AZFC 5JRGB 3LELB 1P3BC 5BO0B 1AOIB 3B6FD 3W99C 1P3OB 3W96D 5B0YA 2NZDD 5B31A 5F99B 1P3FB 5GSUC 1TZYA 4J8VD 1M18C 3W98B 5FUGA 2YFVB 1S32D 4LD9D 1P3GC 5GXQB 3AZKC 3AZEA 3X1VC 5B40B 4WU8C 4NE5A 4DRAA 3X1UC 4XZQC 3C1CC 1AOIC 4H9NA 3W97A 3AZGC 2CV5D 3UT9A 4H9OA 4ZBJC 3MGRC 5G49A 5DNNC 3MGPB 3REID 3UTBC 3AZMB 3WAAB 3NQUB 4G91B 1P3KD 5B2IB 4G92C 5B2JD 3MGSA 5AVCA 3AZHB 3VH5W 3B6GB 5B1LC 5B33B 3KXBD 3AZFA 1P3BA 5AV9B 1KU5A 1P3PA 4H9QB 3AV2B 3LZ1D 5B0ZC 3W99A 3AYWC 4HGAC 5B40C 5CPIA 3REHD 5B1MD 5GT3B 4ZUXC 4YS3C 3AV1C 1M18A 1KX5B 3AZJB 1U35A 1P3GA 4KHAA 3AZKA 3AZMC 3X1VA 4WU8A 2HIOB 4QLCB 3TU4D 4KUDA 2BYMB 2YFWA 5AV8B 5B2IC 1EQZB 2BYKB 3UTAA 3B0BA 3C1CA 3AZHC 1AOIA 2LY8A 3REJC 5BS7C 5B24D 4XUJC 3MGRA 3AZNB 1ULYA 3WA9D 5DNNA 1KX4C 1F66D 3UTBA 5E5AC 1WWSA 5CP6B 2NQBC 3MNNC 5JRGD 3AN2A 3B6FB 3W96B 5GT3C 5B1LA 3LJAC 2NZDB 1KX3A 4NE3A 1A7WA 1M19C 4J8VB 5C3IC 4J8WC 5B0ZA 4NE6A 5CPJD 3AYWA 5AV6A 2HIOC 4QLCC 3X1TD 4R8PD 4ZUXA 4YS3A 1BFMA 3AV1A 3REKD 5AY8D 2HUEB 4KGCA 1TAFB 4Z5TD 3VH5T 5GT0A 2CV5B 3VH5A 3REIB 5CPKB 1P3AC 3B6FC 1P3KB 5AVBD 3WKJD 3REJA 5BS7A 2NZDC 2RVQD 4XUJA 5B2JB 4WV4B 3MVDD 1KX4A 4J8XD 3KSYA 4J8VC 5E5AA 5B32D 2NQBA 3KXBB 3MNNA 1S32C 4LD9C 4YM6D 1JFIA 3LZ1B 1HTAA 5KDMB 3LJAA 3A6ND 2F8ND 3AZIA 3REHB 1BH8A 5B1MB 1M19A 4J8WA 2L5AA 3VH6T 2CV5C 2AROC 4CSRB 3WTPC 3LZ0A 3AFAB 5DNMA 3TU4B 3MGQA 4CAYB 4WNNA 5B24B 5B32G 3WA9B 3O62C 3AZLC 1P34D 1P3AA 4X23C 4WU9C 2F8NG 5AV5A 5BNXB 1M1AD 1N1JA 4JJND 4WZSB 5CPIB 2PYOC 4J8UD 1S32A 4LD9A 3NQJA 2FJ7A 3KWQC 5BNVB 3C1BD 5CPJB 1ID3D 4Z66D 3KUYD 3TU4C 3X1TB 3R45B 4R8PB 3B0DC 3X1SD 1HQ3D 3REKB 5AY8B 2AROA 3WA9C 1P3LD 1F66C 4Z5TB 3WTPA 1ZLAD 1BH9B 1P3ID 1P3MD 4H9SC 5JRGC 3LELC 5CPKD 5AVBB 4EO5B 3WKJB 2CWEA 1P3OC 3RELA 3MVDB 5B0YD 5F99C 3WTPE 3O62A 4J8XB 1P3FC 5B31D 4H9PA 4UUZB 3V9RA 5B32B 1TZYD 3AZLA 3W98C 4X23A 4WU9A 1Q9CA 1H3OA 5GXQC 4YM6B 3X1TC 2PYOA 2F8NB 3A6NB 3AZED 5GSUA 3KWQA 3W97D 3UT9D 3MGPC 3AFAD 3WAAC 4G91C 4AWLB 3X1UA 4XZQA 3B0CW 4M6BA 1F66A 3VH6W 5B31G 3MGSD 3AZGA 3B6GC 1WWIA 5B33C 4H9SA 5JRGA 5AV9C 3LELA 3AZFD 1P3BD 5BO0A 4YM6C 1P34B 3AV2C 1P3PD 1P3OA 3W99D 3A6NC 5BT1C 1M1AB 5F99A 1P3FA 4JJNB 5CPID 3W98A 2YFVA 4J8UB 1M18D 1KX5C 3AZJC 4DRBA 5GXQA 1U35D 1P3GD 1ID3B 3C1BB 4Z66B 3AZKD 5B40A 3KUYB 4Z2MG 4AWLC 3X1VD 4WU8D 5AV8C 4KUDD 5JA4B 1EQZC 4H9RB 3X1SB 1HQ3B 3UTAD 3C1CD 1AOID 3AZNC 3MGRD 3MGPA 1P3LB 5DNND 1ZLAB 3AZMA 3UTBD 1P3IB 3WAAA 3NQUA 1P3MB 5CP6C 5B2IA 1M1AC 3AZHA 3AN2D 3B6GA 3W96C 5B1LD 5B0YB 5B33A 2F8NH 5AV9A 5B31B 2IO5B 1KX3D 1TZYB 4H9QA 3AV2A 1ID3C 5B0ZD 5FUGB 3KUYC 3AYWD 1R4VA 5AV6D 3X1SC 1HQ3C 5GT3A 3AZEB 4ZUXD 4YS3D 2HUEC 3AV1D 1KX5A 3AZJA 3B0CT 4KGCD 4H9NB 3W97B 3VH6A 1P3IC 5GT0D 3UT9B 1P3MC 4H9OB 2HIOA 4QLCA 5G49B 2BYMA 3REIC 5AV8A 5CPKC 1EQZA 2BYKA 1P3KC 3AZNA 5B2JC 3REJD 5B0YC 4XUJD 3MGSB 1KX4D 5AVCB 1TZYC 5E5AD 5CP6A 3KXBC 2NQBD 3AZFB 1P3BB 3MNND 3LZ1C 1P3PB 3B6FA 3W96A 3W99B 2NZDA 3LJAD 3REHC 5B1MC 3AZID 4J8VA 1M19D 4J8WD 1M18B 3UT9C 1U35B 1P3GB 3AFAC 4KHAB 3AZKB 3LZ0D 3X1VB 4WU8B 5DNMD 4KUDB 3MGQD 4E44A 2YFWB 1TAFA 3UTAB 3C1CB 2CV5A 5B24C
chains in the Genus database with same CATH superfamily
3MGRB 3EPLA 5DNNB 3REIA 3UTBB 1P3PC 1P3KA 3EG5B 2JE5A 1P3AD 4E45A 5B2JA 4G92B 3AN2B 5AV5D 5CPIC 5B1LB 3KXBA 1KX3B 3A1KA 3LZ1A 1U35C 2FJ7D 5KDMA 5CPJC 5B0ZB 3AYWB 4HGAB 3REHA 5AV6B 4R8PC 4KUDC 5B1MA 2Y2IA 3UTAC 2UWXA 4ZUXB 3REKC 5AY8C 4YS3B 3AV1B 4CSRA 4Z2MH 2AROD 4Z5TC 4KGCB 3AFAA 5GT0B 3WTPD 3TU4A 4CAYA 3AN2C 5AVBC 4EO5C 3WKJC 5B24A 2RVQC 3REJB 3WA9A 4XUJB 3MVDC 3RELD 4J8XC 1KX3C 1KX4B 5AVCD 5B32C 3O62D 5E5AB 3AZLD 2NQBB 3P5JB 4X23D 3MNNB 5BNXA 2F8NK 4WU9D 5AV6C 1JFIB 2PYOD 3LJAB 3AZIB 1BH8B 5GSUD 1M19B 4KGCC 5C3IB 4J8WB 2JSSA 5BNVA 3KWQD 2Y2JA 5GT0C 5CPJA 3X1TA 3R45A 4R8PA 3LZ0B 3REKA 5AY8A 5DNMB 3MGQB 3X1UD 4XZQD 4Z5TA 4WNNB 2ZY4A 3AZGD 1BH9A 3LELD 1P34C 5AVBA 3WKJA 1P3AB 2Y2QA 1P3OD 3MVDA 4J8XA 5AV5B 4JJNC 3AZIC 1N1JB 4UUZA 1F1EA 5F99D 5B32A 1P3FD 4NFTA 4J8UC 3W98D 1S32B 2G5IC 4LD9B 1B6WA 4YM6A 3NQJB 2FJ7B 5GXQD 3C1BC 3LZ0C 4Z66C 2F8NA 3A6NA 5CHLB 5B40D 5DNMC 3MGQC 2AROB 1P3LC 3MGPD 1ZLAC 3WTPB 3AZMD 3WAAD 5B2ID 2BG1A 5AV5C 3AL0C 3AZHD 3B6GD 3RELB 5B31C 2IO5C 5B33D 3O62B 5AV9D 1P34A 4H9PB 2FJ7C 3V9RB 3AZLB 3AV2D 4X23B 1M1AA 4WU9B 1H3OB 5BT1D 4JJNA 3AZEC 2PYOB 1B67A 2XD1A 5GT3D 4J8UA 5GSUB 1KX5D 3AZJD 1ID3A 3KWQB 2FFFB 3C1BA 4Z66A 3W97C 3KUYA 2HIOD 4QLCD 5JA4A 4H9RA 1W2EA 1HQ3A 3B0DB 3X1SA 5AV8D 1EQZD 2DQNC 3X1UB 4XZQB 3EPJA 3RELC 3AZND 1P3LA 3MGSC 1F66B 1ZLAA 5AVCC 3EPKA 3AZGB 1P3IA 1P3MA 4ZBJB 5CP6D 5CPKA 3AZFC 5JRGB 3LELB 1P3BC 5BO0B 1AOIB 3B6FD 3W99C 1P3OB 3W96D 5B0YA 2NZDD 5B31A 5F99B 1P3FB 5GSUC 1TZYA 4J8VD 1M18C 3W98B 5FUGA 2YFVB 1S32D 4LD9D 1P3GC 5GXQB 3AZKC 3AZEA 3X1VC 5B40B 4WU8C 4NE5A 4DRAA 3X1UC 2ZY3A 4XZQC 2XD5A 2Y2HA 3C1CC 1AOIC 4H9NA 3W97A 3AZGC 2CV5D 3UT9A 4H9OA 4ZBJC 3MGRC 5G49A 5DNNC 3MGPB 3REID 3UTBC 3AZMB 3WAAB 3NQUB 4G91B 1P3KD 5B2IB 4G92C 5B2JD 3MGSA 5AVCA 3AZHB 3H0LC 3VH5W 3B6GB 5B1LC 5B33B 3KXBD 3AZFA 1P3BA 5AV9B 1KU5A 1P3PA 4H9QB 3AV2B 3LZ1D 5B0ZC 3W99A 3AYWC 4HGAC 5B40C 5CPIA 3REHD 5B1MD 5GT3B 4ZUXC 4YS3C 3AV1C 1M18A 1KX5B 3AZJB 1U35A 1P3GA 4KHAA 3AZKA 3AZMC 3X1VA 4WU8A 2HIOB 4QLCB 3TU4D 4KUDA 2BYMB 2YFWA 5AV8B 5B2IC 1EQZB 2BYKB 3UTAA 2Y2OA 3B0BA 3C1CA 3AZHC 1AOIA 2LY8A 3REJC 5BS7C 5B24D 4XUJC 3MGRA 3AZNB 1ULYA 2RIQA 5DNNA 1KX4C 3WA9D 1F66D 3UTBA 5E5AC 1WWSA 4WJ3C 5CP6B 2NQBC 3MNNC 5JRGD 2ZY5A 3AN2A 3B6FB 3W96B 5GT3C 5B1LA 3LJAC 2NZDB 1KX3A 4NE3A 1A7WA 1M19C 4J8VB 5C3IC 4J8WC 5B0ZA 4NE6A 5CPJD 3AYWA 5AV6A 2HIOC 2ZY2A 4QLCC 3X1TD 4R8PD 4ZUXA 4YS3A 1BFMA 3AV1A 3REKD 5AY8D 2HUEB 4KGCA 1TAFB 4Z5TD 3VH5T 5GT0A 2CV5B 3VH5A 3REIB 5CPKB 1P3AC 3B6FC 1P3KB 5AVBD 3WKJD 3REJA 5BS7A 2NZDC 2RVQD 4XUJA 5B2JB 4WV4B 3MVDD 1KX4A 4J8XD 3KSYA 4J8VC 5E5AA 5B32D 2NQBA 3KXBB 3H0MC 3MNNA 1S32C 4LD9C 2Y2KA 4YM6D 1JFIA 3LZ1B 1HTAA 5KDMB 3LJAA 3A6ND 2F8ND 3AZIA 3REHB 1BH8A 5B1MB 1M19A 4DQYB 4J8WA 2L5AA 3VH6T 2CV5C 2AROC 4CSRB 3WTPC 3LZ0A 3AFAB 2Y2NA 5DNMA 3TU4B 3MGQA 3F6TA 4CAYB 4WNNA 5B24B 5B32G 3WA9B 3O62C 3AZLC 1P34D 1P3AA 4X23C 4WU9C 2F8NG 5AV5A 5BNXB 1M1AD 1N1JA 4JJND 4WZSB 5CPIB 2PYOC 2DF4C 2Y2MA 4J8UD 1S32A 4LD9A 3NQJA 2FJ7A 2Y2PA 3KWQC 5BNVB 3C1BD 5CPJB 1ID3D 4Z66D 3KUYD 3TU4C 3X1TB 3R45B 4R8PB 3B0DC 3X1SD 1HQ3D 3REKB 5AY8B 2J8PA 2AROA 2ZM5A 3WA9C 1P3LD 1F66C 4Z5TB 3WTPA 1ZLAD 3IP4C 1BH9B 1P3ID 1P3MD 4H9SC 5JRGC 3LELC 5CPKD 5AVBB 3A1IA 4EO5B 3WKJB 2CWEA 1P3OC 3RELA 3MVDB 5B0YD 5F99C 3WTPE 3O62A 4J8XB 1P3FC 5B31D 4H9PA 4UUZB 3V9RA 5B32B 1TZYD 1PZRA 3AZLA 3W98C 4X23A 4WU9A 1H3OA 1Q9CA 5GXQC 4YM6B 3X1TC 2PYOA 2G5HC 2F8NB 3A6NB 3AZED 3KFUG 5GSUA 3KWQA 3W97D 3UT9D 3MGPC 1Z2CB 3AFAD 3WAAC 4G91C 4AWLB 3X1UA 4XZQA 3EPHA 3B0CW 4M6BA 1F66A 3H0RC 3VH6W 5B31G 3MGSD 3AZGA 3B6GC 1WWIA 5B33C 4H9SA 5JRGA 2VQRA 5AV9C 3LELA 3AZFD 1P3BD 5BO0A 4YM6C 1P34B 3AV2C 1P3PD 1P3OA 3W99D 3A6NC 5BT1C 1M1AB 5F99A 1P3FA 4JJNB 5CPID 3W98A 2YFVA 4J8UB 1M18D 1KX5C 3AZJC 4DRBA 5GXQA 1U35D 1P3GD 1ID3B 3C1BB 4Z66B 3AZKD 5B40A 3KUYB 4Z2MG 4AWLC 3X1VD 4WU8D 5AV8C 4KUDD 5JA4B 1EQZC 4H9RB 3X1SB 1HQ3B 3UTAD 3C1CD 1AOID 3AZNC 3MGRD 3MGPA 1P3LB 5DNND 1ZLAB 3AZMA 3UTBD 1P3IB 3WAAA 3NQUA 1P3MB 5CP6C 5B2IA 1M1AC 3AZHA 3AN2D 2Y2LA 3B6GA 3FDDA 3W96C 5B1LD 5B0YB 5B33A 2F8NH 5AV9A 5B31B 2IO5B 1KX3D 1TZYB 4H9QA 3AV2A 1ID3C 5B0ZD 5FUGB 3KUYC 3AYWD 1R4VA 5AV6D 3X1SC 1HQ3C 5GT3A 3AZEB 4ZUXD 4YS3D 2HUEC 3AV1D 1KX5A 3AZJA 3B0CT 2W8SA 4KGCD 4H9NB 3W97B 3VH6A 1P3IC 5GT0D 3UT9B 1P3MC 4H9OB 2HIOA 4QLCA 5G49B 2BYMA 3REIC 5AV8A 5CPKC 1EQZA 2BYKA 1P3KC 3AZNA 5B2JC 3REJD 5B0YC 2F2AC 4XUJD 3MGSB 1KX4D 5AVCB 1T3UA 1TZYC 5E5AD 5CP6A 3KXBC 2JCHA 2NQBD 3AZFB 1P3BB 3MNND 3LZ1C 1P3PB 3B6FA 3W96A 3W99B 2NZDA 3LJAD 3REHC 5B1MC 3AZID 4J8VA 1M19D 4J8WD 1M18B 2Y2GA 3UT9C 1U35B 1P3GB 3AFAC 4KHAB 3AZKB 3LZ0D 3X1VB 4WU8B 4UPKA 5DNMD 4KUDB 3MGQD 4E44A 2YFWB 1TAFA 3UTAB 3C1CB 2CV5A 5B24C
chains in the Genus database with same CATH topology
3MGRB 3EPLA 5DNNB 3REIA 3UTBB 1P3PC 1P3KA 3EG5B 2JE5A 1P3AD 4E45A 5B2JA 4G92B 3AN2B 5AV5D 5CPIC 5B1LB 3KXBA 1KX3B 3A1KA 3LZ1A 1U35C 2FJ7D 5KDMA 5CPJC 5B0ZB 3AYWB 4HGAB 3REHA 5AV6B 4R8PC 4KUDC 5B1MA 2Y2IA 3UTAC 2UWXA 4ZUXB 3REKC 5AY8C 4YS3B 3AV1B 4CSRA 4Z2MH 2AROD 4Z5TC 4KGCB 3AFAA 5GT0B 3WTPD 3TU4A 4CAYA 3AN2C 5AVBC 4EO5C 3WKJC 5B24A 2RVQC 3REJB 3WA9A 4XUJB 3MVDC 3RELD 4J8XC 1KX3C 1KX4B 5AVCD 5B32C 3O62D 5E5AB 3AZLD 2NQBB 3P5JB 4X23D 3MNNB 5BNXA 2F8NK 4WU9D 5AV6C 1JFIB 2PYOD 3LJAB 3AZIB 1BH8B 5GSUD 1M19B 4KGCC 5C3IB 4J8WB 2JSSA 5BNVA 3KWQD 2Y2JA 5GT0C 5CPJA 3X1TA 3R45A 4R8PA 3LZ0B 3REKA 5AY8A 5DNMB 3MGQB 3X1UD 4XZQD 4Z5TA 4WNNB 2ZY4A 3AZGD 1BH9A 3LELD 1P34C 5AVBA 3WKJA 1P3AB 2Y2QA 1P3OD 3MVDA 4J8XA 5AV5B 4JJNC 3AZIC 1N1JB 4UUZA 1F1EA 5F99D 5B32A 1P3FD 4NFTA 4J8UC 3W98D 1S32B 2G5IC 4LD9B 1B6WA 4YM6A 3NQJB 2FJ7B 5GXQD 3C1BC 3LZ0C 4Z66C 2F8NA 3A6NA 5CHLB 5B40D 5DNMC 3MGQC 2AROB 1P3LC 3MGPD 1ZLAC 3WTPB 3AZMD 3WAAD 5B2ID 2BG1A 5AV5C 3AL0C 3AZHD 3B6GD 3RELB 5B31C 2IO5C 5B33D 3O62B 5AV9D 1P34A 4H9PB 2FJ7C 3V9RB 3AZLB 3AV2D 4X23B 1M1AA 4WU9B 1H3OB 5BT1D 4JJNA 3AZEC 2PYOB 1B67A 2XD1A 5GT3D 4J8UA 5GSUB 1KX5D 3AZJD 1ID3A 3KWQB 2FFFB 3C1BA 4Z66A 3W97C 3KUYA 2HIOD 4QLCD 5JA4A 4H9RA 1W2EA 1HQ3A 3B0DB 3X1SA 5AV8D 1EQZD 2DQNC 3X1UB 4XZQB 3EPJA 3RELC 3AZND 1P3LA 3MGSC 1F66B 1ZLAA 5AVCC 3EPKA 3AZGB 1P3IA 1P3MA 4ZBJB 5CP6D 5CPKA 3AZFC 5JRGB 3LELB 1P3BC 5BO0B 1AOIB 3B6FD 3W99C 1P3OB 3W96D 5B0YA 2NZDD 5B31A 5F99B 1P3FB 5GSUC 1TZYA 4J8VD 1M18C 3W98B 5FUGA 2YFVB 1S32D 4LD9D 1P3GC 5GXQB 3AZKC 3AZEA 3X1VC 5B40B 4WU8C 4NE5A 4DRAA 3X1UC 2ZY3A 4XZQC 2XD5A 2Y2HA 3C1CC 1AOIC 4H9NA 3W97A 3AZGC 2CV5D 3UT9A 4H9OA 4ZBJC 3MGRC 5G49A 5DNNC 3MGPB 3REID 3UTBC 3AZMB 3WAAB 3NQUB 4G91B 1P3KD 5B2IB 4G92C 5B2JD 3MGSA 5AVCA 3AZHB 3H0LC 3VH5W 3B6GB 5B1LC 5B33B 3KXBD 3AZFA 1P3BA 5AV9B 1KU5A 1P3PA 4H9QB 3AV2B 3LZ1D 5B0ZC 3W99A 3AYWC 4HGAC 5B40C 5CPIA 3REHD 5B1MD 5GT3B 4ZUXC 4YS3C 3AV1C 1M18A 1KX5B 3AZJB 1U35A 1P3GA 4KHAA 3AZKA 3AZMC 3X1VA 4WU8A 2HIOB 4QLCB 3TU4D 4KUDA 2BYMB 2YFWA 5AV8B 5B2IC 1EQZB 2BYKB 3UTAA 2Y2OA 3B0BA 3C1CA 3AZHC 1AOIA 2LY8A 3REJC 5BS7C 5B24D 4XUJC 3MGRA 3AZNB 1ULYA 2RIQA 5DNNA 1KX4C 3WA9D 1F66D 3UTBA 5E5AC 1WWSA 4WJ3C 5CP6B 2NQBC 3MNNC 5JRGD 2ZY5A 3AN2A 3B6FB 3W96B 5GT3C 5B1LA 3LJAC 2NZDB 1KX3A 4NE3A 1A7WA 1M19C 4J8VB 5C3IC 4J8WC 5B0ZA 4NE6A 5CPJD 3AYWA 5AV6A 2HIOC 2ZY2A 4QLCC 3X1TD 4R8PD 4ZUXA 4YS3A 1BFMA 3AV1A 3REKD 5AY8D 2HUEB 4KGCA 1TAFB 4Z5TD 3VH5T 5GT0A 2CV5B 3VH5A 3REIB 5CPKB 1P3AC 3B6FC 1P3KB 5AVBD 3WKJD 3REJA 5BS7A 2NZDC 2RVQD 4XUJA 5B2JB 4WV4B 3MVDD 1KX4A 4J8XD 3KSYA 4J8VC 5E5AA 5B32D 2NQBA 3KXBB 3H0MC 3MNNA 1S32C 4LD9C 2Y2KA 4YM6D 1JFIA 3LZ1B 1HTAA 5KDMB 3LJAA 3A6ND 2F8ND 3AZIA 3REHB 1BH8A 5B1MB 1M19A 4DQYB 4J8WA 2L5AA 3VH6T 2CV5C 2AROC 4CSRB 3WTPC 3LZ0A 3AFAB 2Y2NA 5DNMA 3TU4B 3MGQA 3F6TA 4CAYB 4WNNA 5B24B 5B32G 3WA9B 3O62C 3AZLC 1P34D 1P3AA 4X23C 4WU9C 2F8NG 5AV5A 5BNXB 1M1AD 1N1JA 4JJND 4WZSB 5CPIB 2PYOC 2DF4C 2Y2MA 4J8UD 1S32A 4LD9A 3NQJA 2FJ7A 2Y2PA 3KWQC 5BNVB 3C1BD 5CPJB 1ID3D 4Z66D 3KUYD 3TU4C 3X1TB 3R45B 4R8PB 3B0DC 3X1SD 1HQ3D 3REKB 5AY8B 2J8PA 2AROA 2ZM5A 3WA9C 1P3LD 1F66C 4Z5TB 3WTPA 1ZLAD 3IP4C 1BH9B 1P3ID 1P3MD 4H9SC 5JRGC 3LELC 5CPKD 5AVBB 3A1IA 4EO5B 3WKJB 2CWEA 1P3OC 3RELA 3MVDB 5B0YD 5F99C 3WTPE 3O62A 4J8XB 1P3FC 5B31D 4H9PA 4UUZB 3V9RA 5B32B 1TZYD 1PZRA 3AZLA 3W98C 4X23A 4WU9A 1H3OA 1Q9CA 5GXQC 4YM6B 3X1TC 2PYOA 2G5HC 2F8NB 3A6NB 3AZED 3KFUG 5GSUA 3KWQA 3W97D 3UT9D 3MGPC 1Z2CB 3AFAD 3WAAC 4G91C 4AWLB 3X1UA 4XZQA 3EPHA 3B0CW 4M6BA 1F66A 3H0RC 3VH6W 5B31G 3MGSD 3AZGA 3B6GC 1WWIA 5B33C 4H9SA 5JRGA 2VQRA 5AV9C 3LELA 3AZFD 1P3BD 5BO0A 4YM6C 1P34B 3AV2C 1P3PD 1P3OA 3W99D 3A6NC 5BT1C 1M1AB 5F99A 1P3FA 4JJNB 5CPID 3W98A 2YFVA 4J8UB 1M18D 1KX5C 3AZJC 4DRBA 5GXQA 1U35D 1P3GD 1ID3B 3C1BB 4Z66B 3AZKD 5B40A 3KUYB 4Z2MG 4AWLC 3X1VD 4WU8D 5AV8C 4KUDD 5JA4B 1EQZC 4H9RB 3X1SB 1HQ3B 3UTAD 3C1CD 1AOID 3AZNC 3MGRD 3MGPA 1P3LB 5DNND 1ZLAB 3AZMA 3UTBD 1P3IB 3WAAA 3NQUA 1P3MB 5CP6C 5B2IA 1M1AC 3AZHA 3AN2D 2Y2LA 3B6GA 3FDDA 3W96C 5B1LD 5B0YB 5B33A 2F8NH 5AV9A 5B31B 2IO5B 1KX3D 1TZYB 4H9QA 3AV2A 1ID3C 5B0ZD 5FUGB 3KUYC 3AYWD 1R4VA 5AV6D 3X1SC 1HQ3C 5GT3A 3AZEB 4ZUXD 4YS3D 2HUEC 3AV1D 1KX5A 3AZJA 3B0CT 2W8SA 4KGCD 4H9NB 3W97B 3VH6A 1P3IC 5GT0D 3UT9B 1P3MC 4H9OB 2HIOA 4QLCA 5G49B 2BYMA 3REIC 5AV8A 5CPKC 1EQZA 2BYKA 1P3KC 3AZNA 5B2JC 3REJD 5B0YC 2F2AC 4XUJD 3MGSB 1KX4D 5AVCB 1T3UA 1TZYC 5E5AD 5CP6A 3KXBC 2JCHA 2NQBD 3AZFB 1P3BB 3MNND 3LZ1C 1P3PB 3B6FA 3W96A 3W99B 2NZDA 3LJAD 3REHC 5B1MC 3AZID 4J8VA 1M19D 4J8WD 1M18B 2Y2GA 3UT9C 1U35B 1P3GB 3AFAC 4KHAB 3AZKB 3LZ0D 3X1VB 4WU8B 4UPKA 5DNMD 4KUDB 3MGQD 4E44A 2YFWB 1TAFA 3UTAB 3C1CB 2CV5A 5B24C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR B;  3REI A;  5DNN B;  3UTB B;  1P3P C;  1P3K A;  1P3A D;  4E45 A;  5B2J A;  4G92 B;  3AN2 B;  5AV5 D;  5CPI C;  5B1L B;  3KXB A;  1KX3 B;  3LZ1 A;  1U35 C;  2FJ7 D;  5KDM A;  5CPJ C;  5B0Z B;  3AYW B;  4HGA B;  3REH A;  5AV6 B;  4R8P C;  4KUD C;  5B1M A;  3UTA C;  4ZUX B;  3REK C;  5AY8 C;  4YS3 B;  3AV1 B;  4CSR A;  4Z2M H;  2ARO D;  4Z5T C;  4KGC B;  3AFA A;  5GT0 B;  3WTP D;  3TU4 A;  4CAY A;  3AN2 C;  5AVB C;  4EO5 C;  3WKJ C;  5B24 A;  2RVQ C;  3REJ B;  3WA9 A;  4XUJ B;  3MVD C;  3REL D;  4J8X C;  1KX3 C;  1KX4 B;  5AVC D;  5B32 C;  3O62 D;  5E5A B;  3AZL D;  2NQB B;  4X23 D;  3MNN B;  5BNX A;  2F8N K;  4WU9 D;  5AV6 C;  1JFI B;  2PYO D;  3LJA B;  3AZI B;  1BH8 B;  5GSU D;  1M19 B;  4KGC C;  5C3I B;  4J8W B;  2JSS A;  5BNV A;  3KWQ D;  5GT0 C;  5CPJ A;  3X1T A;  3R45 A;  4R8P A;  3LZ0 B;  3REK A;  5AY8 A;  5DNM B;  3MGQ B;  3X1U D;  4XZQ D;  4Z5T A;  4WNN B;  3AZG D;  1BH9 A;  3LEL D;  1P34 C;  5AVB A;  3WKJ A;  1P3A B;  1P3O D;  3MVD A;  4J8X A;  5AV5 B;  4JJN C;  3AZI C;  1N1J B;  4UUZ A;  1F1E A;  5F99 D;  5B32 A;  1P3F D;  4NFT A;  4J8U C;  3W98 D;  1S32 B;  4LD9 B;  1B6W A;  4YM6 A;  3NQJ B;  2FJ7 B;  5GXQ D;  3C1B C;  3LZ0 C;  4Z66 C;  2F8N A;  3A6N A;  5CHL B;  5B40 D;  5DNM C;  3MGQ C;  2ARO B;  1P3L C;  3MGP D;  1ZLA C;  3WTP B;  3AZM D;  3WAA D;  5B2I D;  5AV5 C;  3AZH D;  3B6G D;  3REL B;  5B31 C;  2IO5 C;  5B33 D;  3O62 B;  5AV9 D;  1P34 A;  4H9P B;  2FJ7 C;  3V9R B;  3AZL B;  3AV2 D;  4X23 B;  1M1A A;  4WU9 B;  1H3O B;  5BT1 D;  4JJN A;  3AZE C;  2PYO B;  1B67 A;  5GT3 D;  4J8U A;  5GSU B;  1KX5 D;  3AZJ D;  1ID3 A;  3KWQ B;  3C1B A;  3W97 C;  4Z66 A;  3KUY A;  2HIO D;  4QLC D;  5JA4 A;  4H9R A;  3X1S A;  1HQ3 A;  3B0D B;  5AV8 D;  1EQZ D;  3X1U B;  4XZQ B;  3REL C;  3AZN D;  1P3L A;  3MGS C;  1F66 B;  1ZLA A;  5AVC C;  3AZG B;  1P3I A;  1P3M A;  4ZBJ B;  5CP6 D;  5CPK A;  3AZF C;  5JRG B;  3LEL B;  1P3B C;  5BO0 B;  1AOI B;  3B6F D;  3W99 C;  1P3O B;  3W96 D;  5B0Y A;  2NZD D;  5B31 A;  5F99 B;  1P3F B;  5GSU C;  1TZY A;  4J8V D;  1M18 C;  3W98 B;  5FUG A;  2YFV B;  1S32 D;  4LD9 D;  1P3G C;  5GXQ B;  3AZK C;  3AZE A;  3X1V C;  5B40 B;  4WU8 C;  4NE5 A;  4DRA A;  3X1U C;  4XZQ C;  3C1C C;  1AOI C;  4H9N A;  3W97 A;  3AZG C;  2CV5 D;  3UT9 A;  4H9O A;  4ZBJ C;  3MGR C;  5G49 A;  5DNN C;  3MGP B;  3REI D;  3UTB C;  3AZM B;  3WAA B;  3NQU B;  4G91 B;  1P3K D;  5B2I B;  4G92 C;  5B2J D;  3MGS A;  5AVC A;  3AZH B;  3VH5 W;  3B6G B;  5B1L C;  5B33 B;  3KXB D;  3AZF A;  1P3B A;  5AV9 B;  1KU5 A;  1P3P A;  4H9Q B;  3AV2 B;  3LZ1 D;  5B0Z C;  3W99 A;  3AYW C;  4HGA C;  5B40 C;  5CPI A;  3REH D;  5B1M D;  5GT3 B;  4ZUX C;  4YS3 C;  3AV1 C;  1M18 A;  1KX5 B;  3AZJ B;  1U35 A;  1P3G A;  4KHA A;  3AZK A;  3AZM C;  3X1V A;  4WU8 A;  2HIO B;  4QLC B;  3TU4 D;  4KUD A;  2BYM B;  2YFW A;  5AV8 B;  5B2I C;  1EQZ B;  2BYK B;  3UTA A;  3B0B A;  3C1C A;  3AZH C;  1AOI A;  2LY8 A;  3REJ C;  5BS7 C;  5B24 D;  4XUJ C;  3MGR A;  3AZN B;  1ULY A;  3WA9 D;  5DNN A;  1KX4 C;  1F66 D;  3UTB A;  5E5A C;  1WWS A;  5CP6 B;  2NQB C;  3MNN C;  5JRG D;  3AN2 A;  3B6F B;  3W96 B;  5GT3 C;  5B1L A;  3LJA C;  2NZD B;  1KX3 A;  4NE3 A;  1A7W A;  1M19 C;  4J8V B;  5C3I C;  4J8W C;  5B0Z A;  4NE6 A;  5CPJ D;  3AYW A;  5AV6 A;  2HIO C;  4QLC C;  3X1T D;  4R8P D;  4ZUX A;  4YS3 A;  1BFM A;  3AV1 A;  3REK D;  5AY8 D;  2HUE B;  4KGC A;  1TAF B;  4Z5T D;  3VH5 T;  5GT0 A;  2CV5 B;  3VH5 A;  3REI B;  5CPK B;  1P3A C;  3B6F C;  1P3K B;  5AVB D;  3WKJ D;  3REJ A;  5BS7 A;  2NZD C;  2RVQ D;  4XUJ A;  5B2J B;  4WV4 B;  3MVD D;  1KX4 A;  4J8X D;  3KSY A;  4J8V C;  5E5A A;  5B32 D;  2NQB A;  3KXB B;  3MNN A;  1S32 C;  4LD9 C;  4YM6 D;  1JFI A;  3LZ1 B;  1HTA A;  5KDM B;  3LJA A;  3A6N D;  2F8N D;  3AZI A;  3REH B;  1BH8 A;  5B1M B;  1M19 A;  4J8W A;  2L5A A;  3VH6 T;  2CV5 C;  2ARO C;  4CSR B;  3WTP C;  3LZ0 A;  3AFA B;  5DNM A;  3TU4 B;  3MGQ A;  4CAY B;  4WNN A;  5B24 B;  5B32 G;  3WA9 B;  3O62 C;  3AZL C;  1P34 D;  1P3A A;  4X23 C;  4WU9 C;  2F8N G;  5AV5 A;  5BNX B;  1M1A D;  1N1J A;  4JJN D;  4WZS B;  5CPI B;  2PYO C;  4J8U D;  1S32 A;  4LD9 A;  3NQJ A;  2FJ7 A;  3KWQ C;  5BNV B;  3C1B D;  5CPJ B;  1ID3 D;  4Z66 D;  3KUY D;  3TU4 C;  3X1T B;  3R45 B;  4R8P B;  3B0D C;  3X1S D;  1HQ3 D;  3REK B;  5AY8 B;  2ARO A;  3WA9 C;  1P3L D;  1F66 C;  4Z5T B;  3WTP A;  1ZLA D;  1BH9 B;  1P3I D;  1P3M D;  4H9S C;  5JRG C;  3LEL C;  5CPK D;  5AVB B;  4EO5 B;  3WKJ B;  2CWE A;  1P3O C;  3REL A;  3MVD B;  5B0Y D;  5F99 C;  3WTP E;  3O62 A;  4J8X B;  1P3F C;  5B31 D;  4H9P A;  4UUZ B;  3V9R A;  5B32 B;  1TZY D;  3AZL A;  3W98 C;  4X23 A;  4WU9 A;  1Q9C A;  1H3O A;  5GXQ C;  4YM6 B;  3X1T C;  2PYO A;  2F8N B;  3A6N B;  3AZE D;  5GSU A;  3KWQ A;  3W97 D;  3UT9 D;  3MGP C;  3AFA D;  3WAA C;  4G91 C;  4AWL B;  3X1U A;  4XZQ A;  3B0C W;  4M6B A;  1F66 A;  3VH6 W;  5B31 G;  3MGS D;  3AZG A;  3B6G C;  1WWI A;  5B33 C;  4H9S A;  5JRG A;  5AV9 C;  3LEL A;  3AZF D;  1P3B D;  5BO0 A;  4YM6 C;  1P34 B;  3AV2 C;  1P3P D;  1P3O A;  3W99 D;  3A6N C;  5BT1 C;  1M1A B;  5F99 A;  1P3F A;  4JJN B;  5CPI D;  3W98 A;  2YFV A;  4J8U B;  1M18 D;  1KX5 C;  3AZJ C;  4DRB A;  5GXQ A;  1U35 D;  1P3G D;  1ID3 B;  3C1B B;  4Z66 B;  3AZK D;  5B40 A;  3KUY B;  4Z2M G;  4AWL C;  3X1V D;  4WU8 D;  5AV8 C;  4KUD D;  5JA4 B;  1EQZ C;  4H9R B;  3X1S B;  1HQ3 B;  3UTA D;  3C1C D;  1AOI D;  3AZN C;  3MGR D;  3MGP A;  1P3L B;  5DNN D;  1ZLA B;  3AZM A;  3UTB D;  1P3I B;  3WAA A;  3NQU A;  1P3M B;  5CP6 C;  5B2I A;  1M1A C;  3AZH A;  3AN2 D;  3B6G A;  3W96 C;  5B1L D;  5B0Y B;  5B33 A;  2F8N H;  5AV9 A;  5B31 B;  2IO5 B;  1KX3 D;  1TZY B;  4H9Q A;  3AV2 A;  1ID3 C;  5B0Z D;  5FUG B;  3KUY C;  3AYW D;  1R4V A;  5AV6 D;  3X1S C;  1HQ3 C;  5GT3 A;  3AZE B;  4ZUX D;  4YS3 D;  2HUE C;  3AV1 D;  1KX5 A;  3AZJ A;  3B0C T;  4KGC D;  4H9N B;  3W97 B;  3VH6 A;  1P3I C;  5GT0 D;  3UT9 B;  1P3M C;  4H9O B;  2HIO A;  4QLC A;  5G49 B;  2BYM A;  3REI C;  5AV8 A;  5CPK C;  1EQZ A;  2BYK A;  1P3K C;  3AZN A;  5B2J C;  3REJ D;  5B0Y C;  4XUJ D;  3MGS B;  1KX4 D;  5AVC B;  1TZY C;  5E5A D;  5CP6 A;  3KXB C;  2NQB D;  3AZF B;  1P3B B;  3MNN D;  3LZ1 C;  1P3P B;  3B6F A;  3W96 A;  3W99 B;  2NZD A;  3LJA D;  3REH C;  5B1M C;  3AZI D;  4J8V A;  1M19 D;  4J8W D;  1M18 B;  3UT9 C;  1U35 B;  1P3G B;  3AFA C;  4KHA B;  3AZK B;  3LZ0 D;  3X1V B;  4WU8 B;  5DNM D;  4KUD B;  3MGQ D;  4E44 A;  2YFW B;  1TAF A;  3UTA B;  3C1C B;  2CV5 A;  5B24 C; 
#chains in the Genus database with same CATH topology
 3MGR B;  3EPL A;  5DNN B;  3REI A;  3UTB B;  1P3P C;  1P3K A;  3EG5 B;  2JE5 A;  1P3A D;  4E45 A;  5B2J A;  4G92 B;  3AN2 B;  5AV5 D;  5CPI C;  5B1L B;  3KXB A;  1KX3 B;  3A1K A;  3LZ1 A;  1U35 C;  2FJ7 D;  5KDM A;  5CPJ C;  5B0Z B;  3AYW B;  4HGA B;  3REH A;  5AV6 B;  4R8P C;  4KUD C;  5B1M A;  2Y2I A;  3UTA C;  2UWX A;  4ZUX B;  3REK C;  5AY8 C;  4YS3 B;  3AV1 B;  4CSR A;  4Z2M H;  2ARO D;  4Z5T C;  4KGC B;  3AFA A;  5GT0 B;  3WTP D;  3TU4 A;  4CAY A;  3AN2 C;  5AVB C;  4EO5 C;  3WKJ C;  5B24 A;  2RVQ C;  3REJ B;  3WA9 A;  4XUJ B;  3MVD C;  3REL D;  4J8X C;  1KX3 C;  1KX4 B;  5AVC D;  5B32 C;  3O62 D;  5E5A B;  3AZL D;  2NQB B;  3P5J B;  4X23 D;  3MNN B;  5BNX A;  2F8N K;  4WU9 D;  5AV6 C;  1JFI B;  2PYO D;  3LJA B;  3AZI B;  1BH8 B;  5GSU D;  1M19 B;  4KGC C;  5C3I B;  4J8W B;  2JSS A;  5BNV A;  3KWQ D;  2Y2J A;  5GT0 C;  5CPJ A;  3X1T A;  3R45 A;  4R8P A;  3LZ0 B;  3REK A;  5AY8 A;  5DNM B;  3MGQ B;  3X1U D;  4XZQ D;  4Z5T A;  4WNN B;  2ZY4 A;  3AZG D;  1BH9 A;  3LEL D;  1P34 C;  5AVB A;  3WKJ A;  1P3A B;  2Y2Q A;  1P3O D;  3MVD A;  4J8X A;  5AV5 B;  4JJN C;  3AZI C;  1N1J B;  4UUZ A;  1F1E A;  5F99 D;  5B32 A;  1P3F D;  4NFT A;  4J8U C;  3W98 D;  1S32 B;  2G5I C;  4LD9 B;  1B6W A;  4YM6 A;  3NQJ B;  2FJ7 B;  5GXQ D;  3C1B C;  3LZ0 C;  4Z66 C;  2F8N A;  3A6N A;  5CHL B;  5B40 D;  5DNM C;  3MGQ C;  2ARO B;  1P3L C;  3MGP D;  1ZLA C;  3WTP B;  3AZM D;  3WAA D;  5B2I D;  2BG1 A;  5AV5 C;  3AL0 C;  3AZH D;  3B6G D;  3REL B;  5B31 C;  2IO5 C;  5B33 D;  3O62 B;  5AV9 D;  1P34 A;  4H9P B;  2FJ7 C;  3V9R B;  3AZL B;  3AV2 D;  4X23 B;  1M1A A;  4WU9 B;  1H3O B;  5BT1 D;  4JJN A;  3AZE C;  2PYO B;  1B67 A;  2XD1 A;  5GT3 D;  4J8U A;  5GSU B;  1KX5 D;  3AZJ D;  1ID3 A;  3KWQ B;  2FFF B;  3C1B A;  4Z66 A;  3W97 C;  3KUY A;  2HIO D;  4QLC D;  5JA4 A;  4H9R A;  1W2E A;  1HQ3 A;  3B0D B;  3X1S A;  5AV8 D;  1EQZ D;  2DQN C;  3X1U B;  4XZQ B;  3EPJ A;  3REL C;  3AZN D;  1P3L A;  3MGS C;  1F66 B;  1ZLA A;  5AVC C;  3EPK A;  3AZG B;  1P3I A;  1P3M A;  4ZBJ B;  5CP6 D;  5CPK A;  3AZF C;  5JRG B;  3LEL B;  1P3B C;  5BO0 B;  1AOI B;  3B6F D;  3W99 C;  1P3O B;  3W96 D;  5B0Y A;  2NZD D;  5B31 A;  5F99 B;  1P3F B;  5GSU C;  1TZY A;  4J8V D;  1M18 C;  3W98 B;  5FUG A;  2YFV B;  1S32 D;  4LD9 D;  1P3G C;  5GXQ B;  3AZK C;  3AZE A;  3X1V C;  5B40 B;  4WU8 C;  4NE5 A;  4DRA A;  3X1U C;  2ZY3 A;  4XZQ C;  2XD5 A;  2Y2H A;  3C1C C;  1AOI C;  4H9N A;  3W97 A;  3AZG C;  2CV5 D;  3UT9 A;  4H9O A;  4ZBJ C;  3MGR C;  5G49 A;  5DNN C;  3MGP B;  3REI D;  3UTB C;  3AZM B;  3WAA B;  3NQU B;  4G91 B;  1P3K D;  5B2I B;  4G92 C;  5B2J D;  3MGS A;  5AVC A;  3AZH B;  3H0L C;  3VH5 W;  3B6G B;  5B1L C;  5B33 B;  3KXB D;  3AZF A;  1P3B A;  5AV9 B;  1KU5 A;  1P3P A;  4H9Q B;  3AV2 B;  3LZ1 D;  5B0Z C;  3W99 A;  3AYW C;  4HGA C;  5B40 C;  5CPI A;  3REH D;  5B1M D;  5GT3 B;  4ZUX C;  4YS3 C;  3AV1 C;  1M18 A;  1KX5 B;  3AZJ B;  1U35 A;  1P3G A;  4KHA A;  3AZK A;  3AZM C;  3X1V A;  4WU8 A;  2HIO B;  4QLC B;  3TU4 D;  4KUD A;  2BYM B;  2YFW A;  5AV8 B;  5B2I C;  1EQZ B;  2BYK B;  3UTA A;  2Y2O A;  3B0B A;  3C1C A;  3AZH C;  1AOI A;  2LY8 A;  3REJ C;  5BS7 C;  5B24 D;  4XUJ C;  3MGR A;  3AZN B;  1ULY A;  2RIQ A;  5DNN A;  1KX4 C;  3WA9 D;  1F66 D;  3UTB A;  5E5A C;  1WWS A;  4WJ3 C;  5CP6 B;  2NQB C;  3MNN C;  5JRG D;  2ZY5 A;  3AN2 A;  3B6F B;  3W96 B;  5GT3 C;  5B1L A;  3LJA C;  2NZD B;  1KX3 A;  4NE3 A;  1A7W A;  1M19 C;  4J8V B;  5C3I C;  4J8W C;  5B0Z A;  4NE6 A;  5CPJ D;  3AYW A;  5AV6 A;  2HIO C;  2ZY2 A;  4QLC C;  3X1T D;  4R8P D;  4ZUX A;  4YS3 A;  1BFM A;  3AV1 A;  3REK D;  5AY8 D;  2HUE B;  4KGC A;  1TAF B;  4Z5T D;  3VH5 T;  5GT0 A;  2CV5 B;  3VH5 A;  3REI B;  5CPK B;  1P3A C;  3B6F C;  1P3K B;  5AVB D;  3WKJ D;  3REJ A;  5BS7 A;  2NZD C;  2RVQ D;  4XUJ A;  5B2J B;  4WV4 B;  3MVD D;  1KX4 A;  4J8X D;  3KSY A;  4J8V C;  5E5A A;  5B32 D;  2NQB A;  3KXB B;  3H0M C;  3MNN A;  1S32 C;  4LD9 C;  2Y2K A;  4YM6 D;  1JFI A;  3LZ1 B;  1HTA A;  5KDM B;  3LJA A;  3A6N D;  2F8N D;  3AZI A;  3REH B;  1BH8 A;  5B1M B;  1M19 A;  4DQY B;  4J8W A;  2L5A A;  3VH6 T;  2CV5 C;  2ARO C;  4CSR B;  3WTP C;  3LZ0 A;  3AFA B;  2Y2N A;  5DNM A;  3TU4 B;  3MGQ A;  3F6T A;  4CAY B;  4WNN A;  5B24 B;  5B32 G;  3WA9 B;  3O62 C;  3AZL C;  1P34 D;  1P3A A;  4X23 C;  4WU9 C;  2F8N G;  5AV5 A;  5BNX B;  1M1A D;  1N1J A;  4JJN D;  4WZS B;  5CPI B;  2PYO C;  2DF4 C;  2Y2M A;  4J8U D;  1S32 A;  4LD9 A;  3NQJ A;  2FJ7 A;  2Y2P A;  3KWQ C;  5BNV B;  3C1B D;  5CPJ B;  1ID3 D;  4Z66 D;  3KUY D;  3TU4 C;  3X1T B;  3R45 B;  4R8P B;  3B0D C;  3X1S D;  1HQ3 D;  3REK B;  5AY8 B;  2J8P A;  2ARO A;  2ZM5 A;  3WA9 C;  1P3L D;  1F66 C;  4Z5T B;  3WTP A;  1ZLA D;  3IP4 C;  1BH9 B;  1P3I D;  1P3M D;  4H9S C;  5JRG C;  3LEL C;  5CPK D;  5AVB B;  3A1I A;  4EO5 B;  3WKJ B;  2CWE A;  1P3O C;  3REL A;  3MVD B;  5B0Y D;  5F99 C;  3WTP E;  3O62 A;  4J8X B;  1P3F C;  5B31 D;  4H9P A;  4UUZ B;  3V9R A;  5B32 B;  1TZY D;  1PZR A;  3AZL A;  3W98 C;  4X23 A;  4WU9 A;  1H3O A;  1Q9C A;  5GXQ C;  4YM6 B;  3X1T C;  2PYO A;  2G5H C;  2F8N B;  3A6N B;  3AZE D;  3KFU G;  5GSU A;  3KWQ A;  3W97 D;  3UT9 D;  3MGP C;  1Z2C B;  3AFA D;  3WAA C;  4G91 C;  4AWL B;  3X1U A;  4XZQ A;  3EPH A;  3B0C W;  4M6B A;  1F66 A;  3H0R C;  3VH6 W;  5B31 G;  3MGS D;  3AZG A;  3B6G C;  1WWI A;  5B33 C;  4H9S A;  5JRG A;  2VQR A;  5AV9 C;  3LEL A;  3AZF D;  1P3B D;  5BO0 A;  4YM6 C;  1P34 B;  3AV2 C;  1P3P D;  1P3O A;  3W99 D;  3A6N C;  5BT1 C;  1M1A B;  5F99 A;  1P3F A;  4JJN B;  5CPI D;  3W98 A;  2YFV A;  4J8U B;  1M18 D;  1KX5 C;  3AZJ C;  4DRB A;  5GXQ A;  1U35 D;  1P3G D;  1ID3 B;  3C1B B;  4Z66 B;  3AZK D;  5B40 A;  3KUY B;  4Z2M G;  4AWL C;  3X1V D;  4WU8 D;  5AV8 C;  4KUD D;  5JA4 B;  1EQZ C;  4H9R B;  3X1S B;  1HQ3 B;  3UTA D;  3C1C D;  1AOI D;  3AZN C;  3MGR D;  3MGP A;  1P3L B;  5DNN D;  1ZLA B;  3AZM A;  3UTB D;  1P3I B;  3WAA A;  3NQU A;  1P3M B;  5CP6 C;  5B2I A;  1M1A C;  3AZH A;  3AN2 D;  2Y2L A;  3B6G A;  3FDD A;  3W96 C;  5B1L D;  5B0Y B;  5B33 A;  2F8N H;  5AV9 A;  5B31 B;  2IO5 B;  1KX3 D;  1TZY B;  4H9Q A;  3AV2 A;  1ID3 C;  5B0Z D;  5FUG B;  3KUY C;  3AYW D;  1R4V A;  5AV6 D;  3X1S C;  1HQ3 C;  5GT3 A;  3AZE B;  4ZUX D;  4YS3 D;  2HUE C;  3AV1 D;  1KX5 A;  3AZJ A;  3B0C T;  2W8S A;  4KGC D;  4H9N B;  3W97 B;  3VH6 A;  1P3I C;  5GT0 D;  3UT9 B;  1P3M C;  4H9O B;  2HIO A;  4QLC A;  5G49 B;  2BYM A;  3REI C;  5AV8 A;  5CPK C;  1EQZ A;  2BYK A;  1P3K C;  3AZN A;  5B2J C;  3REJ D;  5B0Y C;  2F2A C;  4XUJ D;  3MGS B;  1KX4 D;  5AVC B;  1T3U A;  1TZY C;  5E5A D;  5CP6 A;  3KXB C;  2JCH A;  2NQB D;  3AZF B;  1P3B B;  3MNN D;  3LZ1 C;  1P3P B;  3B6F A;  3W96 A;  3W99 B;  2NZD A;  3LJA D;  3REH C;  5B1M C;  3AZI D;  4J8V A;  1M19 D;  4J8W D;  1M18 B;  2Y2G A;  3UT9 C;  1U35 B;  1P3G B;  3AFA C;  4KHA B;  3AZK B;  3LZ0 D;  3X1V B;  4WU8 B;  4UPK A;  5DNM D;  4KUD B;  3MGQ D;  4E44 A;  2YFW B;  1TAF A;  3UTA B;  3C1C B;  2CV5 A;  5B24 C; 
#chains in the Genus database with same CATH homology
 3MGR B;  3EPL A;  5DNN B;  3REI A;  3UTB B;  1P3P C;  1P3K A;  3EG5 B;  2JE5 A;  1P3A D;  4E45 A;  5B2J A;  4G92 B;  3AN2 B;  5AV5 D;  5CPI C;  5B1L B;  3KXB A;  1KX3 B;  3A1K A;  3LZ1 A;  1U35 C;  2FJ7 D;  5KDM A;  5CPJ C;  5B0Z B;  3AYW B;  4HGA B;  3REH A;  5AV6 B;  4R8P C;  4KUD C;  5B1M A;  2Y2I A;  3UTA C;  2UWX A;  4ZUX B;  3REK C;  5AY8 C;  4YS3 B;  3AV1 B;  4CSR A;  4Z2M H;  2ARO D;  4Z5T C;  4KGC B;  3AFA A;  5GT0 B;  3WTP D;  3TU4 A;  4CAY A;  3AN2 C;  5AVB C;  4EO5 C;  3WKJ C;  5B24 A;  2RVQ C;  3REJ B;  3WA9 A;  4XUJ B;  3MVD C;  3REL D;  4J8X C;  1KX3 C;  1KX4 B;  5AVC D;  5B32 C;  3O62 D;  5E5A B;  3AZL D;  2NQB B;  3P5J B;  4X23 D;  3MNN B;  5BNX A;  2F8N K;  4WU9 D;  5AV6 C;  1JFI B;  2PYO D;  3LJA B;  3AZI B;  1BH8 B;  5GSU D;  1M19 B;  4KGC C;  5C3I B;  4J8W B;  2JSS A;  5BNV A;  3KWQ D;  2Y2J A;  5GT0 C;  5CPJ A;  3X1T A;  3R45 A;  4R8P A;  3LZ0 B;  3REK A;  5AY8 A;  5DNM B;  3MGQ B;  3X1U D;  4XZQ D;  4Z5T A;  4WNN B;  2ZY4 A;  3AZG D;  1BH9 A;  3LEL D;  1P34 C;  5AVB A;  3WKJ A;  1P3A B;  2Y2Q A;  1P3O D;  3MVD A;  4J8X A;  5AV5 B;  4JJN C;  3AZI C;  1N1J B;  4UUZ A;  1F1E A;  5F99 D;  5B32 A;  1P3F D;  4NFT A;  4J8U C;  3W98 D;  1S32 B;  2G5I C;  4LD9 B;  1B6W A;  4YM6 A;  3NQJ B;  2FJ7 B;  5GXQ D;  3C1B C;  3LZ0 C;  4Z66 C;  2F8N A;  3A6N A;  5CHL B;  5B40 D;  5DNM C;  3MGQ C;  2ARO B;  1P3L C;  3MGP D;  1ZLA C;  3WTP B;  3AZM D;  3WAA D;  5B2I D;  2BG1 A;  5AV5 C;  3AL0 C;  3AZH D;  3B6G D;  3REL B;  5B31 C;  2IO5 C;  5B33 D;  3O62 B;  5AV9 D;  1P34 A;  4H9P B;  2FJ7 C;  3V9R B;  3AZL B;  3AV2 D;  4X23 B;  1M1A A;  4WU9 B;  1H3O B;  5BT1 D;  4JJN A;  3AZE C;  2PYO B;  1B67 A;  2XD1 A;  5GT3 D;  4J8U A;  5GSU B;  1KX5 D;  3AZJ D;  1ID3 A;  3KWQ B;  2FFF B;  3C1B A;  4Z66 A;  3W97 C;  3KUY A;  2HIO D;  4QLC D;  5JA4 A;  4H9R A;  1W2E A;  1HQ3 A;  3B0D B;  3X1S A;  5AV8 D;  1EQZ D;  2DQN C;  3X1U B;  4XZQ B;  3EPJ A;  3REL C;  3AZN D;  1P3L A;  3MGS C;  1F66 B;  1ZLA A;  5AVC C;  3EPK A;  3AZG B;  1P3I A;  1P3M A;  4ZBJ B;  5CP6 D;  5CPK A;  3AZF C;  5JRG B;  3LEL B;  1P3B C;  5BO0 B;  1AOI B;  3B6F D;  3W99 C;  1P3O B;  3W96 D;  5B0Y A;  2NZD D;  5B31 A;  5F99 B;  1P3F B;  5GSU C;  1TZY A;  4J8V D;  1M18 C;  3W98 B;  5FUG A;  2YFV B;  1S32 D;  4LD9 D;  1P3G C;  5GXQ B;  3AZK C;  3AZE A;  3X1V C;  5B40 B;  4WU8 C;  4NE5 A;  4DRA A;  3X1U C;  2ZY3 A;  4XZQ C;  2XD5 A;  2Y2H A;  3C1C C;  1AOI C;  4H9N A;  3W97 A;  3AZG C;  2CV5 D;  3UT9 A;  4H9O A;  4ZBJ C;  3MGR C;  5G49 A;  5DNN C;  3MGP B;  3REI D;  3UTB C;  3AZM B;  3WAA B;  3NQU B;  4G91 B;  1P3K D;  5B2I B;  4G92 C;  5B2J D;  3MGS A;  5AVC A;  3AZH B;  3H0L C;  3VH5 W;  3B6G B;  5B1L C;  5B33 B;  3KXB D;  3AZF A;  1P3B A;  5AV9 B;  1KU5 A;  1P3P A;  4H9Q B;  3AV2 B;  3LZ1 D;  5B0Z C;  3W99 A;  3AYW C;  4HGA C;  5B40 C;  5CPI A;  3REH D;  5B1M D;  5GT3 B;  4ZUX C;  4YS3 C;  3AV1 C;  1M18 A;  1KX5 B;  3AZJ B;  1U35 A;  1P3G A;  4KHA A;  3AZK A;  3AZM C;  3X1V A;  4WU8 A;  2HIO B;  4QLC B;  3TU4 D;  4KUD A;  2BYM B;  2YFW A;  5AV8 B;  5B2I C;  1EQZ B;  2BYK B;  3UTA A;  2Y2O A;  3B0B A;  3C1C A;  3AZH C;  1AOI A;  2LY8 A;  3REJ C;  5BS7 C;  5B24 D;  4XUJ C;  3MGR A;  3AZN B;  1ULY A;  2RIQ A;  5DNN A;  1KX4 C;  3WA9 D;  1F66 D;  3UTB A;  5E5A C;  1WWS A;  4WJ3 C;  5CP6 B;  2NQB C;  3MNN C;  5JRG D;  2ZY5 A;  3AN2 A;  3B6F B;  3W96 B;  5GT3 C;  5B1L A;  3LJA C;  2NZD B;  1KX3 A;  4NE3 A;  1A7W A;  1M19 C;  4J8V B;  5C3I C;  4J8W C;  5B0Z A;  4NE6 A;  5CPJ D;  3AYW A;  5AV6 A;  2HIO C;  2ZY2 A;  4QLC C;  3X1T D;  4R8P D;  4ZUX A;  4YS3 A;  1BFM A;  3AV1 A;  3REK D;  5AY8 D;  2HUE B;  4KGC A;  1TAF B;  4Z5T D;  3VH5 T;  5GT0 A;  2CV5 B;  3VH5 A;  3REI B;  5CPK B;  1P3A C;  3B6F C;  1P3K B;  5AVB D;  3WKJ D;  3REJ A;  5BS7 A;  2NZD C;  2RVQ D;  4XUJ A;  5B2J B;  4WV4 B;  3MVD D;  1KX4 A;  4J8X D;  3KSY A;  4J8V C;  5E5A A;  5B32 D;  2NQB A;  3KXB B;  3H0M C;  3MNN A;  1S32 C;  4LD9 C;  2Y2K A;  4YM6 D;  1JFI A;  3LZ1 B;  1HTA A;  5KDM B;  3LJA A;  3A6N D;  2F8N D;  3AZI A;  3REH B;  1BH8 A;  5B1M B;  1M19 A;  4DQY B;  4J8W A;  2L5A A;  3VH6 T;  2CV5 C;  2ARO C;  4CSR B;  3WTP C;  3LZ0 A;  3AFA B;  2Y2N A;  5DNM A;  3TU4 B;  3MGQ A;  3F6T A;  4CAY B;  4WNN A;  5B24 B;  5B32 G;  3WA9 B;  3O62 C;  3AZL C;  1P34 D;  1P3A A;  4X23 C;  4WU9 C;  2F8N G;  5AV5 A;  5BNX B;  1M1A D;  1N1J A;  4JJN D;  4WZS B;  5CPI B;  2PYO C;  2DF4 C;  2Y2M A;  4J8U D;  1S32 A;  4LD9 A;  3NQJ A;  2FJ7 A;  2Y2P A;  3KWQ C;  5BNV B;  3C1B D;  5CPJ B;  1ID3 D;  4Z66 D;  3KUY D;  3TU4 C;  3X1T B;  3R45 B;  4R8P B;  3B0D C;  3X1S D;  1HQ3 D;  3REK B;  5AY8 B;  2J8P A;  2ARO A;  2ZM5 A;  3WA9 C;  1P3L D;  1F66 C;  4Z5T B;  3WTP A;  1ZLA D;  3IP4 C;  1BH9 B;  1P3I D;  1P3M D;  4H9S C;  5JRG C;  3LEL C;  5CPK D;  5AVB B;  3A1I A;  4EO5 B;  3WKJ B;  2CWE A;  1P3O C;  3REL A;  3MVD B;  5B0Y D;  5F99 C;  3WTP E;  3O62 A;  4J8X B;  1P3F C;  5B31 D;  4H9P A;  4UUZ B;  3V9R A;  5B32 B;  1TZY D;  1PZR A;  3AZL A;  3W98 C;  4X23 A;  4WU9 A;  1H3O A;  1Q9C A;  5GXQ C;  4YM6 B;  3X1T C;  2PYO A;  2G5H C;  2F8N B;  3A6N B;  3AZE D;  3KFU G;  5GSU A;  3KWQ A;  3W97 D;  3UT9 D;  3MGP C;  1Z2C B;  3AFA D;  3WAA C;  4G91 C;  4AWL B;  3X1U A;  4XZQ A;  3EPH A;  3B0C W;  4M6B A;  1F66 A;  3H0R C;  3VH6 W;  5B31 G;  3MGS D;  3AZG A;  3B6G C;  1WWI A;  5B33 C;  4H9S A;  5JRG A;  2VQR A;  5AV9 C;  3LEL A;  3AZF D;  1P3B D;  5BO0 A;  4YM6 C;  1P34 B;  3AV2 C;  1P3P D;  1P3O A;  3W99 D;  3A6N C;  5BT1 C;  1M1A B;  5F99 A;  1P3F A;  4JJN B;  5CPI D;  3W98 A;  2YFV A;  4J8U B;  1M18 D;  1KX5 C;  3AZJ C;  4DRB A;  5GXQ A;  1U35 D;  1P3G D;  1ID3 B;  3C1B B;  4Z66 B;  3AZK D;  5B40 A;  3KUY B;  4Z2M G;  4AWL C;  3X1V D;  4WU8 D;  5AV8 C;  4KUD D;  5JA4 B;  1EQZ C;  4H9R B;  3X1S B;  1HQ3 B;  3UTA D;  3C1C D;  1AOI D;  3AZN C;  3MGR D;  3MGP A;  1P3L B;  5DNN D;  1ZLA B;  3AZM A;  3UTB D;  1P3I B;  3WAA A;  3NQU A;  1P3M B;  5CP6 C;  5B2I A;  1M1A C;  3AZH A;  3AN2 D;  2Y2L A;  3B6G A;  3FDD A;  3W96 C;  5B1L D;  5B0Y B;  5B33 A;  2F8N H;  5AV9 A;  5B31 B;  2IO5 B;  1KX3 D;  1TZY B;  4H9Q A;  3AV2 A;  1ID3 C;  5B0Z D;  5FUG B;  3KUY C;  3AYW D;  1R4V A;  5AV6 D;  3X1S C;  1HQ3 C;  5GT3 A;  3AZE B;  4ZUX D;  4YS3 D;  2HUE C;  3AV1 D;  1KX5 A;  3AZJ A;  3B0C T;  2W8S A;  4KGC D;  4H9N B;  3W97 B;  3VH6 A;  1P3I C;  5GT0 D;  3UT9 B;  1P3M C;  4H9O B;  2HIO A;  4QLC A;  5G49 B;  2BYM A;  3REI C;  5AV8 A;  5CPK C;  1EQZ A;  2BYK A;  1P3K C;  3AZN A;  5B2J C;  3REJ D;  5B0Y C;  2F2A C;  4XUJ D;  3MGS B;  1KX4 D;  5AVC B;  1T3U A;  1TZY C;  5E5A D;  5CP6 A;  3KXB C;  2JCH A;  2NQB D;  3AZF B;  1P3B B;  3MNN D;  3LZ1 C;  1P3P B;  3B6F A;  3W96 A;  3W99 B;  2NZD A;  3LJA D;  3REH C;  5B1M C;  3AZI D;  4J8V A;  1M19 D;  4J8W D;  1M18 B;  2Y2G A;  3UT9 C;  1U35 B;  1P3G B;  3AFA C;  4KHA B;  3AZK B;  3LZ0 D;  3X1V B;  4WU8 B;  4UPK A;  5DNM D;  4KUD B;  3MGQ D;  4E44 A;  2YFW B;  1TAF A;  3UTA B;  3C1C B;  2CV5 A;  5B24 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...