3MGRC

Binding of rubidium ions to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgrC00
5B40C 5JA4B 3VH5T 3WTPB 5B24C 5FUGA 5F99C 3MVDD 1P34B 4Z5TA 4J8WD 1HQ3C 5AVCB 4JJNC 4Z2MH 1F66B 1P3BA 5GT3B 3REHC 5B40B 3REKB 5B32D 5B24B 5B31G 5AY8D 4H9NB 3UT9D 1P3KC 1ZLAD 3C1CA 1P3FD 5AVBA 1HQ3B 4H9SA 3REJA 4JJNB 1P3AA 1AOIA 4ZBJC 3REHB 1WWSA 3AZJD 5B1MC 4KGCD 5GT0D 5CP6C 3X1SB 3KWQC 1P3KB 3W97C 5B1LA 1KX3C 3VH5A 2PYOC 3MGSD 1TZYD 4WNNA 4ZBJB 3VH5W 1TAFB 3UTBD 3AV1A 4NE6A 3AYWD 5CP6B 3LZ1D 3AN2D 3KWQB 2NZDA 4WU8D 3MVDC 3W97B 4XUJA 4R8PA 1KX3B 2YFWA 3WTPE 2PYOB 2FJ7C 1ID3D 4YS3A 3AZHC 3WTPA 5C3IC 3W96D 3MVDB 3VH6T 3UT9C 1ZLAC 2NQBD 5DNMA 2F8NG 2FJ7B 4E44A 4J8UB 3KXBC 3AZHB 3UTAA 5F99A 1KX5C 5C3IB 1P3IA 3AZJC 5E5AC 5DNNC 3A6NA 4KUDA 3KXBB 3REHA 3R45A 3V9RB 5AV5D 1P3MA 1KX5B 4M6BA 5E5AB 5DNNB 4G91C 3LZ0A 5CPKD 1P3PC 3VH6A 5B1MA 3MGPD 4QLCD 5CP6A 1ULYA 1ID3C 2IO5C 3VH6W 4XUJD 3KWQA 3NQJA 1JFIB 3LELA 4G91B 1P3PB 3B6GB 3W96C 1KX4A 5GSUD 1KX3A 3AZMA 3WTPD 3AZED 1P34D 3AZIA 3B6FA 2NQBC 5JRGB 5AVCD 5CPID 1F66D 2F8NH 4Z66B 3MVDA 5GT3D 4WU9B 5B40D 4J8WA 2LY8A 3REKD 1Q9CA 5B24D 2NQBB 1HQ3D 3MNNC 5AV5C 4JJND 3KUYC 5B32A 5AY8A 3UT9A 1ZLAA 4DRBA 1P3FA 5CPKC 2HUEC 3X1SD 1P3KD 3V9RA 4KHAA 3MNNB 1KX5A 3AZJA 5E5AA 5B32G 4UUZB 3KUYB 3MGPC 4QLCC 5GT0A 4KGCA 3AZNB 5CPKB 5CP6D 2HUEB 1P3LB 3MGSA 1TZYA 3AZEC 3W97D 5KDMA 1BH8B 3W99D 3UTBA 3WA9C 3MGPB 2PYOD 3LZ1A 4H9RB 1P3PA 3AN2A 4H9QA 5CPIC 3AV2C 2CWEA 3REIC 3REKC 1P3OD 3AZEB 3AZFC 1ID3A 2HIOC 5B2JC 3WA9B 4ZUXC 2FJ7D 4J8UD 1H3OB 3W96A 5BO0B 1N1JB 3AV2B 2RVQC 3AZHD 5CPIB 3MGRB 3REIB 2NQBA 3AZFB 2HIOB 3X1SC 5B2JB 4ZUXB 3KXBD 2CV5C 4CAYA 2F8NB 1KX5D 4H9PA 5E5AD 5DNND 3LJAD 3RELC 1KU5A 5AV5A 3X1TC 3W98C 5B33C 4YM6C 3W99C 2CV5B 5BNXB 5CPKA 3RELB 1P3PD 3B6GD 3X1TB 1P3OC 3W98B 3MGPA 4QLCA 5B33B 3WKJC 4YM6B 3W99B 5CPJC 5JRGD 4J8UC 5GSUA 3AZLB 5JA4A 4WZSB 4Z66D 3AZEA 1P34A 4J8XC 4WU9D 3WA9A 1P3OB 3WKJB 3TU4C 5CPJB 1BH9B 5AVCA 5B0YC 5CPIA 1F66A 5GT3A 5B40A 3REIA 3REKA 5B24A 3AZFA 4J8XB 4H9NA 3LJAC 1HQ3A 5AV6D 3TU4B 4JJNA 5B0YB 3MNND 5B31D 3X1VC 3KUYD 5B0ZB 3NQUB 2AROC 2L5AA 3X1SA 5BNVB 1P3KA 3AZND 3LJAB 3B6GC 4X23D 5BNXA 1P3LD 1P3GB 1TAFA 3X1VB 5JRGC 2AROB 4Z66C 4E45A 3W98A 3W97A 4WU9C 3W99A 3AFAC 2PYOA 2BYMB 1M1AD 3WA9D 1M18C 3AV2D 5G49B 1P3OA 4NE3A 4CSRB 3AFAB 5CPJA 3MGRD 3REID 3AZKB 5AV6C 5BT1C 1B6WA 4J8UA 3AZFD 1U35B 2FJ7A 2HIOD 4AWLB 5B2JD 3AZHA 1M18B 5B31C 4ZUXD 2RVQD 2F8ND 5AV9B 3AZGD 1P3BC 2BYKB 3AZNC 1S32B 5B0YA 5AV6B 4X23C 3KXBA 4LD9D 5FUGB 1P3LC 4Z5TB 5B31B 5AVBC 5DNNA 3REJC 4H9SC 2CV5D 3LJAA 1P3AC 1P3BB 1HTAA 3RELD 4X23B 4Z2MG 3X1TD 3X1VA 3W98D 5B33D 4YM6D 3C1CB 5AVBB 1M1AC 3REJB 1JFIA 5B1LC 1P3AB 3B6GA 1AOIB 3AZLD 3MGRC 5JRGA 3WKJD 5CPJD 1M1AB 4Z66A 5B1LB 4R8PC 1EQZC 4EO5B 4WU9A 4WNNB 4NE5A 3AZGC 4J8XD 2F8NK 4H9OB 2NZDB 5B2IC 4LD9C 3TU4D 5B0YD 3B0BA 4R8PB 3X1UD 2YFVB 1EQZB 2YFWB 2BYKA 5B0ZD 5AV6A 3MGQD 3AZGB 4YS3B 3UTAC 1M19D 1P3IC 5B2IB 3MNNA 5B31A 4LD9B 3O62D 5CHLB 4UUZA 3KUYA 3A6NC 5DNMB 5GXQC 1P3GD 3AZNA 3WAAD 4KUDC 5AV8D 4J8VD 3X1VD 4X23A 2AROD 3UTAB 3AZLC 1P3MC 5F99B 1B67A 1P3LA 1P3IB 3C1BD 1BH8A 3LZ0C 1R4VA 3A6NB 4H9RA 5GXQB 4KUDB 3R45B 1P3MB 3LELC 3LZ0B 3AFAD 1M1AA 3AZKD 1KX4C 1U35D 3B0CW 1H3OA 4XZQC 5BO0A 1N1JA 3AZMC 3AV2A 1M18D 3X1UC 3AZIC 3B6FC 5BS7C 5B1MB 3MGRA 5B0ZC 3MGQC 4H9OA 5AV9D 1WWIA 2HIOA 3NQJB 3LELB 5B2JA 1M19C 1S32D 4DRAA 1KX4B 5BT1D 4ZUXA 3O62C 4J8WC 2YFVA 4XZQB 3AZMB 1EQZA 2F8NA 3X1UB 3KSYA 3AZIB 4Z5TD 3AZGA 3B6FB 3WAAC 1P3GC 5AV8C 4J8VC 3MGQB 5B2IA 1M19B 4LD9A 5B32C 1P3BD 5AY8C 3C1BC 3O62B 4J8WB 1P3FC 2CV5A 3C1CD 3WAAB 5AVBD 3REJD 5AV8B 4J8VB 3RELA 1P3AD 4KGCC 5B32B 5GT0C 1AOID 3X1TA 5AY8B 3UT9B 1ZLAB 5B33A 3C1BB 4YM6A 1P3FB 3B0DC 5GXQA 3AZKC 1U35C 4AWLC 4KHAB 3MGSC 1TZYC 3AZLA 4HGAC 4NFTA 5B1LD 3AZJB 3UTBC 4KGCB 3AYWC 5GT0B 3LZ1C 4G92C 3AN2C 5AV9C 3WKJA 3B0DB 1BH9A 3AV1D 4WU8C 1S32C 2NZDD 3MGSB 1TZYB 4HGAB 5KDMB 4Z5TC 4R8PD 3UTBB 4J8XA 1EQZD 3AYWB 3LZ1B 4G92B 1A7WA 3AN2B 4H9QB 4YS3D 3TU4A 4XZQA 4WU8B 3X1UA 5B2ID 5BS7A 1ID3B 5B0ZA 3MGQA 2IO5B 3NQUA 3C1CC 1M19A 5BNVA 5DNMD 3W96B 3O62A 1AOIC 3UTAD 5F99D 1F1EA 1P3ID 1P3GA 3WAAA 5AV8A 4J8VA 3A6ND 2AROA 5GXQD 4KUDD 2JSSA 3REHD 4CAYB 4EO5C 3C1BA 1P3MD 2BYMA 4H9PB 3AV1C 3LZ0D 2NZDC 5AV5B 5G49A 4XUJC 4CSRA 3AFAA 5B1MD 1BFMA 3AZKA 4YS3C 5GSUC 1U35A 3KWQD 3AV1B 3LELD 3WTPC 1M18A 1P34C 1KX4D 1KX3D 4XZQD 3AYWA 3AZMD 4QLCB 4XUJB 4WV4B 5AV9A 5AVCC 3AZID 1F66C 5DNMC 3B6FD 1S32A 4WU8A 5GT3C 3B0CT 5GSUB
chains in the Genus database with same CATH superfamily
5B40C 5JA4B 3VH5T 3WTPB 5B24C 5FUGA 5F99C 3MVDD 1P34B 4Z5TA 4J8WD 1HQ3C 5AVCB 4JJNC 4Z2MH 1F66B 1P3BA 5GT3B 2BG1A 2Y2OA 3REHC 5B40B 3REKB 5B32D 5B24B 5B31G 5AY8D 4H9NB 3UT9D 1P3KC 1ZLAD 3C1CA 1P3FD 5AVBA 1HQ3B 4H9SA 3REJA 4JJNB 1P3AA 1AOIA 4ZBJC 3REHB 1WWSA 3AZJD 5B1MC 4KGCD 3A1IA 5CP6C 5GT0D 3X1SB 3KWQC 1P3KB 3W97C 5B1LA 1KX3C 3VH5A 2PYOC 3MGSD 1TZYD 4WNNA 4ZBJB 3VH5W 1TAFB 3UTBD 3AV1A 4NE6A 3AYWD 5CP6B 3LZ1D 3AN2D 3KWQB 2NZDA 4WU8D 3MVDC 3W97B 4XUJA 4R8PA 1KX3B 2YFWA 3WTPE 2PYOB 2FJ7C 1ID3D 4YS3A 3AZHC 3WTPA 5C3IC 3W96D 3MVDB 3VH6T 3UT9C 1ZLAC 2NQBD 5DNMA 2F8NG 2FJ7B 4E44A 4J8UB 3EPHA 3KXBC 3AZHB 3UTAA 2Y2MA 5F99A 1KX5C 5C3IB 1P3IA 3AZJC 5E5AC 5DNNC 3A6NA 4KUDA 3KXBB 3REHA 2JE5A 3R45A 3V9RB 5AV5D 1P3MA 1KX5B 4M6BA 5E5AB 5DNNB 4G91C 3LZ0A 5CPKD 1P3PC 3EG5B 3VH6A 5B1MA 3MGPD 4QLCD 5CP6A 1ULYA 1ID3C 2IO5C 2G5IC 3VH6W 4XUJD 3KWQA 3NQJA 1JFIB 3LELA 4G91B 1P3PB 3B6GB 3W96C 1KX4A 5GSUD 1KX3A 3AZMA 3WTPD 3AZED 1P34D 3AZIA 3B6FA 2NQBC 2ZY5A 5JRGB 5AVCD 5CPID 1F66D 2F8NH 4Z66B 3MVDA 5GT3D 4WU9B 5B40D 4J8WA 2LY8A 3REKD 1Q9CA 5B24D 2NQBB 1HQ3D 3MNNC 5AV5C 4JJND 3KUYC 5B32A 5AY8A 3UT9A 1ZLAA 4DRBA 1P3FA 5CPKC 1Z2CB 2HUEC 3X1SD 1P3KD 2DQNC 3V9RA 4KHAA 3MNNB 1KX5A 3AZJA 5E5AA 5B32G 4UUZB 3KUYB 3MGPC 4QLCC 5GT0A 4KGCA 3AZNB 5CPKB 5CP6D 2HUEB 1P3LB 3MGSA 1TZYA 3AZEC 3W97D 5KDMA 1BH8B 3W99D 3UTBA 3WA9C 3MGPB 2PYOD 3LZ1A 4H9RB 1P3PA 3AN2A 4H9QA 5CPIC 3AV2C 2CWEA 3F6TA 1PZRA 3REIC 3REKC 1P3OD 3AZEB 3AZFC 1ID3A 2HIOC 5B2JC 3WA9B 4ZUXC 2FJ7D 4J8UD 1H3OB 3W96A 5BO0B 1N1JB 3AV2B 2RVQC 3AZHD 5CPIB 3MGRB 3REIB 2NQBA 3AZFB 2HIOB 3X1SC 5B2JB 4ZUXB 3KXBD 2CV5C 4CAYA 2F8NB 1KX5D 4H9PA 5E5AD 5DNND 3LJAD 3RELC 1KU5A 5AV5A 3X1TC 3W98C 5B33C 4YM6C 3W99C 2CV5B 5BNXB 5CPKA 3RELB 1P3PD 2Y2NA 3B6GD 3X1TB 1P3OC 3W98B 3MGPA 4QLCA 5B33B 3WKJC 4YM6B 3W99B 5CPJC 5JRGD 4J8UC 4UPKA 5GSUA 3AZLB 5JA4A 4WZSB 4Z66D 3AZEA 1P34A 4J8XC 4WU9D 3WA9A 1P3OB 3WKJB 3TU4C 5CPJB 1BH9B 5AVCA 5B0YC 2XD5A 5CPIA 1F66A 5GT3A 5B40A 3REIA 3REKA 5B24A 3AZFA 4J8XB 4H9NA 1W2EA 3LJAC 3EPJA 1HQ3A 5AV6D 3TU4B 4JJNA 5B0YB 2J8PA 3MNND 5B31D 3X1VC 3KUYD 2F2AC 5B0ZB 3NQUB 2AROC 2L5AA 3X1SA 5BNVB 1P3KA 3AZND 2Y2IA 3LJAB 3B6GC 4X23D 5BNXA 2Y2JA 1P3LD 1P3GB 1TAFA 3X1VB 5JRGC 2AROB 2Y2PA 4Z66C 4E45A 3W98A 3W97A 4WU9C 3W99A 3AFAC 2Y2QA 2ZY4A 3A1KA 2BYMB 2PYOA 1M1AD 3WA9D 1M18C 3AV2D 5G49B 2VQRA 1P3OA 2FFFB 4NE3A 4CSRB 3AFAB 5CPJA 3MGRD 3REID 3AZKB 5AV6C 5BT1C 1B6WA 4J8UA 3AZFD 1U35B 2FJ7A 2HIOD 4AWLB 5B2JD 3AZHA 1M18B 5B31C 4ZUXD 2RVQD 2F8ND 5AV9B 3AZGD 1P3BC 2BYKB 3AZNC 1S32B 5B0YA 4WJ3C 5AV6B 4X23C 3KXBA 4LD9D 5FUGB 1P3LC 4Z5TB 5B31B 5AVBC 5DNNA 3REJC 4H9SC 2CV5D 3LJAA 2JCHA 1P3AC 1P3BB 1HTAA 3RELD 4X23B 4Z2MG 3X1TD 3X1VA 3W98D 2XD1A 5B33D 4YM6D 3C1CB 5AVBB 1M1AC 3REJB 1JFIA 5B1LC 1P3AB 3B6GA 1AOIB 3AZLD 3MGRC 5JRGA 3WKJD 5CPJD 1M1AB 2Y2KA 4Z66A 5B1LB 4R8PC 1EQZC 4EO5B 4WU9A 4WNNB 4NE5A 3AZGC 4J8XD 2F8NK 4H9OB 2NZDB 5B2IC 4LD9C 3TU4D 5B0YD 3B0BA 4R8PB 3X1UD 2YFVB 1EQZB 2YFWB 2BYKA 5B0ZD 5AV6A 3MGQD 3AZGB 4YS3B 3UTAC 1M19D 1P3IC 5B2IB 3MNNA 5B31A 4LD9B 3O62D 5CHLB 4UUZA 3KUYA 3A6NC 5DNMB 5GXQC 1P3GD 3AZNA 3WAAD 3P5JB 4KUDC 3KFUG 5AV8D 4J8VD 3X1VD 4X23A 2AROD 3UTAB 3AZLC 1P3MC 5F99B 1B67A 1P3LA 1P3IB 3C1BD 1BH8A 3LZ0C 1R4VA 3A6NB 4H9RA 2ZY2A 5GXQB 4KUDB 3R45B 1P3MB 3LELC 3LZ0B 3AFAD 1M1AA 3H0MC 3AZKD 1KX4C 1U35D 3B0CW 1H3OA 4XZQC 5BO0A 1N1JA 3AZMC 3AV2A 1M18D 3X1UC 3AZIC 3B6FC 5BS7C 5B1MB 3MGRA 5B0ZC 3MGQC 4H9OA 2Y2LA 5AV9D 1WWIA 2HIOA 3NQJB 3LELB 5B2JA 1M19C 1S32D 4DRAA 1KX4B 5BT1D 4ZUXA 3O62C 4J8WC 2YFVA 4XZQB 3AZMB 1EQZA 3AL0C 2Y2HA 2F8NA 3X1UB 3KSYA 3AZIB 4Z5TD 3AZGA 3B6FB 3WAAC 1P3GC 5AV8C 4J8VC 3MGQB 5B2IA 1M19B 4LD9A 5B32C 1P3BD 5AY8C 3C1BC 3O62B 4J8WB 1P3FC 2CV5A 2UWXA 3C1CD 3WAAB 5AVBD 3REJD 5AV8B 4J8VB 3RELA 1P3AD 4KGCC 5B32B 5GT0C 1AOID 2G5HC 3X1TA 5AY8B 3UT9B 1ZLAB 5B33A 3C1BB 4YM6A 1P3FB 3B0DC 5GXQA 3AZKC 1U35C 4AWLC 3H0RC 4KHAB 1TZYC 3MGSC 3AZLA 4HGAC 4NFTA 5B1LD 3AZJB 3UTBC 4KGCB 3AYWC 5GT0B 3LZ1C 3EPKA 4G92C 3AN2C 5AV9C 3WKJA 3B0DB 1BH9A 3AV1D 4WU8C 1S32C 1T3UA 2NZDD 2RIQA 3MGSB 1TZYB 2ZY3A 4HGAB 5KDMB 4Z5TC 4R8PD 3UTBB 4J8XA 1EQZD 3AYWB 3LZ1B 4G92B 1A7WA 3AN2B 4H9QB 4YS3D 3TU4A 4XZQA 4WU8B 3X1UA 5B2ID 5BS7A 1ID3B 5B0ZA 3MGQA 2IO5B 3NQUA 3EPLA 3C1CC 1M19A 5BNVA 5DNMD 3IP4C 3W96B 3O62A 1AOIC 3UTAD 5F99D 1F1EA 1P3ID 1P3GA 3WAAA 5AV8A 2ZM5A 3A6ND 4J8VA 2AROA 5GXQD 4KUDD 2JSSA 4DQYB 3REHD 4CAYB 4EO5C 3C1BA 1P3MD 2BYMA 4H9PB 3H0LC 3AV1C 3LZ0D 2NZDC 5AV5B 5G49A 4XUJC 4CSRA 3AFAA 5B1MD 1BFMA 3AZKA 4YS3C 5GSUC 1U35A 2DF4C 3KWQD 3AV1B 3LELD 3FDDA 3WTPC 1M18A 1P34C 1KX4D 1KX3D 4XZQD 3AYWA 3AZMD 2W8SA 4QLCB 4XUJB 4WV4B 5AV9A 5AVCC 3AZID 1F66C 2Y2GA 5DNMC 3B6FD 1S32A 4WU8A 5GT3C 3B0CT 5GSUB
chains in the Genus database with same CATH topology
5B40C 5JA4B 3VH5T 3WTPB 5B24C 5FUGA 5F99C 3MVDD 1P34B 4Z5TA 4J8WD 1HQ3C 5AVCB 4JJNC 4Z2MH 1F66B 1P3BA 5GT3B 2BG1A 2Y2OA 3REHC 5B40B 3REKB 5B32D 5B24B 5B31G 5AY8D 4H9NB 3UT9D 1P3KC 1ZLAD 3C1CA 1P3FD 5AVBA 1HQ3B 4H9SA 3REJA 4JJNB 1P3AA 1AOIA 4ZBJC 3REHB 1WWSA 3AZJD 5B1MC 4KGCD 3A1IA 5CP6C 5GT0D 3X1SB 3KWQC 1P3KB 3W97C 5B1LA 1KX3C 3VH5A 2PYOC 3MGSD 1TZYD 4WNNA 4ZBJB 3VH5W 1TAFB 3UTBD 3AV1A 4NE6A 3AYWD 5CP6B 3LZ1D 3AN2D 3KWQB 2NZDA 4WU8D 3MVDC 3W97B 4XUJA 4R8PA 1KX3B 2YFWA 3WTPE 2PYOB 2FJ7C 1ID3D 4YS3A 3AZHC 3WTPA 5C3IC 3W96D 3MVDB 3VH6T 3UT9C 1ZLAC 2NQBD 5DNMA 2F8NG 2FJ7B 4E44A 4J8UB 3EPHA 3KXBC 3AZHB 3UTAA 2Y2MA 5F99A 1KX5C 5C3IB 1P3IA 3AZJC 5E5AC 5DNNC 3A6NA 4KUDA 3KXBB 3REHA 2JE5A 3R45A 3V9RB 5AV5D 1P3MA 1KX5B 4M6BA 5E5AB 5DNNB 4G91C 3LZ0A 5CPKD 1P3PC 3EG5B 3VH6A 5B1MA 3MGPD 4QLCD 5CP6A 1ULYA 1ID3C 2IO5C 2G5IC 3VH6W 4XUJD 3KWQA 3NQJA 1JFIB 3LELA 4G91B 1P3PB 3B6GB 3W96C 1KX4A 5GSUD 1KX3A 3AZMA 3WTPD 3AZED 1P34D 3AZIA 3B6FA 2NQBC 2ZY5A 5JRGB 5AVCD 5CPID 1F66D 2F8NH 4Z66B 3MVDA 5GT3D 4WU9B 5B40D 4J8WA 2LY8A 3REKD 1Q9CA 5B24D 2NQBB 1HQ3D 3MNNC 5AV5C 4JJND 3KUYC 5B32A 5AY8A 3UT9A 1ZLAA 4DRBA 1P3FA 5CPKC 1Z2CB 2HUEC 3X1SD 1P3KD 2DQNC 3V9RA 4KHAA 3MNNB 1KX5A 3AZJA 5E5AA 5B32G 4UUZB 3KUYB 3MGPC 4QLCC 5GT0A 4KGCA 3AZNB 5CPKB 5CP6D 2HUEB 1P3LB 3MGSA 1TZYA 3AZEC 3W97D 5KDMA 1BH8B 3W99D 3UTBA 3WA9C 3MGPB 2PYOD 3LZ1A 4H9RB 1P3PA 3AN2A 4H9QA 5CPIC 3AV2C 2CWEA 3F6TA 1PZRA 3REIC 3REKC 1P3OD 3AZEB 3AZFC 1ID3A 2HIOC 5B2JC 3WA9B 4ZUXC 2FJ7D 4J8UD 1H3OB 3W96A 5BO0B 1N1JB 3AV2B 2RVQC 3AZHD 5CPIB 3MGRB 3REIB 2NQBA 3AZFB 2HIOB 3X1SC 5B2JB 4ZUXB 3KXBD 2CV5C 4CAYA 2F8NB 1KX5D 4H9PA 5E5AD 5DNND 3LJAD 3RELC 1KU5A 5AV5A 3X1TC 3W98C 5B33C 4YM6C 3W99C 2CV5B 5BNXB 5CPKA 3RELB 1P3PD 2Y2NA 3B6GD 3X1TB 1P3OC 3W98B 3MGPA 4QLCA 5B33B 3WKJC 4YM6B 3W99B 5CPJC 5JRGD 4J8UC 4UPKA 5GSUA 3AZLB 5JA4A 4WZSB 4Z66D 3AZEA 1P34A 4J8XC 4WU9D 3WA9A 1P3OB 3WKJB 3TU4C 5CPJB 1BH9B 5AVCA 5B0YC 2XD5A 5CPIA 1F66A 5GT3A 5B40A 3REIA 3REKA 5B24A 3AZFA 4J8XB 4H9NA 1W2EA 3LJAC 3EPJA 1HQ3A 5AV6D 3TU4B 4JJNA 5B0YB 2J8PA 3MNND 5B31D 3X1VC 3KUYD 2F2AC 5B0ZB 3NQUB 2AROC 2L5AA 3X1SA 5BNVB 1P3KA 3AZND 2Y2IA 3LJAB 3B6GC 4X23D 5BNXA 2Y2JA 1P3LD 1P3GB 1TAFA 3X1VB 5JRGC 2AROB 2Y2PA 4Z66C 4E45A 3W98A 3W97A 4WU9C 3W99A 3AFAC 2Y2QA 2ZY4A 3A1KA 2BYMB 2PYOA 1M1AD 3WA9D 1M18C 3AV2D 5G49B 2VQRA 1P3OA 2FFFB 4NE3A 4CSRB 3AFAB 5CPJA 3MGRD 3REID 3AZKB 5AV6C 5BT1C 1B6WA 4J8UA 3AZFD 1U35B 2FJ7A 2HIOD 4AWLB 5B2JD 3AZHA 1M18B 5B31C 4ZUXD 2RVQD 2F8ND 5AV9B 3AZGD 1P3BC 2BYKB 3AZNC 1S32B 5B0YA 4WJ3C 5AV6B 4X23C 3KXBA 4LD9D 5FUGB 1P3LC 4Z5TB 5B31B 5AVBC 5DNNA 3REJC 4H9SC 2CV5D 3LJAA 2JCHA 1P3AC 1P3BB 1HTAA 3RELD 4X23B 4Z2MG 3X1TD 3X1VA 3W98D 2XD1A 5B33D 4YM6D 3C1CB 5AVBB 1M1AC 3REJB 1JFIA 5B1LC 1P3AB 3B6GA 1AOIB 3AZLD 3MGRC 5JRGA 3WKJD 5CPJD 1M1AB 2Y2KA 4Z66A 5B1LB 4R8PC 1EQZC 4EO5B 4WU9A 4WNNB 4NE5A 3AZGC 4J8XD 2F8NK 4H9OB 2NZDB 5B2IC 4LD9C 3TU4D 5B0YD 3B0BA 4R8PB 3X1UD 2YFVB 1EQZB 2YFWB 2BYKA 5B0ZD 5AV6A 3MGQD 3AZGB 4YS3B 3UTAC 1M19D 1P3IC 5B2IB 3MNNA 5B31A 4LD9B 3O62D 5CHLB 4UUZA 3KUYA 3A6NC 5DNMB 5GXQC 1P3GD 3AZNA 3WAAD 3P5JB 4KUDC 3KFUG 5AV8D 4J8VD 3X1VD 4X23A 2AROD 3UTAB 3AZLC 1P3MC 5F99B 1B67A 1P3LA 1P3IB 3C1BD 1BH8A 3LZ0C 1R4VA 3A6NB 4H9RA 2ZY2A 5GXQB 4KUDB 3R45B 1P3MB 3LELC 3LZ0B 3AFAD 1M1AA 3H0MC 3AZKD 1KX4C 1U35D 3B0CW 1H3OA 4XZQC 5BO0A 1N1JA 3AZMC 3AV2A 1M18D 3X1UC 3AZIC 3B6FC 5BS7C 5B1MB 3MGRA 5B0ZC 3MGQC 4H9OA 2Y2LA 5AV9D 1WWIA 2HIOA 3NQJB 3LELB 5B2JA 1M19C 1S32D 4DRAA 1KX4B 5BT1D 4ZUXA 3O62C 4J8WC 2YFVA 4XZQB 3AZMB 1EQZA 3AL0C 2Y2HA 2F8NA 3X1UB 3KSYA 3AZIB 4Z5TD 3AZGA 3B6FB 3WAAC 1P3GC 5AV8C 4J8VC 3MGQB 5B2IA 1M19B 4LD9A 5B32C 1P3BD 5AY8C 3C1BC 3O62B 4J8WB 1P3FC 2CV5A 2UWXA 3C1CD 3WAAB 5AVBD 3REJD 5AV8B 4J8VB 3RELA 1P3AD 4KGCC 5B32B 5GT0C 1AOID 2G5HC 3X1TA 5AY8B 3UT9B 1ZLAB 5B33A 3C1BB 4YM6A 1P3FB 3B0DC 5GXQA 3AZKC 1U35C 4AWLC 3H0RC 4KHAB 1TZYC 3MGSC 3AZLA 4HGAC 4NFTA 5B1LD 3AZJB 3UTBC 4KGCB 3AYWC 5GT0B 3LZ1C 3EPKA 4G92C 3AN2C 5AV9C 3WKJA 3B0DB 1BH9A 3AV1D 4WU8C 1S32C 1T3UA 2NZDD 2RIQA 3MGSB 1TZYB 2ZY3A 4HGAB 5KDMB 4Z5TC 4R8PD 3UTBB 4J8XA 1EQZD 3AYWB 3LZ1B 4G92B 1A7WA 3AN2B 4H9QB 4YS3D 3TU4A 4XZQA 4WU8B 3X1UA 5B2ID 5BS7A 1ID3B 5B0ZA 3MGQA 2IO5B 3NQUA 3EPLA 3C1CC 1M19A 5BNVA 5DNMD 3IP4C 3W96B 3O62A 1AOIC 3UTAD 5F99D 1F1EA 1P3ID 1P3GA 3WAAA 5AV8A 2ZM5A 3A6ND 4J8VA 2AROA 5GXQD 4KUDD 2JSSA 4DQYB 3REHD 4CAYB 4EO5C 3C1BA 1P3MD 2BYMA 4H9PB 3H0LC 3AV1C 3LZ0D 2NZDC 5AV5B 5G49A 4XUJC 4CSRA 3AFAA 5B1MD 1BFMA 3AZKA 4YS3C 5GSUC 1U35A 2DF4C 3KWQD 3AV1B 3LELD 3FDDA 3WTPC 1M18A 1P34C 1KX4D 1KX3D 4XZQD 3AYWA 3AZMD 2W8SA 4QLCB 4XUJB 4WV4B 5AV9A 5AVCC 3AZID 1F66C 2Y2GA 5DNMC 3B6FD 1S32A 4WU8A 5GT3C 3B0CT 5GSUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B40 C;  5JA4 B;  3VH5 T;  3WTP B;  5B24 C;  5FUG A;  5F99 C;  3MVD D;  1P34 B;  4Z5T A;  4J8W D;  1HQ3 C;  5AVC B;  4JJN C;  4Z2M H;  1F66 B;  1P3B A;  5GT3 B;  3REH C;  5B40 B;  3REK B;  5B32 D;  5B24 B;  5B31 G;  5AY8 D;  4H9N B;  3UT9 D;  1P3K C;  1ZLA D;  3C1C A;  1P3F D;  5AVB A;  1HQ3 B;  4H9S A;  3REJ A;  4JJN B;  1P3A A;  1AOI A;  4ZBJ C;  3REH B;  1WWS A;  3AZJ D;  5B1M C;  4KGC D;  5GT0 D;  5CP6 C;  3X1S B;  3KWQ C;  1P3K B;  3W97 C;  5B1L A;  1KX3 C;  3VH5 A;  2PYO C;  3MGS D;  1TZY D;  4WNN A;  4ZBJ B;  3VH5 W;  1TAF B;  3UTB D;  3AV1 A;  4NE6 A;  3AYW D;  5CP6 B;  3LZ1 D;  3AN2 D;  3KWQ B;  2NZD A;  4WU8 D;  3MVD C;  3W97 B;  4XUJ A;  4R8P A;  1KX3 B;  2YFW A;  3WTP E;  2PYO B;  2FJ7 C;  1ID3 D;  4YS3 A;  3AZH C;  3WTP A;  5C3I C;  3W96 D;  3MVD B;  3VH6 T;  3UT9 C;  1ZLA C;  2NQB D;  5DNM A;  2F8N G;  2FJ7 B;  4E44 A;  4J8U B;  3KXB C;  3AZH B;  3UTA A;  5F99 A;  1KX5 C;  5C3I B;  1P3I A;  3AZJ C;  5E5A C;  5DNN C;  3A6N A;  4KUD A;  3KXB B;  3REH A;  3R45 A;  3V9R B;  5AV5 D;  1P3M A;  1KX5 B;  4M6B A;  5E5A B;  5DNN B;  4G91 C;  3LZ0 A;  5CPK D;  1P3P C;  3VH6 A;  5B1M A;  3MGP D;  4QLC D;  5CP6 A;  1ULY A;  1ID3 C;  2IO5 C;  3VH6 W;  4XUJ D;  3KWQ A;  3NQJ A;  1JFI B;  3LEL A;  4G91 B;  1P3P B;  3B6G B;  3W96 C;  1KX4 A;  5GSU D;  1KX3 A;  3AZM A;  3WTP D;  3AZE D;  1P34 D;  3AZI A;  3B6F A;  2NQB C;  5JRG B;  5AVC D;  5CPI D;  1F66 D;  2F8N H;  4Z66 B;  3MVD A;  5GT3 D;  4WU9 B;  5B40 D;  4J8W A;  2LY8 A;  3REK D;  1Q9C A;  5B24 D;  2NQB B;  1HQ3 D;  3MNN C;  5AV5 C;  4JJN D;  3KUY C;  5B32 A;  5AY8 A;  3UT9 A;  1ZLA A;  4DRB A;  1P3F A;  5CPK C;  2HUE C;  3X1S D;  1P3K D;  3V9R A;  4KHA A;  3MNN B;  1KX5 A;  3AZJ A;  5E5A A;  5B32 G;  4UUZ B;  3KUY B;  3MGP C;  4QLC C;  5GT0 A;  4KGC A;  3AZN B;  5CPK B;  5CP6 D;  2HUE B;  1P3L B;  3MGS A;  1TZY A;  3AZE C;  3W97 D;  5KDM A;  1BH8 B;  3W99 D;  3UTB A;  3WA9 C;  3MGP B;  2PYO D;  3LZ1 A;  4H9R B;  1P3P A;  3AN2 A;  4H9Q A;  5CPI C;  3AV2 C;  2CWE A;  3REI C;  3REK C;  1P3O D;  3AZE B;  3AZF C;  1ID3 A;  2HIO C;  5B2J C;  3WA9 B;  4ZUX C;  2FJ7 D;  4J8U D;  1H3O B;  3W96 A;  5BO0 B;  1N1J B;  3AV2 B;  2RVQ C;  3AZH D;  5CPI B;  3MGR B;  3REI B;  2NQB A;  3AZF B;  2HIO B;  3X1S C;  5B2J B;  4ZUX B;  3KXB D;  2CV5 C;  4CAY A;  2F8N B;  1KX5 D;  4H9P A;  5E5A D;  5DNN D;  3LJA D;  3REL C;  1KU5 A;  5AV5 A;  3X1T C;  3W98 C;  5B33 C;  4YM6 C;  3W99 C;  2CV5 B;  5BNX B;  5CPK A;  3REL B;  1P3P D;  3B6G D;  3X1T B;  1P3O C;  3W98 B;  3MGP A;  4QLC A;  5B33 B;  3WKJ C;  4YM6 B;  3W99 B;  5CPJ C;  5JRG D;  4J8U C;  5GSU A;  3AZL B;  5JA4 A;  4WZS B;  4Z66 D;  3AZE A;  1P34 A;  4J8X C;  4WU9 D;  3WA9 A;  1P3O B;  3WKJ B;  3TU4 C;  5CPJ B;  1BH9 B;  5AVC A;  5B0Y C;  5CPI A;  1F66 A;  5GT3 A;  5B40 A;  3REI A;  3REK A;  5B24 A;  3AZF A;  4J8X B;  4H9N A;  3LJA C;  1HQ3 A;  5AV6 D;  3TU4 B;  4JJN A;  5B0Y B;  3MNN D;  5B31 D;  3X1V C;  3KUY D;  5B0Z B;  3NQU B;  2ARO C;  2L5A A;  3X1S A;  5BNV B;  1P3K A;  3AZN D;  3LJA B;  3B6G C;  4X23 D;  5BNX A;  1P3L D;  1P3G B;  1TAF A;  3X1V B;  5JRG C;  2ARO B;  4Z66 C;  4E45 A;  3W98 A;  3W97 A;  4WU9 C;  3W99 A;  3AFA C;  2PYO A;  2BYM B;  1M1A D;  3WA9 D;  1M18 C;  3AV2 D;  5G49 B;  1P3O A;  4NE3 A;  4CSR B;  3AFA B;  5CPJ A;  3MGR D;  3REI D;  3AZK B;  5AV6 C;  5BT1 C;  1B6W A;  4J8U A;  3AZF D;  1U35 B;  2FJ7 A;  2HIO D;  4AWL B;  5B2J D;  3AZH A;  1M18 B;  5B31 C;  4ZUX D;  2RVQ D;  2F8N D;  5AV9 B;  3AZG D;  1P3B C;  2BYK B;  3AZN C;  1S32 B;  5B0Y A;  5AV6 B;  4X23 C;  3KXB A;  4LD9 D;  5FUG B;  1P3L C;  4Z5T B;  5B31 B;  5AVB C;  5DNN A;  3REJ C;  4H9S C;  2CV5 D;  3LJA A;  1P3A C;  1P3B B;  1HTA A;  3REL D;  4X23 B;  4Z2M G;  3X1T D;  3X1V A;  3W98 D;  5B33 D;  4YM6 D;  3C1C B;  5AVB B;  1M1A C;  3REJ B;  1JFI A;  5B1L C;  1P3A B;  3B6G A;  1AOI B;  3AZL D;  3MGR C;  5JRG A;  3WKJ D;  5CPJ D;  1M1A B;  4Z66 A;  5B1L B;  4R8P C;  1EQZ C;  4EO5 B;  4WU9 A;  4WNN B;  4NE5 A;  3AZG C;  4J8X D;  2F8N K;  4H9O B;  2NZD B;  5B2I C;  4LD9 C;  3TU4 D;  5B0Y D;  3B0B A;  4R8P B;  3X1U D;  2YFV B;  1EQZ B;  2YFW B;  2BYK A;  5B0Z D;  5AV6 A;  3MGQ D;  3AZG B;  4YS3 B;  3UTA C;  1M19 D;  1P3I C;  5B2I B;  3MNN A;  5B31 A;  4LD9 B;  3O62 D;  5CHL B;  4UUZ A;  3KUY A;  3A6N C;  5DNM B;  5GXQ C;  1P3G D;  3AZN A;  3WAA D;  4KUD C;  5AV8 D;  4J8V D;  3X1V D;  4X23 A;  2ARO D;  3UTA B;  3AZL C;  1P3M C;  5F99 B;  1B67 A;  1P3L A;  1P3I B;  3C1B D;  1BH8 A;  3LZ0 C;  1R4V A;  3A6N B;  4H9R A;  5GXQ B;  4KUD B;  3R45 B;  1P3M B;  3LEL C;  3LZ0 B;  3AFA D;  1M1A A;  3AZK D;  1KX4 C;  1U35 D;  3B0C W;  1H3O A;  4XZQ C;  5BO0 A;  1N1J A;  3AZM C;  3AV2 A;  1M18 D;  3X1U C;  3AZI C;  3B6F C;  5BS7 C;  5B1M B;  3MGR A;  5B0Z C;  3MGQ C;  4H9O A;  5AV9 D;  1WWI A;  2HIO A;  3NQJ B;  3LEL B;  5B2J A;  1M19 C;  1S32 D;  4DRA A;  1KX4 B;  5BT1 D;  4ZUX A;  3O62 C;  4J8W C;  2YFV A;  4XZQ B;  3AZM B;  1EQZ A;  2F8N A;  3X1U B;  3KSY A;  3AZI B;  4Z5T D;  3AZG A;  3B6F B;  3WAA C;  1P3G C;  5AV8 C;  4J8V C;  3MGQ B;  5B2I A;  1M19 B;  4LD9 A;  5B32 C;  1P3B D;  5AY8 C;  3C1B C;  3O62 B;  4J8W B;  1P3F C;  2CV5 A;  3C1C D;  3WAA B;  5AVB D;  3REJ D;  5AV8 B;  4J8V B;  3REL A;  1P3A D;  4KGC C;  5B32 B;  5GT0 C;  1AOI D;  3X1T A;  5AY8 B;  3UT9 B;  1ZLA B;  5B33 A;  3C1B B;  4YM6 A;  1P3F B;  3B0D C;  5GXQ A;  3AZK C;  1U35 C;  4AWL C;  4KHA B;  3MGS C;  1TZY C;  3AZL A;  4HGA C;  4NFT A;  5B1L D;  3AZJ B;  3UTB C;  4KGC B;  3AYW C;  5GT0 B;  3LZ1 C;  4G92 C;  3AN2 C;  5AV9 C;  3WKJ A;  3B0D B;  1BH9 A;  3AV1 D;  4WU8 C;  1S32 C;  2NZD D;  3MGS B;  1TZY B;  4HGA B;  5KDM B;  4Z5T C;  4R8P D;  3UTB B;  4J8X A;  1EQZ D;  3AYW B;  3LZ1 B;  4G92 B;  1A7W A;  3AN2 B;  4H9Q B;  4YS3 D;  3TU4 A;  4XZQ A;  4WU8 B;  3X1U A;  5B2I D;  5BS7 A;  1ID3 B;  5B0Z A;  3MGQ A;  2IO5 B;  3NQU A;  3C1C C;  1M19 A;  5BNV A;  5DNM D;  3W96 B;  3O62 A;  1AOI C;  3UTA D;  5F99 D;  1F1E A;  1P3I D;  1P3G A;  3WAA A;  5AV8 A;  4J8V A;  3A6N D;  2ARO A;  5GXQ D;  4KUD D;  2JSS A;  3REH D;  4CAY B;  4EO5 C;  3C1B A;  1P3M D;  2BYM A;  4H9P B;  3AV1 C;  3LZ0 D;  2NZD C;  5AV5 B;  5G49 A;  4XUJ C;  4CSR A;  3AFA A;  5B1M D;  1BFM A;  3AZK A;  4YS3 C;  5GSU C;  1U35 A;  3KWQ D;  3AV1 B;  3LEL D;  3WTP C;  1M18 A;  1P34 C;  1KX4 D;  1KX3 D;  4XZQ D;  3AYW A;  3AZM D;  4QLC B;  4XUJ B;  4WV4 B;  5AV9 A;  5AVC C;  3AZI D;  1F66 C;  5DNM C;  3B6F D;  1S32 A;  4WU8 A;  5GT3 C;  3B0C T;  5GSU B; 
#chains in the Genus database with same CATH topology
 5B40 C;  5JA4 B;  3VH5 T;  3WTP B;  5B24 C;  5FUG A;  5F99 C;  3MVD D;  1P34 B;  4Z5T A;  4J8W D;  1HQ3 C;  5AVC B;  4JJN C;  4Z2M H;  1F66 B;  1P3B A;  5GT3 B;  2BG1 A;  2Y2O A;  3REH C;  5B40 B;  3REK B;  5B32 D;  5B24 B;  5B31 G;  5AY8 D;  4H9N B;  3UT9 D;  1P3K C;  1ZLA D;  3C1C A;  1P3F D;  5AVB A;  1HQ3 B;  4H9S A;  3REJ A;  4JJN B;  1P3A A;  1AOI A;  4ZBJ C;  3REH B;  1WWS A;  3AZJ D;  5B1M C;  4KGC D;  3A1I A;  5CP6 C;  5GT0 D;  3X1S B;  3KWQ C;  1P3K B;  3W97 C;  5B1L A;  1KX3 C;  3VH5 A;  2PYO C;  3MGS D;  1TZY D;  4WNN A;  4ZBJ B;  3VH5 W;  1TAF B;  3UTB D;  3AV1 A;  4NE6 A;  3AYW D;  5CP6 B;  3LZ1 D;  3AN2 D;  3KWQ B;  2NZD A;  4WU8 D;  3MVD C;  3W97 B;  4XUJ A;  4R8P A;  1KX3 B;  2YFW A;  3WTP E;  2PYO B;  2FJ7 C;  1ID3 D;  4YS3 A;  3AZH C;  3WTP A;  5C3I C;  3W96 D;  3MVD B;  3VH6 T;  3UT9 C;  1ZLA C;  2NQB D;  5DNM A;  2F8N G;  2FJ7 B;  4E44 A;  4J8U B;  3EPH A;  3KXB C;  3AZH B;  3UTA A;  2Y2M A;  5F99 A;  1KX5 C;  5C3I B;  1P3I A;  3AZJ C;  5E5A C;  5DNN C;  3A6N A;  4KUD A;  3KXB B;  3REH A;  2JE5 A;  3R45 A;  3V9R B;  5AV5 D;  1P3M A;  1KX5 B;  4M6B A;  5E5A B;  5DNN B;  4G91 C;  3LZ0 A;  5CPK D;  1P3P C;  3EG5 B;  3VH6 A;  5B1M A;  3MGP D;  4QLC D;  5CP6 A;  1ULY A;  1ID3 C;  2IO5 C;  2G5I C;  3VH6 W;  4XUJ D;  3KWQ A;  3NQJ A;  1JFI B;  3LEL A;  4G91 B;  1P3P B;  3B6G B;  3W96 C;  1KX4 A;  5GSU D;  1KX3 A;  3AZM A;  3WTP D;  3AZE D;  1P34 D;  3AZI A;  3B6F A;  2NQB C;  2ZY5 A;  5JRG B;  5AVC D;  5CPI D;  1F66 D;  2F8N H;  4Z66 B;  3MVD A;  5GT3 D;  4WU9 B;  5B40 D;  4J8W A;  2LY8 A;  3REK D;  1Q9C A;  5B24 D;  2NQB B;  1HQ3 D;  3MNN C;  5AV5 C;  4JJN D;  3KUY C;  5B32 A;  5AY8 A;  3UT9 A;  1ZLA A;  4DRB A;  1P3F A;  5CPK C;  1Z2C B;  2HUE C;  3X1S D;  1P3K D;  2DQN C;  3V9R A;  4KHA A;  3MNN B;  1KX5 A;  3AZJ A;  5E5A A;  5B32 G;  4UUZ B;  3KUY B;  3MGP C;  4QLC C;  5GT0 A;  4KGC A;  3AZN B;  5CPK B;  5CP6 D;  2HUE B;  1P3L B;  3MGS A;  1TZY A;  3AZE C;  3W97 D;  5KDM A;  1BH8 B;  3W99 D;  3UTB A;  3WA9 C;  3MGP B;  2PYO D;  3LZ1 A;  4H9R B;  1P3P A;  3AN2 A;  4H9Q A;  5CPI C;  3AV2 C;  2CWE A;  3F6T A;  1PZR A;  3REI C;  3REK C;  1P3O D;  3AZE B;  3AZF C;  1ID3 A;  2HIO C;  5B2J C;  3WA9 B;  4ZUX C;  2FJ7 D;  4J8U D;  1H3O B;  3W96 A;  5BO0 B;  1N1J B;  3AV2 B;  2RVQ C;  3AZH D;  5CPI B;  3MGR B;  3REI B;  2NQB A;  3AZF B;  2HIO B;  3X1S C;  5B2J B;  4ZUX B;  3KXB D;  2CV5 C;  4CAY A;  2F8N B;  1KX5 D;  4H9P A;  5E5A D;  5DNN D;  3LJA D;  3REL C;  1KU5 A;  5AV5 A;  3X1T C;  3W98 C;  5B33 C;  4YM6 C;  3W99 C;  2CV5 B;  5BNX B;  5CPK A;  3REL B;  1P3P D;  2Y2N A;  3B6G D;  3X1T B;  1P3O C;  3W98 B;  3MGP A;  4QLC A;  5B33 B;  3WKJ C;  4YM6 B;  3W99 B;  5CPJ C;  5JRG D;  4J8U C;  4UPK A;  5GSU A;  3AZL B;  5JA4 A;  4WZS B;  4Z66 D;  3AZE A;  1P34 A;  4J8X C;  4WU9 D;  3WA9 A;  1P3O B;  3WKJ B;  3TU4 C;  5CPJ B;  1BH9 B;  5AVC A;  5B0Y C;  2XD5 A;  5CPI A;  1F66 A;  5GT3 A;  5B40 A;  3REI A;  3REK A;  5B24 A;  3AZF A;  4J8X B;  4H9N A;  1W2E A;  3LJA C;  3EPJ A;  1HQ3 A;  5AV6 D;  3TU4 B;  4JJN A;  5B0Y B;  2J8P A;  3MNN D;  5B31 D;  3X1V C;  3KUY D;  2F2A C;  5B0Z B;  3NQU B;  2ARO C;  2L5A A;  3X1S A;  5BNV B;  1P3K A;  3AZN D;  2Y2I A;  3LJA B;  3B6G C;  4X23 D;  5BNX A;  2Y2J A;  1P3L D;  1P3G B;  1TAF A;  3X1V B;  5JRG C;  2ARO B;  2Y2P A;  4Z66 C;  4E45 A;  3W98 A;  3W97 A;  4WU9 C;  3W99 A;  3AFA C;  2Y2Q A;  2ZY4 A;  3A1K A;  2BYM B;  2PYO A;  1M1A D;  3WA9 D;  1M18 C;  3AV2 D;  5G49 B;  2VQR A;  1P3O A;  2FFF B;  4NE3 A;  4CSR B;  3AFA B;  5CPJ A;  3MGR D;  3REI D;  3AZK B;  5AV6 C;  5BT1 C;  1B6W A;  4J8U A;  3AZF D;  1U35 B;  2FJ7 A;  2HIO D;  4AWL B;  5B2J D;  3AZH A;  1M18 B;  5B31 C;  4ZUX D;  2RVQ D;  2F8N D;  5AV9 B;  3AZG D;  1P3B C;  2BYK B;  3AZN C;  1S32 B;  5B0Y A;  4WJ3 C;  5AV6 B;  4X23 C;  3KXB A;  4LD9 D;  5FUG B;  1P3L C;  4Z5T B;  5B31 B;  5AVB C;  5DNN A;  3REJ C;  4H9S C;  2CV5 D;  3LJA A;  2JCH A;  1P3A C;  1P3B B;  1HTA A;  3REL D;  4X23 B;  4Z2M G;  3X1T D;  3X1V A;  3W98 D;  2XD1 A;  5B33 D;  4YM6 D;  3C1C B;  5AVB B;  1M1A C;  3REJ B;  1JFI A;  5B1L C;  1P3A B;  3B6G A;  1AOI B;  3AZL D;  3MGR C;  5JRG A;  3WKJ D;  5CPJ D;  1M1A B;  2Y2K A;  4Z66 A;  5B1L B;  4R8P C;  1EQZ C;  4EO5 B;  4WU9 A;  4WNN B;  4NE5 A;  3AZG C;  4J8X D;  2F8N K;  4H9O B;  2NZD B;  5B2I C;  4LD9 C;  3TU4 D;  5B0Y D;  3B0B A;  4R8P B;  3X1U D;  2YFV B;  1EQZ B;  2YFW B;  2BYK A;  5B0Z D;  5AV6 A;  3MGQ D;  3AZG B;  4YS3 B;  3UTA C;  1M19 D;  1P3I C;  5B2I B;  3MNN A;  5B31 A;  4LD9 B;  3O62 D;  5CHL B;  4UUZ A;  3KUY A;  3A6N C;  5DNM B;  5GXQ C;  1P3G D;  3AZN A;  3WAA D;  3P5J B;  4KUD C;  3KFU G;  5AV8 D;  4J8V D;  3X1V D;  4X23 A;  2ARO D;  3UTA B;  3AZL C;  1P3M C;  5F99 B;  1B67 A;  1P3L A;  1P3I B;  3C1B D;  1BH8 A;  3LZ0 C;  1R4V A;  3A6N B;  4H9R A;  2ZY2 A;  5GXQ B;  4KUD B;  3R45 B;  1P3M B;  3LEL C;  3LZ0 B;  3AFA D;  1M1A A;  3H0M C;  3AZK D;  1KX4 C;  1U35 D;  3B0C W;  1H3O A;  4XZQ C;  5BO0 A;  1N1J A;  3AZM C;  3AV2 A;  1M18 D;  3X1U C;  3AZI C;  3B6F C;  5BS7 C;  5B1M B;  3MGR A;  5B0Z C;  3MGQ C;  4H9O A;  2Y2L A;  5AV9 D;  1WWI A;  2HIO A;  3NQJ B;  3LEL B;  5B2J A;  1M19 C;  1S32 D;  4DRA A;  1KX4 B;  5BT1 D;  4ZUX A;  3O62 C;  4J8W C;  2YFV A;  4XZQ B;  3AZM B;  1EQZ A;  3AL0 C;  2Y2H A;  2F8N A;  3X1U B;  3KSY A;  3AZI B;  4Z5T D;  3AZG A;  3B6F B;  3WAA C;  1P3G C;  5AV8 C;  4J8V C;  3MGQ B;  5B2I A;  1M19 B;  4LD9 A;  5B32 C;  1P3B D;  5AY8 C;  3C1B C;  3O62 B;  4J8W B;  1P3F C;  2CV5 A;  2UWX A;  3C1C D;  3WAA B;  5AVB D;  3REJ D;  5AV8 B;  4J8V B;  3REL A;  1P3A D;  4KGC C;  5B32 B;  5GT0 C;  1AOI D;  2G5H C;  3X1T A;  5AY8 B;  3UT9 B;  1ZLA B;  5B33 A;  3C1B B;  4YM6 A;  1P3F B;  3B0D C;  5GXQ A;  3AZK C;  1U35 C;  4AWL C;  3H0R C;  4KHA B;  1TZY C;  3MGS C;  3AZL A;  4HGA C;  4NFT A;  5B1L D;  3AZJ B;  3UTB C;  4KGC B;  3AYW C;  5GT0 B;  3LZ1 C;  3EPK A;  4G92 C;  3AN2 C;  5AV9 C;  3WKJ A;  3B0D B;  1BH9 A;  3AV1 D;  4WU8 C;  1S32 C;  1T3U A;  2NZD D;  2RIQ A;  3MGS B;  1TZY B;  2ZY3 A;  4HGA B;  5KDM B;  4Z5T C;  4R8P D;  3UTB B;  4J8X A;  1EQZ D;  3AYW B;  3LZ1 B;  4G92 B;  1A7W A;  3AN2 B;  4H9Q B;  4YS3 D;  3TU4 A;  4XZQ A;  4WU8 B;  3X1U A;  5B2I D;  5BS7 A;  1ID3 B;  5B0Z A;  3MGQ A;  2IO5 B;  3NQU A;  3EPL A;  3C1C C;  1M19 A;  5BNV A;  5DNM D;  3IP4 C;  3W96 B;  3O62 A;  1AOI C;  3UTA D;  5F99 D;  1F1E A;  1P3I D;  1P3G A;  3WAA A;  5AV8 A;  2ZM5 A;  3A6N D;  4J8V A;  2ARO A;  5GXQ D;  4KUD D;  2JSS A;  4DQY B;  3REH D;  4CAY B;  4EO5 C;  3C1B A;  1P3M D;  2BYM A;  4H9P B;  3H0L C;  3AV1 C;  3LZ0 D;  2NZD C;  5AV5 B;  5G49 A;  4XUJ C;  4CSR A;  3AFA A;  5B1M D;  1BFM A;  3AZK A;  4YS3 C;  5GSU C;  1U35 A;  2DF4 C;  3KWQ D;  3AV1 B;  3LEL D;  3FDD A;  3WTP C;  1M18 A;  1P34 C;  1KX4 D;  1KX3 D;  4XZQ D;  3AYW A;  3AZM D;  2W8S A;  4QLC B;  4XUJ B;  4WV4 B;  5AV9 A;  5AVC C;  3AZI D;  1F66 C;  2Y2G A;  5DNM C;  3B6F D;  1S32 A;  4WU8 A;  5GT3 C;  3B0C T;  5GSU B; 
#chains in the Genus database with same CATH homology
 5B40 C;  5JA4 B;  3VH5 T;  3WTP B;  5B24 C;  5FUG A;  5F99 C;  3MVD D;  1P34 B;  4Z5T A;  4J8W D;  1HQ3 C;  5AVC B;  4JJN C;  4Z2M H;  1F66 B;  1P3B A;  5GT3 B;  2BG1 A;  2Y2O A;  3REH C;  5B40 B;  3REK B;  5B32 D;  5B24 B;  5B31 G;  5AY8 D;  4H9N B;  3UT9 D;  1P3K C;  1ZLA D;  3C1C A;  1P3F D;  5AVB A;  1HQ3 B;  4H9S A;  3REJ A;  4JJN B;  1P3A A;  1AOI A;  4ZBJ C;  3REH B;  1WWS A;  3AZJ D;  5B1M C;  4KGC D;  3A1I A;  5CP6 C;  5GT0 D;  3X1S B;  3KWQ C;  1P3K B;  3W97 C;  5B1L A;  1KX3 C;  3VH5 A;  2PYO C;  3MGS D;  1TZY D;  4WNN A;  4ZBJ B;  3VH5 W;  1TAF B;  3UTB D;  3AV1 A;  4NE6 A;  3AYW D;  5CP6 B;  3LZ1 D;  3AN2 D;  3KWQ B;  2NZD A;  4WU8 D;  3MVD C;  3W97 B;  4XUJ A;  4R8P A;  1KX3 B;  2YFW A;  3WTP E;  2PYO B;  2FJ7 C;  1ID3 D;  4YS3 A;  3AZH C;  3WTP A;  5C3I C;  3W96 D;  3MVD B;  3VH6 T;  3UT9 C;  1ZLA C;  2NQB D;  5DNM A;  2F8N G;  2FJ7 B;  4E44 A;  4J8U B;  3EPH A;  3KXB C;  3AZH B;  3UTA A;  2Y2M A;  5F99 A;  1KX5 C;  5C3I B;  1P3I A;  3AZJ C;  5E5A C;  5DNN C;  3A6N A;  4KUD A;  3KXB B;  3REH A;  2JE5 A;  3R45 A;  3V9R B;  5AV5 D;  1P3M A;  1KX5 B;  4M6B A;  5E5A B;  5DNN B;  4G91 C;  3LZ0 A;  5CPK D;  1P3P C;  3EG5 B;  3VH6 A;  5B1M A;  3MGP D;  4QLC D;  5CP6 A;  1ULY A;  1ID3 C;  2IO5 C;  2G5I C;  3VH6 W;  4XUJ D;  3KWQ A;  3NQJ A;  1JFI B;  3LEL A;  4G91 B;  1P3P B;  3B6G B;  3W96 C;  1KX4 A;  5GSU D;  1KX3 A;  3AZM A;  3WTP D;  3AZE D;  1P34 D;  3AZI A;  3B6F A;  2NQB C;  2ZY5 A;  5JRG B;  5AVC D;  5CPI D;  1F66 D;  2F8N H;  4Z66 B;  3MVD A;  5GT3 D;  4WU9 B;  5B40 D;  4J8W A;  2LY8 A;  3REK D;  1Q9C A;  5B24 D;  2NQB B;  1HQ3 D;  3MNN C;  5AV5 C;  4JJN D;  3KUY C;  5B32 A;  5AY8 A;  3UT9 A;  1ZLA A;  4DRB A;  1P3F A;  5CPK C;  1Z2C B;  2HUE C;  3X1S D;  1P3K D;  2DQN C;  3V9R A;  4KHA A;  3MNN B;  1KX5 A;  3AZJ A;  5E5A A;  5B32 G;  4UUZ B;  3KUY B;  3MGP C;  4QLC C;  5GT0 A;  4KGC A;  3AZN B;  5CPK B;  5CP6 D;  2HUE B;  1P3L B;  3MGS A;  1TZY A;  3AZE C;  3W97 D;  5KDM A;  1BH8 B;  3W99 D;  3UTB A;  3WA9 C;  3MGP B;  2PYO D;  3LZ1 A;  4H9R B;  1P3P A;  3AN2 A;  4H9Q A;  5CPI C;  3AV2 C;  2CWE A;  3F6T A;  1PZR A;  3REI C;  3REK C;  1P3O D;  3AZE B;  3AZF C;  1ID3 A;  2HIO C;  5B2J C;  3WA9 B;  4ZUX C;  2FJ7 D;  4J8U D;  1H3O B;  3W96 A;  5BO0 B;  1N1J B;  3AV2 B;  2RVQ C;  3AZH D;  5CPI B;  3MGR B;  3REI B;  2NQB A;  3AZF B;  2HIO B;  3X1S C;  5B2J B;  4ZUX B;  3KXB D;  2CV5 C;  4CAY A;  2F8N B;  1KX5 D;  4H9P A;  5E5A D;  5DNN D;  3LJA D;  3REL C;  1KU5 A;  5AV5 A;  3X1T C;  3W98 C;  5B33 C;  4YM6 C;  3W99 C;  2CV5 B;  5BNX B;  5CPK A;  3REL B;  1P3P D;  2Y2N A;  3B6G D;  3X1T B;  1P3O C;  3W98 B;  3MGP A;  4QLC A;  5B33 B;  3WKJ C;  4YM6 B;  3W99 B;  5CPJ C;  5JRG D;  4J8U C;  4UPK A;  5GSU A;  3AZL B;  5JA4 A;  4WZS B;  4Z66 D;  3AZE A;  1P34 A;  4J8X C;  4WU9 D;  3WA9 A;  1P3O B;  3WKJ B;  3TU4 C;  5CPJ B;  1BH9 B;  5AVC A;  5B0Y C;  2XD5 A;  5CPI A;  1F66 A;  5GT3 A;  5B40 A;  3REI A;  3REK A;  5B24 A;  3AZF A;  4J8X B;  4H9N A;  1W2E A;  3LJA C;  3EPJ A;  1HQ3 A;  5AV6 D;  3TU4 B;  4JJN A;  5B0Y B;  2J8P A;  3MNN D;  5B31 D;  3X1V C;  3KUY D;  2F2A C;  5B0Z B;  3NQU B;  2ARO C;  2L5A A;  3X1S A;  5BNV B;  1P3K A;  3AZN D;  2Y2I A;  3LJA B;  3B6G C;  4X23 D;  5BNX A;  2Y2J A;  1P3L D;  1P3G B;  1TAF A;  3X1V B;  5JRG C;  2ARO B;  2Y2P A;  4Z66 C;  4E45 A;  3W98 A;  3W97 A;  4WU9 C;  3W99 A;  3AFA C;  2Y2Q A;  2ZY4 A;  3A1K A;  2BYM B;  2PYO A;  1M1A D;  3WA9 D;  1M18 C;  3AV2 D;  5G49 B;  2VQR A;  1P3O A;  2FFF B;  4NE3 A;  4CSR B;  3AFA B;  5CPJ A;  3MGR D;  3REI D;  3AZK B;  5AV6 C;  5BT1 C;  1B6W A;  4J8U A;  3AZF D;  1U35 B;  2FJ7 A;  2HIO D;  4AWL B;  5B2J D;  3AZH A;  1M18 B;  5B31 C;  4ZUX D;  2RVQ D;  2F8N D;  5AV9 B;  3AZG D;  1P3B C;  2BYK B;  3AZN C;  1S32 B;  5B0Y A;  4WJ3 C;  5AV6 B;  4X23 C;  3KXB A;  4LD9 D;  5FUG B;  1P3L C;  4Z5T B;  5B31 B;  5AVB C;  5DNN A;  3REJ C;  4H9S C;  2CV5 D;  3LJA A;  2JCH A;  1P3A C;  1P3B B;  1HTA A;  3REL D;  4X23 B;  4Z2M G;  3X1T D;  3X1V A;  3W98 D;  2XD1 A;  5B33 D;  4YM6 D;  3C1C B;  5AVB B;  1M1A C;  3REJ B;  1JFI A;  5B1L C;  1P3A B;  3B6G A;  1AOI B;  3AZL D;  3MGR C;  5JRG A;  3WKJ D;  5CPJ D;  1M1A B;  2Y2K A;  4Z66 A;  5B1L B;  4R8P C;  1EQZ C;  4EO5 B;  4WU9 A;  4WNN B;  4NE5 A;  3AZG C;  4J8X D;  2F8N K;  4H9O B;  2NZD B;  5B2I C;  4LD9 C;  3TU4 D;  5B0Y D;  3B0B A;  4R8P B;  3X1U D;  2YFV B;  1EQZ B;  2YFW B;  2BYK A;  5B0Z D;  5AV6 A;  3MGQ D;  3AZG B;  4YS3 B;  3UTA C;  1M19 D;  1P3I C;  5B2I B;  3MNN A;  5B31 A;  4LD9 B;  3O62 D;  5CHL B;  4UUZ A;  3KUY A;  3A6N C;  5DNM B;  5GXQ C;  1P3G D;  3AZN A;  3WAA D;  3P5J B;  4KUD C;  3KFU G;  5AV8 D;  4J8V D;  3X1V D;  4X23 A;  2ARO D;  3UTA B;  3AZL C;  1P3M C;  5F99 B;  1B67 A;  1P3L A;  1P3I B;  3C1B D;  1BH8 A;  3LZ0 C;  1R4V A;  3A6N B;  4H9R A;  2ZY2 A;  5GXQ B;  4KUD B;  3R45 B;  1P3M B;  3LEL C;  3LZ0 B;  3AFA D;  1M1A A;  3H0M C;  3AZK D;  1KX4 C;  1U35 D;  3B0C W;  1H3O A;  4XZQ C;  5BO0 A;  1N1J A;  3AZM C;  3AV2 A;  1M18 D;  3X1U C;  3AZI C;  3B6F C;  5BS7 C;  5B1M B;  3MGR A;  5B0Z C;  3MGQ C;  4H9O A;  2Y2L A;  5AV9 D;  1WWI A;  2HIO A;  3NQJ B;  3LEL B;  5B2J A;  1M19 C;  1S32 D;  4DRA A;  1KX4 B;  5BT1 D;  4ZUX A;  3O62 C;  4J8W C;  2YFV A;  4XZQ B;  3AZM B;  1EQZ A;  3AL0 C;  2Y2H A;  2F8N A;  3X1U B;  3KSY A;  3AZI B;  4Z5T D;  3AZG A;  3B6F B;  3WAA C;  1P3G C;  5AV8 C;  4J8V C;  3MGQ B;  5B2I A;  1M19 B;  4LD9 A;  5B32 C;  1P3B D;  5AY8 C;  3C1B C;  3O62 B;  4J8W B;  1P3F C;  2CV5 A;  2UWX A;  3C1C D;  3WAA B;  5AVB D;  3REJ D;  5AV8 B;  4J8V B;  3REL A;  1P3A D;  4KGC C;  5B32 B;  5GT0 C;  1AOI D;  2G5H C;  3X1T A;  5AY8 B;  3UT9 B;  1ZLA B;  5B33 A;  3C1B B;  4YM6 A;  1P3F B;  3B0D C;  5GXQ A;  3AZK C;  1U35 C;  4AWL C;  3H0R C;  4KHA B;  1TZY C;  3MGS C;  3AZL A;  4HGA C;  4NFT A;  5B1L D;  3AZJ B;  3UTB C;  4KGC B;  3AYW C;  5GT0 B;  3LZ1 C;  3EPK A;  4G92 C;  3AN2 C;  5AV9 C;  3WKJ A;  3B0D B;  1BH9 A;  3AV1 D;  4WU8 C;  1S32 C;  1T3U A;  2NZD D;  2RIQ A;  3MGS B;  1TZY B;  2ZY3 A;  4HGA B;  5KDM B;  4Z5T C;  4R8P D;  3UTB B;  4J8X A;  1EQZ D;  3AYW B;  3LZ1 B;  4G92 B;  1A7W A;  3AN2 B;  4H9Q B;  4YS3 D;  3TU4 A;  4XZQ A;  4WU8 B;  3X1U A;  5B2I D;  5BS7 A;  1ID3 B;  5B0Z A;  3MGQ A;  2IO5 B;  3NQU A;  3EPL A;  3C1C C;  1M19 A;  5BNV A;  5DNM D;  3IP4 C;  3W96 B;  3O62 A;  1AOI C;  3UTA D;  5F99 D;  1F1E A;  1P3I D;  1P3G A;  3WAA A;  5AV8 A;  2ZM5 A;  3A6N D;  4J8V A;  2ARO A;  5GXQ D;  4KUD D;  2JSS A;  4DQY B;  3REH D;  4CAY B;  4EO5 C;  3C1B A;  1P3M D;  2BYM A;  4H9P B;  3H0L C;  3AV1 C;  3LZ0 D;  2NZD C;  5AV5 B;  5G49 A;  4XUJ C;  4CSR A;  3AFA A;  5B1M D;  1BFM A;  3AZK A;  4YS3 C;  5GSU C;  1U35 A;  2DF4 C;  3KWQ D;  3AV1 B;  3LEL D;  3FDD A;  3WTP C;  1M18 A;  1P34 C;  1KX4 D;  1KX3 D;  4XZQ D;  3AYW A;  3AZM D;  2W8S A;  4QLC B;  4XUJ B;  4WV4 B;  5AV9 A;  5AVC C;  3AZI D;  1F66 C;  2Y2G A;  5DNM C;  3B6F D;  1S32 A;  4WU8 A;  5GT3 C;  3B0C T;  5GSU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...