3MGRC

Binding of rubidium ions to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgrC00
5KDMB 5B32C 1ZLAA 3MGSB 3W99B 1BH8A 2PYOB 3AZMB 4WU9D 2CV5D 3NQUA 1P3GA 1P3BB 1ID3D 3AV2B 1P3GC 5BNVB 4WU8D 5FUGA 5B24C 5BNXA 4J8UD 1KX5B 3AZKB 5B2JC 5E5AB 5AV5D 3AZID 1TZYA 3B6FB 5B32G 1KX3B 1P3FB 1TZYC 3B0BA 3R45B 3AZED 5F99B 2HUEC 3W96B 4QLCA 3AZJB 4ZUXD 4YM6C 4LD9B 3KUYD 3UTBB 4KUDD 3B0CT 1U35D 3TU4A 4JJNA 3TU4C 4JJNC 2BYMB 3KXBB 5B32B 5B1LD 3MNNA 3X1SA 3MNNC 5CPKC 1N1JB 5AV9B 3NQUB 5CPIA 1P3GB 5GSUC 4KGCC 5B24B 5B31D 5AV6A 5B2JB 2NQBA 3MGPA 3AN2A 2NQBC 1TZYB 5G49A 2AROA 3UT9D 2HUEB 1P3PD 4YM6B 3LJAA 3X1UA 4EO5C 4XZQD 4UUZA 3LJAC 5AVBD 3UTAB 3AV1D 3LZ1A 1P3IC 3WAAC 4R8PA 3B6GA 3LZ1C 3B6GC 4JJNB 3MGRA 3C1BC 4CAYB 3MNNB 3MGRC 5CPKB 5DNNA 5AVCA 1P3KA 1EQZD 5GSUB 5DNNC 5AVCC 3REKD 1P3KC 4KGCB 2F8NH 1P3LD 4ZBJC 5B0ZA 1ULYA 2NQBB 5B0ZC 5CP6D 5CPJC 3RELA 5G49B 4J8WA 3RELC 3REHA 1AOIA 1JFIA 3AZHD 3AZFA 3REHC 1AOIC 3NQJA 4EO5B 5B0YD 5JRGC 4J8XC 3LJAB 3AZFC 3AYWC 2HIOA 1P3IB 3WAAB 2HIOC 3LZ1B 3WKJA 3B6GB 3X1TA 5B1MD 3REJD 3WKJC 3WA9D 3X1TC 3KWQA 3C1BB 3KWQC 3O62A 5KDMA 4M6BA 3A6ND 3MGSA 1P3MC 2PYOA 3AZMA 5DNNB 5AVCB 1P3KB 1P3BA 1H3OB 1M18D 5GT3D 4ZBJB 1KX5A 5B0ZB 4Z5TB 1B67A 4WU9C 3AZKA 5CPJB 2CV5C 1ID3A 1F1EA 3B6FA 3B0DC 3AZKC 1KX3A 3RELB 4WU8A 1ID3C 4WU8C 3R45A 4J8UC 3REHB 1JFIB 4CSRB 5JRGB 4J8XB 3AZFB 3W96A 3AZIA 1P34D 5AV5C 3AYWB 2F8ND 3AZIC 4LD9A 3REID 3AZLD 3WKJB 3X1TB 4ZUXC 3AZND 1B6WA 2YFWA 5AV8D 4YS3D 3KUYC 3KWQB 3V9RA 2BYMA 3KXBA 3KSYA 3KXBC 3MVDD 1P3MB 4Z2MH 1N1JA 5AV9A 1HQ3D 4NE6A 2LY8A 5AV9C 1M19D 5B1LC 4H9OB 5B24A 4WU9B 3VH5W 2CV5B 5B2JA 1M1AD 3C1CD 3B0DB 3MGQD 2BYKB 1ID3B 4WU8B 4J8UB 5B31C 5B2ID 3LZ0D 5AV5B 3AZIB 4YM6A 2NZDD 4Z66D 1S32D 3UT9A 3W97D 3AZEB 3UTAA 3UT9C 1P3PA 3UTAC 1P3PC 4ZUXB 4WNNA 2CWEA 3AFAD 2YFWB 4XZQC 2L5AA 3KUYB 5AVBC 4H9PB 5B40D 3V9RB 5B31G 3AV1A 4KUDB 1U35B 3AV1C 4CAYA 5CPKA 4Z2MG 2FJ7D 5BT1D 5B1LB 5GSUA 3AZGD 4KGCA 4X23D 2JSSA 5B33D 4J8VD 5BO0A 1EQZA 1EQZC 3WTPD 3W98D 3REKC 1P3OA 5B31B 1P3OD 3VH5T 1P3LC 1ZLAD 5DNMD 5GT0D 5CP6C 3UT9B 1P3IA 1P3PB 3WAAA 1R4VA 3AZHC 4WNNB 5B0YC 4XZQB 2YFVA 5AVBB 1P3AD 3C1BA 3AV1B 4H9QA 5B1MA 3REJA 3WA9A 5B1MC 3REJC 3WA9C 4QLCD 1H3OA 1TAFB 3A6NC 5BO0B 1EQZB 4Z5TA 3REKB 3TU4D 5CPJA 4Z5TC 3WTPE 5GT3A 5GT3C 1P3LB 4CSRA 5JRGA 3X1SD 4J8XA 5CP6B 3AYWA 4E44A 5CPID 4DRBA 3X1VD 3AZHB 5B0YB 4KHAB 1P34C 2YFVB 5AV6D 1KX4D 3REIA 3MGPD 3AN2D 3REIC 3AZLA 3AZLC 2AROD 4H9QB 5B1MB 3REJB 5AV8A 1P3MA 3WA9B 5AY8D 3AZNC 5AV8C 4YS3C 3LELD 5GXQD 3VH6W 4WZSB 3X1UD 4NFTA 5JA4A 4DRAA 3MVDA 4H9OA 3A6NB 3MVDC 2F8NG 4H9NA 4R8PD 4WU9A 2CV5A 1HQ3C 1M19C 2BYKA 1M18B 5GT3B 4J8UA 4XUJD 5AV5A 3C1CC 3MGQC 5B2IA 3AZEA 3LZ0A 5B2IC 3AZEC 1P34B 3LZ0C 4ZUXA 2F8NB 4Z66A 2NZDC 4H9SA 4Z66C 3KUYA 4H9SC 3REIB 1S32C 3W97C 4KUDA 4H9PA 3AZLB 4KUDC 4J8WD 1HTAA 1U35A 3AZNB 3AFAA 1AOID 5AV8B 4YS3B 1U35C 3AFAC 1F66D 5B40C 1Q9CA 5B1LA 5JA4B 3MVDB 2HIOD 2FJ7A 4H9NB 3VH6T 1HQ3B 2FJ7C 1M19B 3AZGA 5BT1C 4X23A 3AZGC 4X23C 4J8VA 5B31A 3O62D 5B33C 4J8VC 1M1AB 4G91B 3C1CB 3MGQB 3W98A 3W99D 3MGSD 3WTPC 2PYOD 3W98C 3AZMD 5CHLB 5B2IB 1P3OC 1P3BD 3LZ0B 3AV2D 2IO5C 5DNMA 2NZDB 1ZLAC 4Z66B 5GT0A 5DNMC 4XZQA 1S32B 1KX5D 3VH5A 5GT0C 3W97B 5AVBA 3AZKD 5E5AD 3B6FD 1KX3D 1P3FD 3AFAB 4H9RB 1P3AA 5F99D 5B40B 1P3AC 3W96D 3AZJD 4LD9D 1WWIA 3UTBD 2F8NK 1TAFA 2FJ7B 4QLCC 3REKA 3AZGB 4X23B 2RVQD 5B33B 4J8VB 3KXBD 5B32D 1P3LA 3WTPB 3W98B 4NE3A 5CP6A 5AV9D 1P3OB 1P3GD 2IO5B 1ZLAB 3AZHA 5B0YA 5DNMB 5B24D 1BH8B 4KHAA 3X1SC 5GT0B 5B2JD 3X1VA 5CPIC 1TZYD 3X1VC 5FUGB 1A7WA 5BNXB 5C3IC 1KX4A 1P3AB 5AV6C 1KX4C 4YM6D 3MGPC 3AN2C 2AROC 3UTAD 5AY8A 3A6NA 3LELA 5AY8C 4QLCB 5GXQA 3LELC 5GXQC 3X1UC 4HGAC 4JJND 1M18A 4WV4B 1M18C 4R8PC 3MNND 5CPKD 3TU4B 4G92C 5GSUD 4KGCD 4XUJA 3X1SB 1P34A 4XUJC 2F8NA 1WWSA 5CPIB 1KU5A 2NQBD 3X1VB 5C3IB 5AV6B 3AZNA 1KX4B 4YS3A 3MGPB 3AN2B 3LJAD 2AROB 4E45A 4J8WC 5AY8B 1P3ID 4AWLC 3LELB 3WAAD 1F66A 5GXQB 3X1UB 3LZ1D 4HGAB 1F66C 1HQ3A 3B6GD 4UUZB 1M19A 3C1BD 4R8PB 3MGRD 1BH9A 1M1AA 3C1CA 3MGQA 4G92B 1M1AC 4G91C 3VH6A 5DNND 5AVCD 3MGRB 1P3KD 3O62C 1BFMA 4XUJB 3W99A 2NZDA 3W99C 3MGSC 1S32A 2PYOC 3AZMC 3W97A 4Z5TD 5B0ZD 5CPJD 3AV2A 1P3BC 3RELD 5BNVA 3AV2C 3REHD 4H9RA 1KX5C 5JRGD 4J8XD 3AZFD 5E5AA 5B40A 3AYWD 5E5AC 1P3FA 3B6FC 4J8WB 1KX3C 1P3FC 4AWLB 1AOIB 5F99A 4NE5A 3NQJB 1F66B 3AZJA 5F99C 3B0CW 3W96C 3WKJD 3AZJC 3X1TD 5BS7A 3UTBA 4LD9C 2HIOB 5BS7C 3KWQD 3UTBC 5B33A 1BH9B 1P3MD 3WTPA 3O62B 5B32A 2RVQC
chains in the Genus database with same CATH superfamily
5KDMB 5B32C 1ZLAA 3MGSB 2VQRA 3W99B 1BH8A 2PYOB 3AZMB 4WU9D 2CV5D 3NQUA 1P3GA 1P3BB 1ID3D 3AV2B 1P3GC 5BNVB 4WU8D 5FUGA 5B24C 5BNXA 4J8UD 1KX5B 2ZY4A 3AZKB 5B2JC 5E5AB 5AV5D 3AZID 1TZYA 3B6FB 5B32G 1KX3B 1P3FB 1TZYC 3B0BA 3R45B 3AZED 5F99B 2HUEC 3W96B 4QLCA 3AZJB 4ZUXD 4YM6C 4LD9B 3KUYD 3UTBB 2ZY3A 4KUDD 3B0CT 1U35D 3TU4A 4JJNA 3TU4C 4JJNC 2BYMB 1T3UA 3KXBB 5B32B 5B1LD 3MNNA 2Y2MA 3X1SA 3MNNC 5CPKC 1N1JB 5AV9B 2ZY5A 3NQUB 5CPIA 1P3GB 5GSUC 4KGCC 5B24B 5B31D 5AV6A 5B2JB 2NQBA 3MGPA 3AN2A 2NQBC 1TZYB 5G49A 2AROA 3UT9D 2HUEB 1P3PD 2Y2KA 4YM6B 3LJAA 3X1UA 4EO5C 4XZQD 4UUZA 3LJAC 5AVBD 3UTAB 3AV1D 3LZ1A 1P3IC 3WAAC 4R8PA 3B6GA 3LZ1C 3B6GC 4JJNB 1PZRA 3MGRA 3C1BC 4CAYB 3MNNB 3MGRC 5CPKB 5DNNA 5AVCA 1P3KA 1EQZD 5GSUB 5DNNC 5AVCC 3REKD 1P3KC 4KGCB 2F8NH 1P3LD 5B0ZA 4ZBJC 1ULYA 2NQBB 5B0ZC 5CP6D 5CPJC 3RELA 5G49B 4J8WA 3RELC 3REHA 1AOIA 1JFIA 3AZHD 3AZFA 3REHC 1AOIC 5B0YD 3NQJA 4EO5B 5JRGC 4J8XC 3LJAB 3AZFC 3AYWC 2HIOA 1P3IB 3WAAB 2HIOC 3LZ1B 3WKJA 3B6GB 3X1TA 5B1MD 3REJD 3WKJC 3WA9D 3X1TC 3KWQA 3C1BB 3KWQC 3O62A 5KDMA 4M6BA 3A6ND 3MGSA 1P3MC 2PYOA 3AZMA 5DNNB 5AVCB 1P3KB 2Y2HA 1P3BA 1H3OB 1M18D 5GT3D 4ZBJB 1KX5A 5B0ZB 4Z5TB 1B67A 4WU9C 3AZKA 5CPJB 2CV5C 1ID3A 1F1EA 3B6FA 3B0DC 3AZKC 4DQYB 3RELB 4WU8A 1KX3A 1ID3C 4WU8C 3R45A 4J8UC 3REHB 1JFIB 4CSRB 5JRGB 4J8XB 3AZFB 3W96A 3AZIA 2RIQA 1P34D 5AV5C 3AYWB 2F8ND 3AZIC 4LD9A 3H0LC 3REID 2F2AC 2FFFB 3AZLD 3WKJB 3X1TB 4ZUXC 3AZND 1B6WA 2YFWA 5AV8D 4YS3D 3KUYC 3KWQB 3V9RA 2BYMA 3F6TA 3KXBA 3KSYA 3KXBC 3MVDD 2W8SA 1P3MB 4Z2MH 1N1JA 5AV9A 1HQ3D 4NE6A 2LY8A 5AV9C 1M19D 5B1LC 4H9OB 5B24A 4WU9B 3VH5W 2CV5B 5B2JA 1M1AD 3C1CD 3B0DB 3MGQD 2BYKB 1ID3B 4WU8B 4J8UB 5B31C 5B2ID 3LZ0D 5AV5B 3AZIB 4YM6A 2NZDD 4Z66D 1S32D 3UT9A 3W97D 3AZEB 3UTAA 3UT9C 1P3PA 3UTAC 1P3PC 4ZUXB 4WNNA 2CWEA 3AFAD 2YFWB 4XZQC 2L5AA 3KUYB 5AVBC 4H9PB 5B40D 3V9RB 5B31G 3AV1A 4KUDB 3P5JB 1U35B 3AV1C 4CAYA 5CPKA 4Z2MG 2FJ7D 2XD1A 5BT1D 5B1LB 5GSUA 3AZGD 4KGCA 4X23D 2JSSA 5B33D 4J8VD 2DF4C 5BO0A 3H0RC 1EQZA 2JCHA 3H0MC 1EQZC 2Y2JA 3WTPD 3W98D 3REKC 1P3OA 5B31B 1P3OD 2Y2IA 3VH5T 1P3LC 2J8PA 1ZLAD 5DNMD 5GT0D 5CP6C 3UT9B 1P3IA 1P3PB 3WAAA 1R4VA 3AZHC 4WNNB 5B0YC 4XZQB 2YFVA 5AVBB 1P3AD 3C1BA 3AV1B 4H9QA 5B1MA 3REJA 3WA9A 5B1MC 3REJC 3WA9C 4QLCD 3EPKA 2Y2OA 3A1KA 1H3OA 1TAFB 3A6NC 5BO0B 1EQZB 4Z5TA 1Z2CB 3REKB 3TU4D 5CPJA 4Z5TC 3WTPE 5GT3A 5GT3C 1P3LB 4CSRA 5JRGA 3X1SD 4J8XA 5CP6B 3AYWA 4E44A 5CPID 4DRBA 3X1VD 3AZHB 5B0YB 4KHAB 2Y2GA 1P34C 2YFVB 5AV6D 1KX4D 3REIA 3MGPD 3AN2D 3REIC 3AZLA 3AZLC 2AROD 4H9QB 5B1MB 3REJB 5AV8A 1P3MA 3WA9B 5AY8D 3AZNC 5AV8C 4YS3C 3LELD 5GXQD 3VH6W 4WZSB 3X1UD 4NFTA 5JA4A 4DRAA 3MVDA 4H9OA 3A6NB 3MVDC 2F8NG 4H9NA 4R8PD 4WU9A 2CV5A 1HQ3C 1M19C 2BYKA 1M18B 5GT3B 4J8UA 4XUJD 5AV5A 3C1CC 3MGQC 5B2IA 3AZEA 3LZ0A 5B2IC 3AZEC 1P34B 3LZ0C 4ZUXA 2F8NB 4Z66A 2NZDC 4H9SA 4Z66C 3KUYA 4H9SC 3REIB 1S32C 3W97C 4KUDA 4H9PA 3AZLB 4KUDC 4J8WD 1HTAA 1U35A 3AZNB 2UWXA 3AFAA 5AV8B 4YS3B 1U35C 1AOID 3EPHA 3AFAC 1F66D 5B40C 1Q9CA 5B1LA 5JA4B 3MVDB 2HIOD 2FJ7A 2BG1A 4H9NB 3VH6T 1HQ3B 2FJ7C 1M19B 3AZGA 5BT1C 4X23A 3AZGC 4X23C 4J8VA 5B31A 3O62D 5B33C 4J8VC 1M1AB 4G91B 3C1CB 3MGQB 3W98A 3W99D 3MGSD 3WTPC 2PYOD 3W98C 3AZMD 5CHLB 5B2IB 1P3OC 1P3BD 3LZ0B 3AV2D 2IO5C 5DNMA 2NZDB 1ZLAC 2ZM5A 4Z66B 5GT0A 5DNMC 4XZQA 1S32B 1KX5D 3VH5A 5GT0C 3W97B 5AVBA 3AZKD 5E5AD 2G5IC 3B6FD 1KX3D 1P3FD 3AFAB 4H9RB 1P3AA 5F99D 5B40B 1P3AC 3W96D 3AZJD 4LD9D 1WWIA 3UTBD 2XD5A 2F8NK 1TAFA 2FJ7B 4QLCC 3REKA 3AZGB 4X23B 2RVQD 5B33B 4J8VB 1W2EA 3KXBD 5B32D 1P3LA 3WTPB 3W98B 4NE3A 5CP6A 5AV9D 1P3OB 3A1IA 1P3GD 2Y2NA 2IO5B 1ZLAB 3AZHA 5B0YA 5DNMB 5B24D 1BH8B 4KHAA 3X1SC 5GT0B 5B2JD 3X1VA 5CPIC 1TZYD 3X1VC 5FUGB 1A7WA 5BNXB 5C3IC 1KX4A 1P3AB 5AV6C 2ZY2A 1KX4C 4YM6D 3MGPC 4UPKA 3AN2C 2AROC 3UTAD 5AY8A 3A6NA 3LELA 5AY8C 4QLCB 5GXQA 3LELC 5GXQC 3X1UC 4HGAC 2Y2LA 4JJND 1M18A 4WV4B 1M18C 4R8PC 3MNND 5CPKD 3TU4B 4G92C 5GSUD 4KGCD 4XUJA 3X1SB 1P34A 4XUJC 2F8NA 1WWSA 5CPIB 1KU5A 2NQBD 3X1VB 3AL0C 4WJ3C 5C3IB 5AV6B 3AZNA 1KX4B 4YS3A 3MGPB 3EPLA 3AN2B 3LJAD 2AROB 4E45A 4J8WC 5AY8B 1P3ID 4AWLC 3LELB 3WAAD 1F66A 5GXQB 3X1UB 3LZ1D 4HGAB 1F66C 1HQ3A 3B6GD 4UUZB 1M19A 3EG5B 3EPJA 3C1BD 4R8PB 3MGRD 1BH9A 1M1AA 3C1CA 3MGQA 4G92B 1M1AC 4G91C 3VH6A 5DNND 5AVCD 3MGRB 1P3KD 3O62C 1BFMA 2Y2QA 4XUJB 3W99A 2NZDA 3W99C 3MGSC 1S32A 2PYOC 3AZMC 3W97A 4Z5TD 5B0ZD 5CPJD 3IP4C 3AV2A 1P3BC 3RELD 5BNVA 3AV2C 3REHD 4H9RA 1KX5C 5JRGD 4J8XD 3AZFD 5E5AA 3KFUG 5B40A 3AYWD 5E5AC 2G5HC 1P3FA 3B6FC 4J8WB 1KX3C 3FDDA 1P3FC 4AWLB 1AOIB 2DQNC 5F99A 4NE5A 3NQJB 1F66B 3AZJA 5F99C 3B0CW 3W96C 3WKJD 3AZJC 3X1TD 5BS7A 3UTBA 4LD9C 2HIOB 5BS7C 3KWQD 2Y2PA 3UTBC 5B33A 1BH9B 1P3MD 3WTPA 2JE5A 3O62B 5B32A 2RVQC
chains in the Genus database with same CATH topology
5KDMB 5B32C 1ZLAA 3MGSB 2VQRA 3W99B 1BH8A 2PYOB 3AZMB 4WU9D 2CV5D 3NQUA 1P3GA 1P3BB 1ID3D 3AV2B 1P3GC 5BNVB 4WU8D 5FUGA 5B24C 5BNXA 4J8UD 1KX5B 2ZY4A 3AZKB 5B2JC 5E5AB 5AV5D 3AZID 1TZYA 3B6FB 5B32G 1KX3B 1P3FB 1TZYC 3B0BA 3R45B 3AZED 5F99B 2HUEC 3W96B 4QLCA 3AZJB 4ZUXD 4YM6C 4LD9B 3KUYD 3UTBB 2ZY3A 4KUDD 3B0CT 1U35D 3TU4A 4JJNA 3TU4C 4JJNC 2BYMB 1T3UA 3KXBB 5B32B 5B1LD 3MNNA 2Y2MA 3X1SA 3MNNC 5CPKC 1N1JB 5AV9B 2ZY5A 3NQUB 5CPIA 1P3GB 5GSUC 4KGCC 5B24B 5B31D 5AV6A 5B2JB 2NQBA 3MGPA 3AN2A 2NQBC 1TZYB 5G49A 2AROA 3UT9D 2HUEB 1P3PD 2Y2KA 4YM6B 3LJAA 3X1UA 4EO5C 4XZQD 4UUZA 3LJAC 5AVBD 3UTAB 3AV1D 3LZ1A 1P3IC 3WAAC 4R8PA 3B6GA 3LZ1C 3B6GC 4JJNB 1PZRA 3MGRA 3C1BC 4CAYB 3MNNB 3MGRC 5CPKB 5DNNA 5AVCA 1P3KA 1EQZD 5GSUB 5DNNC 5AVCC 3REKD 1P3KC 4KGCB 2F8NH 1P3LD 5B0ZA 4ZBJC 1ULYA 2NQBB 5B0ZC 5CP6D 5CPJC 3RELA 5G49B 4J8WA 3RELC 3REHA 1AOIA 1JFIA 3AZHD 3AZFA 3REHC 1AOIC 5B0YD 3NQJA 4EO5B 5JRGC 4J8XC 3LJAB 3AZFC 3AYWC 2HIOA 1P3IB 3WAAB 2HIOC 3LZ1B 3WKJA 3B6GB 3X1TA 5B1MD 3REJD 3WKJC 3WA9D 3X1TC 3KWQA 3C1BB 3KWQC 3O62A 5KDMA 4M6BA 3A6ND 3MGSA 1P3MC 2PYOA 3AZMA 5DNNB 5AVCB 1P3KB 2Y2HA 1P3BA 1H3OB 1M18D 5GT3D 4ZBJB 1KX5A 5B0ZB 4Z5TB 1B67A 4WU9C 3AZKA 5CPJB 2CV5C 1ID3A 1F1EA 3B6FA 3B0DC 3AZKC 4DQYB 3RELB 4WU8A 1KX3A 1ID3C 4WU8C 3R45A 4J8UC 3REHB 1JFIB 4CSRB 5JRGB 4J8XB 3AZFB 3W96A 3AZIA 2RIQA 1P34D 5AV5C 3AYWB 2F8ND 3AZIC 4LD9A 3H0LC 3REID 2F2AC 2FFFB 3AZLD 3WKJB 3X1TB 4ZUXC 3AZND 1B6WA 2YFWA 5AV8D 4YS3D 3KUYC 3KWQB 3V9RA 2BYMA 3F6TA 3KXBA 3KSYA 3KXBC 3MVDD 2W8SA 1P3MB 4Z2MH 1N1JA 5AV9A 1HQ3D 4NE6A 2LY8A 5AV9C 1M19D 5B1LC 4H9OB 5B24A 4WU9B 3VH5W 2CV5B 5B2JA 1M1AD 3C1CD 3B0DB 3MGQD 2BYKB 1ID3B 4WU8B 4J8UB 5B31C 5B2ID 3LZ0D 5AV5B 3AZIB 4YM6A 2NZDD 4Z66D 1S32D 3UT9A 3W97D 3AZEB 3UTAA 3UT9C 1P3PA 3UTAC 1P3PC 4ZUXB 4WNNA 2CWEA 3AFAD 2YFWB 4XZQC 2L5AA 3KUYB 5AVBC 4H9PB 5B40D 3V9RB 5B31G 3AV1A 4KUDB 3P5JB 1U35B 3AV1C 4CAYA 5CPKA 4Z2MG 2FJ7D 2XD1A 5BT1D 5B1LB 5GSUA 3AZGD 4KGCA 4X23D 2JSSA 5B33D 4J8VD 2DF4C 5BO0A 3H0RC 1EQZA 2JCHA 3H0MC 1EQZC 2Y2JA 3WTPD 3W98D 3REKC 1P3OA 5B31B 1P3OD 2Y2IA 3VH5T 1P3LC 2J8PA 1ZLAD 5DNMD 5GT0D 5CP6C 3UT9B 1P3IA 1P3PB 3WAAA 1R4VA 3AZHC 4WNNB 5B0YC 4XZQB 2YFVA 5AVBB 1P3AD 3C1BA 3AV1B 4H9QA 5B1MA 3REJA 3WA9A 5B1MC 3REJC 3WA9C 4QLCD 3EPKA 2Y2OA 3A1KA 1H3OA 1TAFB 3A6NC 5BO0B 1EQZB 4Z5TA 1Z2CB 3REKB 3TU4D 5CPJA 4Z5TC 3WTPE 5GT3A 5GT3C 1P3LB 4CSRA 5JRGA 3X1SD 4J8XA 5CP6B 3AYWA 4E44A 5CPID 4DRBA 3X1VD 3AZHB 5B0YB 4KHAB 2Y2GA 1P34C 2YFVB 5AV6D 1KX4D 3REIA 3MGPD 3AN2D 3REIC 3AZLA 3AZLC 2AROD 4H9QB 5B1MB 3REJB 5AV8A 1P3MA 3WA9B 5AY8D 3AZNC 5AV8C 4YS3C 3LELD 5GXQD 3VH6W 4WZSB 3X1UD 4NFTA 5JA4A 4DRAA 3MVDA 4H9OA 3A6NB 3MVDC 2F8NG 4H9NA 4R8PD 4WU9A 2CV5A 1HQ3C 1M19C 2BYKA 1M18B 5GT3B 4J8UA 4XUJD 5AV5A 3C1CC 3MGQC 5B2IA 3AZEA 3LZ0A 5B2IC 3AZEC 1P34B 3LZ0C 4ZUXA 2F8NB 4Z66A 2NZDC 4H9SA 4Z66C 3KUYA 4H9SC 3REIB 1S32C 3W97C 4KUDA 4H9PA 3AZLB 4KUDC 4J8WD 1HTAA 1U35A 3AZNB 2UWXA 3AFAA 5AV8B 4YS3B 1U35C 1AOID 3EPHA 3AFAC 1F66D 5B40C 1Q9CA 5B1LA 5JA4B 3MVDB 2HIOD 2FJ7A 2BG1A 4H9NB 3VH6T 1HQ3B 2FJ7C 1M19B 3AZGA 5BT1C 4X23A 3AZGC 4X23C 4J8VA 5B31A 3O62D 5B33C 4J8VC 1M1AB 4G91B 3C1CB 3MGQB 3W98A 3W99D 3MGSD 3WTPC 2PYOD 3W98C 3AZMD 5CHLB 5B2IB 1P3OC 1P3BD 3LZ0B 3AV2D 2IO5C 5DNMA 2NZDB 1ZLAC 2ZM5A 4Z66B 5GT0A 5DNMC 4XZQA 1S32B 1KX5D 3VH5A 5GT0C 3W97B 5AVBA 3AZKD 5E5AD 2G5IC 3B6FD 1KX3D 1P3FD 3AFAB 4H9RB 1P3AA 5F99D 5B40B 1P3AC 3W96D 3AZJD 4LD9D 1WWIA 3UTBD 2XD5A 2F8NK 1TAFA 2FJ7B 4QLCC 3REKA 3AZGB 4X23B 2RVQD 5B33B 4J8VB 1W2EA 3KXBD 5B32D 1P3LA 3WTPB 3W98B 4NE3A 5CP6A 5AV9D 1P3OB 3A1IA 1P3GD 2Y2NA 2IO5B 1ZLAB 3AZHA 5B0YA 5DNMB 5B24D 1BH8B 4KHAA 3X1SC 5GT0B 5B2JD 3X1VA 5CPIC 1TZYD 3X1VC 5FUGB 1A7WA 5BNXB 5C3IC 1KX4A 1P3AB 5AV6C 2ZY2A 1KX4C 4YM6D 3MGPC 4UPKA 3AN2C 2AROC 3UTAD 5AY8A 3A6NA 3LELA 5AY8C 4QLCB 5GXQA 3LELC 5GXQC 3X1UC 4HGAC 2Y2LA 4JJND 1M18A 4WV4B 1M18C 4R8PC 3MNND 5CPKD 3TU4B 4G92C 5GSUD 4KGCD 4XUJA 3X1SB 1P34A 4XUJC 2F8NA 1WWSA 5CPIB 1KU5A 2NQBD 3X1VB 3AL0C 4WJ3C 5C3IB 5AV6B 3AZNA 1KX4B 4YS3A 3MGPB 3EPLA 3AN2B 3LJAD 2AROB 4E45A 4J8WC 5AY8B 1P3ID 4AWLC 3LELB 3WAAD 1F66A 5GXQB 3X1UB 3LZ1D 4HGAB 1F66C 1HQ3A 3B6GD 4UUZB 1M19A 3EG5B 3EPJA 3C1BD 4R8PB 3MGRD 1BH9A 1M1AA 3C1CA 3MGQA 4G92B 1M1AC 4G91C 3VH6A 5DNND 5AVCD 3MGRB 1P3KD 3O62C 1BFMA 2Y2QA 4XUJB 3W99A 2NZDA 3W99C 3MGSC 1S32A 2PYOC 3AZMC 3W97A 4Z5TD 5B0ZD 5CPJD 3IP4C 3AV2A 1P3BC 3RELD 5BNVA 3AV2C 3REHD 4H9RA 1KX5C 5JRGD 4J8XD 3AZFD 5E5AA 3KFUG 5B40A 3AYWD 5E5AC 2G5HC 1P3FA 3B6FC 4J8WB 1KX3C 3FDDA 1P3FC 4AWLB 1AOIB 2DQNC 5F99A 4NE5A 3NQJB 1F66B 3AZJA 5F99C 3B0CW 3W96C 3WKJD 3AZJC 3X1TD 5BS7A 3UTBA 4LD9C 2HIOB 5BS7C 3KWQD 2Y2PA 3UTBC 5B33A 1BH9B 1P3MD 3WTPA 2JE5A 3O62B 5B32A 2RVQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM B;  5B32 C;  1ZLA A;  3MGS B;  3W99 B;  1BH8 A;  2PYO B;  3AZM B;  4WU9 D;  2CV5 D;  3NQU A;  1P3G A;  1P3B B;  1ID3 D;  3AV2 B;  1P3G C;  5BNV B;  4WU8 D;  5FUG A;  5B24 C;  5BNX A;  4J8U D;  1KX5 B;  3AZK B;  5B2J C;  5E5A B;  5AV5 D;  3AZI D;  1TZY A;  3B6F B;  5B32 G;  1KX3 B;  1P3F B;  1TZY C;  3B0B A;  3R45 B;  3AZE D;  5F99 B;  2HUE C;  3W96 B;  4QLC A;  3AZJ B;  4ZUX D;  4YM6 C;  4LD9 B;  3KUY D;  3UTB B;  4KUD D;  3B0C T;  1U35 D;  3TU4 A;  4JJN A;  3TU4 C;  4JJN C;  2BYM B;  3KXB B;  5B32 B;  5B1L D;  3MNN A;  3X1S A;  3MNN C;  5CPK C;  1N1J B;  5AV9 B;  3NQU B;  5CPI A;  1P3G B;  5GSU C;  4KGC C;  5B24 B;  5B31 D;  5AV6 A;  5B2J B;  2NQB A;  3MGP A;  3AN2 A;  2NQB C;  1TZY B;  5G49 A;  2ARO A;  3UT9 D;  2HUE B;  1P3P D;  4YM6 B;  3LJA A;  3X1U A;  4EO5 C;  4XZQ D;  4UUZ A;  3LJA C;  5AVB D;  3UTA B;  3AV1 D;  3LZ1 A;  1P3I C;  3WAA C;  4R8P A;  3B6G A;  3LZ1 C;  3B6G C;  4JJN B;  3MGR A;  3C1B C;  4CAY B;  3MNN B;  3MGR C;  5CPK B;  5DNN A;  5AVC A;  1P3K A;  1EQZ D;  5GSU B;  5DNN C;  5AVC C;  3REK D;  1P3K C;  4KGC B;  2F8N H;  1P3L D;  4ZBJ C;  5B0Z A;  1ULY A;  2NQB B;  5B0Z C;  5CP6 D;  5CPJ C;  3REL A;  5G49 B;  4J8W A;  3REL C;  3REH A;  1AOI A;  1JFI A;  3AZH D;  3AZF A;  3REH C;  1AOI C;  3NQJ A;  4EO5 B;  5B0Y D;  5JRG C;  4J8X C;  3LJA B;  3AZF C;  3AYW C;  2HIO A;  1P3I B;  3WAA B;  2HIO C;  3LZ1 B;  3WKJ A;  3B6G B;  3X1T A;  5B1M D;  3REJ D;  3WKJ C;  3WA9 D;  3X1T C;  3KWQ A;  3C1B B;  3KWQ C;  3O62 A;  5KDM A;  4M6B A;  3A6N D;  3MGS A;  1P3M C;  2PYO A;  3AZM A;  5DNN B;  5AVC B;  1P3K B;  1P3B A;  1H3O B;  1M18 D;  5GT3 D;  4ZBJ B;  1KX5 A;  5B0Z B;  4Z5T B;  1B67 A;  4WU9 C;  3AZK A;  5CPJ B;  2CV5 C;  1ID3 A;  1F1E A;  3B6F A;  3B0D C;  3AZK C;  1KX3 A;  3REL B;  4WU8 A;  1ID3 C;  4WU8 C;  3R45 A;  4J8U C;  3REH B;  1JFI B;  4CSR B;  5JRG B;  4J8X B;  3AZF B;  3W96 A;  3AZI A;  1P34 D;  5AV5 C;  3AYW B;  2F8N D;  3AZI C;  4LD9 A;  3REI D;  3AZL D;  3WKJ B;  3X1T B;  4ZUX C;  3AZN D;  1B6W A;  2YFW A;  5AV8 D;  4YS3 D;  3KUY C;  3KWQ B;  3V9R A;  2BYM A;  3KXB A;  3KSY A;  3KXB C;  3MVD D;  1P3M B;  4Z2M H;  1N1J A;  5AV9 A;  1HQ3 D;  4NE6 A;  2LY8 A;  5AV9 C;  1M19 D;  5B1L C;  4H9O B;  5B24 A;  4WU9 B;  3VH5 W;  2CV5 B;  5B2J A;  1M1A D;  3C1C D;  3B0D B;  3MGQ D;  2BYK B;  1ID3 B;  4WU8 B;  4J8U B;  5B31 C;  5B2I D;  3LZ0 D;  5AV5 B;  3AZI B;  4YM6 A;  2NZD D;  4Z66 D;  1S32 D;  3UT9 A;  3W97 D;  3AZE B;  3UTA A;  3UT9 C;  1P3P A;  3UTA C;  1P3P C;  4ZUX B;  4WNN A;  2CWE A;  3AFA D;  2YFW B;  4XZQ C;  2L5A A;  3KUY B;  5AVB C;  4H9P B;  5B40 D;  3V9R B;  5B31 G;  3AV1 A;  4KUD B;  1U35 B;  3AV1 C;  4CAY A;  5CPK A;  4Z2M G;  2FJ7 D;  5BT1 D;  5B1L B;  5GSU A;  3AZG D;  4KGC A;  4X23 D;  2JSS A;  5B33 D;  4J8V D;  5BO0 A;  1EQZ A;  1EQZ C;  3WTP D;  3W98 D;  3REK C;  1P3O A;  5B31 B;  1P3O D;  3VH5 T;  1P3L C;  1ZLA D;  5DNM D;  5GT0 D;  5CP6 C;  3UT9 B;  1P3I A;  1P3P B;  3WAA A;  1R4V A;  3AZH C;  4WNN B;  5B0Y C;  4XZQ B;  2YFV A;  5AVB B;  1P3A D;  3C1B A;  3AV1 B;  4H9Q A;  5B1M A;  3REJ A;  3WA9 A;  5B1M C;  3REJ C;  3WA9 C;  4QLC D;  1H3O A;  1TAF B;  3A6N C;  5BO0 B;  1EQZ B;  4Z5T A;  3REK B;  3TU4 D;  5CPJ A;  4Z5T C;  3WTP E;  5GT3 A;  5GT3 C;  1P3L B;  4CSR A;  5JRG A;  3X1S D;  4J8X A;  5CP6 B;  3AYW A;  4E44 A;  5CPI D;  4DRB A;  3X1V D;  3AZH B;  5B0Y B;  4KHA B;  1P34 C;  2YFV B;  5AV6 D;  1KX4 D;  3REI A;  3MGP D;  3AN2 D;  3REI C;  3AZL A;  3AZL C;  2ARO D;  4H9Q B;  5B1M B;  3REJ B;  5AV8 A;  1P3M A;  3WA9 B;  5AY8 D;  3AZN C;  5AV8 C;  4YS3 C;  3LEL D;  5GXQ D;  3VH6 W;  4WZS B;  3X1U D;  4NFT A;  5JA4 A;  4DRA A;  3MVD A;  4H9O A;  3A6N B;  3MVD C;  2F8N G;  4H9N A;  4R8P D;  4WU9 A;  2CV5 A;  1HQ3 C;  1M19 C;  2BYK A;  1M18 B;  5GT3 B;  4J8U A;  4XUJ D;  5AV5 A;  3C1C C;  3MGQ C;  5B2I A;  3AZE A;  3LZ0 A;  5B2I C;  3AZE C;  1P34 B;  3LZ0 C;  4ZUX A;  2F8N B;  4Z66 A;  2NZD C;  4H9S A;  4Z66 C;  3KUY A;  4H9S C;  3REI B;  1S32 C;  3W97 C;  4KUD A;  4H9P A;  3AZL B;  4KUD C;  4J8W D;  1HTA A;  1U35 A;  3AZN B;  3AFA A;  1AOI D;  5AV8 B;  4YS3 B;  1U35 C;  3AFA C;  1F66 D;  5B40 C;  1Q9C A;  5B1L A;  5JA4 B;  3MVD B;  2HIO D;  2FJ7 A;  4H9N B;  3VH6 T;  1HQ3 B;  2FJ7 C;  1M19 B;  3AZG A;  5BT1 C;  4X23 A;  3AZG C;  4X23 C;  4J8V A;  5B31 A;  3O62 D;  5B33 C;  4J8V C;  1M1A B;  4G91 B;  3C1C B;  3MGQ B;  3W98 A;  3W99 D;  3MGS D;  3WTP C;  2PYO D;  3W98 C;  3AZM D;  5CHL B;  5B2I B;  1P3O C;  1P3B D;  3LZ0 B;  3AV2 D;  2IO5 C;  5DNM A;  2NZD B;  1ZLA C;  4Z66 B;  5GT0 A;  5DNM C;  4XZQ A;  1S32 B;  1KX5 D;  3VH5 A;  5GT0 C;  3W97 B;  5AVB A;  3AZK D;  5E5A D;  3B6F D;  1KX3 D;  1P3F D;  3AFA B;  4H9R B;  1P3A A;  5F99 D;  5B40 B;  1P3A C;  3W96 D;  3AZJ D;  4LD9 D;  1WWI A;  3UTB D;  2F8N K;  1TAF A;  2FJ7 B;  4QLC C;  3REK A;  3AZG B;  4X23 B;  2RVQ D;  5B33 B;  4J8V B;  3KXB D;  5B32 D;  1P3L A;  3WTP B;  3W98 B;  4NE3 A;  5CP6 A;  5AV9 D;  1P3O B;  1P3G D;  2IO5 B;  1ZLA B;  3AZH A;  5B0Y A;  5DNM B;  5B24 D;  1BH8 B;  4KHA A;  3X1S C;  5GT0 B;  5B2J D;  3X1V A;  5CPI C;  1TZY D;  3X1V C;  5FUG B;  1A7W A;  5BNX B;  5C3I C;  1KX4 A;  1P3A B;  5AV6 C;  1KX4 C;  4YM6 D;  3MGP C;  3AN2 C;  2ARO C;  3UTA D;  5AY8 A;  3A6N A;  3LEL A;  5AY8 C;  4QLC B;  5GXQ A;  3LEL C;  5GXQ C;  3X1U C;  4HGA C;  4JJN D;  1M18 A;  4WV4 B;  1M18 C;  4R8P C;  3MNN D;  5CPK D;  3TU4 B;  4G92 C;  5GSU D;  4KGC D;  4XUJ A;  3X1S B;  1P34 A;  4XUJ C;  2F8N A;  1WWS A;  5CPI B;  1KU5 A;  2NQB D;  3X1V B;  5C3I B;  5AV6 B;  3AZN A;  1KX4 B;  4YS3 A;  3MGP B;  3AN2 B;  3LJA D;  2ARO B;  4E45 A;  4J8W C;  5AY8 B;  1P3I D;  4AWL C;  3LEL B;  3WAA D;  1F66 A;  5GXQ B;  3X1U B;  3LZ1 D;  4HGA B;  1F66 C;  1HQ3 A;  3B6G D;  4UUZ B;  1M19 A;  3C1B D;  4R8P B;  3MGR D;  1BH9 A;  1M1A A;  3C1C A;  3MGQ A;  4G92 B;  1M1A C;  4G91 C;  3VH6 A;  5DNN D;  5AVC D;  3MGR B;  1P3K D;  3O62 C;  1BFM A;  4XUJ B;  3W99 A;  2NZD A;  3W99 C;  3MGS C;  1S32 A;  2PYO C;  3AZM C;  3W97 A;  4Z5T D;  5B0Z D;  5CPJ D;  3AV2 A;  1P3B C;  3REL D;  5BNV A;  3AV2 C;  3REH D;  4H9R A;  1KX5 C;  5JRG D;  4J8X D;  3AZF D;  5E5A A;  5B40 A;  3AYW D;  5E5A C;  1P3F A;  3B6F C;  4J8W B;  1KX3 C;  1P3F C;  4AWL B;  1AOI B;  5F99 A;  4NE5 A;  3NQJ B;  1F66 B;  3AZJ A;  5F99 C;  3B0C W;  3W96 C;  3WKJ D;  3AZJ C;  3X1T D;  5BS7 A;  3UTB A;  4LD9 C;  2HIO B;  5BS7 C;  3KWQ D;  3UTB C;  5B33 A;  1BH9 B;  1P3M D;  3WTP A;  3O62 B;  5B32 A;  2RVQ C; 
#chains in the Genus database with same CATH topology
 5KDM B;  5B32 C;  1ZLA A;  3MGS B;  2VQR A;  3W99 B;  1BH8 A;  2PYO B;  3AZM B;  4WU9 D;  2CV5 D;  3NQU A;  1P3G A;  1P3B B;  1ID3 D;  3AV2 B;  1P3G C;  5BNV B;  4WU8 D;  5FUG A;  5B24 C;  5BNX A;  4J8U D;  1KX5 B;  2ZY4 A;  3AZK B;  5B2J C;  5E5A B;  5AV5 D;  3AZI D;  1TZY A;  3B6F B;  5B32 G;  1KX3 B;  1P3F B;  1TZY C;  3B0B A;  3R45 B;  3AZE D;  5F99 B;  2HUE C;  3W96 B;  4QLC A;  3AZJ B;  4ZUX D;  4YM6 C;  4LD9 B;  3KUY D;  3UTB B;  2ZY3 A;  4KUD D;  3B0C T;  1U35 D;  3TU4 A;  4JJN A;  3TU4 C;  4JJN C;  2BYM B;  1T3U A;  3KXB B;  5B32 B;  5B1L D;  3MNN A;  2Y2M A;  3X1S A;  3MNN C;  5CPK C;  1N1J B;  5AV9 B;  2ZY5 A;  3NQU B;  5CPI A;  1P3G B;  5GSU C;  4KGC C;  5B24 B;  5B31 D;  5AV6 A;  5B2J B;  2NQB A;  3MGP A;  3AN2 A;  2NQB C;  1TZY B;  5G49 A;  2ARO A;  3UT9 D;  2HUE B;  1P3P D;  2Y2K A;  4YM6 B;  3LJA A;  3X1U A;  4EO5 C;  4XZQ D;  4UUZ A;  3LJA C;  5AVB D;  3UTA B;  3AV1 D;  3LZ1 A;  1P3I C;  3WAA C;  4R8P A;  3B6G A;  3LZ1 C;  3B6G C;  4JJN B;  1PZR A;  3MGR A;  3C1B C;  4CAY B;  3MNN B;  3MGR C;  5CPK B;  5DNN A;  5AVC A;  1P3K A;  1EQZ D;  5GSU B;  5DNN C;  5AVC C;  3REK D;  1P3K C;  4KGC B;  2F8N H;  1P3L D;  5B0Z A;  4ZBJ C;  1ULY A;  2NQB B;  5B0Z C;  5CP6 D;  5CPJ C;  3REL A;  5G49 B;  4J8W A;  3REL C;  3REH A;  1AOI A;  1JFI A;  3AZH D;  3AZF A;  3REH C;  1AOI C;  5B0Y D;  3NQJ A;  4EO5 B;  5JRG C;  4J8X C;  3LJA B;  3AZF C;  3AYW C;  2HIO A;  1P3I B;  3WAA B;  2HIO C;  3LZ1 B;  3WKJ A;  3B6G B;  3X1T A;  5B1M D;  3REJ D;  3WKJ C;  3WA9 D;  3X1T C;  3KWQ A;  3C1B B;  3KWQ C;  3O62 A;  5KDM A;  4M6B A;  3A6N D;  3MGS A;  1P3M C;  2PYO A;  3AZM A;  5DNN B;  5AVC B;  1P3K B;  2Y2H A;  1P3B A;  1H3O B;  1M18 D;  5GT3 D;  4ZBJ B;  1KX5 A;  5B0Z B;  4Z5T B;  1B67 A;  4WU9 C;  3AZK A;  5CPJ B;  2CV5 C;  1ID3 A;  1F1E A;  3B6F A;  3B0D C;  3AZK C;  4DQY B;  3REL B;  4WU8 A;  1KX3 A;  1ID3 C;  4WU8 C;  3R45 A;  4J8U C;  3REH B;  1JFI B;  4CSR B;  5JRG B;  4J8X B;  3AZF B;  3W96 A;  3AZI A;  2RIQ A;  1P34 D;  5AV5 C;  3AYW B;  2F8N D;  3AZI C;  4LD9 A;  3H0L C;  3REI D;  2F2A C;  2FFF B;  3AZL D;  3WKJ B;  3X1T B;  4ZUX C;  3AZN D;  1B6W A;  2YFW A;  5AV8 D;  4YS3 D;  3KUY C;  3KWQ B;  3V9R A;  2BYM A;  3F6T A;  3KXB A;  3KSY A;  3KXB C;  3MVD D;  2W8S A;  1P3M B;  4Z2M H;  1N1J A;  5AV9 A;  1HQ3 D;  4NE6 A;  2LY8 A;  5AV9 C;  1M19 D;  5B1L C;  4H9O B;  5B24 A;  4WU9 B;  3VH5 W;  2CV5 B;  5B2J A;  1M1A D;  3C1C D;  3B0D B;  3MGQ D;  2BYK B;  1ID3 B;  4WU8 B;  4J8U B;  5B31 C;  5B2I D;  3LZ0 D;  5AV5 B;  3AZI B;  4YM6 A;  2NZD D;  4Z66 D;  1S32 D;  3UT9 A;  3W97 D;  3AZE B;  3UTA A;  3UT9 C;  1P3P A;  3UTA C;  1P3P C;  4ZUX B;  4WNN A;  2CWE A;  3AFA D;  2YFW B;  4XZQ C;  2L5A A;  3KUY B;  5AVB C;  4H9P B;  5B40 D;  3V9R B;  5B31 G;  3AV1 A;  4KUD B;  3P5J B;  1U35 B;  3AV1 C;  4CAY A;  5CPK A;  4Z2M G;  2FJ7 D;  2XD1 A;  5BT1 D;  5B1L B;  5GSU A;  3AZG D;  4KGC A;  4X23 D;  2JSS A;  5B33 D;  4J8V D;  2DF4 C;  5BO0 A;  3H0R C;  1EQZ A;  2JCH A;  3H0M C;  1EQZ C;  2Y2J A;  3WTP D;  3W98 D;  3REK C;  1P3O A;  5B31 B;  1P3O D;  2Y2I A;  3VH5 T;  1P3L C;  2J8P A;  1ZLA D;  5DNM D;  5GT0 D;  5CP6 C;  3UT9 B;  1P3I A;  1P3P B;  3WAA A;  1R4V A;  3AZH C;  4WNN B;  5B0Y C;  4XZQ B;  2YFV A;  5AVB B;  1P3A D;  3C1B A;  3AV1 B;  4H9Q A;  5B1M A;  3REJ A;  3WA9 A;  5B1M C;  3REJ C;  3WA9 C;  4QLC D;  3EPK A;  2Y2O A;  3A1K A;  1H3O A;  1TAF B;  3A6N C;  5BO0 B;  1EQZ B;  4Z5T A;  1Z2C B;  3REK B;  3TU4 D;  5CPJ A;  4Z5T C;  3WTP E;  5GT3 A;  5GT3 C;  1P3L B;  4CSR A;  5JRG A;  3X1S D;  4J8X A;  5CP6 B;  3AYW A;  4E44 A;  5CPI D;  4DRB A;  3X1V D;  3AZH B;  5B0Y B;  4KHA B;  2Y2G A;  1P34 C;  2YFV B;  5AV6 D;  1KX4 D;  3REI A;  3MGP D;  3AN2 D;  3REI C;  3AZL A;  3AZL C;  2ARO D;  4H9Q B;  5B1M B;  3REJ B;  5AV8 A;  1P3M A;  3WA9 B;  5AY8 D;  3AZN C;  5AV8 C;  4YS3 C;  3LEL D;  5GXQ D;  3VH6 W;  4WZS B;  3X1U D;  4NFT A;  5JA4 A;  4DRA A;  3MVD A;  4H9O A;  3A6N B;  3MVD C;  2F8N G;  4H9N A;  4R8P D;  4WU9 A;  2CV5 A;  1HQ3 C;  1M19 C;  2BYK A;  1M18 B;  5GT3 B;  4J8U A;  4XUJ D;  5AV5 A;  3C1C C;  3MGQ C;  5B2I A;  3AZE A;  3LZ0 A;  5B2I C;  3AZE C;  1P34 B;  3LZ0 C;  4ZUX A;  2F8N B;  4Z66 A;  2NZD C;  4H9S A;  4Z66 C;  3KUY A;  4H9S C;  3REI B;  1S32 C;  3W97 C;  4KUD A;  4H9P A;  3AZL B;  4KUD C;  4J8W D;  1HTA A;  1U35 A;  3AZN B;  2UWX A;  3AFA A;  5AV8 B;  4YS3 B;  1U35 C;  1AOI D;  3EPH A;  3AFA C;  1F66 D;  5B40 C;  1Q9C A;  5B1L A;  5JA4 B;  3MVD B;  2HIO D;  2FJ7 A;  2BG1 A;  4H9N B;  3VH6 T;  1HQ3 B;  2FJ7 C;  1M19 B;  3AZG A;  5BT1 C;  4X23 A;  3AZG C;  4X23 C;  4J8V A;  5B31 A;  3O62 D;  5B33 C;  4J8V C;  1M1A B;  4G91 B;  3C1C B;  3MGQ B;  3W98 A;  3W99 D;  3MGS D;  3WTP C;  2PYO D;  3W98 C;  3AZM D;  5CHL B;  5B2I B;  1P3O C;  1P3B D;  3LZ0 B;  3AV2 D;  2IO5 C;  5DNM A;  2NZD B;  1ZLA C;  2ZM5 A;  4Z66 B;  5GT0 A;  5DNM C;  4XZQ A;  1S32 B;  1KX5 D;  3VH5 A;  5GT0 C;  3W97 B;  5AVB A;  3AZK D;  5E5A D;  2G5I C;  3B6F D;  1KX3 D;  1P3F D;  3AFA B;  4H9R B;  1P3A A;  5F99 D;  5B40 B;  1P3A C;  3W96 D;  3AZJ D;  4LD9 D;  1WWI A;  3UTB D;  2XD5 A;  2F8N K;  1TAF A;  2FJ7 B;  4QLC C;  3REK A;  3AZG B;  4X23 B;  2RVQ D;  5B33 B;  4J8V B;  1W2E A;  3KXB D;  5B32 D;  1P3L A;  3WTP B;  3W98 B;  4NE3 A;  5CP6 A;  5AV9 D;  1P3O B;  3A1I A;  1P3G D;  2Y2N A;  2IO5 B;  1ZLA B;  3AZH A;  5B0Y A;  5DNM B;  5B24 D;  1BH8 B;  4KHA A;  3X1S C;  5GT0 B;  5B2J D;  3X1V A;  5CPI C;  1TZY D;  3X1V C;  5FUG B;  1A7W A;  5BNX B;  5C3I C;  1KX4 A;  1P3A B;  5AV6 C;  2ZY2 A;  1KX4 C;  4YM6 D;  3MGP C;  4UPK A;  3AN2 C;  2ARO C;  3UTA D;  5AY8 A;  3A6N A;  3LEL A;  5AY8 C;  4QLC B;  5GXQ A;  3LEL C;  5GXQ C;  3X1U C;  4HGA C;  2Y2L A;  4JJN D;  1M18 A;  4WV4 B;  1M18 C;  4R8P C;  3MNN D;  5CPK D;  3TU4 B;  4G92 C;  5GSU D;  4KGC D;  4XUJ A;  3X1S B;  1P34 A;  4XUJ C;  2F8N A;  1WWS A;  5CPI B;  1KU5 A;  2NQB D;  3X1V B;  3AL0 C;  4WJ3 C;  5C3I B;  5AV6 B;  3AZN A;  1KX4 B;  4YS3 A;  3MGP B;  3EPL A;  3AN2 B;  3LJA D;  2ARO B;  4E45 A;  4J8W C;  5AY8 B;  1P3I D;  4AWL C;  3LEL B;  3WAA D;  1F66 A;  5GXQ B;  3X1U B;  3LZ1 D;  4HGA B;  1F66 C;  1HQ3 A;  3B6G D;  4UUZ B;  1M19 A;  3EG5 B;  3EPJ A;  3C1B D;  4R8P B;  3MGR D;  1BH9 A;  1M1A A;  3C1C A;  3MGQ A;  4G92 B;  1M1A C;  4G91 C;  3VH6 A;  5DNN D;  5AVC D;  3MGR B;  1P3K D;  3O62 C;  1BFM A;  2Y2Q A;  4XUJ B;  3W99 A;  2NZD A;  3W99 C;  3MGS C;  1S32 A;  2PYO C;  3AZM C;  3W97 A;  4Z5T D;  5B0Z D;  5CPJ D;  3IP4 C;  3AV2 A;  1P3B C;  3REL D;  5BNV A;  3AV2 C;  3REH D;  4H9R A;  1KX5 C;  5JRG D;  4J8X D;  3AZF D;  5E5A A;  3KFU G;  5B40 A;  3AYW D;  5E5A C;  2G5H C;  1P3F A;  3B6F C;  4J8W B;  1KX3 C;  3FDD A;  1P3F C;  4AWL B;  1AOI B;  2DQN C;  5F99 A;  4NE5 A;  3NQJ B;  1F66 B;  3AZJ A;  5F99 C;  3B0C W;  3W96 C;  3WKJ D;  3AZJ C;  3X1T D;  5BS7 A;  3UTB A;  4LD9 C;  2HIO B;  5BS7 C;  3KWQ D;  2Y2P A;  3UTB C;  5B33 A;  1BH9 B;  1P3M D;  3WTP A;  2JE5 A;  3O62 B;  5B32 A;  2RVQ C; 
#chains in the Genus database with same CATH homology
 5KDM B;  5B32 C;  1ZLA A;  3MGS B;  2VQR A;  3W99 B;  1BH8 A;  2PYO B;  3AZM B;  4WU9 D;  2CV5 D;  3NQU A;  1P3G A;  1P3B B;  1ID3 D;  3AV2 B;  1P3G C;  5BNV B;  4WU8 D;  5FUG A;  5B24 C;  5BNX A;  4J8U D;  1KX5 B;  2ZY4 A;  3AZK B;  5B2J C;  5E5A B;  5AV5 D;  3AZI D;  1TZY A;  3B6F B;  5B32 G;  1KX3 B;  1P3F B;  1TZY C;  3B0B A;  3R45 B;  3AZE D;  5F99 B;  2HUE C;  3W96 B;  4QLC A;  3AZJ B;  4ZUX D;  4YM6 C;  4LD9 B;  3KUY D;  3UTB B;  2ZY3 A;  4KUD D;  3B0C T;  1U35 D;  3TU4 A;  4JJN A;  3TU4 C;  4JJN C;  2BYM B;  1T3U A;  3KXB B;  5B32 B;  5B1L D;  3MNN A;  2Y2M A;  3X1S A;  3MNN C;  5CPK C;  1N1J B;  5AV9 B;  2ZY5 A;  3NQU B;  5CPI A;  1P3G B;  5GSU C;  4KGC C;  5B24 B;  5B31 D;  5AV6 A;  5B2J B;  2NQB A;  3MGP A;  3AN2 A;  2NQB C;  1TZY B;  5G49 A;  2ARO A;  3UT9 D;  2HUE B;  1P3P D;  2Y2K A;  4YM6 B;  3LJA A;  3X1U A;  4EO5 C;  4XZQ D;  4UUZ A;  3LJA C;  5AVB D;  3UTA B;  3AV1 D;  3LZ1 A;  1P3I C;  3WAA C;  4R8P A;  3B6G A;  3LZ1 C;  3B6G C;  4JJN B;  1PZR A;  3MGR A;  3C1B C;  4CAY B;  3MNN B;  3MGR C;  5CPK B;  5DNN A;  5AVC A;  1P3K A;  1EQZ D;  5GSU B;  5DNN C;  5AVC C;  3REK D;  1P3K C;  4KGC B;  2F8N H;  1P3L D;  5B0Z A;  4ZBJ C;  1ULY A;  2NQB B;  5B0Z C;  5CP6 D;  5CPJ C;  3REL A;  5G49 B;  4J8W A;  3REL C;  3REH A;  1AOI A;  1JFI A;  3AZH D;  3AZF A;  3REH C;  1AOI C;  5B0Y D;  3NQJ A;  4EO5 B;  5JRG C;  4J8X C;  3LJA B;  3AZF C;  3AYW C;  2HIO A;  1P3I B;  3WAA B;  2HIO C;  3LZ1 B;  3WKJ A;  3B6G B;  3X1T A;  5B1M D;  3REJ D;  3WKJ C;  3WA9 D;  3X1T C;  3KWQ A;  3C1B B;  3KWQ C;  3O62 A;  5KDM A;  4M6B A;  3A6N D;  3MGS A;  1P3M C;  2PYO A;  3AZM A;  5DNN B;  5AVC B;  1P3K B;  2Y2H A;  1P3B A;  1H3O B;  1M18 D;  5GT3 D;  4ZBJ B;  1KX5 A;  5B0Z B;  4Z5T B;  1B67 A;  4WU9 C;  3AZK A;  5CPJ B;  2CV5 C;  1ID3 A;  1F1E A;  3B6F A;  3B0D C;  3AZK C;  4DQY B;  3REL B;  4WU8 A;  1KX3 A;  1ID3 C;  4WU8 C;  3R45 A;  4J8U C;  3REH B;  1JFI B;  4CSR B;  5JRG B;  4J8X B;  3AZF B;  3W96 A;  3AZI A;  2RIQ A;  1P34 D;  5AV5 C;  3AYW B;  2F8N D;  3AZI C;  4LD9 A;  3H0L C;  3REI D;  2F2A C;  2FFF B;  3AZL D;  3WKJ B;  3X1T B;  4ZUX C;  3AZN D;  1B6W A;  2YFW A;  5AV8 D;  4YS3 D;  3KUY C;  3KWQ B;  3V9R A;  2BYM A;  3F6T A;  3KXB A;  3KSY A;  3KXB C;  3MVD D;  2W8S A;  1P3M B;  4Z2M H;  1N1J A;  5AV9 A;  1HQ3 D;  4NE6 A;  2LY8 A;  5AV9 C;  1M19 D;  5B1L C;  4H9O B;  5B24 A;  4WU9 B;  3VH5 W;  2CV5 B;  5B2J A;  1M1A D;  3C1C D;  3B0D B;  3MGQ D;  2BYK B;  1ID3 B;  4WU8 B;  4J8U B;  5B31 C;  5B2I D;  3LZ0 D;  5AV5 B;  3AZI B;  4YM6 A;  2NZD D;  4Z66 D;  1S32 D;  3UT9 A;  3W97 D;  3AZE B;  3UTA A;  3UT9 C;  1P3P A;  3UTA C;  1P3P C;  4ZUX B;  4WNN A;  2CWE A;  3AFA D;  2YFW B;  4XZQ C;  2L5A A;  3KUY B;  5AVB C;  4H9P B;  5B40 D;  3V9R B;  5B31 G;  3AV1 A;  4KUD B;  3P5J B;  1U35 B;  3AV1 C;  4CAY A;  5CPK A;  4Z2M G;  2FJ7 D;  2XD1 A;  5BT1 D;  5B1L B;  5GSU A;  3AZG D;  4KGC A;  4X23 D;  2JSS A;  5B33 D;  4J8V D;  2DF4 C;  5BO0 A;  3H0R C;  1EQZ A;  2JCH A;  3H0M C;  1EQZ C;  2Y2J A;  3WTP D;  3W98 D;  3REK C;  1P3O A;  5B31 B;  1P3O D;  2Y2I A;  3VH5 T;  1P3L C;  2J8P A;  1ZLA D;  5DNM D;  5GT0 D;  5CP6 C;  3UT9 B;  1P3I A;  1P3P B;  3WAA A;  1R4V A;  3AZH C;  4WNN B;  5B0Y C;  4XZQ B;  2YFV A;  5AVB B;  1P3A D;  3C1B A;  3AV1 B;  4H9Q A;  5B1M A;  3REJ A;  3WA9 A;  5B1M C;  3REJ C;  3WA9 C;  4QLC D;  3EPK A;  2Y2O A;  3A1K A;  1H3O A;  1TAF B;  3A6N C;  5BO0 B;  1EQZ B;  4Z5T A;  1Z2C B;  3REK B;  3TU4 D;  5CPJ A;  4Z5T C;  3WTP E;  5GT3 A;  5GT3 C;  1P3L B;  4CSR A;  5JRG A;  3X1S D;  4J8X A;  5CP6 B;  3AYW A;  4E44 A;  5CPI D;  4DRB A;  3X1V D;  3AZH B;  5B0Y B;  4KHA B;  2Y2G A;  1P34 C;  2YFV B;  5AV6 D;  1KX4 D;  3REI A;  3MGP D;  3AN2 D;  3REI C;  3AZL A;  3AZL C;  2ARO D;  4H9Q B;  5B1M B;  3REJ B;  5AV8 A;  1P3M A;  3WA9 B;  5AY8 D;  3AZN C;  5AV8 C;  4YS3 C;  3LEL D;  5GXQ D;  3VH6 W;  4WZS B;  3X1U D;  4NFT A;  5JA4 A;  4DRA A;  3MVD A;  4H9O A;  3A6N B;  3MVD C;  2F8N G;  4H9N A;  4R8P D;  4WU9 A;  2CV5 A;  1HQ3 C;  1M19 C;  2BYK A;  1M18 B;  5GT3 B;  4J8U A;  4XUJ D;  5AV5 A;  3C1C C;  3MGQ C;  5B2I A;  3AZE A;  3LZ0 A;  5B2I C;  3AZE C;  1P34 B;  3LZ0 C;  4ZUX A;  2F8N B;  4Z66 A;  2NZD C;  4H9S A;  4Z66 C;  3KUY A;  4H9S C;  3REI B;  1S32 C;  3W97 C;  4KUD A;  4H9P A;  3AZL B;  4KUD C;  4J8W D;  1HTA A;  1U35 A;  3AZN B;  2UWX A;  3AFA A;  5AV8 B;  4YS3 B;  1U35 C;  1AOI D;  3EPH A;  3AFA C;  1F66 D;  5B40 C;  1Q9C A;  5B1L A;  5JA4 B;  3MVD B;  2HIO D;  2FJ7 A;  2BG1 A;  4H9N B;  3VH6 T;  1HQ3 B;  2FJ7 C;  1M19 B;  3AZG A;  5BT1 C;  4X23 A;  3AZG C;  4X23 C;  4J8V A;  5B31 A;  3O62 D;  5B33 C;  4J8V C;  1M1A B;  4G91 B;  3C1C B;  3MGQ B;  3W98 A;  3W99 D;  3MGS D;  3WTP C;  2PYO D;  3W98 C;  3AZM D;  5CHL B;  5B2I B;  1P3O C;  1P3B D;  3LZ0 B;  3AV2 D;  2IO5 C;  5DNM A;  2NZD B;  1ZLA C;  2ZM5 A;  4Z66 B;  5GT0 A;  5DNM C;  4XZQ A;  1S32 B;  1KX5 D;  3VH5 A;  5GT0 C;  3W97 B;  5AVB A;  3AZK D;  5E5A D;  2G5I C;  3B6F D;  1KX3 D;  1P3F D;  3AFA B;  4H9R B;  1P3A A;  5F99 D;  5B40 B;  1P3A C;  3W96 D;  3AZJ D;  4LD9 D;  1WWI A;  3UTB D;  2XD5 A;  2F8N K;  1TAF A;  2FJ7 B;  4QLC C;  3REK A;  3AZG B;  4X23 B;  2RVQ D;  5B33 B;  4J8V B;  1W2E A;  3KXB D;  5B32 D;  1P3L A;  3WTP B;  3W98 B;  4NE3 A;  5CP6 A;  5AV9 D;  1P3O B;  3A1I A;  1P3G D;  2Y2N A;  2IO5 B;  1ZLA B;  3AZH A;  5B0Y A;  5DNM B;  5B24 D;  1BH8 B;  4KHA A;  3X1S C;  5GT0 B;  5B2J D;  3X1V A;  5CPI C;  1TZY D;  3X1V C;  5FUG B;  1A7W A;  5BNX B;  5C3I C;  1KX4 A;  1P3A B;  5AV6 C;  2ZY2 A;  1KX4 C;  4YM6 D;  3MGP C;  4UPK A;  3AN2 C;  2ARO C;  3UTA D;  5AY8 A;  3A6N A;  3LEL A;  5AY8 C;  4QLC B;  5GXQ A;  3LEL C;  5GXQ C;  3X1U C;  4HGA C;  2Y2L A;  4JJN D;  1M18 A;  4WV4 B;  1M18 C;  4R8P C;  3MNN D;  5CPK D;  3TU4 B;  4G92 C;  5GSU D;  4KGC D;  4XUJ A;  3X1S B;  1P34 A;  4XUJ C;  2F8N A;  1WWS A;  5CPI B;  1KU5 A;  2NQB D;  3X1V B;  3AL0 C;  4WJ3 C;  5C3I B;  5AV6 B;  3AZN A;  1KX4 B;  4YS3 A;  3MGP B;  3EPL A;  3AN2 B;  3LJA D;  2ARO B;  4E45 A;  4J8W C;  5AY8 B;  1P3I D;  4AWL C;  3LEL B;  3WAA D;  1F66 A;  5GXQ B;  3X1U B;  3LZ1 D;  4HGA B;  1F66 C;  1HQ3 A;  3B6G D;  4UUZ B;  1M19 A;  3EG5 B;  3EPJ A;  3C1B D;  4R8P B;  3MGR D;  1BH9 A;  1M1A A;  3C1C A;  3MGQ A;  4G92 B;  1M1A C;  4G91 C;  3VH6 A;  5DNN D;  5AVC D;  3MGR B;  1P3K D;  3O62 C;  1BFM A;  2Y2Q A;  4XUJ B;  3W99 A;  2NZD A;  3W99 C;  3MGS C;  1S32 A;  2PYO C;  3AZM C;  3W97 A;  4Z5T D;  5B0Z D;  5CPJ D;  3IP4 C;  3AV2 A;  1P3B C;  3REL D;  5BNV A;  3AV2 C;  3REH D;  4H9R A;  1KX5 C;  5JRG D;  4J8X D;  3AZF D;  5E5A A;  3KFU G;  5B40 A;  3AYW D;  5E5A C;  2G5H C;  1P3F A;  3B6F C;  4J8W B;  1KX3 C;  3FDD A;  1P3F C;  4AWL B;  1AOI B;  2DQN C;  5F99 A;  4NE5 A;  3NQJ B;  1F66 B;  3AZJ A;  5F99 C;  3B0C W;  3W96 C;  3WKJ D;  3AZJ C;  3X1T D;  5BS7 A;  3UTB A;  4LD9 C;  2HIO B;  5BS7 C;  3KWQ D;  2Y2P A;  3UTB C;  5B33 A;  1BH9 B;  1P3M D;  3WTP A;  2JE5 A;  3O62 B;  5B32 A;  2RVQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...