4KGCA

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcA00
4ZUXA 4J8WD 5GT3B 1S32D 5CP6A 3V9RB 5BNXB 5AV9B 3LELA 4YM6A 3KXBC 4LD9B 4CAYB 3AZGA 3REKC 3RELA 4H9QA 5CPKB 4WU8D 1P3KD 5B1LD 3WTPA 4AWLB 3UTBB 4Z66A 4YS3C 3O62A 3X1VB 5B24A 1P3BD 3WA9A 5AVCD 3X1SD 3AN2C 3AYWB 3KUYA 5B0YC 1ZLAA 3B0CT 4Z5TD 3LZ0D 5G49B 1B6WA 3AV2C 3MGRC 3WKJB 1WWSA 3REIA 3AFAD 1P34C 5AV5C 4JJNC 3AZMC 1P3GA 3W97A 3AZEB 5B2IA 2FJ7C 4KGCB 4J8WA 3TU4D 3C1CC 1S32A 2YFVB 4H9RA 5BO0A 1N1JA 4J8XD 2IO5B 3X1UC 1P3MB 3MGPD 1ULYA 1TZYD 3X1TB 4X23C 1M19D 4HGAB 4WU8A 1P3KA 5B1LA 5DNND 1JFIB 3MGQB 1P3BA 5GT3D 5AVCA 3X1SA 2BYMB 5AV9D 4WZSB 1HTAA 4LD9D 3W98C 5JA4A 4Z5TA 5CPKD 3LZ0A 3AZHD 3UTBD 3X1VD 5AVBC 5KDMA 1U35C 3AFAA 5AY8B 3AYWD 4WNNB 4WU9B 5CPIB 3TU4A 1KX4B 5B31C 3AZNB 5B32C 4J8XA 3MVDC 3WKJD 3NQUA 3MGPA 1TZYA 4ZBJB 1AOIC 1M19A 3AZED 3WAAB 5C3IC 5DNNA 4KGCD 3REHB 5GT3A 3LJAC 5GXQB 3V9RA 5BNXA 5AV9A 4J8VC 1P3MD 5BNVB 5B0ZB 4LD9A 4CAYA 3REJC 3X1TD 3AZJC 5CPKA 3AZHA 2RVQD 3MGQD 4E44A 3UTBA 3X1VA 3MNNB 4J8UC 2F8NG 3AZLB 3AYWA 2F8NK 4ZUXC 3VH6A 1EQZB 5CP6C 5G49A 5JRGB 3LELC 4YM6C 3WKJA 3VH5A 3AZGC 5AY8D 3RELC 3R45B 4WU9D 3AZEA 1P3AB 3WTPC 4KGCA 5CPID 1KX4D 4Z66C 3O62C 3A6NB 5B24C 2YFVA 3WA9C 3AZND 3WTPE 3KUYC 2AROB 1P3MA 1ZLAC 3X1TA 3B6GB 3WAAD 1JFIA 3MGQA 5F99B 3REHD 3REIC 5GXQD 2BYMA 3W97C 3MGSB 1ID3B 4QLCB 5B2IC 5B0ZD 4J8WC 3AV1B 1S32C 5CPJB 3LZ1B 2L5AA 5B33B 5B2JB 3MNND 5AY8A 3AZKB 3AZLD 4WNNA 4WU9A 4WU8C 1P3KC 4H9PB 5B1LC 2NQBB 5CPIA 1P3BC 1KX4A 3REKB 5AVCC 3X1SC 3AZNA 5JRGD 1HQ3B 4XUJB 3KSYA 4Z5TC 5B0YB 3LZ0C 1P3AD 3WAAA 3REHA 4NE6A 3A6ND 3AFAC 5GXQA 3AZIB 2F8NB 3AV2B 2AROD 5BNVA 5B0ZA 3TU4C 3B6FB 3B6GD 4NE5A 5E5AB 4J8XC 5F99D 4EO5B 3MNNA 4G92B 3MGPC 1TZYC 5FUGB 3AZLA 4G91B 1M19C 3MGSD 1ID3D 4QLCD 5DNNC 1BFMA 5GT3C 3AV1D 5AV6B 5CPJD 3LZ1D 5AV9C 1P3IB 5JRGA 5B33D 5B2JD 2NZDB 4LD9C 3AZKD 3R45A 4KUDB 5CPKC 5B40B 1P3AA 3AZHC 1M1AB 4AWLC 4R8PB 2NQBD 3UTBC 3X1VC 3A6NA 4NFTA 2HUEB 2YFWB 3AYWC 1KX3B 3B0DB 2AROA 1HQ3D 2JSSA 1F66B 1P3LB 3B6GA 4XUJD 5F99A 3WKJC 3AZID 2F8ND 4XZQB 3AZEC 3MGSA 3AZFB 1ID3A 4QLCA 4KGCC 2LY8A 3AV1A 3B6FD 5CPJA 3LZ1A 5E5AD 5B33A 2IO5C 5B2JA 1P3MC 1P3FB 3AZKA 3X1TC 4HGAC 4Z2MH 2NQBA 2RVQC 3MGQC 2PYOB 5AV6D 1M18B 1P3ID 1BH8B 2NZDD 3C1BB 1HQ3A 1P3OB 1A7WA 4XUJA 4KUDD 5B40D 4H9SA 1M1AD 4R8PD 3KWQB 1H3OB 3AZIA 2F8NA 5AY8C 1KX3D 2CV5B 4WU9C 1TAFB 4WV4B 5BS7A 5CPIC 1KX4C 3AZGB 1F66D 2HIOB 3B6FA 1P3LD 4UUZB 3VH6W 3AZNC 5E5AA 2BYKB 5BT1D 5B1MB 3VH5W 4XZQD 4CSRB 5FUGA 4ZBJC 5DNMB 3WAAC 3AZFD 5AV8B 3REHC 3W99B 5AV6A 3UT9B 5GXQC 4H9NB 1P3IA 1KX5B 2NZDA 5B0ZC 1P3FD 5GT0B 4KUDA 5B40A 1M1AA 4R8PA 5GSUB 2PYOD 3UTAB 3MNNC 3W96B 1M18D 2YFWA 3AZLC 1P3GC 1KX3A 3C1BD 1P3PB 1F66A 1P3OD 1P3LA 5JRGC 3KWQD 5B31G 4XZQA 2CV5D 5B32G 3KXBB 3AZFA 1P3AC 3VH6T 2HIOD 3A6NC 1EQZD 3B0CW 2CWEA 2AROC 4YS3B 1P3FA 5B1MD 3B0BA 3AN2B 5DNMD 3B6GC 5AV8D 2PYOA 5F99C 3W99D 3UT9D 1M18A 5CHLB 1KX5D 3MGRB 3MGSC 4E45A 1BH8A 4QLCC 3C1BA 1ID3C 1P34B 3AV1C 1P3OA 5AV5B 4JJNB 3AZMB 3LZ1C 5CPJC 5GT0D 5DNNB 2FJ7B 1Q9CA 3KWQA 5GSUD 5B33C 3C1CB 5B2JC 3UTAD 1H3OA 3W96D 1B67A 3AZKC 2CV5A 1TAFA 3X1UB 2NQBC 1P3PD 2HIOA 4UUZA 1EQZA 4X23B 3AZHB 2BYKA 1HQ3C 5B1MA 4CSRA 5DNMA 4XUJC 3KXBD 1R4VA 4H9SC 5AV8A 3REKD 1BH9B 3W98B 3W99A 3UT9A 3AZIC 4H9NA 1KX5A 4YS3D 5BS7C 5AVBB 1U35B 3B6FC 3AN2D 5GT0A 5B0YD 5E5AC 5GSUA 4EO5C 3W96A 3UTAA 5B31B 4G92C 5B32B 4G91C 3MVDB 3MGRD 3AV2D 1P3PA 1P34D 5AV5D 5AV6C 4JJND 3AZMD 1AOIB 5C3IB 1P3IC 2FJ7D 3NQJB 3C1CD 2NZDC 3LJAB 4J8VB 4KUDC 3KXBA 3X1UD 4KHAB 5B40C 4H9PA 4R8PC 1M1AC 4M6BA 3REKA 3REJB 4NE3A 4X23D 3AZJB 2HUEC 1KX3C 3B0DC 4YS3A 4Z2MG 4J8UB 1F66C 4DRAA 3AN2A 1P3LC 4H9OB 5B0YA 5BT1C 4ZUXB 3W98D 5CP6B 4XZQC 3AV2A 3LELB 4YM6B 3MGRA 3AZFC 5AVBD 1U35D 1P34A 5AV5A 4JJNA 3RELB 3AZMA 4H9QB 3WTPB 2FJ7A 4Z66B 3C1CA 3O62B 3WA9B 5B24B 5B31D 1P3FC 1KU5A 5B32D 3KUYB 3MVDD 3X1UA 2PYOC 2F8NH 1ZLAB 4X23A 1M18C 1AOID 4DRBA 3C1BC 3LJAD 3REIB 1P3OC 4J8VD 1P3GB 3W97B 5B2IB 3KWQC 4J8WB 1S32B 4H9RB 1BH9A 3W98A 3REJD 3AZJD 5BO0B 1N1JB 2CV5C 5AVBA 1U35A 4J8UD 2HIOC 1EQZC 4WU8B 1P3KB 5B1LB 4ZUXD 1P3BB 5B31A 5AVCB 5CP6D 3X1SB 5B1MC 5B32A 5DNMC 3MVDA 4YM6D 3LELD 5AV8C 1WWIA 3AZGD 3W99C 3RELD 1F1EA 3UT9C 1AOIA 5JA4B 4Z5TB 3LZ0B 3WTPD 3NQJA 1KX5C 3VH5T 4Z66D 3O62D 3WA9D 5B24D 5KDMB 3LJAA 3AFAB 4J8VA 3KUYD 5GT0C 4KHAA 5GSUC 3TU4B 3W96C 3UTAC 1ZLAD 3REJA 3AZJA 4J8XB 1P3PC 3NQUB 4J8UA 3MGPB 3REID 1TZYB 1P3GD 4H9OA 1M19B 3W97D 5B2ID
chains in the Genus database with same CATH superfamily
4ZUXA 4J8WD 5GT3B 1S32D 5CP6A 3V9RB 5BNXB 5AV9B 3LELA 4YM6A 2G5HC 3KXBC 4LD9B 4CAYB 3AZGA 2ZY4A 3REKC 3RELA 4H9QA 5CPKB 4WU8D 1P3KD 5B1LD 3WTPA 4AWLB 3UTBB 4Z66A 4YS3C 3O62A 3X1VB 5B24A 1P3BD 3WA9A 5AVCD 3X1SD 3AN2C 3AYWB 3KUYA 5B0YC 1ZLAA 3B0CT 4Z5TD 3LZ0D 5G49B 1B6WA 3H0RC 3AV2C 3MGRC 3WKJB 1WWSA 3REIA 3AFAD 1P34C 5AV5C 4JJNC 3AZMC 1P3GA 3W97A 3AZEB 5B2IA 2FJ7C 4KGCB 4J8WA 3TU4D 3C1CC 1S32A 2YFVB 4H9RA 5BO0A 1N1JA 4J8XD 2IO5B 3X1UC 1P3MB 4UPKA 2W8SA 3MGPD 1ULYA 1TZYD 3X1TB 4X23C 1M19D 4HGAB 4WU8A 1P3KA 5B1LA 5DNND 1JFIB 3MGQB 1P3BA 5GT3D 5AVCA 3X1SA 2BYMB 5AV9D 4WZSB 1HTAA 4LD9D 3W98C 5JA4A 4Z5TA 5CPKD 3LZ0A 3AZHD 3UTBD 3X1VD 2Y2HA 5AVBC 5KDMA 1U35C 3AFAA 5AY8B 3AYWD 4WNNB 4WU9B 5CPIB 3TU4A 1KX4B 5B31C 2DF4C 3AZNB 5B32C 4J8XA 3MVDC 3WKJD 3NQUA 3MGPA 1TZYA 4ZBJB 1AOIC 1M19A 3AZED 3WAAB 5C3IC 5DNNA 4KGCD 3REHB 5GT3A 3LJAC 2XD5A 5GXQB 3V9RA 5BNXA 5AV9A 4J8VC 2DQNC 1P3MD 5BNVB 5B0ZB 4LD9A 4CAYA 3REJC 3X1TD 3AZJC 5CPKA 3AZHA 2RVQD 3MGQD 4E44A 3UTBA 3X1VA 3MNNB 4J8UC 2F8NG 3AZLB 3AYWA 2F8NK 4ZUXC 3VH6A 1EQZB 5CP6C 5G49A 5JRGB 3LELC 4YM6C 3WKJA 3VH5A 3AZGC 5AY8D 3RELC 3R45B 4WU9D 3AZEA 1P3AB 3WTPC 4KGCA 5CPID 1KX4D 4Z66C 3O62C 3A6NB 5B24C 2YFVA 3WA9C 2JE5A 3AZND 3WTPE 3KUYC 2AROB 2Y2LA 1P3MA 1ZLAC 3X1TA 3B6GB 3WAAD 1JFIA 3MGQA 5F99B 3REHD 3REIC 5GXQD 2BYMA 3W97C 3MGSB 1ID3B 4QLCB 5B2IC 5B0ZD 4J8WC 3AV1B 1S32C 5CPJB 3LZ1B 2L5AA 5B33B 5B2JB 3MNND 5AY8A 3AZKB 3AZLD 4WNNA 4WU9A 4WU8C 1P3KC 4H9PB 5B1LC 2NQBB 5CPIA 2FFFB 1P3BC 1KX4A 3REKB 5AVCC 3X1SC 3AZNA 5JRGD 2Y2MA 1HQ3B 4XUJB 3KSYA 4Z5TC 5B0YB 3LZ0C 1P3AD 3WAAA 3EPLA 2ZY2A 3REHA 4NE6A 3A6ND 3AFAC 5GXQA 3AZIB 2F8NB 3AV2B 2AROD 5BNVA 5B0ZA 3TU4C 3B6FB 3B6GD 3AL0C 4NE5A 5E5AB 4J8XC 3FDDA 5F99D 2G5IC 4EO5B 3MNNA 4G92B 1T3UA 3MGPC 1TZYC 5FUGB 3AZLA 4G91B 1M19C 3MGSD 3IP4C 4QLCD 5DNNC 1ID3D 1BFMA 5GT3C 3AV1D 1W2EA 2RIQA 5AV6B 5CPJD 3LZ1D 5AV9C 1P3IB 5JRGA 5B33D 5B2JD 2NZDB 4LD9C 3AZKD 3R45A 4KUDB 5CPKC 5B40B 1P3AA 3AZHC 1M1AB 4AWLC 4R8PB 2NQBD 3EPHA 3UTBC 3X1VC 3A6NA 1M19B 4NFTA 2HUEB 2YFWB 3AYWC 1KX3B 3B0DB 2AROA 1HQ3D 2JSSA 1F66B 1P3LB 3B6GA 4XUJD 5F99A 3EPJA 3WKJC 3AZID 2F8ND 4XZQB 3AZEC 3MGSA 3AZFB 1ID3A 4QLCA 4KGCC 2LY8A 3AV1A 3B6FD 2Y2IA 3F6TA 5CPJA 3LZ1A 5E5AD 5B33A 2Y2JA 2IO5C 5B2JA 1P3MC 1P3FB 3AZKA 3X1TC 4HGAC 4Z2MH 2NQBA 2RVQC 3MGQC 2PYOB 5AV6D 1M18B 1P3ID 2UWXA 1BH8B 2NZDD 3C1BB 1HQ3A 1P3OB 1A7WA 4XUJA 4KUDD 5B40D 4H9SA 1M1AD 4R8PD 3KWQB 1H3OB 3AZIA 2F8NA 5AY8C 1KX3D 2CV5B 3A1IA 4WU9C 1TAFB 4WV4B 5BS7A 5CPIC 1KX4C 3AZGB 1F66D 2HIOB 3B6FA 1P3LD 2JCHA 4UUZB 2Y2KA 3VH6W 3AZNC 2Y2NA 5E5AA 2BYKB 3A1KA 5BT1D 5B1MB 3VH5W 4XZQD 4CSRB 5FUGA 4ZBJC 5DNMB 3WAAC 3AZFD 5AV8B 3REHC 3W99B 5AV6A 3UT9B 5GXQC 4H9NB 1P3IA 1KX5B 2NZDA 5B0ZC 1P3FD 5GT0B 4KUDA 5B40A 1M1AA 4R8PA 5GSUB 2PYOD 3UTAB 3MNNC 3W96B 1M18D 2YFWA 3AZLC 1P3GC 1KX3A 3C1BD 1P3PB 1F66A 1P3OD 1P3LA 5JRGC 3KWQD 5B31G 4XZQA 2CV5D 5B32G 3KXBB 3AZFA 1P3AC 3VH6T 2HIOD 3A6NC 3H0LC 1EQZD 3B0CW 2CWEA 2AROC 4YS3B 1P3FA 5B1MD 3B0BA 3AN2B 5DNMD 3H0MC 3B6GC 5AV8D 2PYOA 5F99C 3W99D 3UT9D 1M18A 5CHLB 2VQRA 3MGRB 1KX5D 3MGSC 4E45A 1BH8A 4QLCC 2Y2PA 3C1BA 1ID3C 3W97D 1P34B 4WJ3C 3AV1C 1P3OA 5AV5B 4JJNB 3AZMB 3LZ1C 5CPJC 5GT0D 5DNNB 2FJ7B 1Q9CA 3KWQA 5GSUD 5B33C 3C1CB 5B2JC 3UTAD 1H3OA 3W96D 1B67A 2Y2OA 3AZKC 2CV5A 1TAFA 3X1UB 2NQBC 1P3PD 2HIOA 4UUZA 1EQZA 4X23B 3AZHB 2BYKA 1HQ3C 5B1MA 4CSRA 5DNMA 4XUJC 3KXBD 1R4VA 4H9SC 5AV8A 3REKD 1BH9B 3W98B 3W99A 3UT9A 3AZIC 4H9NA 1KX5A 4YS3D 5BS7C 5AVBB 1U35B 3KFUG 3B6FC 3AN2D 5GT0A 5B0YD 5E5AC 5GSUA 4EO5C 3W96A 3UTAA 5B31B 4G92C 2J8PA 5B32B 4G91C 3MVDB 3MGRD 3AV2D 1P3PA 1P34D 5AV5D 5AV6C 4JJND 3AZMD 1AOIB 5C3IB 1P3IC 2FJ7D 3NQJB 3C1CD 2NZDC 3LJAB 4J8VB 2Y2QA 4KUDC 3KXBA 3X1UD 4KHAB 5B40C 4H9PA 4R8PC 1M1AC 4M6BA 3REKA 3EPKA 3REJB 4NE3A 4X23D 3AZJB 2HUEC 1KX3C 3B0DC 4YS3A 4DQYB 4Z2MG 4J8UB 1F66C 4DRAA 3AN2A 1P3LC 4H9OB 5B0YA 5BT1C 4ZUXB 2F2AC 3W98D 5CP6B 4XZQC 3AV2A 3LELB 4YM6B 3MGRA 3AZFC 5AVBD 1U35D 1P34A 5AV5A 4JJNA 3RELB 3AZMA 4H9QB 3WTPB 2FJ7A 4Z66B 3C1CA 3O62B 3WA9B 5B24B 5B31D 1P3FC 1KU5A 5B32D 3KUYB 3MVDD 3X1UA 2PYOC 2F8NH 1ZLAB 4X23A 1M18C 1AOID 4DRBA 2ZY5A 2XD1A 3C1BC 3LJAD 3REIB 1P3OC 4J8VD 1P3GB 3W97B 5B2IB 3KWQC 4J8WB 1S32B 4H9RB 1BH9A 3W98A 3REJD 3EG5B 3AZJD 5BO0B 1N1JB 2BG1A 2CV5C 3P5JB 5AVBA 4J8UD 1U35A 2HIOC 1EQZC 4WU8B 1P3KB 5B1LB 4ZUXD 1P3BB 5B31A 5AVCB 5CP6D 3X1SB 5B1MC 5B32A 5DNMC 3MVDA 4YM6D 3LELD 5AV8C 1WWIA 3AZGD 3W99C 3RELD 1F1EA 3UT9C 1AOIA 5JA4B 4Z5TB 3LZ0B 3WTPD 3NQJA 2Y2GA 1Z2CB 3VH5T 4Z66D 3O62D 1KX5C 5B24D 3WA9D 5KDMB 3LJAA 3AFAB 4J8VA 3KUYD 5GT0C 4KHAA 5GSUC 3TU4B 3W96C 3UTAC 1ZLAD 3REJA 3AZJA 4J8XB 1PZRA 1P3PC 3NQUB 4J8UA 3MGPB 3REID 1TZYB 1P3GD 4H9OA 2ZY3A 2ZM5A 5B2ID
chains in the Genus database with same CATH topology
4ZUXA 4J8WD 5GT3B 1S32D 5CP6A 3V9RB 5BNXB 5AV9B 3LELA 4YM6A 2G5HC 3KXBC 4LD9B 4CAYB 3AZGA 2ZY4A 3REKC 3RELA 4H9QA 5CPKB 4WU8D 1P3KD 5B1LD 3WTPA 4AWLB 3UTBB 4Z66A 4YS3C 3O62A 3X1VB 5B24A 1P3BD 3WA9A 5AVCD 3X1SD 3AN2C 3AYWB 3KUYA 5B0YC 1ZLAA 3B0CT 4Z5TD 3LZ0D 5G49B 1B6WA 3H0RC 3AV2C 3MGRC 3WKJB 1WWSA 3REIA 3AFAD 1P34C 5AV5C 4JJNC 3AZMC 1P3GA 3W97A 3AZEB 5B2IA 2FJ7C 4KGCB 4J8WA 3TU4D 3C1CC 1S32A 2YFVB 4H9RA 5BO0A 1N1JA 4J8XD 2IO5B 3X1UC 1P3MB 4UPKA 2W8SA 3MGPD 1ULYA 1TZYD 3X1TB 4X23C 1M19D 4HGAB 4WU8A 1P3KA 5B1LA 5DNND 1JFIB 3MGQB 1P3BA 5GT3D 5AVCA 3X1SA 2BYMB 5AV9D 4WZSB 1HTAA 4LD9D 3W98C 5JA4A 4Z5TA 5CPKD 3LZ0A 3AZHD 3UTBD 3X1VD 2Y2HA 5AVBC 5KDMA 1U35C 3AFAA 5AY8B 3AYWD 4WNNB 4WU9B 5CPIB 3TU4A 1KX4B 5B31C 2DF4C 3AZNB 5B32C 4J8XA 3MVDC 3WKJD 3NQUA 3MGPA 1TZYA 4ZBJB 1AOIC 1M19A 3AZED 3WAAB 5C3IC 5DNNA 4KGCD 3REHB 5GT3A 3LJAC 2XD5A 5GXQB 3V9RA 5BNXA 5AV9A 4J8VC 2DQNC 1P3MD 5BNVB 5B0ZB 4LD9A 4CAYA 3REJC 3X1TD 3AZJC 5CPKA 3AZHA 2RVQD 3MGQD 4E44A 3UTBA 3X1VA 3MNNB 4J8UC 2F8NG 3AZLB 3AYWA 2F8NK 4ZUXC 3VH6A 1EQZB 5CP6C 5G49A 5JRGB 3LELC 4YM6C 3WKJA 3VH5A 3AZGC 5AY8D 3RELC 3R45B 4WU9D 3AZEA 1P3AB 3WTPC 4KGCA 5CPID 1KX4D 4Z66C 3O62C 3A6NB 5B24C 2YFVA 3WA9C 2JE5A 3AZND 3WTPE 3KUYC 2AROB 2Y2LA 1P3MA 1ZLAC 3X1TA 3B6GB 3WAAD 1JFIA 3MGQA 5F99B 3REHD 3REIC 5GXQD 2BYMA 3W97C 3MGSB 1ID3B 4QLCB 5B2IC 5B0ZD 4J8WC 3AV1B 1S32C 5CPJB 3LZ1B 2L5AA 5B33B 5B2JB 3MNND 5AY8A 3AZKB 3AZLD 4WNNA 4WU9A 4WU8C 1P3KC 4H9PB 5B1LC 2NQBB 5CPIA 2FFFB 1P3BC 1KX4A 3REKB 5AVCC 3X1SC 3AZNA 5JRGD 2Y2MA 1HQ3B 4XUJB 3KSYA 4Z5TC 5B0YB 3LZ0C 1P3AD 3WAAA 3EPLA 2ZY2A 3REHA 4NE6A 3A6ND 3AFAC 5GXQA 3AZIB 2F8NB 3AV2B 2AROD 5BNVA 5B0ZA 3TU4C 3B6FB 3B6GD 3AL0C 4NE5A 5E5AB 4J8XC 3FDDA 5F99D 2G5IC 4EO5B 3MNNA 4G92B 1T3UA 3MGPC 1TZYC 5FUGB 3AZLA 4G91B 1M19C 3MGSD 3IP4C 4QLCD 5DNNC 1ID3D 1BFMA 5GT3C 3AV1D 1W2EA 2RIQA 5AV6B 5CPJD 3LZ1D 5AV9C 1P3IB 5JRGA 5B33D 5B2JD 2NZDB 4LD9C 3AZKD 3R45A 4KUDB 5CPKC 5B40B 1P3AA 3AZHC 1M1AB 4AWLC 4R8PB 2NQBD 3EPHA 3UTBC 3X1VC 3A6NA 1M19B 4NFTA 2HUEB 2YFWB 3AYWC 1KX3B 3B0DB 2AROA 1HQ3D 2JSSA 1F66B 1P3LB 3B6GA 4XUJD 5F99A 3EPJA 3WKJC 3AZID 2F8ND 4XZQB 3AZEC 3MGSA 3AZFB 1ID3A 4QLCA 4KGCC 2LY8A 3AV1A 3B6FD 2Y2IA 3F6TA 5CPJA 3LZ1A 5E5AD 5B33A 2Y2JA 2IO5C 5B2JA 1P3MC 1P3FB 3AZKA 3X1TC 4HGAC 4Z2MH 2NQBA 2RVQC 3MGQC 2PYOB 5AV6D 1M18B 1P3ID 2UWXA 1BH8B 2NZDD 3C1BB 1HQ3A 1P3OB 1A7WA 4XUJA 4KUDD 5B40D 4H9SA 1M1AD 4R8PD 3KWQB 1H3OB 3AZIA 2F8NA 5AY8C 1KX3D 2CV5B 3A1IA 4WU9C 1TAFB 4WV4B 5BS7A 5CPIC 1KX4C 3AZGB 1F66D 2HIOB 3B6FA 1P3LD 2JCHA 4UUZB 2Y2KA 3VH6W 3AZNC 2Y2NA 5E5AA 2BYKB 3A1KA 5BT1D 5B1MB 3VH5W 4XZQD 4CSRB 5FUGA 4ZBJC 5DNMB 3WAAC 3AZFD 5AV8B 3REHC 3W99B 5AV6A 3UT9B 5GXQC 4H9NB 1P3IA 1KX5B 2NZDA 5B0ZC 1P3FD 5GT0B 4KUDA 5B40A 1M1AA 4R8PA 5GSUB 2PYOD 3UTAB 3MNNC 3W96B 1M18D 2YFWA 3AZLC 1P3GC 1KX3A 3C1BD 1P3PB 1F66A 1P3OD 1P3LA 5JRGC 3KWQD 5B31G 4XZQA 2CV5D 5B32G 3KXBB 3AZFA 1P3AC 3VH6T 2HIOD 3A6NC 3H0LC 1EQZD 3B0CW 2CWEA 2AROC 4YS3B 1P3FA 5B1MD 3B0BA 3AN2B 5DNMD 3H0MC 3B6GC 5AV8D 2PYOA 5F99C 3W99D 3UT9D 1M18A 5CHLB 2VQRA 3MGRB 1KX5D 3MGSC 4E45A 1BH8A 4QLCC 2Y2PA 3C1BA 1ID3C 3W97D 1P34B 4WJ3C 3AV1C 1P3OA 5AV5B 4JJNB 3AZMB 3LZ1C 5CPJC 5GT0D 5DNNB 2FJ7B 1Q9CA 3KWQA 5GSUD 5B33C 3C1CB 5B2JC 3UTAD 1H3OA 3W96D 1B67A 2Y2OA 3AZKC 2CV5A 1TAFA 3X1UB 2NQBC 1P3PD 2HIOA 4UUZA 1EQZA 4X23B 3AZHB 2BYKA 1HQ3C 5B1MA 4CSRA 5DNMA 4XUJC 3KXBD 1R4VA 4H9SC 5AV8A 3REKD 1BH9B 3W98B 3W99A 3UT9A 3AZIC 4H9NA 1KX5A 4YS3D 5BS7C 5AVBB 1U35B 3KFUG 3B6FC 3AN2D 5GT0A 5B0YD 5E5AC 5GSUA 4EO5C 3W96A 3UTAA 5B31B 4G92C 2J8PA 5B32B 4G91C 3MVDB 3MGRD 3AV2D 1P3PA 1P34D 5AV5D 5AV6C 4JJND 3AZMD 1AOIB 5C3IB 1P3IC 2FJ7D 3NQJB 3C1CD 2NZDC 3LJAB 4J8VB 2Y2QA 4KUDC 3KXBA 3X1UD 4KHAB 5B40C 4H9PA 4R8PC 1M1AC 4M6BA 3REKA 3EPKA 3REJB 4NE3A 4X23D 3AZJB 2HUEC 1KX3C 3B0DC 4YS3A 4DQYB 4Z2MG 4J8UB 1F66C 4DRAA 3AN2A 1P3LC 4H9OB 5B0YA 5BT1C 4ZUXB 2F2AC 3W98D 5CP6B 4XZQC 3AV2A 3LELB 4YM6B 3MGRA 3AZFC 5AVBD 1U35D 1P34A 5AV5A 4JJNA 3RELB 3AZMA 4H9QB 3WTPB 2FJ7A 4Z66B 3C1CA 3O62B 3WA9B 5B24B 5B31D 1P3FC 1KU5A 5B32D 3KUYB 3MVDD 3X1UA 2PYOC 2F8NH 1ZLAB 4X23A 1M18C 1AOID 4DRBA 2ZY5A 2XD1A 3C1BC 3LJAD 3REIB 1P3OC 4J8VD 1P3GB 3W97B 5B2IB 3KWQC 4J8WB 1S32B 4H9RB 1BH9A 3W98A 3REJD 3EG5B 3AZJD 5BO0B 1N1JB 2BG1A 2CV5C 3P5JB 5AVBA 4J8UD 1U35A 2HIOC 1EQZC 4WU8B 1P3KB 5B1LB 4ZUXD 1P3BB 5B31A 5AVCB 5CP6D 3X1SB 5B1MC 5B32A 5DNMC 3MVDA 4YM6D 3LELD 5AV8C 1WWIA 3AZGD 3W99C 3RELD 1F1EA 3UT9C 1AOIA 5JA4B 4Z5TB 3LZ0B 3WTPD 3NQJA 2Y2GA 1Z2CB 3VH5T 4Z66D 3O62D 1KX5C 5B24D 3WA9D 5KDMB 3LJAA 3AFAB 4J8VA 3KUYD 5GT0C 4KHAA 5GSUC 3TU4B 3W96C 3UTAC 1ZLAD 3REJA 3AZJA 4J8XB 1PZRA 1P3PC 3NQUB 4J8UA 3MGPB 3REID 1TZYB 1P3GD 4H9OA 2ZY3A 2ZM5A 5B2ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX A;  4J8W D;  5GT3 B;  1S32 D;  5CP6 A;  3V9R B;  5BNX B;  5AV9 B;  3LEL A;  4YM6 A;  3KXB C;  4LD9 B;  4CAY B;  3AZG A;  3REK C;  3REL A;  4H9Q A;  5CPK B;  4WU8 D;  1P3K D;  5B1L D;  3WTP A;  4AWL B;  3UTB B;  4Z66 A;  4YS3 C;  3O62 A;  3X1V B;  5B24 A;  1P3B D;  3WA9 A;  5AVC D;  3X1S D;  3AN2 C;  3AYW B;  3KUY A;  5B0Y C;  1ZLA A;  3B0C T;  4Z5T D;  3LZ0 D;  5G49 B;  1B6W A;  3AV2 C;  3MGR C;  3WKJ B;  1WWS A;  3REI A;  3AFA D;  1P34 C;  5AV5 C;  4JJN C;  3AZM C;  1P3G A;  3W97 A;  3AZE B;  5B2I A;  2FJ7 C;  4KGC B;  4J8W A;  3TU4 D;  3C1C C;  1S32 A;  2YFV B;  4H9R A;  5BO0 A;  1N1J A;  4J8X D;  2IO5 B;  3X1U C;  1P3M B;  3MGP D;  1ULY A;  1TZY D;  3X1T B;  4X23 C;  1M19 D;  4HGA B;  4WU8 A;  1P3K A;  5B1L A;  5DNN D;  1JFI B;  3MGQ B;  1P3B A;  5GT3 D;  5AVC A;  3X1S A;  2BYM B;  5AV9 D;  4WZS B;  1HTA A;  4LD9 D;  3W98 C;  5JA4 A;  4Z5T A;  5CPK D;  3LZ0 A;  3AZH D;  3UTB D;  3X1V D;  5AVB C;  5KDM A;  1U35 C;  3AFA A;  5AY8 B;  3AYW D;  4WNN B;  4WU9 B;  5CPI B;  3TU4 A;  1KX4 B;  5B31 C;  3AZN B;  5B32 C;  4J8X A;  3MVD C;  3WKJ D;  3NQU A;  3MGP A;  1TZY A;  4ZBJ B;  1AOI C;  1M19 A;  3AZE D;  3WAA B;  5C3I C;  5DNN A;  4KGC D;  3REH B;  5GT3 A;  3LJA C;  5GXQ B;  3V9R A;  5BNX A;  5AV9 A;  4J8V C;  1P3M D;  5BNV B;  5B0Z B;  4LD9 A;  4CAY A;  3REJ C;  3X1T D;  3AZJ C;  5CPK A;  3AZH A;  2RVQ D;  3MGQ D;  4E44 A;  3UTB A;  3X1V A;  3MNN B;  4J8U C;  2F8N G;  3AZL B;  3AYW A;  2F8N K;  4ZUX C;  3VH6 A;  1EQZ B;  5CP6 C;  5G49 A;  5JRG B;  3LEL C;  4YM6 C;  3WKJ A;  3VH5 A;  3AZG C;  5AY8 D;  3REL C;  3R45 B;  4WU9 D;  3AZE A;  1P3A B;  3WTP C;  4KGC A;  5CPI D;  1KX4 D;  4Z66 C;  3O62 C;  3A6N B;  5B24 C;  2YFV A;  3WA9 C;  3AZN D;  3WTP E;  3KUY C;  2ARO B;  1P3M A;  1ZLA C;  3X1T A;  3B6G B;  3WAA D;  1JFI A;  3MGQ A;  5F99 B;  3REH D;  3REI C;  5GXQ D;  2BYM A;  3W97 C;  3MGS B;  1ID3 B;  4QLC B;  5B2I C;  5B0Z D;  4J8W C;  3AV1 B;  1S32 C;  5CPJ B;  3LZ1 B;  2L5A A;  5B33 B;  5B2J B;  3MNN D;  5AY8 A;  3AZK B;  3AZL D;  4WNN A;  4WU9 A;  4WU8 C;  1P3K C;  4H9P B;  5B1L C;  2NQB B;  5CPI A;  1P3B C;  1KX4 A;  3REK B;  5AVC C;  3X1S C;  3AZN A;  5JRG D;  1HQ3 B;  4XUJ B;  3KSY A;  4Z5T C;  5B0Y B;  3LZ0 C;  1P3A D;  3WAA A;  3REH A;  4NE6 A;  3A6N D;  3AFA C;  5GXQ A;  3AZI B;  2F8N B;  3AV2 B;  2ARO D;  5BNV A;  5B0Z A;  3TU4 C;  3B6F B;  3B6G D;  4NE5 A;  5E5A B;  4J8X C;  5F99 D;  4EO5 B;  3MNN A;  4G92 B;  3MGP C;  1TZY C;  5FUG B;  3AZL A;  4G91 B;  1M19 C;  3MGS D;  1ID3 D;  4QLC D;  5DNN C;  1BFM A;  5GT3 C;  3AV1 D;  5AV6 B;  5CPJ D;  3LZ1 D;  5AV9 C;  1P3I B;  5JRG A;  5B33 D;  5B2J D;  2NZD B;  4LD9 C;  3AZK D;  3R45 A;  4KUD B;  5CPK C;  5B40 B;  1P3A A;  3AZH C;  1M1A B;  4AWL C;  4R8P B;  2NQB D;  3UTB C;  3X1V C;  3A6N A;  4NFT A;  2HUE B;  2YFW B;  3AYW C;  1KX3 B;  3B0D B;  2ARO A;  1HQ3 D;  2JSS A;  1F66 B;  1P3L B;  3B6G A;  4XUJ D;  5F99 A;  3WKJ C;  3AZI D;  2F8N D;  4XZQ B;  3AZE C;  3MGS A;  3AZF B;  1ID3 A;  4QLC A;  4KGC C;  2LY8 A;  3AV1 A;  3B6F D;  5CPJ A;  3LZ1 A;  5E5A D;  5B33 A;  2IO5 C;  5B2J A;  1P3M C;  1P3F B;  3AZK A;  3X1T C;  4HGA C;  4Z2M H;  2NQB A;  2RVQ C;  3MGQ C;  2PYO B;  5AV6 D;  1M18 B;  1P3I D;  1BH8 B;  2NZD D;  3C1B B;  1HQ3 A;  1P3O B;  1A7W A;  4XUJ A;  4KUD D;  5B40 D;  4H9S A;  1M1A D;  4R8P D;  3KWQ B;  1H3O B;  3AZI A;  2F8N A;  5AY8 C;  1KX3 D;  2CV5 B;  4WU9 C;  1TAF B;  4WV4 B;  5BS7 A;  5CPI C;  1KX4 C;  3AZG B;  1F66 D;  2HIO B;  3B6F A;  1P3L D;  4UUZ B;  3VH6 W;  3AZN C;  5E5A A;  2BYK B;  5BT1 D;  5B1M B;  3VH5 W;  4XZQ D;  4CSR B;  5FUG A;  4ZBJ C;  5DNM B;  3WAA C;  3AZF D;  5AV8 B;  3REH C;  3W99 B;  5AV6 A;  3UT9 B;  5GXQ C;  4H9N B;  1P3I A;  1KX5 B;  2NZD A;  5B0Z C;  1P3F D;  5GT0 B;  4KUD A;  5B40 A;  1M1A A;  4R8P A;  5GSU B;  2PYO D;  3UTA B;  3MNN C;  3W96 B;  1M18 D;  2YFW A;  3AZL C;  1P3G C;  1KX3 A;  3C1B D;  1P3P B;  1F66 A;  1P3O D;  1P3L A;  5JRG C;  3KWQ D;  5B31 G;  4XZQ A;  2CV5 D;  5B32 G;  3KXB B;  3AZF A;  1P3A C;  3VH6 T;  2HIO D;  3A6N C;  1EQZ D;  3B0C W;  2CWE A;  2ARO C;  4YS3 B;  1P3F A;  5B1M D;  3B0B A;  3AN2 B;  5DNM D;  3B6G C;  5AV8 D;  2PYO A;  5F99 C;  3W99 D;  3UT9 D;  1M18 A;  5CHL B;  1KX5 D;  3MGR B;  3MGS C;  4E45 A;  1BH8 A;  4QLC C;  3C1B A;  1ID3 C;  1P34 B;  3AV1 C;  1P3O A;  5AV5 B;  4JJN B;  3AZM B;  3LZ1 C;  5CPJ C;  5GT0 D;  5DNN B;  2FJ7 B;  1Q9C A;  3KWQ A;  5GSU D;  5B33 C;  3C1C B;  5B2J C;  3UTA D;  1H3O A;  3W96 D;  1B67 A;  3AZK C;  2CV5 A;  1TAF A;  3X1U B;  2NQB C;  1P3P D;  2HIO A;  4UUZ A;  1EQZ A;  4X23 B;  3AZH B;  2BYK A;  1HQ3 C;  5B1M A;  4CSR A;  5DNM A;  4XUJ C;  3KXB D;  1R4V A;  4H9S C;  5AV8 A;  3REK D;  1BH9 B;  3W98 B;  3W99 A;  3UT9 A;  3AZI C;  4H9N A;  1KX5 A;  4YS3 D;  5BS7 C;  5AVB B;  1U35 B;  3B6F C;  3AN2 D;  5GT0 A;  5B0Y D;  5E5A C;  5GSU A;  4EO5 C;  3W96 A;  3UTA A;  5B31 B;  4G92 C;  5B32 B;  4G91 C;  3MVD B;  3MGR D;  3AV2 D;  1P3P A;  1P34 D;  5AV5 D;  5AV6 C;  4JJN D;  3AZM D;  1AOI B;  5C3I B;  1P3I C;  2FJ7 D;  3NQJ B;  3C1C D;  2NZD C;  3LJA B;  4J8V B;  4KUD C;  3KXB A;  3X1U D;  4KHA B;  5B40 C;  4H9P A;  4R8P C;  1M1A C;  4M6B A;  3REK A;  3REJ B;  4NE3 A;  4X23 D;  3AZJ B;  2HUE C;  1KX3 C;  3B0D C;  4YS3 A;  4Z2M G;  4J8U B;  1F66 C;  4DRA A;  3AN2 A;  1P3L C;  4H9O B;  5B0Y A;  5BT1 C;  4ZUX B;  3W98 D;  5CP6 B;  4XZQ C;  3AV2 A;  3LEL B;  4YM6 B;  3MGR A;  3AZF C;  5AVB D;  1U35 D;  1P34 A;  5AV5 A;  4JJN A;  3REL B;  3AZM A;  4H9Q B;  3WTP B;  2FJ7 A;  4Z66 B;  3C1C A;  3O62 B;  3WA9 B;  5B24 B;  5B31 D;  1P3F C;  1KU5 A;  5B32 D;  3KUY B;  3MVD D;  3X1U A;  2PYO C;  2F8N H;  1ZLA B;  4X23 A;  1M18 C;  1AOI D;  4DRB A;  3C1B C;  3LJA D;  3REI B;  1P3O C;  4J8V D;  1P3G B;  3W97 B;  5B2I B;  3KWQ C;  4J8W B;  1S32 B;  4H9R B;  1BH9 A;  3W98 A;  3REJ D;  3AZJ D;  5BO0 B;  1N1J B;  2CV5 C;  5AVB A;  1U35 A;  4J8U D;  2HIO C;  1EQZ C;  4WU8 B;  1P3K B;  5B1L B;  4ZUX D;  1P3B B;  5B31 A;  5AVC B;  5CP6 D;  3X1S B;  5B1M C;  5B32 A;  5DNM C;  3MVD A;  4YM6 D;  3LEL D;  5AV8 C;  1WWI A;  3AZG D;  3W99 C;  3REL D;  1F1E A;  3UT9 C;  1AOI A;  5JA4 B;  4Z5T B;  3LZ0 B;  3WTP D;  3NQJ A;  1KX5 C;  3VH5 T;  4Z66 D;  3O62 D;  3WA9 D;  5B24 D;  5KDM B;  3LJA A;  3AFA B;  4J8V A;  3KUY D;  5GT0 C;  4KHA A;  5GSU C;  3TU4 B;  3W96 C;  3UTA C;  1ZLA D;  3REJ A;  3AZJ A;  4J8X B;  1P3P C;  3NQU B;  4J8U A;  3MGP B;  3REI D;  1TZY B;  1P3G D;  4H9O A;  1M19 B;  3W97 D;  5B2I D; 
#chains in the Genus database with same CATH topology
 4ZUX A;  4J8W D;  5GT3 B;  1S32 D;  5CP6 A;  3V9R B;  5BNX B;  5AV9 B;  3LEL A;  4YM6 A;  2G5H C;  3KXB C;  4LD9 B;  4CAY B;  3AZG A;  2ZY4 A;  3REK C;  3REL A;  4H9Q A;  5CPK B;  4WU8 D;  1P3K D;  5B1L D;  3WTP A;  4AWL B;  3UTB B;  4Z66 A;  4YS3 C;  3O62 A;  3X1V B;  5B24 A;  1P3B D;  3WA9 A;  5AVC D;  3X1S D;  3AN2 C;  3AYW B;  3KUY A;  5B0Y C;  1ZLA A;  3B0C T;  4Z5T D;  3LZ0 D;  5G49 B;  1B6W A;  3H0R C;  3AV2 C;  3MGR C;  3WKJ B;  1WWS A;  3REI A;  3AFA D;  1P34 C;  5AV5 C;  4JJN C;  3AZM C;  1P3G A;  3W97 A;  3AZE B;  5B2I A;  2FJ7 C;  4KGC B;  4J8W A;  3TU4 D;  3C1C C;  1S32 A;  2YFV B;  4H9R A;  5BO0 A;  1N1J A;  4J8X D;  2IO5 B;  3X1U C;  1P3M B;  4UPK A;  2W8S A;  3MGP D;  1ULY A;  1TZY D;  3X1T B;  4X23 C;  1M19 D;  4HGA B;  4WU8 A;  1P3K A;  5B1L A;  5DNN D;  1JFI B;  3MGQ B;  1P3B A;  5GT3 D;  5AVC A;  3X1S A;  2BYM B;  5AV9 D;  4WZS B;  1HTA A;  4LD9 D;  3W98 C;  5JA4 A;  4Z5T A;  5CPK D;  3LZ0 A;  3AZH D;  3UTB D;  3X1V D;  2Y2H A;  5AVB C;  5KDM A;  1U35 C;  3AFA A;  5AY8 B;  3AYW D;  4WNN B;  4WU9 B;  5CPI B;  3TU4 A;  1KX4 B;  5B31 C;  2DF4 C;  3AZN B;  5B32 C;  4J8X A;  3MVD C;  3WKJ D;  3NQU A;  3MGP A;  1TZY A;  4ZBJ B;  1AOI C;  1M19 A;  3AZE D;  3WAA B;  5C3I C;  5DNN A;  4KGC D;  3REH B;  5GT3 A;  3LJA C;  2XD5 A;  5GXQ B;  3V9R A;  5BNX A;  5AV9 A;  4J8V C;  2DQN C;  1P3M D;  5BNV B;  5B0Z B;  4LD9 A;  4CAY A;  3REJ C;  3X1T D;  3AZJ C;  5CPK A;  3AZH A;  2RVQ D;  3MGQ D;  4E44 A;  3UTB A;  3X1V A;  3MNN B;  4J8U C;  2F8N G;  3AZL B;  3AYW A;  2F8N K;  4ZUX C;  3VH6 A;  1EQZ B;  5CP6 C;  5G49 A;  5JRG B;  3LEL C;  4YM6 C;  3WKJ A;  3VH5 A;  3AZG C;  5AY8 D;  3REL C;  3R45 B;  4WU9 D;  3AZE A;  1P3A B;  3WTP C;  4KGC A;  5CPI D;  1KX4 D;  4Z66 C;  3O62 C;  3A6N B;  5B24 C;  2YFV A;  3WA9 C;  2JE5 A;  3AZN D;  3WTP E;  3KUY C;  2ARO B;  2Y2L A;  1P3M A;  1ZLA C;  3X1T A;  3B6G B;  3WAA D;  1JFI A;  3MGQ A;  5F99 B;  3REH D;  3REI C;  5GXQ D;  2BYM A;  3W97 C;  3MGS B;  1ID3 B;  4QLC B;  5B2I C;  5B0Z D;  4J8W C;  3AV1 B;  1S32 C;  5CPJ B;  3LZ1 B;  2L5A A;  5B33 B;  5B2J B;  3MNN D;  5AY8 A;  3AZK B;  3AZL D;  4WNN A;  4WU9 A;  4WU8 C;  1P3K C;  4H9P B;  5B1L C;  2NQB B;  5CPI A;  2FFF B;  1P3B C;  1KX4 A;  3REK B;  5AVC C;  3X1S C;  3AZN A;  5JRG D;  2Y2M A;  1HQ3 B;  4XUJ B;  3KSY A;  4Z5T C;  5B0Y B;  3LZ0 C;  1P3A D;  3WAA A;  3EPL A;  2ZY2 A;  3REH A;  4NE6 A;  3A6N D;  3AFA C;  5GXQ A;  3AZI B;  2F8N B;  3AV2 B;  2ARO D;  5BNV A;  5B0Z A;  3TU4 C;  3B6F B;  3B6G D;  3AL0 C;  4NE5 A;  5E5A B;  4J8X C;  3FDD A;  5F99 D;  2G5I C;  4EO5 B;  3MNN A;  4G92 B;  1T3U A;  3MGP C;  1TZY C;  5FUG B;  3AZL A;  4G91 B;  1M19 C;  3MGS D;  3IP4 C;  4QLC D;  5DNN C;  1ID3 D;  1BFM A;  5GT3 C;  3AV1 D;  1W2E A;  2RIQ A;  5AV6 B;  5CPJ D;  3LZ1 D;  5AV9 C;  1P3I B;  5JRG A;  5B33 D;  5B2J D;  2NZD B;  4LD9 C;  3AZK D;  3R45 A;  4KUD B;  5CPK C;  5B40 B;  1P3A A;  3AZH C;  1M1A B;  4AWL C;  4R8P B;  2NQB D;  3EPH A;  3UTB C;  3X1V C;  3A6N A;  1M19 B;  4NFT A;  2HUE B;  2YFW B;  3AYW C;  1KX3 B;  3B0D B;  2ARO A;  1HQ3 D;  2JSS A;  1F66 B;  1P3L B;  3B6G A;  4XUJ D;  5F99 A;  3EPJ A;  3WKJ C;  3AZI D;  2F8N D;  4XZQ B;  3AZE C;  3MGS A;  3AZF B;  1ID3 A;  4QLC A;  4KGC C;  2LY8 A;  3AV1 A;  3B6F D;  2Y2I A;  3F6T A;  5CPJ A;  3LZ1 A;  5E5A D;  5B33 A;  2Y2J A;  2IO5 C;  5B2J A;  1P3M C;  1P3F B;  3AZK A;  3X1T C;  4HGA C;  4Z2M H;  2NQB A;  2RVQ C;  3MGQ C;  2PYO B;  5AV6 D;  1M18 B;  1P3I D;  2UWX A;  1BH8 B;  2NZD D;  3C1B B;  1HQ3 A;  1P3O B;  1A7W A;  4XUJ A;  4KUD D;  5B40 D;  4H9S A;  1M1A D;  4R8P D;  3KWQ B;  1H3O B;  3AZI A;  2F8N A;  5AY8 C;  1KX3 D;  2CV5 B;  3A1I A;  4WU9 C;  1TAF B;  4WV4 B;  5BS7 A;  5CPI C;  1KX4 C;  3AZG B;  1F66 D;  2HIO B;  3B6F A;  1P3L D;  2JCH A;  4UUZ B;  2Y2K A;  3VH6 W;  3AZN C;  2Y2N A;  5E5A A;  2BYK B;  3A1K A;  5BT1 D;  5B1M B;  3VH5 W;  4XZQ D;  4CSR B;  5FUG A;  4ZBJ C;  5DNM B;  3WAA C;  3AZF D;  5AV8 B;  3REH C;  3W99 B;  5AV6 A;  3UT9 B;  5GXQ C;  4H9N B;  1P3I A;  1KX5 B;  2NZD A;  5B0Z C;  1P3F D;  5GT0 B;  4KUD A;  5B40 A;  1M1A A;  4R8P A;  5GSU B;  2PYO D;  3UTA B;  3MNN C;  3W96 B;  1M18 D;  2YFW A;  3AZL C;  1P3G C;  1KX3 A;  3C1B D;  1P3P B;  1F66 A;  1P3O D;  1P3L A;  5JRG C;  3KWQ D;  5B31 G;  4XZQ A;  2CV5 D;  5B32 G;  3KXB B;  3AZF A;  1P3A C;  3VH6 T;  2HIO D;  3A6N C;  3H0L C;  1EQZ D;  3B0C W;  2CWE A;  2ARO C;  4YS3 B;  1P3F A;  5B1M D;  3B0B A;  3AN2 B;  5DNM D;  3H0M C;  3B6G C;  5AV8 D;  2PYO A;  5F99 C;  3W99 D;  3UT9 D;  1M18 A;  5CHL B;  2VQR A;  3MGR B;  1KX5 D;  3MGS C;  4E45 A;  1BH8 A;  4QLC C;  2Y2P A;  3C1B A;  1ID3 C;  3W97 D;  1P34 B;  4WJ3 C;  3AV1 C;  1P3O A;  5AV5 B;  4JJN B;  3AZM B;  3LZ1 C;  5CPJ C;  5GT0 D;  5DNN B;  2FJ7 B;  1Q9C A;  3KWQ A;  5GSU D;  5B33 C;  3C1C B;  5B2J C;  3UTA D;  1H3O A;  3W96 D;  1B67 A;  2Y2O A;  3AZK C;  2CV5 A;  1TAF A;  3X1U B;  2NQB C;  1P3P D;  2HIO A;  4UUZ A;  1EQZ A;  4X23 B;  3AZH B;  2BYK A;  1HQ3 C;  5B1M A;  4CSR A;  5DNM A;  4XUJ C;  3KXB D;  1R4V A;  4H9S C;  5AV8 A;  3REK D;  1BH9 B;  3W98 B;  3W99 A;  3UT9 A;  3AZI C;  4H9N A;  1KX5 A;  4YS3 D;  5BS7 C;  5AVB B;  1U35 B;  3KFU G;  3B6F C;  3AN2 D;  5GT0 A;  5B0Y D;  5E5A C;  5GSU A;  4EO5 C;  3W96 A;  3UTA A;  5B31 B;  4G92 C;  2J8P A;  5B32 B;  4G91 C;  3MVD B;  3MGR D;  3AV2 D;  1P3P A;  1P34 D;  5AV5 D;  5AV6 C;  4JJN D;  3AZM D;  1AOI B;  5C3I B;  1P3I C;  2FJ7 D;  3NQJ B;  3C1C D;  2NZD C;  3LJA B;  4J8V B;  2Y2Q A;  4KUD C;  3KXB A;  3X1U D;  4KHA B;  5B40 C;  4H9P A;  4R8P C;  1M1A C;  4M6B A;  3REK A;  3EPK A;  3REJ B;  4NE3 A;  4X23 D;  3AZJ B;  2HUE C;  1KX3 C;  3B0D C;  4YS3 A;  4DQY B;  4Z2M G;  4J8U B;  1F66 C;  4DRA A;  3AN2 A;  1P3L C;  4H9O B;  5B0Y A;  5BT1 C;  4ZUX B;  2F2A C;  3W98 D;  5CP6 B;  4XZQ C;  3AV2 A;  3LEL B;  4YM6 B;  3MGR A;  3AZF C;  5AVB D;  1U35 D;  1P34 A;  5AV5 A;  4JJN A;  3REL B;  3AZM A;  4H9Q B;  3WTP B;  2FJ7 A;  4Z66 B;  3C1C A;  3O62 B;  3WA9 B;  5B24 B;  5B31 D;  1P3F C;  1KU5 A;  5B32 D;  3KUY B;  3MVD D;  3X1U A;  2PYO C;  2F8N H;  1ZLA B;  4X23 A;  1M18 C;  1AOI D;  4DRB A;  2ZY5 A;  2XD1 A;  3C1B C;  3LJA D;  3REI B;  1P3O C;  4J8V D;  1P3G B;  3W97 B;  5B2I B;  3KWQ C;  4J8W B;  1S32 B;  4H9R B;  1BH9 A;  3W98 A;  3REJ D;  3EG5 B;  3AZJ D;  5BO0 B;  1N1J B;  2BG1 A;  2CV5 C;  3P5J B;  5AVB A;  4J8U D;  1U35 A;  2HIO C;  1EQZ C;  4WU8 B;  1P3K B;  5B1L B;  4ZUX D;  1P3B B;  5B31 A;  5AVC B;  5CP6 D;  3X1S B;  5B1M C;  5B32 A;  5DNM C;  3MVD A;  4YM6 D;  3LEL D;  5AV8 C;  1WWI A;  3AZG D;  3W99 C;  3REL D;  1F1E A;  3UT9 C;  1AOI A;  5JA4 B;  4Z5T B;  3LZ0 B;  3WTP D;  3NQJ A;  2Y2G A;  1Z2C B;  3VH5 T;  4Z66 D;  3O62 D;  1KX5 C;  5B24 D;  3WA9 D;  5KDM B;  3LJA A;  3AFA B;  4J8V A;  3KUY D;  5GT0 C;  4KHA A;  5GSU C;  3TU4 B;  3W96 C;  3UTA C;  1ZLA D;  3REJ A;  3AZJ A;  4J8X B;  1PZR A;  1P3P C;  3NQU B;  4J8U A;  3MGP B;  3REI D;  1TZY B;  1P3G D;  4H9O A;  2ZY3 A;  2ZM5 A;  5B2I D; 
#chains in the Genus database with same CATH homology
 4ZUX A;  4J8W D;  5GT3 B;  1S32 D;  5CP6 A;  3V9R B;  5BNX B;  5AV9 B;  3LEL A;  4YM6 A;  2G5H C;  3KXB C;  4LD9 B;  4CAY B;  3AZG A;  2ZY4 A;  3REK C;  3REL A;  4H9Q A;  5CPK B;  4WU8 D;  1P3K D;  5B1L D;  3WTP A;  4AWL B;  3UTB B;  4Z66 A;  4YS3 C;  3O62 A;  3X1V B;  5B24 A;  1P3B D;  3WA9 A;  5AVC D;  3X1S D;  3AN2 C;  3AYW B;  3KUY A;  5B0Y C;  1ZLA A;  3B0C T;  4Z5T D;  3LZ0 D;  5G49 B;  1B6W A;  3H0R C;  3AV2 C;  3MGR C;  3WKJ B;  1WWS A;  3REI A;  3AFA D;  1P34 C;  5AV5 C;  4JJN C;  3AZM C;  1P3G A;  3W97 A;  3AZE B;  5B2I A;  2FJ7 C;  4KGC B;  4J8W A;  3TU4 D;  3C1C C;  1S32 A;  2YFV B;  4H9R A;  5BO0 A;  1N1J A;  4J8X D;  2IO5 B;  3X1U C;  1P3M B;  4UPK A;  2W8S A;  3MGP D;  1ULY A;  1TZY D;  3X1T B;  4X23 C;  1M19 D;  4HGA B;  4WU8 A;  1P3K A;  5B1L A;  5DNN D;  1JFI B;  3MGQ B;  1P3B A;  5GT3 D;  5AVC A;  3X1S A;  2BYM B;  5AV9 D;  4WZS B;  1HTA A;  4LD9 D;  3W98 C;  5JA4 A;  4Z5T A;  5CPK D;  3LZ0 A;  3AZH D;  3UTB D;  3X1V D;  2Y2H A;  5AVB C;  5KDM A;  1U35 C;  3AFA A;  5AY8 B;  3AYW D;  4WNN B;  4WU9 B;  5CPI B;  3TU4 A;  1KX4 B;  5B31 C;  2DF4 C;  3AZN B;  5B32 C;  4J8X A;  3MVD C;  3WKJ D;  3NQU A;  3MGP A;  1TZY A;  4ZBJ B;  1AOI C;  1M19 A;  3AZE D;  3WAA B;  5C3I C;  5DNN A;  4KGC D;  3REH B;  5GT3 A;  3LJA C;  2XD5 A;  5GXQ B;  3V9R A;  5BNX A;  5AV9 A;  4J8V C;  2DQN C;  1P3M D;  5BNV B;  5B0Z B;  4LD9 A;  4CAY A;  3REJ C;  3X1T D;  3AZJ C;  5CPK A;  3AZH A;  2RVQ D;  3MGQ D;  4E44 A;  3UTB A;  3X1V A;  3MNN B;  4J8U C;  2F8N G;  3AZL B;  3AYW A;  2F8N K;  4ZUX C;  3VH6 A;  1EQZ B;  5CP6 C;  5G49 A;  5JRG B;  3LEL C;  4YM6 C;  3WKJ A;  3VH5 A;  3AZG C;  5AY8 D;  3REL C;  3R45 B;  4WU9 D;  3AZE A;  1P3A B;  3WTP C;  4KGC A;  5CPI D;  1KX4 D;  4Z66 C;  3O62 C;  3A6N B;  5B24 C;  2YFV A;  3WA9 C;  2JE5 A;  3AZN D;  3WTP E;  3KUY C;  2ARO B;  2Y2L A;  1P3M A;  1ZLA C;  3X1T A;  3B6G B;  3WAA D;  1JFI A;  3MGQ A;  5F99 B;  3REH D;  3REI C;  5GXQ D;  2BYM A;  3W97 C;  3MGS B;  1ID3 B;  4QLC B;  5B2I C;  5B0Z D;  4J8W C;  3AV1 B;  1S32 C;  5CPJ B;  3LZ1 B;  2L5A A;  5B33 B;  5B2J B;  3MNN D;  5AY8 A;  3AZK B;  3AZL D;  4WNN A;  4WU9 A;  4WU8 C;  1P3K C;  4H9P B;  5B1L C;  2NQB B;  5CPI A;  2FFF B;  1P3B C;  1KX4 A;  3REK B;  5AVC C;  3X1S C;  3AZN A;  5JRG D;  2Y2M A;  1HQ3 B;  4XUJ B;  3KSY A;  4Z5T C;  5B0Y B;  3LZ0 C;  1P3A D;  3WAA A;  3EPL A;  2ZY2 A;  3REH A;  4NE6 A;  3A6N D;  3AFA C;  5GXQ A;  3AZI B;  2F8N B;  3AV2 B;  2ARO D;  5BNV A;  5B0Z A;  3TU4 C;  3B6F B;  3B6G D;  3AL0 C;  4NE5 A;  5E5A B;  4J8X C;  3FDD A;  5F99 D;  2G5I C;  4EO5 B;  3MNN A;  4G92 B;  1T3U A;  3MGP C;  1TZY C;  5FUG B;  3AZL A;  4G91 B;  1M19 C;  3MGS D;  3IP4 C;  4QLC D;  5DNN C;  1ID3 D;  1BFM A;  5GT3 C;  3AV1 D;  1W2E A;  2RIQ A;  5AV6 B;  5CPJ D;  3LZ1 D;  5AV9 C;  1P3I B;  5JRG A;  5B33 D;  5B2J D;  2NZD B;  4LD9 C;  3AZK D;  3R45 A;  4KUD B;  5CPK C;  5B40 B;  1P3A A;  3AZH C;  1M1A B;  4AWL C;  4R8P B;  2NQB D;  3EPH A;  3UTB C;  3X1V C;  3A6N A;  1M19 B;  4NFT A;  2HUE B;  2YFW B;  3AYW C;  1KX3 B;  3B0D B;  2ARO A;  1HQ3 D;  2JSS A;  1F66 B;  1P3L B;  3B6G A;  4XUJ D;  5F99 A;  3EPJ A;  3WKJ C;  3AZI D;  2F8N D;  4XZQ B;  3AZE C;  3MGS A;  3AZF B;  1ID3 A;  4QLC A;  4KGC C;  2LY8 A;  3AV1 A;  3B6F D;  2Y2I A;  3F6T A;  5CPJ A;  3LZ1 A;  5E5A D;  5B33 A;  2Y2J A;  2IO5 C;  5B2J A;  1P3M C;  1P3F B;  3AZK A;  3X1T C;  4HGA C;  4Z2M H;  2NQB A;  2RVQ C;  3MGQ C;  2PYO B;  5AV6 D;  1M18 B;  1P3I D;  2UWX A;  1BH8 B;  2NZD D;  3C1B B;  1HQ3 A;  1P3O B;  1A7W A;  4XUJ A;  4KUD D;  5B40 D;  4H9S A;  1M1A D;  4R8P D;  3KWQ B;  1H3O B;  3AZI A;  2F8N A;  5AY8 C;  1KX3 D;  2CV5 B;  3A1I A;  4WU9 C;  1TAF B;  4WV4 B;  5BS7 A;  5CPI C;  1KX4 C;  3AZG B;  1F66 D;  2HIO B;  3B6F A;  1P3L D;  2JCH A;  4UUZ B;  2Y2K A;  3VH6 W;  3AZN C;  2Y2N A;  5E5A A;  2BYK B;  3A1K A;  5BT1 D;  5B1M B;  3VH5 W;  4XZQ D;  4CSR B;  5FUG A;  4ZBJ C;  5DNM B;  3WAA C;  3AZF D;  5AV8 B;  3REH C;  3W99 B;  5AV6 A;  3UT9 B;  5GXQ C;  4H9N B;  1P3I A;  1KX5 B;  2NZD A;  5B0Z C;  1P3F D;  5GT0 B;  4KUD A;  5B40 A;  1M1A A;  4R8P A;  5GSU B;  2PYO D;  3UTA B;  3MNN C;  3W96 B;  1M18 D;  2YFW A;  3AZL C;  1P3G C;  1KX3 A;  3C1B D;  1P3P B;  1F66 A;  1P3O D;  1P3L A;  5JRG C;  3KWQ D;  5B31 G;  4XZQ A;  2CV5 D;  5B32 G;  3KXB B;  3AZF A;  1P3A C;  3VH6 T;  2HIO D;  3A6N C;  3H0L C;  1EQZ D;  3B0C W;  2CWE A;  2ARO C;  4YS3 B;  1P3F A;  5B1M D;  3B0B A;  3AN2 B;  5DNM D;  3H0M C;  3B6G C;  5AV8 D;  2PYO A;  5F99 C;  3W99 D;  3UT9 D;  1M18 A;  5CHL B;  2VQR A;  3MGR B;  1KX5 D;  3MGS C;  4E45 A;  1BH8 A;  4QLC C;  2Y2P A;  3C1B A;  1ID3 C;  3W97 D;  1P34 B;  4WJ3 C;  3AV1 C;  1P3O A;  5AV5 B;  4JJN B;  3AZM B;  3LZ1 C;  5CPJ C;  5GT0 D;  5DNN B;  2FJ7 B;  1Q9C A;  3KWQ A;  5GSU D;  5B33 C;  3C1C B;  5B2J C;  3UTA D;  1H3O A;  3W96 D;  1B67 A;  2Y2O A;  3AZK C;  2CV5 A;  1TAF A;  3X1U B;  2NQB C;  1P3P D;  2HIO A;  4UUZ A;  1EQZ A;  4X23 B;  3AZH B;  2BYK A;  1HQ3 C;  5B1M A;  4CSR A;  5DNM A;  4XUJ C;  3KXB D;  1R4V A;  4H9S C;  5AV8 A;  3REK D;  1BH9 B;  3W98 B;  3W99 A;  3UT9 A;  3AZI C;  4H9N A;  1KX5 A;  4YS3 D;  5BS7 C;  5AVB B;  1U35 B;  3KFU G;  3B6F C;  3AN2 D;  5GT0 A;  5B0Y D;  5E5A C;  5GSU A;  4EO5 C;  3W96 A;  3UTA A;  5B31 B;  4G92 C;  2J8P A;  5B32 B;  4G91 C;  3MVD B;  3MGR D;  3AV2 D;  1P3P A;  1P34 D;  5AV5 D;  5AV6 C;  4JJN D;  3AZM D;  1AOI B;  5C3I B;  1P3I C;  2FJ7 D;  3NQJ B;  3C1C D;  2NZD C;  3LJA B;  4J8V B;  2Y2Q A;  4KUD C;  3KXB A;  3X1U D;  4KHA B;  5B40 C;  4H9P A;  4R8P C;  1M1A C;  4M6B A;  3REK A;  3EPK A;  3REJ B;  4NE3 A;  4X23 D;  3AZJ B;  2HUE C;  1KX3 C;  3B0D C;  4YS3 A;  4DQY B;  4Z2M G;  4J8U B;  1F66 C;  4DRA A;  3AN2 A;  1P3L C;  4H9O B;  5B0Y A;  5BT1 C;  4ZUX B;  2F2A C;  3W98 D;  5CP6 B;  4XZQ C;  3AV2 A;  3LEL B;  4YM6 B;  3MGR A;  3AZF C;  5AVB D;  1U35 D;  1P34 A;  5AV5 A;  4JJN A;  3REL B;  3AZM A;  4H9Q B;  3WTP B;  2FJ7 A;  4Z66 B;  3C1C A;  3O62 B;  3WA9 B;  5B24 B;  5B31 D;  1P3F C;  1KU5 A;  5B32 D;  3KUY B;  3MVD D;  3X1U A;  2PYO C;  2F8N H;  1ZLA B;  4X23 A;  1M18 C;  1AOI D;  4DRB A;  2ZY5 A;  2XD1 A;  3C1B C;  3LJA D;  3REI B;  1P3O C;  4J8V D;  1P3G B;  3W97 B;  5B2I B;  3KWQ C;  4J8W B;  1S32 B;  4H9R B;  1BH9 A;  3W98 A;  3REJ D;  3EG5 B;  3AZJ D;  5BO0 B;  1N1J B;  2BG1 A;  2CV5 C;  3P5J B;  5AVB A;  4J8U D;  1U35 A;  2HIO C;  1EQZ C;  4WU8 B;  1P3K B;  5B1L B;  4ZUX D;  1P3B B;  5B31 A;  5AVC B;  5CP6 D;  3X1S B;  5B1M C;  5B32 A;  5DNM C;  3MVD A;  4YM6 D;  3LEL D;  5AV8 C;  1WWI A;  3AZG D;  3W99 C;  3REL D;  1F1E A;  3UT9 C;  1AOI A;  5JA4 B;  4Z5T B;  3LZ0 B;  3WTP D;  3NQJ A;  2Y2G A;  1Z2C B;  3VH5 T;  4Z66 D;  3O62 D;  1KX5 C;  5B24 D;  3WA9 D;  5KDM B;  3LJA A;  3AFA B;  4J8V A;  3KUY D;  5GT0 C;  4KHA A;  5GSU C;  3TU4 B;  3W96 C;  3UTA C;  1ZLA D;  3REJ A;  3AZJ A;  4J8X B;  1PZR A;  1P3P C;  3NQU B;  4J8U A;  3MGP B;  3REI D;  1TZY B;  1P3G D;  4H9O A;  2ZY3 A;  2ZM5 A;  5B2I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...