3MGRC

Binding of rubidium ions to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgrC00
4R8PB 3AZMC 3WTPE 4J8VD 4Z5TB 3MGRC 1S32D 5AY8A 4R8PD 3B0DC 5CP6C 4WU8A 1R4VA 5B40A 1ZLAA 1HTAA 2PYOB 4QLCC 5CPJC 1P3KD 5DNNC 1ID3B 3AV1D 1F66A 5JA4A 4KUDC 5BNXA 1KX4D 3MGSA 1P34A 3UTAC 3AZJA 3MGPA 1P3LC 3AZFA 5CPIB 1AOID 4H9SC 4KHAB 1P3AA 3C1BD 3AYWC 3REKD 1P3MB 5B1LD 4J8XA 5GXQC 5FUGB 1KU5A 5GT3B 4J8UB 4ZUXC 1M1AD 3NQJA 5F99B 4JJND 5GSUA 3AZHD 5CPKB 4LD9C 3AZIA 3W99A 5B33C 4NFTA 1HQ3A 4KGCB 3AZGA 1M19A 3MGQA 3REID 4KGCD 3KWQD 4ZBJC 4XUJB 1P3ID 3A6ND 2F8ND 4M6BA 3AZKA 3UT9D 3LZ0A 4DRAA 1KX3B 3UTBA 3TU4C 3AFAC 1N1JA 5GT0A 3WTPB 3O62A 1M18C 5B24B 1A7WA 4R8PC 1Q9CA 4J8WD 4YS3B 1U35D 3WA9D 4WZSB 1P3PB 1TAFA 1P3FD 4H9RA 4WU9A 2HIOB 5AV8D 1P3KC 3LZ1D 4G91B 3AV1C 4Z66A 3REHD 2PYOC 2YFVA 1TZYB 1ID3C 5B0ZA 3AN2A 3REJB 2NZDB 3RELA 5DNMB 3MGRD 5G49B 3AZMA 1AOIC 3W97B 2AROB 5BO0A 5AVBD 4YM6B 3C1BC 3MVDB 5CP6D 2NQBA 3REKC 3AZEB 2FJ7A 5B31A 4XZQA 3AZLB 4QLCD 3B0CT 5AV6A 4Z2MG 5CPJA 3WAAB 5DNNA 1EQZB 4JJNC 2CV5A 4KUDA 3AZNA 4J8UC 3KUYA 1P3GD 1H3OA 3UTAA 1KX5B 5F99C 1P3LD 5CPKC 3X1SB 3MNND 3KXBD 3REIC 4E45A 1B67A 5B1MB 3AYWD 4KGCC 3X1VA 2CWEA 4X23B 3W98B 3A6NC 3W96D 3LELB 3LJAA 5GXQD 4XUJC 3C1CA 1P3BA 4X23D 3X1UD 5B2ID 4ZUXD 1KX3C 4J8WC 4CSRA 1U35C 4WNNA 4LD9A 5B33D 3WA9C 2BYMA 3V9RA 4YS3C 1P3FC 5B0YA 3AV2A 5B2JA 5AV8C 3LZ1C 1P3OB 3B6GB 5B32B 3R45A 5BNVB 1BH8A 3B6FD 3TU4D 3AFAD 1TZYC 5AVCB 2L5AA 1M18D 4J8VA 1S32A 5AVBC 3REJC 3NQUA 4H9OB 4Z2MH 4R8PA 5JRGB 5DNMC 4Z5TD 5AV9B 3MVDC 3X1TB 5JRGD 3AZEC 3WKJB 1P3KA 2PYOD 3AV1A 1ID3D 1KX4A 1P3GC 1EQZC 4WU8B 5B40B 1ZLAB 3MNNC 3KXBC 1AOIA 5B32G 3C1BA 5CPID 5BT1C 3X1SC 3REKA 1BH9A 2LY8A 3W96C 1F66B 5B1LA 5JA4B 4X23C 5BNXB 3MGSB 3X1UC 1P34B 1P3MD 5B2IC 3LELC 2RVQC 3AZJB 3MGPB 3AZFB 2HUEB 1M1AA 5GT3D 4J8UD 4JJNA 3AZHA 1P3AB 4HGAB 5F99D 5CPKD 4H9PA 4J8XB 3REIA 4G92B 4KGCA 3KWQA 1P3IA 3A6NA 2F8NA 3UT9A 4XUJD 3NQJB 3B6FC 5GSUB 5B32C 3AZIB 3W99B 1HQ3B 1KX3D 3AZGB 1M19B 4Z5TC 5AVCC 3WTPD 5E5AA 3MGQB 4J8WA 5B24D 1U35A 4EO5B 3WA9A 4AWLB 4YS3D 5JRGC 1JFIA 1P3FA 3AZKB 3LZ0B 5AV5A 5AV8A 1P3PD 3X1TC 3LZ1A 3UTBB 2HIOD 3REHA 1N1JB 5GT0B 3O62B 3WKJC 4NE6A 5GT0D 3VH6A 1TZYD 3MGRA 3REJD 1TAFB 4WU8C 2BYKA 4H9RB 5CPIC 5AVBA 4WU9B 5DNMD 5CP6A 3W97D 2NZDD 1ZLAC 2AROD 4YM6D 4Z66B 3MVDD 2YFVB 3AZED 4QLCA 1P3MC 5B0ZB 4Z66D 3AN2B 3AZLD 3RELB 3MGSC 1P34C 3AZMB 5GT3C 3VH6T 3WAAD 5BO0B 3AZJC 1P3GA 1EQZD 2HUEC 3B0DB 4UUZA 2NQBB 1P3LA 1P3AC 2FJ7B 5B31B 4H9SA 4XZQB 1KX5D 3MNNA 4CAYA 3KXBA 2NQBD 5BT1D 3AYWA 3X1SD 5AV6B 4J8XC 5CPJB 5DNNB 3B0CW 5B1MD 3W96A 5KDMA 5GXQA 3W98D 2CV5B 4H9NA 4KUDB 5AV6D 4X23A 3AZNB 3KUYB 3LELD 3X1UA 1H3OB 2YFWA 5B2IA 2RVQD 4ZUXA 3WTPC 3W99C 3AZIC 5B24C 4H9QA 5B33A 1M19C 3X1VB 3LJAB 1P3PC 3C1CB 4AWLC 1P3BB 2HIOC 3LZ0C 4G91C 2JSSA 3UTBC 1P3OD 3B6GD 4CSRB 5GT0C 3O62C 5B32D 3TU4A 3B6FA 4WNNB 3AFAA 4LD9B 2BYMB 3V9RB 1M18A 2NZDC 5B0YB 3AV2B 5B2JB 5AVCD 3W97C 4Z5TA 2AROC 4YM6C 5BS7C 5JRGA 5AV9D 3R45B 4Z66C 3X1TD 1BH8B 3AZLC 2PYOA 3WKJD 5B0ZC 4J8VB 1S32B 3WAAC 5AY8B 3AN2C 1ID3A 3NQUB 3RELC 3KSYA 5AY8D 1KX5C 4WU8D 2NQBC 5CPIA 5B40D 4WV4B 2FJ7C 5B31C 1ZLAD 1P3KB 4XZQC 4KHAA 5B1MC 3AV1B 3W98C 5AV6C 1KX4B 1F66D 1P3MA 2CV5C 3AZNC 3MGSD 1P34D 3KUYC 5FUGA 5GT3A 4J8UA 3AZJD 1AOIB 3MGPD 3C1BB 3AZFD 1WWSA 5F99A 3REKB 5CPKA 1P3AD 1BH9B 5B1LB 3X1VC 3VH5A 1BFMA 4J8XD 5CHLB 3LJAC 3C1CC 1P3BC 1P3OC 3B6GC 1WWIA 4XUJA 1M1AB 4JJNB 3AZHB 2IO5B 5GSUD 1KX3A 3AZID 3W99D 4H9PB 3WTPA 1HQ3D 5B24A 3REIB 3AZGD 1M19D 5B0YC 3AV2C 5B2JC 3KWQB 3MGQD 3VH5T 4YS3A 1P3IB 3A6NB 5AV9C 2F8NB 3UT9B 1P3PA 3AZKD 2HIOA 3LZ0D 3UTBD 3O62D 5E5AB 4J8WB 4J8VC 1S32C 5AY8C 1U35B 1TZYA 3WA9B 1F1EA 1JFIB 3REJA 5E5AD 1P3FB 2NZDA 5B40C 5DNMA 5AV5B 5G49A 3W97A 5AV8B 3VH5W 3LZ1B 2AROA 4WU9D 4YM6A 5BS7A 3MVDA 5C3IB 3REHB 5AV5D 3AZEA 3B0BA 1F66C 2F8NK 3AZLA 3WKJA 1KX4C 5B0ZD 3MGRB 3AN2D 3WAAA 3MGPC 2F8NG 2BYKB 5AVBB 3AZFC 3RELD 4DRBA 5CP6B 3AZMD 1EQZA 4HGAC 1B6WA 4NE3A 1KX5A 4QLCB 3X1SA 5B31D 2FJ7D 4XZQD 1ULYA 5B1LC 4G92C 5B1MA 5CPJD 3W98A 5DNND 3UTAB 3LELA 1P3GB 4UUZB 3VH6W 5GSUC 3AZND 2CV5D 1P3LB 1M1AC 4KUDD 3KUYD 3AZHC 2IO5C 3UTAD 1HQ3C 3MNNB 4CAYB 3KXBB 3AZGC 3AYWB 3MGQC 4EO5C 3W96B 5KDMB 3X1VD 5GXQB 3KWQC 1P3IC 4H9NB 3AZKC 3X1UB 3UT9C 2YFWB 5B2IB 3LJAD 3C1CD 1P3BD 5B31G 4ZUXB 1P3OA 3B6GA 5B32A 4H9QB 5B33B 5BNVA 4NE5A 5E5AC 4LD9D 5AVCA 4WU9C 5B0YD 3AV2D 5B2JD 4H9OA 4ZBJB 5AV5C 2F8NH 5AV9A 3REHC 5C3IC 3X1TA 3B6FB 3TU4B 3AFAB 4E44A 1M18B
chains in the Genus database with same CATH superfamily
4R8PB 3AZMC 3WTPE 4J8VD 4Z5TB 3MGRC 1S32D 5AY8A 3F6TA 4R8PD 3B0DC 5CP6C 4WU8A 1R4VA 3EPLA 5B40A 1ZLAA 2J8PA 1HTAA 2PYOB 4QLCC 5CPJC 1P3KD 5DNNC 1ID3B 3AV1D 1F66A 5JA4A 4KUDC 5BNXA 1KX4D 3MGSA 1P34A 3UTAC 3AZJA 3MGPA 1P3LC 3AZFA 5CPIB 1AOID 4H9SC 4KHAB 1P3AA 3C1BD 3AYWC 3REKD 1P3MB 5B1LD 4J8XA 5GXQC 2ZY2A 5FUGB 1KU5A 5GT3B 4J8UB 4ZUXC 1M1AD 3NQJA 5F99B 4JJND 5GSUA 3AZHD 5CPKB 4LD9C 3AZIA 3W99A 5B33C 4NFTA 2Y2JA 1HQ3A 4KGCB 3AZGA 1M19A 3MGQA 3REID 3H0LC 4KGCD 3KWQD 4ZBJC 4XUJB 1P3ID 3A6ND 2F8ND 4M6BA 3AZKA 3UT9D 3LZ0A 2Y2GA 4DQYB 4DRAA 1W2EA 3UTBA 3TU4C 1KX3B 3AFAC 1N1JA 5GT0A 3WTPB 3O62A 1M18C 5B24B 1A7WA 4R8PC 1Q9CA 4J8WD 4YS3B 1U35D 3WA9D 4WZSB 1P3PB 1TAFA 1P3FD 4H9RA 4WU9A 2HIOB 5AV8D 1P3KC 3LZ1D 4G91B 3AV1C 2XD1A 4Z66A 3REHD 2PYOC 2YFVA 1TZYB 1ID3C 5B0ZA 3AN2A 3REJB 2NZDB 3RELA 5DNMB 3MGRD 5G49B 3AZMA 1AOIC 3W97B 2AROB 5BO0A 5AVBD 4YM6B 3C1BC 3MVDB 5CP6D 2NQBA 3REKC 3AZEB 2FJ7A 5B31A 4XZQA 3AZLB 4QLCD 3B0CT 2Y2MA 5AV6A 4Z2MG 5CPJA 3WAAB 5DNNA 1EQZB 4JJNC 2CV5A 4KUDA 3AZNA 4J8UC 3KUYA 1P3GD 1H3OA 3UTAA 1KX5B 5F99C 1P3LD 5CPKC 3X1SB 4WJ3C 3MNND 3KXBD 3REIC 4E45A 1B67A 5B1MB 3AYWD 4KGCC 3X1VA 2CWEA 4X23B 3W98B 3A6NC 3W96D 3LELB 3LJAA 5GXQD 2G5HC 4XUJC 3C1CA 1P3BA 4X23D 3X1UD 5B2ID 4ZUXD 1KX3C 2Y2OA 4J8WC 4CSRA 2Y2KA 1U35C 4WNNA 4LD9A 5B33D 3WA9C 2BYMA 3V9RA 2RIQA 4YS3C 1P3FC 5B0YA 3AV2A 5B2JA 5AV8C 3LZ1C 1P3OB 3B6GB 5B32B 3R45A 5BNVB 1BH8A 3B6FD 3TU4D 3AFAD 1TZYC 5AVCB 2L5AA 1M18D 4J8VA 1S32A 3EPHA 5AVBC 3REJC 3NQUA 4H9OB 4Z2MH 4R8PA 5JRGB 5DNMC 4Z5TD 5AV9B 3MVDC 3X1TB 5JRGD 3AZEC 3EG5B 3WKJB 2F2AC 1P3KA 3H0MC 2PYOD 3AV1A 1ID3D 1KX4A 1P3GC 1EQZC 4WU8B 1Z2CB 5B40B 1ZLAB 3MNNC 3KXBC 1AOIA 5B32G 3C1BA 5CPID 5BT1C 3X1SC 3REKA 1BH9A 2LY8A 3W96C 1F66B 5B1LA 5JA4B 4X23C 3KFUG 5BNXB 3MGSB 3X1UC 1P34B 1P3MD 5B2IC 3LELC 2RVQC 3AZJB 3MGPB 3AZFB 2HUEB 1M1AA 5GT3D 4J8UD 4JJNA 3AZHA 1P3AB 4HGAB 5F99D 5CPKD 3FDDA 4H9PA 4J8XB 3EPJA 3REIA 3EPKA 4G92B 4KGCA 3KWQA 1P3IA 3A6NA 2F8NA 3UT9A 4XUJD 3NQJB 3B6FC 5GSUB 5B32C 3AZIB 3W99B 1HQ3B 2ZY3A 1KX3D 2Y2HA 3AZGB 1M19B 4Z5TC 5AVCC 3WTPD 5E5AA 3MGQB 4J8WA 5B24D 1U35A 4EO5B 3WA9A 4AWLB 4YS3D 5JRGC 1JFIA 1P3FA 3AZKB 3LZ0B 5AV5A 5AV8A 1P3PD 3X1TC 3LZ1A 3UTBB 2DQNC 2HIOD 3REHA 1N1JB 5GT0B 3O62B 3WKJC 3H0RC 4NE6A 5GT0D 2Y2NA 3VH6A 1TZYD 3MGRA 2Y2LA 3REJD 1TAFB 4WU8C 2BYKA 4H9RB 5CPIC 5AVBA 4WU9B 5DNMD 5CP6A 2Y2QA 3W97D 2NZDD 1ZLAC 2AROD 4YM6D 4Z66B 3MVDD 2YFVB 3AZED 3A1IA 4QLCA 1P3MC 5B0ZB 4Z66D 3AN2B 3AZLD 3RELB 3MGSC 1P34C 3AZMB 5GT3C 3VH6T 3WAAD 5BO0B 3AZJC 3P5JB 1P3GA 1EQZD 2HUEC 3B0DB 4UUZA 2NQBB 1P3LA 1P3AC 2FJ7B 5B31B 4H9SA 4XZQB 1KX5D 3MNNA 4CAYA 3KXBA 2NQBD 5BT1D 3AYWA 2VQRA 3X1SD 2JE5A 5AV6B 4J8XC 5CPJB 5DNNB 3B0CW 5B1MD 3W96A 5KDMA 5GXQA 3W98D 2CV5B 4H9NA 4KUDB 5AV6D 4X23A 3AZNB 3KUYB 3LELD 3X1UA 1H3OB 2YFWA 5B2IA 2RVQD 4ZUXA 3WTPC 3W99C 3AZIC 1T3UA 3A1KA 5B24C 4H9QA 5B33A 1M19C 3X1VB 1PZRA 3LJAB 1P3PC 3C1CB 4AWLC 1P3BB 2HIOC 3LZ0C 4G91C 2JSSA 3UTBC 1P3OD 3B6GD 4CSRB 5GT0C 3O62C 5B32D 3TU4A 3B6FA 4WNNB 3AFAA 4LD9B 2BYMB 3V9RB 1M18A 2NZDC 5B0YB 3AV2B 5B2JB 5AVCD 3W97C 4Z5TA 2AROC 4YM6C 5BS7C 5JRGA 5AV9D 3R45B 4Z66C 3X1TD 1BH8B 3AZLC 2FFFB 2PYOA 3WKJD 5B0ZC 4J8VB 1S32B 3WAAC 5AY8B 3AN2C 1ID3A 3NQUB 3RELC 3KSYA 3IP4C 5AY8D 1KX5C 4WU8D 2NQBC 5CPIA 5B40D 4WV4B 2FJ7C 5B31C 1ZLAD 1P3KB 4XZQC 4KHAA 5B1MC 3AV1B 3W98C 5AV6C 1KX4B 1F66D 1P3MA 2CV5C 3AZNC 3MGSD 1P34D 3KUYC 5FUGA 5GT3A 4J8UA 3AZJD 1AOIB 3MGPD 3C1BB 3AZFD 1WWSA 5F99A 3REKB 5CPKA 1P3AD 1BH9B 5B1LB 3X1VC 3VH5A 1BFMA 4J8XD 5CHLB 3LJAC 3C1CC 1P3BC 1P3OC 3B6GC 1WWIA 4XUJA 2ZY5A 1M1AB 4JJNB 3AZHB 2IO5B 5GSUD 1KX3A 3AZID 3W99D 4H9PB 3WTPA 1HQ3D 5B24A 3REIB 3AZGD 1M19D 5B0YC 3AV2C 5B2JC 3KWQB 3MGQD 3VH5T 4YS3A 1P3IB 3A6NB 5AV9C 2F8NB 3UT9B 1P3PA 3AZKD 2HIOA 3LZ0D 2ZY4A 3UTBD 3O62D 5E5AB 4J8WB 4J8VC 1S32C 5AY8C 1U35B 1TZYA 3WA9B 1F1EA 2Y2IA 1JFIB 3REJA 5E5AD 1P3FB 2NZDA 5B40C 5DNMA 5G49A 3W97A 5AV8B 5AV5B 3VH5W 3LZ1B 2AROA 4WU9D 4YM6A 5BS7A 3MVDA 5C3IB 3REHB 5AV5D 3AZEA 3B0BA 1F66C 4UPKA 2F8NK 3AZLA 2UWXA 3WKJA 2DF4C 1KX4C 5B0ZD 3MGRB 3AN2D 3WAAA 3MGPC 2F8NG 2BYKB 2W8SA 5AVBB 3RELD 3AZFC 4DRBA 2JCHA 5CP6B 3AZMD 1EQZA 4HGAC 1B6WA 4NE3A 1KX5A 4QLCB 3X1SA 5B31D 2FJ7D 4XZQD 1ULYA 5B1LC 4G92C 5B1MA 5CPJD 3W98A 2XD5A 2G5IC 5DNND 3UTAB 3LELA 1P3GB 4UUZB 3VH6W 5GSUC 3AZND 2CV5D 1P3LB 1M1AC 4KUDD 3KUYD 3AZHC 2BG1A 2IO5C 3UTAD 1HQ3C 3MNNB 4CAYB 3KXBB 3AZGC 3AYWB 3MGQC 4EO5C 2Y2PA 3W96B 5KDMB 3X1VD 5GXQB 3KWQC 1P3IC 4H9NB 3AZKC 3X1UB 3UT9C 2YFWB 5B2IB 3LJAD 3C1CD 1P3BD 5B31G 4ZUXB 1P3OA 3B6GA 5B32A 4H9QB 5B33B 5BNVA 4NE5A 5E5AC 4LD9D 5AVCA 3AL0C 4WU9C 5B0YD 3AV2D 5B2JD 4H9OA 4ZBJB 5AV5C 2F8NH 5AV9A 3REHC 5C3IC 3X1TA 3B6FB 3TU4B 2ZM5A 3AFAB 4E44A 1M18B
chains in the Genus database with same CATH topology
4R8PB 3AZMC 3WTPE 4J8VD 4Z5TB 3MGRC 1S32D 5AY8A 3F6TA 4R8PD 3B0DC 5CP6C 4WU8A 1R4VA 3EPLA 5B40A 1ZLAA 2J8PA 1HTAA 2PYOB 4QLCC 5CPJC 1P3KD 5DNNC 1ID3B 3AV1D 1F66A 5JA4A 4KUDC 5BNXA 1KX4D 3MGSA 1P34A 3UTAC 3AZJA 3MGPA 1P3LC 3AZFA 5CPIB 1AOID 4H9SC 4KHAB 1P3AA 3C1BD 3AYWC 3REKD 1P3MB 5B1LD 4J8XA 5GXQC 2ZY2A 5FUGB 1KU5A 5GT3B 4J8UB 4ZUXC 1M1AD 3NQJA 5F99B 4JJND 5GSUA 3AZHD 5CPKB 4LD9C 3AZIA 3W99A 5B33C 4NFTA 2Y2JA 1HQ3A 4KGCB 3AZGA 1M19A 3MGQA 3REID 3H0LC 4KGCD 3KWQD 4ZBJC 4XUJB 1P3ID 3A6ND 2F8ND 4M6BA 3AZKA 3UT9D 3LZ0A 2Y2GA 4DQYB 4DRAA 1W2EA 3UTBA 3TU4C 1KX3B 3AFAC 1N1JA 5GT0A 3WTPB 3O62A 1M18C 5B24B 1A7WA 4R8PC 1Q9CA 4J8WD 4YS3B 1U35D 3WA9D 4WZSB 1P3PB 1TAFA 1P3FD 4H9RA 4WU9A 2HIOB 5AV8D 1P3KC 3LZ1D 4G91B 3AV1C 2XD1A 4Z66A 3REHD 2PYOC 2YFVA 1TZYB 1ID3C 5B0ZA 3AN2A 3REJB 2NZDB 3RELA 5DNMB 3MGRD 5G49B 3AZMA 1AOIC 3W97B 2AROB 5BO0A 5AVBD 4YM6B 3C1BC 3MVDB 5CP6D 2NQBA 3REKC 3AZEB 2FJ7A 5B31A 4XZQA 3AZLB 4QLCD 3B0CT 2Y2MA 5AV6A 4Z2MG 5CPJA 3WAAB 5DNNA 1EQZB 4JJNC 2CV5A 4KUDA 3AZNA 4J8UC 3KUYA 1P3GD 1H3OA 3UTAA 1KX5B 5F99C 1P3LD 5CPKC 3X1SB 4WJ3C 3MNND 3KXBD 3REIC 4E45A 1B67A 5B1MB 3AYWD 4KGCC 3X1VA 2CWEA 4X23B 3W98B 3A6NC 3W96D 3LELB 3LJAA 5GXQD 2G5HC 4XUJC 3C1CA 1P3BA 4X23D 3X1UD 5B2ID 4ZUXD 1KX3C 2Y2OA 4J8WC 4CSRA 2Y2KA 1U35C 4WNNA 4LD9A 5B33D 3WA9C 2BYMA 3V9RA 2RIQA 4YS3C 1P3FC 5B0YA 3AV2A 5B2JA 5AV8C 3LZ1C 1P3OB 3B6GB 5B32B 3R45A 5BNVB 1BH8A 3B6FD 3TU4D 3AFAD 1TZYC 5AVCB 2L5AA 1M18D 4J8VA 1S32A 3EPHA 5AVBC 3REJC 3NQUA 4H9OB 4Z2MH 4R8PA 5JRGB 5DNMC 4Z5TD 5AV9B 3MVDC 3X1TB 5JRGD 3AZEC 3EG5B 3WKJB 2F2AC 1P3KA 3H0MC 2PYOD 3AV1A 1ID3D 1KX4A 1P3GC 1EQZC 4WU8B 1Z2CB 5B40B 1ZLAB 3MNNC 3KXBC 1AOIA 5B32G 3C1BA 5CPID 5BT1C 3X1SC 3REKA 1BH9A 2LY8A 3W96C 1F66B 5B1LA 5JA4B 4X23C 3KFUG 5BNXB 3MGSB 3X1UC 1P34B 1P3MD 5B2IC 3LELC 2RVQC 3AZJB 3MGPB 3AZFB 2HUEB 1M1AA 5GT3D 4J8UD 4JJNA 3AZHA 1P3AB 4HGAB 5F99D 5CPKD 3FDDA 4H9PA 4J8XB 3EPJA 3REIA 3EPKA 4G92B 4KGCA 3KWQA 1P3IA 3A6NA 2F8NA 3UT9A 4XUJD 3NQJB 3B6FC 5GSUB 5B32C 3AZIB 3W99B 1HQ3B 2ZY3A 1KX3D 2Y2HA 3AZGB 1M19B 4Z5TC 5AVCC 3WTPD 5E5AA 3MGQB 4J8WA 5B24D 1U35A 4EO5B 3WA9A 4AWLB 4YS3D 5JRGC 1JFIA 1P3FA 3AZKB 3LZ0B 5AV5A 5AV8A 1P3PD 3X1TC 3LZ1A 3UTBB 2DQNC 2HIOD 3REHA 1N1JB 5GT0B 3O62B 3WKJC 3H0RC 4NE6A 5GT0D 2Y2NA 3VH6A 1TZYD 3MGRA 2Y2LA 3REJD 1TAFB 4WU8C 2BYKA 4H9RB 5CPIC 5AVBA 4WU9B 5DNMD 5CP6A 2Y2QA 3W97D 2NZDD 1ZLAC 2AROD 4YM6D 4Z66B 3MVDD 2YFVB 3AZED 3A1IA 4QLCA 1P3MC 5B0ZB 4Z66D 3AN2B 3AZLD 3RELB 3MGSC 1P34C 3AZMB 5GT3C 3VH6T 3WAAD 5BO0B 3AZJC 3P5JB 1P3GA 1EQZD 2HUEC 3B0DB 4UUZA 2NQBB 1P3LA 1P3AC 2FJ7B 5B31B 4H9SA 4XZQB 1KX5D 3MNNA 4CAYA 3KXBA 2NQBD 5BT1D 3AYWA 2VQRA 3X1SD 2JE5A 5AV6B 4J8XC 5CPJB 5DNNB 3B0CW 5B1MD 3W96A 5KDMA 5GXQA 3W98D 2CV5B 4H9NA 4KUDB 5AV6D 4X23A 3AZNB 3KUYB 3LELD 3X1UA 1H3OB 2YFWA 5B2IA 2RVQD 4ZUXA 3WTPC 3W99C 3AZIC 1T3UA 3A1KA 5B24C 4H9QA 5B33A 1M19C 3X1VB 1PZRA 3LJAB 1P3PC 3C1CB 4AWLC 1P3BB 2HIOC 3LZ0C 4G91C 2JSSA 3UTBC 1P3OD 3B6GD 4CSRB 5GT0C 3O62C 5B32D 3TU4A 3B6FA 4WNNB 3AFAA 4LD9B 2BYMB 3V9RB 1M18A 2NZDC 5B0YB 3AV2B 5B2JB 5AVCD 3W97C 4Z5TA 2AROC 4YM6C 5BS7C 5JRGA 5AV9D 3R45B 4Z66C 3X1TD 1BH8B 3AZLC 2FFFB 2PYOA 3WKJD 5B0ZC 4J8VB 1S32B 3WAAC 5AY8B 3AN2C 1ID3A 3NQUB 3RELC 3KSYA 3IP4C 5AY8D 1KX5C 4WU8D 2NQBC 5CPIA 5B40D 4WV4B 2FJ7C 5B31C 1ZLAD 1P3KB 4XZQC 4KHAA 5B1MC 3AV1B 3W98C 5AV6C 1KX4B 1F66D 1P3MA 2CV5C 3AZNC 3MGSD 1P34D 3KUYC 5FUGA 5GT3A 4J8UA 3AZJD 1AOIB 3MGPD 3C1BB 3AZFD 1WWSA 5F99A 3REKB 5CPKA 1P3AD 1BH9B 5B1LB 3X1VC 3VH5A 1BFMA 4J8XD 5CHLB 3LJAC 3C1CC 1P3BC 1P3OC 3B6GC 1WWIA 4XUJA 2ZY5A 1M1AB 4JJNB 3AZHB 2IO5B 5GSUD 1KX3A 3AZID 3W99D 4H9PB 3WTPA 1HQ3D 5B24A 3REIB 3AZGD 1M19D 5B0YC 3AV2C 5B2JC 3KWQB 3MGQD 3VH5T 4YS3A 1P3IB 3A6NB 5AV9C 2F8NB 3UT9B 1P3PA 3AZKD 2HIOA 3LZ0D 2ZY4A 3UTBD 3O62D 5E5AB 4J8WB 4J8VC 1S32C 5AY8C 1U35B 1TZYA 3WA9B 1F1EA 2Y2IA 1JFIB 3REJA 5E5AD 1P3FB 2NZDA 5B40C 5DNMA 5G49A 3W97A 5AV8B 5AV5B 3VH5W 3LZ1B 2AROA 4WU9D 4YM6A 5BS7A 3MVDA 5C3IB 3REHB 5AV5D 3AZEA 3B0BA 1F66C 4UPKA 2F8NK 3AZLA 2UWXA 3WKJA 2DF4C 1KX4C 5B0ZD 3MGRB 3AN2D 3WAAA 3MGPC 2F8NG 2BYKB 2W8SA 5AVBB 3RELD 3AZFC 4DRBA 2JCHA 5CP6B 3AZMD 1EQZA 4HGAC 1B6WA 4NE3A 1KX5A 4QLCB 3X1SA 5B31D 2FJ7D 4XZQD 1ULYA 5B1LC 4G92C 5B1MA 5CPJD 3W98A 2XD5A 2G5IC 5DNND 3UTAB 3LELA 1P3GB 4UUZB 3VH6W 5GSUC 3AZND 2CV5D 1P3LB 1M1AC 4KUDD 3KUYD 3AZHC 2BG1A 2IO5C 3UTAD 1HQ3C 3MNNB 4CAYB 3KXBB 3AZGC 3AYWB 3MGQC 4EO5C 2Y2PA 3W96B 5KDMB 3X1VD 5GXQB 3KWQC 1P3IC 4H9NB 3AZKC 3X1UB 3UT9C 2YFWB 5B2IB 3LJAD 3C1CD 1P3BD 5B31G 4ZUXB 1P3OA 3B6GA 5B32A 4H9QB 5B33B 5BNVA 4NE5A 5E5AC 4LD9D 5AVCA 3AL0C 4WU9C 5B0YD 3AV2D 5B2JD 4H9OA 4ZBJB 5AV5C 2F8NH 5AV9A 3REHC 5C3IC 3X1TA 3B6FB 3TU4B 2ZM5A 3AFAB 4E44A 1M18B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8P B;  3AZM C;  3WTP E;  4J8V D;  4Z5T B;  3MGR C;  1S32 D;  5AY8 A;  4R8P D;  3B0D C;  5CP6 C;  4WU8 A;  1R4V A;  5B40 A;  1ZLA A;  1HTA A;  2PYO B;  4QLC C;  5CPJ C;  1P3K D;  5DNN C;  1ID3 B;  3AV1 D;  1F66 A;  5JA4 A;  4KUD C;  5BNX A;  1KX4 D;  3MGS A;  1P34 A;  3UTA C;  3AZJ A;  3MGP A;  1P3L C;  3AZF A;  5CPI B;  1AOI D;  4H9S C;  4KHA B;  1P3A A;  3C1B D;  3AYW C;  3REK D;  1P3M B;  5B1L D;  4J8X A;  5GXQ C;  5FUG B;  1KU5 A;  5GT3 B;  4J8U B;  4ZUX C;  1M1A D;  3NQJ A;  5F99 B;  4JJN D;  5GSU A;  3AZH D;  5CPK B;  4LD9 C;  3AZI A;  3W99 A;  5B33 C;  4NFT A;  1HQ3 A;  4KGC B;  3AZG A;  1M19 A;  3MGQ A;  3REI D;  4KGC D;  3KWQ D;  4ZBJ C;  4XUJ B;  1P3I D;  3A6N D;  2F8N D;  4M6B A;  3AZK A;  3UT9 D;  3LZ0 A;  4DRA A;  1KX3 B;  3UTB A;  3TU4 C;  3AFA C;  1N1J A;  5GT0 A;  3WTP B;  3O62 A;  1M18 C;  5B24 B;  1A7W A;  4R8P C;  1Q9C A;  4J8W D;  4YS3 B;  1U35 D;  3WA9 D;  4WZS B;  1P3P B;  1TAF A;  1P3F D;  4H9R A;  4WU9 A;  2HIO B;  5AV8 D;  1P3K C;  3LZ1 D;  4G91 B;  3AV1 C;  4Z66 A;  3REH D;  2PYO C;  2YFV A;  1TZY B;  1ID3 C;  5B0Z A;  3AN2 A;  3REJ B;  2NZD B;  3REL A;  5DNM B;  3MGR D;  5G49 B;  3AZM A;  1AOI C;  3W97 B;  2ARO B;  5BO0 A;  5AVB D;  4YM6 B;  3C1B C;  3MVD B;  5CP6 D;  2NQB A;  3REK C;  3AZE B;  2FJ7 A;  5B31 A;  4XZQ A;  3AZL B;  4QLC D;  3B0C T;  5AV6 A;  4Z2M G;  5CPJ A;  3WAA B;  5DNN A;  1EQZ B;  4JJN C;  2CV5 A;  4KUD A;  3AZN A;  4J8U C;  3KUY A;  1P3G D;  1H3O A;  3UTA A;  1KX5 B;  5F99 C;  1P3L D;  5CPK C;  3X1S B;  3MNN D;  3KXB D;  3REI C;  4E45 A;  1B67 A;  5B1M B;  3AYW D;  4KGC C;  3X1V A;  2CWE A;  4X23 B;  3W98 B;  3A6N C;  3W96 D;  3LEL B;  3LJA A;  5GXQ D;  4XUJ C;  3C1C A;  1P3B A;  4X23 D;  3X1U D;  5B2I D;  4ZUX D;  1KX3 C;  4J8W C;  4CSR A;  1U35 C;  4WNN A;  4LD9 A;  5B33 D;  3WA9 C;  2BYM A;  3V9R A;  4YS3 C;  1P3F C;  5B0Y A;  3AV2 A;  5B2J A;  5AV8 C;  3LZ1 C;  1P3O B;  3B6G B;  5B32 B;  3R45 A;  5BNV B;  1BH8 A;  3B6F D;  3TU4 D;  3AFA D;  1TZY C;  5AVC B;  2L5A A;  1M18 D;  4J8V A;  1S32 A;  5AVB C;  3REJ C;  3NQU A;  4H9O B;  4Z2M H;  4R8P A;  5JRG B;  5DNM C;  4Z5T D;  5AV9 B;  3MVD C;  3X1T B;  5JRG D;  3AZE C;  3WKJ B;  1P3K A;  2PYO D;  3AV1 A;  1ID3 D;  1KX4 A;  1P3G C;  1EQZ C;  4WU8 B;  5B40 B;  1ZLA B;  3MNN C;  3KXB C;  1AOI A;  5B32 G;  3C1B A;  5CPI D;  5BT1 C;  3X1S C;  3REK A;  1BH9 A;  2LY8 A;  3W96 C;  1F66 B;  5B1L A;  5JA4 B;  4X23 C;  5BNX B;  3MGS B;  3X1U C;  1P34 B;  1P3M D;  5B2I C;  3LEL C;  2RVQ C;  3AZJ B;  3MGP B;  3AZF B;  2HUE B;  1M1A A;  5GT3 D;  4J8U D;  4JJN A;  3AZH A;  1P3A B;  4HGA B;  5F99 D;  5CPK D;  4H9P A;  4J8X B;  3REI A;  4G92 B;  4KGC A;  3KWQ A;  1P3I A;  3A6N A;  2F8N A;  3UT9 A;  4XUJ D;  3NQJ B;  3B6F C;  5GSU B;  5B32 C;  3AZI B;  3W99 B;  1HQ3 B;  1KX3 D;  3AZG B;  1M19 B;  4Z5T C;  5AVC C;  3WTP D;  5E5A A;  3MGQ B;  4J8W A;  5B24 D;  1U35 A;  4EO5 B;  3WA9 A;  4AWL B;  4YS3 D;  5JRG C;  1JFI A;  1P3F A;  3AZK B;  3LZ0 B;  5AV5 A;  5AV8 A;  1P3P D;  3X1T C;  3LZ1 A;  3UTB B;  2HIO D;  3REH A;  1N1J B;  5GT0 B;  3O62 B;  3WKJ C;  4NE6 A;  5GT0 D;  3VH6 A;  1TZY D;  3MGR A;  3REJ D;  1TAF B;  4WU8 C;  2BYK A;  4H9R B;  5CPI C;  5AVB A;  4WU9 B;  5DNM D;  5CP6 A;  3W97 D;  2NZD D;  1ZLA C;  2ARO D;  4YM6 D;  4Z66 B;  3MVD D;  2YFV B;  3AZE D;  4QLC A;  1P3M C;  5B0Z B;  4Z66 D;  3AN2 B;  3AZL D;  3REL B;  3MGS C;  1P34 C;  3AZM B;  5GT3 C;  3VH6 T;  3WAA D;  5BO0 B;  3AZJ C;  1P3G A;  1EQZ D;  2HUE C;  3B0D B;  4UUZ A;  2NQB B;  1P3L A;  1P3A C;  2FJ7 B;  5B31 B;  4H9S A;  4XZQ B;  1KX5 D;  3MNN A;  4CAY A;  3KXB A;  2NQB D;  5BT1 D;  3AYW A;  3X1S D;  5AV6 B;  4J8X C;  5CPJ B;  5DNN B;  3B0C W;  5B1M D;  3W96 A;  5KDM A;  5GXQ A;  3W98 D;  2CV5 B;  4H9N A;  4KUD B;  5AV6 D;  4X23 A;  3AZN B;  3KUY B;  3LEL D;  3X1U A;  1H3O B;  2YFW A;  5B2I A;  2RVQ D;  4ZUX A;  3WTP C;  3W99 C;  3AZI C;  5B24 C;  4H9Q A;  5B33 A;  1M19 C;  3X1V B;  3LJA B;  1P3P C;  3C1C B;  4AWL C;  1P3B B;  2HIO C;  3LZ0 C;  4G91 C;  2JSS A;  3UTB C;  1P3O D;  3B6G D;  4CSR B;  5GT0 C;  3O62 C;  5B32 D;  3TU4 A;  3B6F A;  4WNN B;  3AFA A;  4LD9 B;  2BYM B;  3V9R B;  1M18 A;  2NZD C;  5B0Y B;  3AV2 B;  5B2J B;  5AVC D;  3W97 C;  4Z5T A;  2ARO C;  4YM6 C;  5BS7 C;  5JRG A;  5AV9 D;  3R45 B;  4Z66 C;  3X1T D;  1BH8 B;  3AZL C;  2PYO A;  3WKJ D;  5B0Z C;  4J8V B;  1S32 B;  3WAA C;  5AY8 B;  3AN2 C;  1ID3 A;  3NQU B;  3REL C;  3KSY A;  5AY8 D;  1KX5 C;  4WU8 D;  2NQB C;  5CPI A;  5B40 D;  4WV4 B;  2FJ7 C;  5B31 C;  1ZLA D;  1P3K B;  4XZQ C;  4KHA A;  5B1M C;  3AV1 B;  3W98 C;  5AV6 C;  1KX4 B;  1F66 D;  1P3M A;  2CV5 C;  3AZN C;  3MGS D;  1P34 D;  3KUY C;  5FUG A;  5GT3 A;  4J8U A;  3AZJ D;  1AOI B;  3MGP D;  3C1B B;  3AZF D;  1WWS A;  5F99 A;  3REK B;  5CPK A;  1P3A D;  1BH9 B;  5B1L B;  3X1V C;  3VH5 A;  1BFM A;  4J8X D;  5CHL B;  3LJA C;  3C1C C;  1P3B C;  1P3O C;  3B6G C;  1WWI A;  4XUJ A;  1M1A B;  4JJN B;  3AZH B;  2IO5 B;  5GSU D;  1KX3 A;  3AZI D;  3W99 D;  4H9P B;  3WTP A;  1HQ3 D;  5B24 A;  3REI B;  3AZG D;  1M19 D;  5B0Y C;  3AV2 C;  5B2J C;  3KWQ B;  3MGQ D;  3VH5 T;  4YS3 A;  1P3I B;  3A6N B;  5AV9 C;  2F8N B;  3UT9 B;  1P3P A;  3AZK D;  2HIO A;  3LZ0 D;  3UTB D;  3O62 D;  5E5A B;  4J8W B;  4J8V C;  1S32 C;  5AY8 C;  1U35 B;  1TZY A;  3WA9 B;  1F1E A;  1JFI B;  3REJ A;  5E5A D;  1P3F B;  2NZD A;  5B40 C;  5DNM A;  5AV5 B;  5G49 A;  3W97 A;  5AV8 B;  3VH5 W;  3LZ1 B;  2ARO A;  4WU9 D;  4YM6 A;  5BS7 A;  3MVD A;  5C3I B;  3REH B;  5AV5 D;  3AZE A;  3B0B A;  1F66 C;  2F8N K;  3AZL A;  3WKJ A;  1KX4 C;  5B0Z D;  3MGR B;  3AN2 D;  3WAA A;  3MGP C;  2F8N G;  2BYK B;  5AVB B;  3AZF C;  3REL D;  4DRB A;  5CP6 B;  3AZM D;  1EQZ A;  4HGA C;  1B6W A;  4NE3 A;  1KX5 A;  4QLC B;  3X1S A;  5B31 D;  2FJ7 D;  4XZQ D;  1ULY A;  5B1L C;  4G92 C;  5B1M A;  5CPJ D;  3W98 A;  5DNN D;  3UTA B;  3LEL A;  1P3G B;  4UUZ B;  3VH6 W;  5GSU C;  3AZN D;  2CV5 D;  1P3L B;  1M1A C;  4KUD D;  3KUY D;  3AZH C;  2IO5 C;  3UTA D;  1HQ3 C;  3MNN B;  4CAY B;  3KXB B;  3AZG C;  3AYW B;  3MGQ C;  4EO5 C;  3W96 B;  5KDM B;  3X1V D;  5GXQ B;  3KWQ C;  1P3I C;  4H9N B;  3AZK C;  3X1U B;  3UT9 C;  2YFW B;  5B2I B;  3LJA D;  3C1C D;  1P3B D;  5B31 G;  4ZUX B;  1P3O A;  3B6G A;  5B32 A;  4H9Q B;  5B33 B;  5BNV A;  4NE5 A;  5E5A C;  4LD9 D;  5AVC A;  4WU9 C;  5B0Y D;  3AV2 D;  5B2J D;  4H9O A;  4ZBJ B;  5AV5 C;  2F8N H;  5AV9 A;  3REH C;  5C3I C;  3X1T A;  3B6F B;  3TU4 B;  3AFA B;  4E44 A;  1M18 B; 
#chains in the Genus database with same CATH topology
 4R8P B;  3AZM C;  3WTP E;  4J8V D;  4Z5T B;  3MGR C;  1S32 D;  5AY8 A;  3F6T A;  4R8P D;  3B0D C;  5CP6 C;  4WU8 A;  1R4V A;  3EPL A;  5B40 A;  1ZLA A;  2J8P A;  1HTA A;  2PYO B;  4QLC C;  5CPJ C;  1P3K D;  5DNN C;  1ID3 B;  3AV1 D;  1F66 A;  5JA4 A;  4KUD C;  5BNX A;  1KX4 D;  3MGS A;  1P34 A;  3UTA C;  3AZJ A;  3MGP A;  1P3L C;  3AZF A;  5CPI B;  1AOI D;  4H9S C;  4KHA B;  1P3A A;  3C1B D;  3AYW C;  3REK D;  1P3M B;  5B1L D;  4J8X A;  5GXQ C;  2ZY2 A;  5FUG B;  1KU5 A;  5GT3 B;  4J8U B;  4ZUX C;  1M1A D;  3NQJ A;  5F99 B;  4JJN D;  5GSU A;  3AZH D;  5CPK B;  4LD9 C;  3AZI A;  3W99 A;  5B33 C;  4NFT A;  2Y2J A;  1HQ3 A;  4KGC B;  3AZG A;  1M19 A;  3MGQ A;  3REI D;  3H0L C;  4KGC D;  3KWQ D;  4ZBJ C;  4XUJ B;  1P3I D;  3A6N D;  2F8N D;  4M6B A;  3AZK A;  3UT9 D;  3LZ0 A;  2Y2G A;  4DQY B;  4DRA A;  1W2E A;  3UTB A;  3TU4 C;  1KX3 B;  3AFA C;  1N1J A;  5GT0 A;  3WTP B;  3O62 A;  1M18 C;  5B24 B;  1A7W A;  4R8P C;  1Q9C A;  4J8W D;  4YS3 B;  1U35 D;  3WA9 D;  4WZS B;  1P3P B;  1TAF A;  1P3F D;  4H9R A;  4WU9 A;  2HIO B;  5AV8 D;  1P3K C;  3LZ1 D;  4G91 B;  3AV1 C;  2XD1 A;  4Z66 A;  3REH D;  2PYO C;  2YFV A;  1TZY B;  1ID3 C;  5B0Z A;  3AN2 A;  3REJ B;  2NZD B;  3REL A;  5DNM B;  3MGR D;  5G49 B;  3AZM A;  1AOI C;  3W97 B;  2ARO B;  5BO0 A;  5AVB D;  4YM6 B;  3C1B C;  3MVD B;  5CP6 D;  2NQB A;  3REK C;  3AZE B;  2FJ7 A;  5B31 A;  4XZQ A;  3AZL B;  4QLC D;  3B0C T;  2Y2M A;  5AV6 A;  4Z2M G;  5CPJ A;  3WAA B;  5DNN A;  1EQZ B;  4JJN C;  2CV5 A;  4KUD A;  3AZN A;  4J8U C;  3KUY A;  1P3G D;  1H3O A;  3UTA A;  1KX5 B;  5F99 C;  1P3L D;  5CPK C;  3X1S B;  4WJ3 C;  3MNN D;  3KXB D;  3REI C;  4E45 A;  1B67 A;  5B1M B;  3AYW D;  4KGC C;  3X1V A;  2CWE A;  4X23 B;  3W98 B;  3A6N C;  3W96 D;  3LEL B;  3LJA A;  5GXQ D;  2G5H C;  4XUJ C;  3C1C A;  1P3B A;  4X23 D;  3X1U D;  5B2I D;  4ZUX D;  1KX3 C;  2Y2O A;  4J8W C;  4CSR A;  2Y2K A;  1U35 C;  4WNN A;  4LD9 A;  5B33 D;  3WA9 C;  2BYM A;  3V9R A;  2RIQ A;  4YS3 C;  1P3F C;  5B0Y A;  3AV2 A;  5B2J A;  5AV8 C;  3LZ1 C;  1P3O B;  3B6G B;  5B32 B;  3R45 A;  5BNV B;  1BH8 A;  3B6F D;  3TU4 D;  3AFA D;  1TZY C;  5AVC B;  2L5A A;  1M18 D;  4J8V A;  1S32 A;  3EPH A;  5AVB C;  3REJ C;  3NQU A;  4H9O B;  4Z2M H;  4R8P A;  5JRG B;  5DNM C;  4Z5T D;  5AV9 B;  3MVD C;  3X1T B;  5JRG D;  3AZE C;  3EG5 B;  3WKJ B;  2F2A C;  1P3K A;  3H0M C;  2PYO D;  3AV1 A;  1ID3 D;  1KX4 A;  1P3G C;  1EQZ C;  4WU8 B;  1Z2C B;  5B40 B;  1ZLA B;  3MNN C;  3KXB C;  1AOI A;  5B32 G;  3C1B A;  5CPI D;  5BT1 C;  3X1S C;  3REK A;  1BH9 A;  2LY8 A;  3W96 C;  1F66 B;  5B1L A;  5JA4 B;  4X23 C;  3KFU G;  5BNX B;  3MGS B;  3X1U C;  1P34 B;  1P3M D;  5B2I C;  3LEL C;  2RVQ C;  3AZJ B;  3MGP B;  3AZF B;  2HUE B;  1M1A A;  5GT3 D;  4J8U D;  4JJN A;  3AZH A;  1P3A B;  4HGA B;  5F99 D;  5CPK D;  3FDD A;  4H9P A;  4J8X B;  3EPJ A;  3REI A;  3EPK A;  4G92 B;  4KGC A;  3KWQ A;  1P3I A;  3A6N A;  2F8N A;  3UT9 A;  4XUJ D;  3NQJ B;  3B6F C;  5GSU B;  5B32 C;  3AZI B;  3W99 B;  1HQ3 B;  2ZY3 A;  1KX3 D;  2Y2H A;  3AZG B;  1M19 B;  4Z5T C;  5AVC C;  3WTP D;  5E5A A;  3MGQ B;  4J8W A;  5B24 D;  1U35 A;  4EO5 B;  3WA9 A;  4AWL B;  4YS3 D;  5JRG C;  1JFI A;  1P3F A;  3AZK B;  3LZ0 B;  5AV5 A;  5AV8 A;  1P3P D;  3X1T C;  3LZ1 A;  3UTB B;  2DQN C;  2HIO D;  3REH A;  1N1J B;  5GT0 B;  3O62 B;  3WKJ C;  3H0R C;  4NE6 A;  5GT0 D;  2Y2N A;  3VH6 A;  1TZY D;  3MGR A;  2Y2L A;  3REJ D;  1TAF B;  4WU8 C;  2BYK A;  4H9R B;  5CPI C;  5AVB A;  4WU9 B;  5DNM D;  5CP6 A;  2Y2Q A;  3W97 D;  2NZD D;  1ZLA C;  2ARO D;  4YM6 D;  4Z66 B;  3MVD D;  2YFV B;  3AZE D;  3A1I A;  4QLC A;  1P3M C;  5B0Z B;  4Z66 D;  3AN2 B;  3AZL D;  3REL B;  3MGS C;  1P34 C;  3AZM B;  5GT3 C;  3VH6 T;  3WAA D;  5BO0 B;  3AZJ C;  3P5J B;  1P3G A;  1EQZ D;  2HUE C;  3B0D B;  4UUZ A;  2NQB B;  1P3L A;  1P3A C;  2FJ7 B;  5B31 B;  4H9S A;  4XZQ B;  1KX5 D;  3MNN A;  4CAY A;  3KXB A;  2NQB D;  5BT1 D;  3AYW A;  2VQR A;  3X1S D;  2JE5 A;  5AV6 B;  4J8X C;  5CPJ B;  5DNN B;  3B0C W;  5B1M D;  3W96 A;  5KDM A;  5GXQ A;  3W98 D;  2CV5 B;  4H9N A;  4KUD B;  5AV6 D;  4X23 A;  3AZN B;  3KUY B;  3LEL D;  3X1U A;  1H3O B;  2YFW A;  5B2I A;  2RVQ D;  4ZUX A;  3WTP C;  3W99 C;  3AZI C;  1T3U A;  3A1K A;  5B24 C;  4H9Q A;  5B33 A;  1M19 C;  3X1V B;  1PZR A;  3LJA B;  1P3P C;  3C1C B;  4AWL C;  1P3B B;  2HIO C;  3LZ0 C;  4G91 C;  2JSS A;  3UTB C;  1P3O D;  3B6G D;  4CSR B;  5GT0 C;  3O62 C;  5B32 D;  3TU4 A;  3B6F A;  4WNN B;  3AFA A;  4LD9 B;  2BYM B;  3V9R B;  1M18 A;  2NZD C;  5B0Y B;  3AV2 B;  5B2J B;  5AVC D;  3W97 C;  4Z5T A;  2ARO C;  4YM6 C;  5BS7 C;  5JRG A;  5AV9 D;  3R45 B;  4Z66 C;  3X1T D;  1BH8 B;  3AZL C;  2FFF B;  2PYO A;  3WKJ D;  5B0Z C;  4J8V B;  1S32 B;  3WAA C;  5AY8 B;  3AN2 C;  1ID3 A;  3NQU B;  3REL C;  3KSY A;  3IP4 C;  5AY8 D;  1KX5 C;  4WU8 D;  2NQB C;  5CPI A;  5B40 D;  4WV4 B;  2FJ7 C;  5B31 C;  1ZLA D;  1P3K B;  4XZQ C;  4KHA A;  5B1M C;  3AV1 B;  3W98 C;  5AV6 C;  1KX4 B;  1F66 D;  1P3M A;  2CV5 C;  3AZN C;  3MGS D;  1P34 D;  3KUY C;  5FUG A;  5GT3 A;  4J8U A;  3AZJ D;  1AOI B;  3MGP D;  3C1B B;  3AZF D;  1WWS A;  5F99 A;  3REK B;  5CPK A;  1P3A D;  1BH9 B;  5B1L B;  3X1V C;  3VH5 A;  1BFM A;  4J8X D;  5CHL B;  3LJA C;  3C1C C;  1P3B C;  1P3O C;  3B6G C;  1WWI A;  4XUJ A;  2ZY5 A;  1M1A B;  4JJN B;  3AZH B;  2IO5 B;  5GSU D;  1KX3 A;  3AZI D;  3W99 D;  4H9P B;  3WTP A;  1HQ3 D;  5B24 A;  3REI B;  3AZG D;  1M19 D;  5B0Y C;  3AV2 C;  5B2J C;  3KWQ B;  3MGQ D;  3VH5 T;  4YS3 A;  1P3I B;  3A6N B;  5AV9 C;  2F8N B;  3UT9 B;  1P3P A;  3AZK D;  2HIO A;  3LZ0 D;  2ZY4 A;  3UTB D;  3O62 D;  5E5A B;  4J8W B;  4J8V C;  1S32 C;  5AY8 C;  1U35 B;  1TZY A;  3WA9 B;  1F1E A;  2Y2I A;  1JFI B;  3REJ A;  5E5A D;  1P3F B;  2NZD A;  5B40 C;  5DNM A;  5G49 A;  3W97 A;  5AV8 B;  5AV5 B;  3VH5 W;  3LZ1 B;  2ARO A;  4WU9 D;  4YM6 A;  5BS7 A;  3MVD A;  5C3I B;  3REH B;  5AV5 D;  3AZE A;  3B0B A;  1F66 C;  4UPK A;  2F8N K;  3AZL A;  2UWX A;  3WKJ A;  2DF4 C;  1KX4 C;  5B0Z D;  3MGR B;  3AN2 D;  3WAA A;  3MGP C;  2F8N G;  2BYK B;  2W8S A;  5AVB B;  3REL D;  3AZF C;  4DRB A;  2JCH A;  5CP6 B;  3AZM D;  1EQZ A;  4HGA C;  1B6W A;  4NE3 A;  1KX5 A;  4QLC B;  3X1S A;  5B31 D;  2FJ7 D;  4XZQ D;  1ULY A;  5B1L C;  4G92 C;  5B1M A;  5CPJ D;  3W98 A;  2XD5 A;  2G5I C;  5DNN D;  3UTA B;  3LEL A;  1P3G B;  4UUZ B;  3VH6 W;  5GSU C;  3AZN D;  2CV5 D;  1P3L B;  1M1A C;  4KUD D;  3KUY D;  3AZH C;  2BG1 A;  2IO5 C;  3UTA D;  1HQ3 C;  3MNN B;  4CAY B;  3KXB B;  3AZG C;  3AYW B;  3MGQ C;  4EO5 C;  2Y2P A;  3W96 B;  5KDM B;  3X1V D;  5GXQ B;  3KWQ C;  1P3I C;  4H9N B;  3AZK C;  3X1U B;  3UT9 C;  2YFW B;  5B2I B;  3LJA D;  3C1C D;  1P3B D;  5B31 G;  4ZUX B;  1P3O A;  3B6G A;  5B32 A;  4H9Q B;  5B33 B;  5BNV A;  4NE5 A;  5E5A C;  4LD9 D;  5AVC A;  3AL0 C;  4WU9 C;  5B0Y D;  3AV2 D;  5B2J D;  4H9O A;  4ZBJ B;  5AV5 C;  2F8N H;  5AV9 A;  3REH C;  5C3I C;  3X1T A;  3B6F B;  3TU4 B;  2ZM5 A;  3AFA B;  4E44 A;  1M18 B; 
#chains in the Genus database with same CATH homology
 4R8P B;  3AZM C;  3WTP E;  4J8V D;  4Z5T B;  3MGR C;  1S32 D;  5AY8 A;  3F6T A;  4R8P D;  3B0D C;  5CP6 C;  4WU8 A;  1R4V A;  3EPL A;  5B40 A;  1ZLA A;  2J8P A;  1HTA A;  2PYO B;  4QLC C;  5CPJ C;  1P3K D;  5DNN C;  1ID3 B;  3AV1 D;  1F66 A;  5JA4 A;  4KUD C;  5BNX A;  1KX4 D;  3MGS A;  1P34 A;  3UTA C;  3AZJ A;  3MGP A;  1P3L C;  3AZF A;  5CPI B;  1AOI D;  4H9S C;  4KHA B;  1P3A A;  3C1B D;  3AYW C;  3REK D;  1P3M B;  5B1L D;  4J8X A;  5GXQ C;  2ZY2 A;  5FUG B;  1KU5 A;  5GT3 B;  4J8U B;  4ZUX C;  1M1A D;  3NQJ A;  5F99 B;  4JJN D;  5GSU A;  3AZH D;  5CPK B;  4LD9 C;  3AZI A;  3W99 A;  5B33 C;  4NFT A;  2Y2J A;  1HQ3 A;  4KGC B;  3AZG A;  1M19 A;  3MGQ A;  3REI D;  3H0L C;  4KGC D;  3KWQ D;  4ZBJ C;  4XUJ B;  1P3I D;  3A6N D;  2F8N D;  4M6B A;  3AZK A;  3UT9 D;  3LZ0 A;  2Y2G A;  4DQY B;  4DRA A;  1W2E A;  3UTB A;  3TU4 C;  1KX3 B;  3AFA C;  1N1J A;  5GT0 A;  3WTP B;  3O62 A;  1M18 C;  5B24 B;  1A7W A;  4R8P C;  1Q9C A;  4J8W D;  4YS3 B;  1U35 D;  3WA9 D;  4WZS B;  1P3P B;  1TAF A;  1P3F D;  4H9R A;  4WU9 A;  2HIO B;  5AV8 D;  1P3K C;  3LZ1 D;  4G91 B;  3AV1 C;  2XD1 A;  4Z66 A;  3REH D;  2PYO C;  2YFV A;  1TZY B;  1ID3 C;  5B0Z A;  3AN2 A;  3REJ B;  2NZD B;  3REL A;  5DNM B;  3MGR D;  5G49 B;  3AZM A;  1AOI C;  3W97 B;  2ARO B;  5BO0 A;  5AVB D;  4YM6 B;  3C1B C;  3MVD B;  5CP6 D;  2NQB A;  3REK C;  3AZE B;  2FJ7 A;  5B31 A;  4XZQ A;  3AZL B;  4QLC D;  3B0C T;  2Y2M A;  5AV6 A;  4Z2M G;  5CPJ A;  3WAA B;  5DNN A;  1EQZ B;  4JJN C;  2CV5 A;  4KUD A;  3AZN A;  4J8U C;  3KUY A;  1P3G D;  1H3O A;  3UTA A;  1KX5 B;  5F99 C;  1P3L D;  5CPK C;  3X1S B;  4WJ3 C;  3MNN D;  3KXB D;  3REI C;  4E45 A;  1B67 A;  5B1M B;  3AYW D;  4KGC C;  3X1V A;  2CWE A;  4X23 B;  3W98 B;  3A6N C;  3W96 D;  3LEL B;  3LJA A;  5GXQ D;  2G5H C;  4XUJ C;  3C1C A;  1P3B A;  4X23 D;  3X1U D;  5B2I D;  4ZUX D;  1KX3 C;  2Y2O A;  4J8W C;  4CSR A;  2Y2K A;  1U35 C;  4WNN A;  4LD9 A;  5B33 D;  3WA9 C;  2BYM A;  3V9R A;  2RIQ A;  4YS3 C;  1P3F C;  5B0Y A;  3AV2 A;  5B2J A;  5AV8 C;  3LZ1 C;  1P3O B;  3B6G B;  5B32 B;  3R45 A;  5BNV B;  1BH8 A;  3B6F D;  3TU4 D;  3AFA D;  1TZY C;  5AVC B;  2L5A A;  1M18 D;  4J8V A;  1S32 A;  3EPH A;  5AVB C;  3REJ C;  3NQU A;  4H9O B;  4Z2M H;  4R8P A;  5JRG B;  5DNM C;  4Z5T D;  5AV9 B;  3MVD C;  3X1T B;  5JRG D;  3AZE C;  3EG5 B;  3WKJ B;  2F2A C;  1P3K A;  3H0M C;  2PYO D;  3AV1 A;  1ID3 D;  1KX4 A;  1P3G C;  1EQZ C;  4WU8 B;  1Z2C B;  5B40 B;  1ZLA B;  3MNN C;  3KXB C;  1AOI A;  5B32 G;  3C1B A;  5CPI D;  5BT1 C;  3X1S C;  3REK A;  1BH9 A;  2LY8 A;  3W96 C;  1F66 B;  5B1L A;  5JA4 B;  4X23 C;  3KFU G;  5BNX B;  3MGS B;  3X1U C;  1P34 B;  1P3M D;  5B2I C;  3LEL C;  2RVQ C;  3AZJ B;  3MGP B;  3AZF B;  2HUE B;  1M1A A;  5GT3 D;  4J8U D;  4JJN A;  3AZH A;  1P3A B;  4HGA B;  5F99 D;  5CPK D;  3FDD A;  4H9P A;  4J8X B;  3EPJ A;  3REI A;  3EPK A;  4G92 B;  4KGC A;  3KWQ A;  1P3I A;  3A6N A;  2F8N A;  3UT9 A;  4XUJ D;  3NQJ B;  3B6F C;  5GSU B;  5B32 C;  3AZI B;  3W99 B;  1HQ3 B;  2ZY3 A;  1KX3 D;  2Y2H A;  3AZG B;  1M19 B;  4Z5T C;  5AVC C;  3WTP D;  5E5A A;  3MGQ B;  4J8W A;  5B24 D;  1U35 A;  4EO5 B;  3WA9 A;  4AWL B;  4YS3 D;  5JRG C;  1JFI A;  1P3F A;  3AZK B;  3LZ0 B;  5AV5 A;  5AV8 A;  1P3P D;  3X1T C;  3LZ1 A;  3UTB B;  2DQN C;  2HIO D;  3REH A;  1N1J B;  5GT0 B;  3O62 B;  3WKJ C;  3H0R C;  4NE6 A;  5GT0 D;  2Y2N A;  3VH6 A;  1TZY D;  3MGR A;  2Y2L A;  3REJ D;  1TAF B;  4WU8 C;  2BYK A;  4H9R B;  5CPI C;  5AVB A;  4WU9 B;  5DNM D;  5CP6 A;  2Y2Q A;  3W97 D;  2NZD D;  1ZLA C;  2ARO D;  4YM6 D;  4Z66 B;  3MVD D;  2YFV B;  3AZE D;  3A1I A;  4QLC A;  1P3M C;  5B0Z B;  4Z66 D;  3AN2 B;  3AZL D;  3REL B;  3MGS C;  1P34 C;  3AZM B;  5GT3 C;  3VH6 T;  3WAA D;  5BO0 B;  3AZJ C;  3P5J B;  1P3G A;  1EQZ D;  2HUE C;  3B0D B;  4UUZ A;  2NQB B;  1P3L A;  1P3A C;  2FJ7 B;  5B31 B;  4H9S A;  4XZQ B;  1KX5 D;  3MNN A;  4CAY A;  3KXB A;  2NQB D;  5BT1 D;  3AYW A;  2VQR A;  3X1S D;  2JE5 A;  5AV6 B;  4J8X C;  5CPJ B;  5DNN B;  3B0C W;  5B1M D;  3W96 A;  5KDM A;  5GXQ A;  3W98 D;  2CV5 B;  4H9N A;  4KUD B;  5AV6 D;  4X23 A;  3AZN B;  3KUY B;  3LEL D;  3X1U A;  1H3O B;  2YFW A;  5B2I A;  2RVQ D;  4ZUX A;  3WTP C;  3W99 C;  3AZI C;  1T3U A;  3A1K A;  5B24 C;  4H9Q A;  5B33 A;  1M19 C;  3X1V B;  1PZR A;  3LJA B;  1P3P C;  3C1C B;  4AWL C;  1P3B B;  2HIO C;  3LZ0 C;  4G91 C;  2JSS A;  3UTB C;  1P3O D;  3B6G D;  4CSR B;  5GT0 C;  3O62 C;  5B32 D;  3TU4 A;  3B6F A;  4WNN B;  3AFA A;  4LD9 B;  2BYM B;  3V9R B;  1M18 A;  2NZD C;  5B0Y B;  3AV2 B;  5B2J B;  5AVC D;  3W97 C;  4Z5T A;  2ARO C;  4YM6 C;  5BS7 C;  5JRG A;  5AV9 D;  3R45 B;  4Z66 C;  3X1T D;  1BH8 B;  3AZL C;  2FFF B;  2PYO A;  3WKJ D;  5B0Z C;  4J8V B;  1S32 B;  3WAA C;  5AY8 B;  3AN2 C;  1ID3 A;  3NQU B;  3REL C;  3KSY A;  3IP4 C;  5AY8 D;  1KX5 C;  4WU8 D;  2NQB C;  5CPI A;  5B40 D;  4WV4 B;  2FJ7 C;  5B31 C;  1ZLA D;  1P3K B;  4XZQ C;  4KHA A;  5B1M C;  3AV1 B;  3W98 C;  5AV6 C;  1KX4 B;  1F66 D;  1P3M A;  2CV5 C;  3AZN C;  3MGS D;  1P34 D;  3KUY C;  5FUG A;  5GT3 A;  4J8U A;  3AZJ D;  1AOI B;  3MGP D;  3C1B B;  3AZF D;  1WWS A;  5F99 A;  3REK B;  5CPK A;  1P3A D;  1BH9 B;  5B1L B;  3X1V C;  3VH5 A;  1BFM A;  4J8X D;  5CHL B;  3LJA C;  3C1C C;  1P3B C;  1P3O C;  3B6G C;  1WWI A;  4XUJ A;  2ZY5 A;  1M1A B;  4JJN B;  3AZH B;  2IO5 B;  5GSU D;  1KX3 A;  3AZI D;  3W99 D;  4H9P B;  3WTP A;  1HQ3 D;  5B24 A;  3REI B;  3AZG D;  1M19 D;  5B0Y C;  3AV2 C;  5B2J C;  3KWQ B;  3MGQ D;  3VH5 T;  4YS3 A;  1P3I B;  3A6N B;  5AV9 C;  2F8N B;  3UT9 B;  1P3P A;  3AZK D;  2HIO A;  3LZ0 D;  2ZY4 A;  3UTB D;  3O62 D;  5E5A B;  4J8W B;  4J8V C;  1S32 C;  5AY8 C;  1U35 B;  1TZY A;  3WA9 B;  1F1E A;  2Y2I A;  1JFI B;  3REJ A;  5E5A D;  1P3F B;  2NZD A;  5B40 C;  5DNM A;  5G49 A;  3W97 A;  5AV8 B;  5AV5 B;  3VH5 W;  3LZ1 B;  2ARO A;  4WU9 D;  4YM6 A;  5BS7 A;  3MVD A;  5C3I B;  3REH B;  5AV5 D;  3AZE A;  3B0B A;  1F66 C;  4UPK A;  2F8N K;  3AZL A;  2UWX A;  3WKJ A;  2DF4 C;  1KX4 C;  5B0Z D;  3MGR B;  3AN2 D;  3WAA A;  3MGP C;  2F8N G;  2BYK B;  2W8S A;  5AVB B;  3REL D;  3AZF C;  4DRB A;  2JCH A;  5CP6 B;  3AZM D;  1EQZ A;  4HGA C;  1B6W A;  4NE3 A;  1KX5 A;  4QLC B;  3X1S A;  5B31 D;  2FJ7 D;  4XZQ D;  1ULY A;  5B1L C;  4G92 C;  5B1M A;  5CPJ D;  3W98 A;  2XD5 A;  2G5I C;  5DNN D;  3UTA B;  3LEL A;  1P3G B;  4UUZ B;  3VH6 W;  5GSU C;  3AZN D;  2CV5 D;  1P3L B;  1M1A C;  4KUD D;  3KUY D;  3AZH C;  2BG1 A;  2IO5 C;  3UTA D;  1HQ3 C;  3MNN B;  4CAY B;  3KXB B;  3AZG C;  3AYW B;  3MGQ C;  4EO5 C;  2Y2P A;  3W96 B;  5KDM B;  3X1V D;  5GXQ B;  3KWQ C;  1P3I C;  4H9N B;  3AZK C;  3X1U B;  3UT9 C;  2YFW B;  5B2I B;  3LJA D;  3C1C D;  1P3B D;  5B31 G;  4ZUX B;  1P3O A;  3B6G A;  5B32 A;  4H9Q B;  5B33 B;  5BNV A;  4NE5 A;  5E5A C;  4LD9 D;  5AVC A;  3AL0 C;  4WU9 C;  5B0Y D;  3AV2 D;  5B2J D;  4H9O A;  4ZBJ B;  5AV5 C;  2F8N H;  5AV9 A;  3REH C;  5C3I C;  3X1T A;  3B6F B;  3TU4 B;  2ZM5 A;  3AFA B;  4E44 A;  1M18 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...