1P34A

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKAVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p34A00
2HUEC 4ZUXD 1M19C 3W97D 5AY8B 1KX5A 3LZ0C 3RELC 3X1UB 5AVCA 4ZUXB 3B6FC 1H3OA 4Z66D 5B33A 5CP6A 3WKJB 3W99C 3LZ1C 2CV5B 1HQ3C 3UTAB 4NFTA 4DRBA 4EO5B 4X23C 5AVBD 3AZND 5CPIC 3A6NA 3MGQA 3C1CD 4KGCA 5GXQD 3AV1B 3NQJB 3MGPA 5B2IC 5BT1D 2BYKA 3MGSB 2HUEB 1M19B 3O62D 5GXQB 1P3KD 3LZ0B 3RELB 5E5AC 4YS3A 3KXBA 1TZYA 2LY8A 1P3KB 1KX3C 3AZED 1KX4A 4XUJC 1M18C 5B32C 4X23B 3AN2C 5GT3C 5AV8D 1P3PA 3AV2C 4LD9C 2HIOC 4XZQC 2PYOD 3KSYA 3MNNC 5AV5C 5B24A 4Z5TC 5AV8B 3X1VA 3AYWA 1P3OC 5B2IB 3AZHC 1AOID 4J8UC 4UUZB 1P3AA 4J8XC 5E5AB 1R4VA 3AZFA 5FUGB 3B6GC 5JA4A 1M18D 1EQZA 1BFMA 3REHA 4XUJB 5B1MA 3KUYC 4LD9D 3AZGA 1M18B 4XZQD 2NQBA 5B32B 2NZDC 3R45B 1N1JA 4QLCA 5GT3B 3W96A 4Z5TD 3KWQA 5B0YA 3AV2B 4LD9B 2HIOB 5CPJD 4XZQB 4J8VC 3MNNB 5AV5B 4Z5TB 5AV9D 1P3OB 2FJ7C 3LELD 3AZHB 5B31C 4WU8C 3WA9C 5B1LA 5GSUA 4J8XB 3LELB 3AZJC 4KUDA 3B6GB 3KUYB 3VH6A 5BNVA 3LJAA 3REIC 5BS7C 2NZDB 3REKD 5B2JA 1P3GD 1P3FA 3AFAA 4YM6A 4H9OB 4Z2MG 3V9RA 3AZKC 4J8VB 5DNNA 3TU4A 3WA9D 5B32G 3UTBC 4R8PC 3WTPC 1P3GB 2FJ7B 5JRGC 3WAAD 5DNMA 3C1BC 2AROC 5B31B 1M1AD 3WA9B 1P3LC 3AZIA 3X1UC 3AZJB 1B6WA 1P3BA 3W97C 4JJNA 3X1SA 2IO5C 5B40D 3REIB 5AY8A 5B0ZD 3AZKD 3AZLC 4Z66C 3B0DB 1ZLAD 4CSRB 4J8WA 4ZUXA 1JFIB 3AZKB 2AROD 5AV6D 3UTBB 1F1EA 3WTPB 5AVBC 4R8PB 1F66D 3WKJA 4H9SC 2CV5A 3UTAA 3AZNC 4DRAA 3C1CC 5F99A 3C1BB 2AROB 5AV6B 1P3LB 5GXQC 2CWEA 1ID3D 5BT1C 1P34D 3AV1A 3UT9A 3NQUA 5KDMB 5B31G 3O62C 3AZLD 1P3KC 3W97B 2IO5B 3NQJA 1BH8B 3MGSA 1M19A 1P34B 3LZ0A 3AZLB 4Z66B 3RELA 1S32D 4WNNB 3MGRD 3AZEC 4E45A 1P3MD 3B6FA 1P3IC 3VH6T 1S32B 5AVBB 3W99A 5AV8C 3LZ1A 4HGAC 1HQ3A 3REJD 3AZNB 3C1CB 4X23A 2PYOC 5CPIA 5BO0B 4WU9D 3REJB 1TAFA 1AOIC 1KX5D 3O62B 2YFWB 5B2IA 5AVCD 4H9NB 4UUZA 1KX5B 1P3ID 4WZSB 5B33D 5E5AA 3AZEB 5CP6D 5AVCB 1P3IB 1KX3A 5B33B 3B0CT 3W98C 4XUJA 3A6ND 4HGAB 2F8NH 1M18A 5B32A 4KGCD 3R45A 5CPJC 3AN2A 5GT3A 2PYOB 5CHLB 4H9QB 3AV2A 4LD9A 5AV9C 2HIOA 3A6NB 3MGPD 4XZQA 3LELC 3MNNA 1AOIB 5AV5A 4Z5TA 4YS3D 1P3OA 3KXBD 3MGPB 3AZHA 4J8UA 4J8XA 1KX4D 3KXBB 3W98D 3B6GA 5BNXB 3REKC 1U35C 1P3GC 3W98B 3KUYA 4CAYB 2YFVB 3AZMC 2NZDA 5CPJB 5B24D 3X1VD 4H9OA 3VH6W 3AYWD 5AV9B 4WU9A 3WAAC 4J8VA 1M1AC 5B24B 5G49B 5C3IC 3X1VB 1P3AD 4H9RB 2FJ7A 3AZFD 4NE5A 5B31A 4WU8A 3WA9A 1EQZD 1KU5A 3REHD 1U35D 3VH5A 5B40C 3AZMD 5B1MD 3AZJA 3B0DC 3AZGD 1ULYA 2F8ND 2NQBD 5B0ZC 4NE3A 4QLCD 3REKB 3W96D 3REHB 1U35B 3KWQD 3AZMB 1BH9A 5B0YD 3REIA 1ZLAC 5BS7A 2F8NB 5AV6C 3KWQB 5GT0C 3MVDC 1JFIA 5B0YB 1F66C 3AZKA 3B0CW 3WAAB 1WWIA 3UTBA 4R8PA 3WTPA 1M1AB 5B1LD 5C3IB 5GSUD 5JRGA 1ID3C 3C1BA 2AROA 4KUDD 1P3LA 2L5AA 1P34C 3X1TC 5B40B 3X1UA 3LJAD 4KUDB 3W97A 5B0ZB 5B2JD 1P3FD 1S32C 4YM6D 5GT0D 3MVDD 3MGRC 3LJAB 1ZLAB 4H9PB 5CPKC 1P3MC 3AZLA 5DNND 4KHAB 4Z66A 4NE6A 3TU4D 4WNNA 4G91C 5B2JB 2BYMB 5GT0B 4YM6B 3MVDB 4ZBJC 1F66B 5DNMD 3REJC 5DNNB 5AVBA 4H9SA 3X1TD 3AZID 3AZNA 1ID3B 3C1CA 4WU9C 1P3BD 5GXQA 4JJND 1KX5C 3X1SD 3X1TB 5BO0A 3AZIB 5AVCC 5AY8D 3O62A 5CPKD 1P3KA 5B33C 2YFWA 3MGRB 4J8WD 5CP6C 4H9NA 3VH5T 1HTAA 5CPKB 1P3MB 4G91B 3AZEA 3WKJD 4J8WB 4ZBJB 3UTAD 2CV5D 3A6NC 5F99D 3MGQC 1P3IA 4KGCC 4AWLC 4Z2MH 5AV8A 5F99B 3MGPC 4WU9B 2PYOA 4M6BA 3UT9D 3AV1D 4H9QA 4YS3C 3KXBC 1TZYC 3MGSD 5FUGA 1M19D 1AOIA 3UT9B 3NQUB 3LZ0D 1H3OB 3RELD 1KX4C 5CP6B 3B6FD 3MGQD 1B67A 3W99D 3LZ1D 1P3PC 1HQ3D 3B6FB 5BNXA 3MGQB 4X23D 4KGCB 4AWLB 3W98A 4CAYA 2YFVA 5B24C 3W99B 5CPID 3X1VC 3WTPE 3LZ1B 1HQ3B 3AYWC 1TZYD 5CPJA 2BYKB 5CPIB 5AV9A 1P3AC 5B2ID 4YS3B 1TZYB 3AZFC 3LELA 1TAFB 2RVQC 5G49A 1EQZC 4H9RA 4WV4B 5E5AD 2JSSA 3REHC 1KX4B 1P3PD 5B1MC 3AZGC 1KX3D 2NQBC 4QLCC 4XUJD 3W96C 3KWQC 1P3PB 5B0YC 5B32D 1KX3B 3REKA 3AN2D 5GT3D 1U35A 1P3GA 3VH5W 3AZMA 3AV2D 2HIOD 2F8NA 3B0BA 3AYWB 2RVQD 3MNND 3AN2B 5AV5D 5B1LC 5GSUC 1P3AB 1P3OD 3AZHD 3WAAA 3AZFB 4J8UD 4KUDC 1M1AA 5JA4B 1EQZB 4J8XD 3B6GD 4J8UB 5B1MB 3LJAC 3AZGB 2NQBB 1N1JB 5B2JC 4QLCB 5B40A 3KUYD 1P3FC 3W96B 3AFAC 4YM6C 4CSRA 2NZDD 5B0ZA 4E44A 5DNNC 3TU4C 1ZLAA 4H9PA 4J8VD 4KHAA 5DNMC 5AV6A 2BYMA 5GT0A 3MVDA 1F66A 5B1LB 5GSUB 2FJ7D 3AZIC 5B31D 4WU8D 1P3BC 5KDMA 4JJNC 3X1SC 1ID3A 1A7WA 4G92C 3AFAD 3AZJD 1BH8A 4WU8B 5BNVB 1P34A 5AY8C 3X1TA 2F8NK 1P3FB 1WWSA 3AFAB 3REID 4J8WC 4ZUXC 3V9RB 2F8NG 3TU4B 1Q9CA 1S32A 3MGRA 1BH9B 3WKJC 2CV5C 3UTAC 5CPKA 1P3MA 5F99C 5DNMB 4EO5C 3UTBD 4R8PD 3WTPD 5JRGD 3REJA 3C1BD 1P3LD 3AV1C 3UT9C 1P3BB 4JJNB 3X1SB 5JRGB 3X1UD 4G92B 3MGSC
chains in the Genus database with same CATH superfamily
2HUEC 4ZUXD 1M19C 3W97D 5AY8B 1KX5A 3LZ0C 2Y2IA 3RELC 3X1UB 5AVCA 4ZUXB 3B6FC 1H3OA 4Z66D 5B33A 5CP6A 3WKJB 3W99C 3LZ1C 2Y2LA 2CV5B 1HQ3C 3UTAB 4NFTA 4DRBA 4EO5B 3H0MC 4X23C 5AVBD 1PZRA 3AZND 5CPIC 3A6NA 3MGQA 3C1CD 4KGCA 1W2EA 5GXQD 3AV1B 3NQJB 3MGPA 5B2IC 5BT1D 2BYKA 3P5JB 3MGSB 2HUEB 1M19B 3O62D 5GXQB 1P3KD 3LZ0B 3RELB 5E5AC 4YS3A 3KXBA 1TZYA 2LY8A 1Z2CB 1P3KB 1KX3C 3AZED 1KX4A 4XUJC 1M18C 5B32C 4X23B 3AN2C 5GT3C 5AV8D 1P3PA 3AV2C 2G5IC 4LD9C 2HIOC 4XZQC 2PYOD 3KSYA 3MNNC 5AV5C 5B24A 4Z5TC 5AV8B 3X1VA 3IP4C 3AYWA 1P3OC 5B2IB 3AZHC 1AOID 4J8UC 4UUZB 1P3AA 4J8XC 5E5AB 1R4VA 3AZFA 5FUGB 3B6GC 5JA4A 1M18D 1EQZA 1BFMA 3REHA 4XUJB 5B1MA 3KUYC 4LD9D 3AZGA 1M18B 4XZQD 2NQBA 5B32B 2NZDC 3R45B 1N1JA 4QLCA 2Y2OA 5GT3B 3W96A 4Z5TD 3KWQA 5B0YA 3AV2B 4LD9B 2HIOB 5CPJD 4XZQB 4J8VC 2ZY4A 3MNNB 5AV5B 4Z5TB 5AV9D 1P3OB 2FJ7C 3LELD 3AZHB 5B31C 4WU8C 3WA9C 5B1LA 5GSUA 3EPKA 4J8XB 3LELB 3AZJC 4KUDA 3B6GB 2Y2NA 3KUYB 3VH6A 5BNVA 3LJAA 3REIC 3AL0C 5BS7C 2NZDB 3REKD 5B2JA 1P3GD 1P3FA 3AFAA 4YM6A 4H9OB 4Z2MG 4UPKA 2G5HC 3V9RA 3AZKC 4J8VB 5DNNA 3TU4A 3WA9D 5B32G 3UTBC 4R8PC 3WTPC 1P3GB 2FJ7B 5JRGC 3WAAD 5DNMA 3C1BC 2AROC 5B31B 1M1AD 3WA9B 1P3LC 2ZY5A 3AZIA 3X1UC 3AZJB 1B6WA 1P3BA 3W97C 4JJNA 3X1SA 2IO5C 5B40D 3REIB 5AY8A 5B0ZD 3AZKD 3AZLC 4Z66C 3B0DB 2JE5A 1ZLAD 4CSRB 4J8WA 2DQNC 4ZUXA 1JFIB 3AZKB 2AROD 5AV6D 3UTBB 1F1EA 3WTPB 5AVBC 4R8PB 1F66D 3WKJA 4H9SC 2CV5A 3UTAA 3AZNC 4DRAA 3C1CC 5F99A 3C1BB 2AROB 5AV6B 1P3LB 5GXQC 2CWEA 1ID3D 5BT1C 1P34D 3AV1A 3UT9A 3NQUA 5KDMB 5B31G 3O62C 3AZLD 1P3KC 3W97B 2IO5B 3NQJA 1BH8B 3MGSA 1M19A 1P34B 3LZ0A 3AZLB 4Z66B 3RELA 1S32D 4WNNB 3MGRD 3AZEC 3FDDA 4E45A 1P3MD 3B6FA 1P3IC 3VH6T 1S32B 5AVBB 3W99A 5AV8C 3LZ1A 4HGAC 1HQ3A 3REJD 3AZNB 3C1CB 4X23A 2PYOC 5CPIA 5BO0B 4WU9D 3REJB 1TAFA 1AOIC 1KX5D 3O62B 2YFWB 5B2IA 5AVCD 4H9NB 4UUZA 1KX5B 1P3ID 5B33D 4WZSB 5E5AA 3AZEB 5CP6D 5AVCB 1P3IB 1KX3A 5B33B 3B0CT 3W98C 4XUJA 3A6ND 4HGAB 2F8NH 1M18A 5B32A 3F6TA 4KGCD 3R45A 5CPJC 3AN2A 5GT3A 2PYOB 5CHLB 4H9QB 3AV2A 4LD9A 5AV9C 2HIOA 3A6NB 3MGPD 4XZQA 3LELC 3MNNA 1AOIB 5AV5A 4Z5TA 4YS3D 1P3OA 3KXBD 3MGPB 3AZHA 4J8UA 2Y2JA 4J8XA 1KX4D 3KXBB 3W98D 3B6GA 3EG5B 5BNXB 3REKC 1U35C 1P3GC 3W98B 3KUYA 4CAYB 2YFVB 3AZMC 2NZDA 5CPJB 2UWXA 5B24D 3X1VD 4H9OA 3VH6W 3AYWD 5AV9B 4WU9A 3WAAC 4J8VA 2Y2QA 1M1AC 5B24B 5G49B 5C3IC 3X1VB 1P3AD 4H9RB 2FJ7A 3AZFD 4NE5A 5B31A 4WU8A 3WA9A 1EQZD 1KU5A 3REHD 1U35D 3VH5A 5B40C 3AZMD 5B1MD 3AZJA 3B0DC 3AZGD 1ULYA 2F8ND 2NQBD 5B0ZC 4NE3A 4QLCD 3REKB 3W96D 3REHB 1U35B 3KWQD 3AZMB 2BG1A 1BH9A 5B0YD 3REIA 1ZLAC 5BS7A 2F8NB 5AV6C 3KWQB 5GT0C 3MVDC 1JFIA 5B0YB 1F66C 3AZKA 3B0CW 3WAAB 2ZY3A 1WWIA 3UTBA 4R8PA 3WTPA 1M1AB 5B1LD 2Y2PA 5C3IB 5GSUD 5JRGA 1ID3C 3EPJA 3C1BA 2AROA 4KUDD 1P3LA 2L5AA 1P34C 3X1TC 5B40B 3X1UA 3LJAD 4KUDB 3W97A 5B0ZB 5B2JD 1P3FD 1S32C 4YM6D 5GT0D 3MVDD 3MGRC 3LJAB 1ZLAB 4H9PB 5CPKC 1P3MC 3AZLA 5DNND 4KHAB 4Z66A 4NE6A 3TU4D 4WNNA 4G91C 5B2JB 2DF4C 2BYMB 5GT0B 4YM6B 3MVDB 4ZBJC 1F66B 2Y2HA 5DNMD 3REJC 5DNNB 5AVBA 4H9SA 3X1TD 3AZID 2XD1A 3AZNA 1ID3B 3C1CA 4WU9C 3KFUG 1P3BD 3H0LC 5GXQA 4JJND 1KX5C 3X1SD 3X1TB 5BO0A 3AZIB 3H0RC 5AVCC 5AY8D 3O62A 5CPKD 1P3KA 5B33C 2YFWA 3MGRB 4J8WD 5CP6C 4H9NA 3VH5T 1HTAA 2FFFB 5CPKB 1P3MB 4G91B 3AZEA 3WKJD 2VQRA 4J8WB 4ZBJB 3UTAD 2CV5D 3A6NC 5F99D 3MGQC 1P3IA 4KGCC 4AWLC 4Z2MH 5AV8A 5F99B 3MGPC 4WU9B 4WJ3C 2PYOA 4M6BA 3UT9D 3AV1D 4H9QA 4YS3C 3KXBC 1TZYC 3MGSD 5FUGA 1M19D 3A1KA 1AOIA 3UT9B 3NQUB 3LZ0D 1H3OB 3RELD 1KX4C 5CP6B 3A1IA 3B6FD 3MGQD 1B67A 3W99D 3LZ1D 1P3PC 1HQ3D 3B6FB 5BNXA 3MGQB 4X23D 4KGCB 4AWLB 3W98A 4CAYA 2YFVA 5B24C 3W99B 5CPID 3X1VC 3WTPE 3LZ1B 1HQ3B 3AYWC 1TZYD 5CPJA 2BYKB 5CPIB 5AV9A 1P3AC 5B2ID 4YS3B 1TZYB 2Y2MA 3LELA 3AZFC 1TAFB 2RVQC 5G49A 1EQZC 4H9RA 4WV4B 5E5AD 2JSSA 2Y2GA 3REHC 1KX4B 1P3PD 5B1MC 3AZGC 1KX3D 2NQBC 4QLCC 4XUJD 3W96C 2XD5A 3KWQC 1P3PB 5B0YC 5B32D 1KX3B 3REKA 3AN2D 5GT3D 1U35A 1P3GA 3VH5W 3AZMA 3AV2D 2HIOD 2F8NA 3B0BA 3AYWB 2RVQD 3MNND 3AN2B 5AV5D 1T3UA 5B1LC 5GSUC 3EPLA 1P3AB 1P3OD 3AZHD 3WAAA 3AZFB 4J8UD 4KUDC 1M1AA 5JA4B 1EQZB 4J8XD 4DQYB 3B6GD 4J8UB 5B1MB 3LJAC 3AZGB 2NQBB 1N1JB 5B2JC 5B40A 4QLCB 3KUYD 1P3FC 3W96B 3AFAC 4YM6C 4CSRA 2NZDD 5B0ZA 4E44A 5DNNC 3TU4C 1ZLAA 4H9PA 4J8VD 4KHAA 5DNMC 5AV6A 2BYMA 5GT0A 3MVDA 1F66A 5B1LB 5GSUB 2FJ7D 3AZIC 5B31D 4WU8D 1P3BC 5KDMA 4JJNC 3X1SC 1ID3A 3EPHA 1A7WA 4G92C 3AFAD 3AZJD 1BH8A 4WU8B 2J8PA 5BNVB 1P34A 5AY8C 3X1TA 2F8NK 1P3FB 2ZY2A 1WWSA 3AFAB 3REID 4J8WC 4ZUXC 2RIQA 3V9RB 2JCHA 2F8NG 3TU4B 1Q9CA 2F2AC 1S32A 2Y2KA 3MGRA 2W8SA 1BH9B 3WKJC 2CV5C 3UTAC 5CPKA 1P3MA 5F99C 5DNMB 4EO5C 3UTBD 4R8PD 3WTPD 5JRGD 2ZM5A 3REJA 3C1BD 1P3LD 3AV1C 3UT9C 1P3BB 4JJNB 3X1SB 5JRGB 3X1UD 4G92B 3MGSC
chains in the Genus database with same CATH topology
2HUEC 4ZUXD 1M19C 3W97D 5AY8B 1KX5A 3LZ0C 2Y2IA 3RELC 3X1UB 5AVCA 4ZUXB 3B6FC 1H3OA 4Z66D 5B33A 5CP6A 3WKJB 3W99C 3LZ1C 2Y2LA 2CV5B 1HQ3C 3UTAB 4NFTA 4DRBA 4EO5B 3H0MC 4X23C 5AVBD 1PZRA 3AZND 5CPIC 3A6NA 3MGQA 3C1CD 4KGCA 1W2EA 5GXQD 3AV1B 3NQJB 3MGPA 5B2IC 5BT1D 2BYKA 3P5JB 3MGSB 2HUEB 1M19B 3O62D 5GXQB 1P3KD 3LZ0B 3RELB 5E5AC 4YS3A 3KXBA 1TZYA 2LY8A 1Z2CB 1P3KB 1KX3C 3AZED 1KX4A 4XUJC 1M18C 5B32C 4X23B 3AN2C 5GT3C 5AV8D 1P3PA 3AV2C 2G5IC 4LD9C 2HIOC 4XZQC 2PYOD 3KSYA 3MNNC 5AV5C 5B24A 4Z5TC 5AV8B 3X1VA 3IP4C 3AYWA 1P3OC 5B2IB 3AZHC 1AOID 4J8UC 4UUZB 1P3AA 4J8XC 5E5AB 1R4VA 3AZFA 5FUGB 3B6GC 5JA4A 1M18D 1EQZA 1BFMA 3REHA 4XUJB 5B1MA 3KUYC 4LD9D 3AZGA 1M18B 4XZQD 2NQBA 5B32B 2NZDC 3R45B 1N1JA 4QLCA 2Y2OA 5GT3B 3W96A 4Z5TD 3KWQA 5B0YA 3AV2B 4LD9B 2HIOB 5CPJD 4XZQB 4J8VC 2ZY4A 3MNNB 5AV5B 4Z5TB 5AV9D 1P3OB 2FJ7C 3LELD 3AZHB 5B31C 4WU8C 3WA9C 5B1LA 5GSUA 3EPKA 4J8XB 3LELB 3AZJC 4KUDA 3B6GB 2Y2NA 3KUYB 3VH6A 5BNVA 3LJAA 3REIC 3AL0C 5BS7C 2NZDB 3REKD 5B2JA 1P3GD 1P3FA 3AFAA 4YM6A 4H9OB 4Z2MG 4UPKA 2G5HC 3V9RA 3AZKC 4J8VB 5DNNA 3TU4A 3WA9D 5B32G 3UTBC 4R8PC 3WTPC 1P3GB 2FJ7B 5JRGC 3WAAD 5DNMA 3C1BC 2AROC 5B31B 1M1AD 3WA9B 1P3LC 2ZY5A 3AZIA 3X1UC 3AZJB 1B6WA 1P3BA 3W97C 4JJNA 3X1SA 2IO5C 5B40D 3REIB 5AY8A 5B0ZD 3AZKD 3AZLC 4Z66C 3B0DB 2JE5A 1ZLAD 4CSRB 4J8WA 2DQNC 4ZUXA 1JFIB 3AZKB 2AROD 5AV6D 3UTBB 1F1EA 3WTPB 5AVBC 4R8PB 1F66D 3WKJA 4H9SC 2CV5A 3UTAA 3AZNC 4DRAA 3C1CC 5F99A 3C1BB 2AROB 5AV6B 1P3LB 5GXQC 2CWEA 1ID3D 5BT1C 1P34D 3AV1A 3UT9A 3NQUA 5KDMB 5B31G 3O62C 3AZLD 1P3KC 3W97B 2IO5B 3NQJA 1BH8B 3MGSA 1M19A 1P34B 3LZ0A 3AZLB 4Z66B 3RELA 1S32D 4WNNB 3MGRD 3AZEC 3FDDA 4E45A 1P3MD 3B6FA 1P3IC 3VH6T 1S32B 5AVBB 3W99A 5AV8C 3LZ1A 4HGAC 1HQ3A 3REJD 3AZNB 3C1CB 4X23A 2PYOC 5CPIA 5BO0B 4WU9D 3REJB 1TAFA 1AOIC 1KX5D 3O62B 2YFWB 5B2IA 5AVCD 4H9NB 4UUZA 1KX5B 1P3ID 5B33D 4WZSB 5E5AA 3AZEB 5CP6D 5AVCB 1P3IB 1KX3A 5B33B 3B0CT 3W98C 4XUJA 3A6ND 4HGAB 2F8NH 1M18A 5B32A 3F6TA 4KGCD 3R45A 5CPJC 3AN2A 5GT3A 2PYOB 5CHLB 4H9QB 3AV2A 4LD9A 5AV9C 2HIOA 3A6NB 3MGPD 4XZQA 3LELC 3MNNA 1AOIB 5AV5A 4Z5TA 4YS3D 1P3OA 3KXBD 3MGPB 3AZHA 4J8UA 2Y2JA 4J8XA 1KX4D 3KXBB 3W98D 3B6GA 3EG5B 5BNXB 3REKC 1U35C 1P3GC 3W98B 3KUYA 4CAYB 2YFVB 3AZMC 2NZDA 5CPJB 2UWXA 5B24D 3X1VD 4H9OA 3VH6W 3AYWD 5AV9B 4WU9A 3WAAC 4J8VA 2Y2QA 1M1AC 5B24B 5G49B 5C3IC 3X1VB 1P3AD 4H9RB 2FJ7A 3AZFD 4NE5A 5B31A 4WU8A 3WA9A 1EQZD 1KU5A 3REHD 1U35D 3VH5A 5B40C 3AZMD 5B1MD 3AZJA 3B0DC 3AZGD 1ULYA 2F8ND 2NQBD 5B0ZC 4NE3A 4QLCD 3REKB 3W96D 3REHB 1U35B 3KWQD 3AZMB 2BG1A 1BH9A 5B0YD 3REIA 1ZLAC 5BS7A 2F8NB 5AV6C 3KWQB 5GT0C 3MVDC 1JFIA 5B0YB 1F66C 3AZKA 3B0CW 3WAAB 2ZY3A 1WWIA 3UTBA 4R8PA 3WTPA 1M1AB 5B1LD 2Y2PA 5C3IB 5GSUD 5JRGA 1ID3C 3EPJA 3C1BA 2AROA 4KUDD 1P3LA 2L5AA 1P34C 3X1TC 5B40B 3X1UA 3LJAD 4KUDB 3W97A 5B0ZB 5B2JD 1P3FD 1S32C 4YM6D 5GT0D 3MVDD 3MGRC 3LJAB 1ZLAB 4H9PB 5CPKC 1P3MC 3AZLA 5DNND 4KHAB 4Z66A 4NE6A 3TU4D 4WNNA 4G91C 5B2JB 2DF4C 2BYMB 5GT0B 4YM6B 3MVDB 4ZBJC 1F66B 2Y2HA 5DNMD 3REJC 5DNNB 5AVBA 4H9SA 3X1TD 3AZID 2XD1A 3AZNA 1ID3B 3C1CA 4WU9C 3KFUG 1P3BD 3H0LC 5GXQA 4JJND 1KX5C 3X1SD 3X1TB 5BO0A 3AZIB 3H0RC 5AVCC 5AY8D 3O62A 5CPKD 1P3KA 5B33C 2YFWA 3MGRB 4J8WD 5CP6C 4H9NA 3VH5T 1HTAA 2FFFB 5CPKB 1P3MB 4G91B 3AZEA 3WKJD 2VQRA 4J8WB 4ZBJB 3UTAD 2CV5D 3A6NC 5F99D 3MGQC 1P3IA 4KGCC 4AWLC 4Z2MH 5AV8A 5F99B 3MGPC 4WU9B 4WJ3C 2PYOA 4M6BA 3UT9D 3AV1D 4H9QA 4YS3C 3KXBC 1TZYC 3MGSD 5FUGA 1M19D 3A1KA 1AOIA 3UT9B 3NQUB 3LZ0D 1H3OB 3RELD 1KX4C 5CP6B 3A1IA 3B6FD 3MGQD 1B67A 3W99D 3LZ1D 1P3PC 1HQ3D 3B6FB 5BNXA 3MGQB 4X23D 4KGCB 4AWLB 3W98A 4CAYA 2YFVA 5B24C 3W99B 5CPID 3X1VC 3WTPE 3LZ1B 1HQ3B 3AYWC 1TZYD 5CPJA 2BYKB 5CPIB 5AV9A 1P3AC 5B2ID 4YS3B 1TZYB 2Y2MA 3LELA 3AZFC 1TAFB 2RVQC 5G49A 1EQZC 4H9RA 4WV4B 5E5AD 2JSSA 2Y2GA 3REHC 1KX4B 1P3PD 5B1MC 3AZGC 1KX3D 2NQBC 4QLCC 4XUJD 3W96C 2XD5A 3KWQC 1P3PB 5B0YC 5B32D 1KX3B 3REKA 3AN2D 5GT3D 1U35A 1P3GA 3VH5W 3AZMA 3AV2D 2HIOD 2F8NA 3B0BA 3AYWB 2RVQD 3MNND 3AN2B 5AV5D 1T3UA 5B1LC 5GSUC 3EPLA 1P3AB 1P3OD 3AZHD 3WAAA 3AZFB 4J8UD 4KUDC 1M1AA 5JA4B 1EQZB 4J8XD 4DQYB 3B6GD 4J8UB 5B1MB 3LJAC 3AZGB 2NQBB 1N1JB 5B2JC 5B40A 4QLCB 3KUYD 1P3FC 3W96B 3AFAC 4YM6C 4CSRA 2NZDD 5B0ZA 4E44A 5DNNC 3TU4C 1ZLAA 4H9PA 4J8VD 4KHAA 5DNMC 5AV6A 2BYMA 5GT0A 3MVDA 1F66A 5B1LB 5GSUB 2FJ7D 3AZIC 5B31D 4WU8D 1P3BC 5KDMA 4JJNC 3X1SC 1ID3A 3EPHA 1A7WA 4G92C 3AFAD 3AZJD 1BH8A 4WU8B 2J8PA 5BNVB 1P34A 5AY8C 3X1TA 2F8NK 1P3FB 2ZY2A 1WWSA 3AFAB 3REID 4J8WC 4ZUXC 2RIQA 3V9RB 2JCHA 2F8NG 3TU4B 1Q9CA 2F2AC 1S32A 2Y2KA 3MGRA 2W8SA 1BH9B 3WKJC 2CV5C 3UTAC 5CPKA 1P3MA 5F99C 5DNMB 4EO5C 3UTBD 4R8PD 3WTPD 5JRGD 2ZM5A 3REJA 3C1BD 1P3LD 3AV1C 3UT9C 1P3BB 4JJNB 3X1SB 5JRGB 3X1UD 4G92B 3MGSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUE C;  4ZUX D;  1M19 C;  3W97 D;  5AY8 B;  1KX5 A;  3LZ0 C;  3REL C;  3X1U B;  5AVC A;  4ZUX B;  3B6F C;  1H3O A;  4Z66 D;  5B33 A;  5CP6 A;  3WKJ B;  3W99 C;  3LZ1 C;  2CV5 B;  1HQ3 C;  3UTA B;  4NFT A;  4DRB A;  4EO5 B;  4X23 C;  5AVB D;  3AZN D;  5CPI C;  3A6N A;  3MGQ A;  3C1C D;  4KGC A;  5GXQ D;  3AV1 B;  3NQJ B;  3MGP A;  5B2I C;  5BT1 D;  2BYK A;  3MGS B;  2HUE B;  1M19 B;  3O62 D;  5GXQ B;  1P3K D;  3LZ0 B;  3REL B;  5E5A C;  4YS3 A;  3KXB A;  1TZY A;  2LY8 A;  1P3K B;  1KX3 C;  3AZE D;  1KX4 A;  4XUJ C;  1M18 C;  5B32 C;  4X23 B;  3AN2 C;  5GT3 C;  5AV8 D;  1P3P A;  3AV2 C;  4LD9 C;  2HIO C;  4XZQ C;  2PYO D;  3KSY A;  3MNN C;  5AV5 C;  5B24 A;  4Z5T C;  5AV8 B;  3X1V A;  3AYW A;  1P3O C;  5B2I B;  3AZH C;  1AOI D;  4J8U C;  4UUZ B;  1P3A A;  4J8X C;  5E5A B;  1R4V A;  3AZF A;  5FUG B;  3B6G C;  5JA4 A;  1M18 D;  1EQZ A;  1BFM A;  3REH A;  4XUJ B;  5B1M A;  3KUY C;  4LD9 D;  3AZG A;  1M18 B;  4XZQ D;  2NQB A;  5B32 B;  2NZD C;  3R45 B;  1N1J A;  4QLC A;  5GT3 B;  3W96 A;  4Z5T D;  3KWQ A;  5B0Y A;  3AV2 B;  4LD9 B;  2HIO B;  5CPJ D;  4XZQ B;  4J8V C;  3MNN B;  5AV5 B;  4Z5T B;  5AV9 D;  1P3O B;  2FJ7 C;  3LEL D;  3AZH B;  5B31 C;  4WU8 C;  3WA9 C;  5B1L A;  5GSU A;  4J8X B;  3LEL B;  3AZJ C;  4KUD A;  3B6G B;  3KUY B;  3VH6 A;  5BNV A;  3LJA A;  3REI C;  5BS7 C;  2NZD B;  3REK D;  5B2J A;  1P3G D;  1P3F A;  3AFA A;  4YM6 A;  4H9O B;  4Z2M G;  3V9R A;  3AZK C;  4J8V B;  5DNN A;  3TU4 A;  3WA9 D;  5B32 G;  3UTB C;  4R8P C;  3WTP C;  1P3G B;  2FJ7 B;  5JRG C;  3WAA D;  5DNM A;  3C1B C;  2ARO C;  5B31 B;  1M1A D;  3WA9 B;  1P3L C;  3AZI A;  3X1U C;  3AZJ B;  1B6W A;  1P3B A;  3W97 C;  4JJN A;  3X1S A;  2IO5 C;  5B40 D;  3REI B;  5AY8 A;  5B0Z D;  3AZK D;  3AZL C;  4Z66 C;  3B0D B;  1ZLA D;  4CSR B;  4J8W A;  4ZUX A;  1JFI B;  3AZK B;  2ARO D;  5AV6 D;  3UTB B;  1F1E A;  3WTP B;  5AVB C;  4R8P B;  1F66 D;  3WKJ A;  4H9S C;  2CV5 A;  3UTA A;  3AZN C;  4DRA A;  3C1C C;  5F99 A;  3C1B B;  2ARO B;  5AV6 B;  1P3L B;  5GXQ C;  2CWE A;  1ID3 D;  5BT1 C;  1P34 D;  3AV1 A;  3UT9 A;  3NQU A;  5KDM B;  5B31 G;  3O62 C;  3AZL D;  1P3K C;  3W97 B;  2IO5 B;  3NQJ A;  1BH8 B;  3MGS A;  1M19 A;  1P34 B;  3LZ0 A;  3AZL B;  4Z66 B;  3REL A;  1S32 D;  4WNN B;  3MGR D;  3AZE C;  4E45 A;  1P3M D;  3B6F A;  1P3I C;  3VH6 T;  1S32 B;  5AVB B;  3W99 A;  5AV8 C;  3LZ1 A;  4HGA C;  1HQ3 A;  3REJ D;  3AZN B;  3C1C B;  4X23 A;  2PYO C;  5CPI A;  5BO0 B;  4WU9 D;  3REJ B;  1TAF A;  1AOI C;  1KX5 D;  3O62 B;  2YFW B;  5B2I A;  5AVC D;  4H9N B;  4UUZ A;  1KX5 B;  1P3I D;  4WZS B;  5B33 D;  5E5A A;  3AZE B;  5CP6 D;  5AVC B;  1P3I B;  1KX3 A;  5B33 B;  3B0C T;  3W98 C;  4XUJ A;  3A6N D;  4HGA B;  2F8N H;  1M18 A;  5B32 A;  4KGC D;  3R45 A;  5CPJ C;  3AN2 A;  5GT3 A;  2PYO B;  5CHL B;  4H9Q B;  3AV2 A;  4LD9 A;  5AV9 C;  2HIO A;  3A6N B;  3MGP D;  4XZQ A;  3LEL C;  3MNN A;  1AOI B;  5AV5 A;  4Z5T A;  4YS3 D;  1P3O A;  3KXB D;  3MGP B;  3AZH A;  4J8U A;  4J8X A;  1KX4 D;  3KXB B;  3W98 D;  3B6G A;  5BNX B;  3REK C;  1U35 C;  1P3G C;  3W98 B;  3KUY A;  4CAY B;  2YFV B;  3AZM C;  2NZD A;  5CPJ B;  5B24 D;  3X1V D;  4H9O A;  3VH6 W;  3AYW D;  5AV9 B;  4WU9 A;  3WAA C;  4J8V A;  1M1A C;  5B24 B;  5G49 B;  5C3I C;  3X1V B;  1P3A D;  4H9R B;  2FJ7 A;  3AZF D;  4NE5 A;  5B31 A;  4WU8 A;  3WA9 A;  1EQZ D;  1KU5 A;  3REH D;  1U35 D;  3VH5 A;  5B40 C;  3AZM D;  5B1M D;  3AZJ A;  3B0D C;  3AZG D;  1ULY A;  2F8N D;  2NQB D;  5B0Z C;  4NE3 A;  4QLC D;  3REK B;  3W96 D;  3REH B;  1U35 B;  3KWQ D;  3AZM B;  1BH9 A;  5B0Y D;  3REI A;  1ZLA C;  5BS7 A;  2F8N B;  5AV6 C;  3KWQ B;  5GT0 C;  3MVD C;  1JFI A;  5B0Y B;  1F66 C;  3AZK A;  3B0C W;  3WAA B;  1WWI A;  3UTB A;  4R8P A;  3WTP A;  1M1A B;  5B1L D;  5C3I B;  5GSU D;  5JRG A;  1ID3 C;  3C1B A;  2ARO A;  4KUD D;  1P3L A;  2L5A A;  1P34 C;  3X1T C;  5B40 B;  3X1U A;  3LJA D;  4KUD B;  3W97 A;  5B0Z B;  5B2J D;  1P3F D;  1S32 C;  4YM6 D;  5GT0 D;  3MVD D;  3MGR C;  3LJA B;  1ZLA B;  4H9P B;  5CPK C;  1P3M C;  3AZL A;  5DNN D;  4KHA B;  4Z66 A;  4NE6 A;  3TU4 D;  4WNN A;  4G91 C;  5B2J B;  2BYM B;  5GT0 B;  4YM6 B;  3MVD B;  4ZBJ C;  1F66 B;  5DNM D;  3REJ C;  5DNN B;  5AVB A;  4H9S A;  3X1T D;  3AZI D;  3AZN A;  1ID3 B;  3C1C A;  4WU9 C;  1P3B D;  5GXQ A;  4JJN D;  1KX5 C;  3X1S D;  3X1T B;  5BO0 A;  3AZI B;  5AVC C;  5AY8 D;  3O62 A;  5CPK D;  1P3K A;  5B33 C;  2YFW A;  3MGR B;  4J8W D;  5CP6 C;  4H9N A;  3VH5 T;  1HTA A;  5CPK B;  1P3M B;  4G91 B;  3AZE A;  3WKJ D;  4J8W B;  4ZBJ B;  3UTA D;  2CV5 D;  3A6N C;  5F99 D;  3MGQ C;  1P3I A;  4KGC C;  4AWL C;  4Z2M H;  5AV8 A;  5F99 B;  3MGP C;  4WU9 B;  2PYO A;  4M6B A;  3UT9 D;  3AV1 D;  4H9Q A;  4YS3 C;  3KXB C;  1TZY C;  3MGS D;  5FUG A;  1M19 D;  1AOI A;  3UT9 B;  3NQU B;  3LZ0 D;  1H3O B;  3REL D;  1KX4 C;  5CP6 B;  3B6F D;  3MGQ D;  1B67 A;  3W99 D;  3LZ1 D;  1P3P C;  1HQ3 D;  3B6F B;  5BNX A;  3MGQ B;  4X23 D;  4KGC B;  4AWL B;  3W98 A;  4CAY A;  2YFV A;  5B24 C;  3W99 B;  5CPI D;  3X1V C;  3WTP E;  3LZ1 B;  1HQ3 B;  3AYW C;  1TZY D;  5CPJ A;  2BYK B;  5CPI B;  5AV9 A;  1P3A C;  5B2I D;  4YS3 B;  1TZY B;  3AZF C;  3LEL A;  1TAF B;  2RVQ C;  5G49 A;  1EQZ C;  4H9R A;  4WV4 B;  5E5A D;  2JSS A;  3REH C;  1KX4 B;  1P3P D;  5B1M C;  3AZG C;  1KX3 D;  2NQB C;  4QLC C;  4XUJ D;  3W96 C;  3KWQ C;  1P3P B;  5B0Y C;  5B32 D;  1KX3 B;  3REK A;  3AN2 D;  5GT3 D;  1U35 A;  1P3G A;  3VH5 W;  3AZM A;  3AV2 D;  2HIO D;  2F8N A;  3B0B A;  3AYW B;  2RVQ D;  3MNN D;  3AN2 B;  5AV5 D;  5B1L C;  5GSU C;  1P3A B;  1P3O D;  3AZH D;  3WAA A;  3AZF B;  4J8U D;  4KUD C;  1M1A A;  5JA4 B;  1EQZ B;  4J8X D;  3B6G D;  4J8U B;  5B1M B;  3LJA C;  3AZG B;  2NQB B;  1N1J B;  5B2J C;  4QLC B;  5B40 A;  3KUY D;  1P3F C;  3W96 B;  3AFA C;  4YM6 C;  4CSR A;  2NZD D;  5B0Z A;  4E44 A;  5DNN C;  3TU4 C;  1ZLA A;  4H9P A;  4J8V D;  4KHA A;  5DNM C;  5AV6 A;  2BYM A;  5GT0 A;  3MVD A;  1F66 A;  5B1L B;  5GSU B;  2FJ7 D;  3AZI C;  5B31 D;  4WU8 D;  1P3B C;  5KDM A;  4JJN C;  3X1S C;  1ID3 A;  1A7W A;  4G92 C;  3AFA D;  3AZJ D;  1BH8 A;  4WU8 B;  5BNV B;  1P34 A;  5AY8 C;  3X1T A;  2F8N K;  1P3F B;  1WWS A;  3AFA B;  3REI D;  4J8W C;  4ZUX C;  3V9R B;  2F8N G;  3TU4 B;  1Q9C A;  1S32 A;  3MGR A;  1BH9 B;  3WKJ C;  2CV5 C;  3UTA C;  5CPK A;  1P3M A;  5F99 C;  5DNM B;  4EO5 C;  3UTB D;  4R8P D;  3WTP D;  5JRG D;  3REJ A;  3C1B D;  1P3L D;  3AV1 C;  3UT9 C;  1P3B B;  4JJN B;  3X1S B;  5JRG B;  3X1U D;  4G92 B;  3MGS C; 
#chains in the Genus database with same CATH topology
 2HUE C;  4ZUX D;  1M19 C;  3W97 D;  5AY8 B;  1KX5 A;  3LZ0 C;  2Y2I A;  3REL C;  3X1U B;  5AVC A;  4ZUX B;  3B6F C;  1H3O A;  4Z66 D;  5B33 A;  5CP6 A;  3WKJ B;  3W99 C;  3LZ1 C;  2Y2L A;  2CV5 B;  1HQ3 C;  3UTA B;  4NFT A;  4DRB A;  4EO5 B;  3H0M C;  4X23 C;  5AVB D;  1PZR A;  3AZN D;  5CPI C;  3A6N A;  3MGQ A;  3C1C D;  4KGC A;  1W2E A;  5GXQ D;  3AV1 B;  3NQJ B;  3MGP A;  5B2I C;  5BT1 D;  2BYK A;  3P5J B;  3MGS B;  2HUE B;  1M19 B;  3O62 D;  5GXQ B;  1P3K D;  3LZ0 B;  3REL B;  5E5A C;  4YS3 A;  3KXB A;  1TZY A;  2LY8 A;  1Z2C B;  1P3K B;  1KX3 C;  3AZE D;  1KX4 A;  4XUJ C;  1M18 C;  5B32 C;  4X23 B;  3AN2 C;  5GT3 C;  5AV8 D;  1P3P A;  3AV2 C;  2G5I C;  4LD9 C;  2HIO C;  4XZQ C;  2PYO D;  3KSY A;  3MNN C;  5AV5 C;  5B24 A;  4Z5T C;  5AV8 B;  3X1V A;  3IP4 C;  3AYW A;  1P3O C;  5B2I B;  3AZH C;  1AOI D;  4J8U C;  4UUZ B;  1P3A A;  4J8X C;  5E5A B;  1R4V A;  3AZF A;  5FUG B;  3B6G C;  5JA4 A;  1M18 D;  1EQZ A;  1BFM A;  3REH A;  4XUJ B;  5B1M A;  3KUY C;  4LD9 D;  3AZG A;  1M18 B;  4XZQ D;  2NQB A;  5B32 B;  2NZD C;  3R45 B;  1N1J A;  4QLC A;  2Y2O A;  5GT3 B;  3W96 A;  4Z5T D;  3KWQ A;  5B0Y A;  3AV2 B;  4LD9 B;  2HIO B;  5CPJ D;  4XZQ B;  4J8V C;  2ZY4 A;  3MNN B;  5AV5 B;  4Z5T B;  5AV9 D;  1P3O B;  2FJ7 C;  3LEL D;  3AZH B;  5B31 C;  4WU8 C;  3WA9 C;  5B1L A;  5GSU A;  3EPK A;  4J8X B;  3LEL B;  3AZJ C;  4KUD A;  3B6G B;  2Y2N A;  3KUY B;  3VH6 A;  5BNV A;  3LJA A;  3REI C;  3AL0 C;  5BS7 C;  2NZD B;  3REK D;  5B2J A;  1P3G D;  1P3F A;  3AFA A;  4YM6 A;  4H9O B;  4Z2M G;  4UPK A;  2G5H C;  3V9R A;  3AZK C;  4J8V B;  5DNN A;  3TU4 A;  3WA9 D;  5B32 G;  3UTB C;  4R8P C;  3WTP C;  1P3G B;  2FJ7 B;  5JRG C;  3WAA D;  5DNM A;  3C1B C;  2ARO C;  5B31 B;  1M1A D;  3WA9 B;  1P3L C;  2ZY5 A;  3AZI A;  3X1U C;  3AZJ B;  1B6W A;  1P3B A;  3W97 C;  4JJN A;  3X1S A;  2IO5 C;  5B40 D;  3REI B;  5AY8 A;  5B0Z D;  3AZK D;  3AZL C;  4Z66 C;  3B0D B;  2JE5 A;  1ZLA D;  4CSR B;  4J8W A;  2DQN C;  4ZUX A;  1JFI B;  3AZK B;  2ARO D;  5AV6 D;  3UTB B;  1F1E A;  3WTP B;  5AVB C;  4R8P B;  1F66 D;  3WKJ A;  4H9S C;  2CV5 A;  3UTA A;  3AZN C;  4DRA A;  3C1C C;  5F99 A;  3C1B B;  2ARO B;  5AV6 B;  1P3L B;  5GXQ C;  2CWE A;  1ID3 D;  5BT1 C;  1P34 D;  3AV1 A;  3UT9 A;  3NQU A;  5KDM B;  5B31 G;  3O62 C;  3AZL D;  1P3K C;  3W97 B;  2IO5 B;  3NQJ A;  1BH8 B;  3MGS A;  1M19 A;  1P34 B;  3LZ0 A;  3AZL B;  4Z66 B;  3REL A;  1S32 D;  4WNN B;  3MGR D;  3AZE C;  3FDD A;  4E45 A;  1P3M D;  3B6F A;  1P3I C;  3VH6 T;  1S32 B;  5AVB B;  3W99 A;  5AV8 C;  3LZ1 A;  4HGA C;  1HQ3 A;  3REJ D;  3AZN B;  3C1C B;  4X23 A;  2PYO C;  5CPI A;  5BO0 B;  4WU9 D;  3REJ B;  1TAF A;  1AOI C;  1KX5 D;  3O62 B;  2YFW B;  5B2I A;  5AVC D;  4H9N B;  4UUZ A;  1KX5 B;  1P3I D;  5B33 D;  4WZS B;  5E5A A;  3AZE B;  5CP6 D;  5AVC B;  1P3I B;  1KX3 A;  5B33 B;  3B0C T;  3W98 C;  4XUJ A;  3A6N D;  4HGA B;  2F8N H;  1M18 A;  5B32 A;  3F6T A;  4KGC D;  3R45 A;  5CPJ C;  3AN2 A;  5GT3 A;  2PYO B;  5CHL B;  4H9Q B;  3AV2 A;  4LD9 A;  5AV9 C;  2HIO A;  3A6N B;  3MGP D;  4XZQ A;  3LEL C;  3MNN A;  1AOI B;  5AV5 A;  4Z5T A;  4YS3 D;  1P3O A;  3KXB D;  3MGP B;  3AZH A;  4J8U A;  2Y2J A;  4J8X A;  1KX4 D;  3KXB B;  3W98 D;  3B6G A;  3EG5 B;  5BNX B;  3REK C;  1U35 C;  1P3G C;  3W98 B;  3KUY A;  4CAY B;  2YFV B;  3AZM C;  2NZD A;  5CPJ B;  2UWX A;  5B24 D;  3X1V D;  4H9O A;  3VH6 W;  3AYW D;  5AV9 B;  4WU9 A;  3WAA C;  4J8V A;  2Y2Q A;  1M1A C;  5B24 B;  5G49 B;  5C3I C;  3X1V B;  1P3A D;  4H9R B;  2FJ7 A;  3AZF D;  4NE5 A;  5B31 A;  4WU8 A;  3WA9 A;  1EQZ D;  1KU5 A;  3REH D;  1U35 D;  3VH5 A;  5B40 C;  3AZM D;  5B1M D;  3AZJ A;  3B0D C;  3AZG D;  1ULY A;  2F8N D;  2NQB D;  5B0Z C;  4NE3 A;  4QLC D;  3REK B;  3W96 D;  3REH B;  1U35 B;  3KWQ D;  3AZM B;  2BG1 A;  1BH9 A;  5B0Y D;  3REI A;  1ZLA C;  5BS7 A;  2F8N B;  5AV6 C;  3KWQ B;  5GT0 C;  3MVD C;  1JFI A;  5B0Y B;  1F66 C;  3AZK A;  3B0C W;  3WAA B;  2ZY3 A;  1WWI A;  3UTB A;  4R8P A;  3WTP A;  1M1A B;  5B1L D;  2Y2P A;  5C3I B;  5GSU D;  5JRG A;  1ID3 C;  3EPJ A;  3C1B A;  2ARO A;  4KUD D;  1P3L A;  2L5A A;  1P34 C;  3X1T C;  5B40 B;  3X1U A;  3LJA D;  4KUD B;  3W97 A;  5B0Z B;  5B2J D;  1P3F D;  1S32 C;  4YM6 D;  5GT0 D;  3MVD D;  3MGR C;  3LJA B;  1ZLA B;  4H9P B;  5CPK C;  1P3M C;  3AZL A;  5DNN D;  4KHA B;  4Z66 A;  4NE6 A;  3TU4 D;  4WNN A;  4G91 C;  5B2J B;  2DF4 C;  2BYM B;  5GT0 B;  4YM6 B;  3MVD B;  4ZBJ C;  1F66 B;  2Y2H A;  5DNM D;  3REJ C;  5DNN B;  5AVB A;  4H9S A;  3X1T D;  3AZI D;  2XD1 A;  3AZN A;  1ID3 B;  3C1C A;  4WU9 C;  3KFU G;  1P3B D;  3H0L C;  5GXQ A;  4JJN D;  1KX5 C;  3X1S D;  3X1T B;  5BO0 A;  3AZI B;  3H0R C;  5AVC C;  5AY8 D;  3O62 A;  5CPK D;  1P3K A;  5B33 C;  2YFW A;  3MGR B;  4J8W D;  5CP6 C;  4H9N A;  3VH5 T;  1HTA A;  2FFF B;  5CPK B;  1P3M B;  4G91 B;  3AZE A;  3WKJ D;  2VQR A;  4J8W B;  4ZBJ B;  3UTA D;  2CV5 D;  3A6N C;  5F99 D;  3MGQ C;  1P3I A;  4KGC C;  4AWL C;  4Z2M H;  5AV8 A;  5F99 B;  3MGP C;  4WU9 B;  4WJ3 C;  2PYO A;  4M6B A;  3UT9 D;  3AV1 D;  4H9Q A;  4YS3 C;  3KXB C;  1TZY C;  3MGS D;  5FUG A;  1M19 D;  3A1K A;  1AOI A;  3UT9 B;  3NQU B;  3LZ0 D;  1H3O B;  3REL D;  1KX4 C;  5CP6 B;  3A1I A;  3B6F D;  3MGQ D;  1B67 A;  3W99 D;  3LZ1 D;  1P3P C;  1HQ3 D;  3B6F B;  5BNX A;  3MGQ B;  4X23 D;  4KGC B;  4AWL B;  3W98 A;  4CAY A;  2YFV A;  5B24 C;  3W99 B;  5CPI D;  3X1V C;  3WTP E;  3LZ1 B;  1HQ3 B;  3AYW C;  1TZY D;  5CPJ A;  2BYK B;  5CPI B;  5AV9 A;  1P3A C;  5B2I D;  4YS3 B;  1TZY B;  2Y2M A;  3LEL A;  3AZF C;  1TAF B;  2RVQ C;  5G49 A;  1EQZ C;  4H9R A;  4WV4 B;  5E5A D;  2JSS A;  2Y2G A;  3REH C;  1KX4 B;  1P3P D;  5B1M C;  3AZG C;  1KX3 D;  2NQB C;  4QLC C;  4XUJ D;  3W96 C;  2XD5 A;  3KWQ C;  1P3P B;  5B0Y C;  5B32 D;  1KX3 B;  3REK A;  3AN2 D;  5GT3 D;  1U35 A;  1P3G A;  3VH5 W;  3AZM A;  3AV2 D;  2HIO D;  2F8N A;  3B0B A;  3AYW B;  2RVQ D;  3MNN D;  3AN2 B;  5AV5 D;  1T3U A;  5B1L C;  5GSU C;  3EPL A;  1P3A B;  1P3O D;  3AZH D;  3WAA A;  3AZF B;  4J8U D;  4KUD C;  1M1A A;  5JA4 B;  1EQZ B;  4J8X D;  4DQY B;  3B6G D;  4J8U B;  5B1M B;  3LJA C;  3AZG B;  2NQB B;  1N1J B;  5B2J C;  5B40 A;  4QLC B;  3KUY D;  1P3F C;  3W96 B;  3AFA C;  4YM6 C;  4CSR A;  2NZD D;  5B0Z A;  4E44 A;  5DNN C;  3TU4 C;  1ZLA A;  4H9P A;  4J8V D;  4KHA A;  5DNM C;  5AV6 A;  2BYM A;  5GT0 A;  3MVD A;  1F66 A;  5B1L B;  5GSU B;  2FJ7 D;  3AZI C;  5B31 D;  4WU8 D;  1P3B C;  5KDM A;  4JJN C;  3X1S C;  1ID3 A;  3EPH A;  1A7W A;  4G92 C;  3AFA D;  3AZJ D;  1BH8 A;  4WU8 B;  2J8P A;  5BNV B;  1P34 A;  5AY8 C;  3X1T A;  2F8N K;  1P3F B;  2ZY2 A;  1WWS A;  3AFA B;  3REI D;  4J8W C;  4ZUX C;  2RIQ A;  3V9R B;  2JCH A;  2F8N G;  3TU4 B;  1Q9C A;  2F2A C;  1S32 A;  2Y2K A;  3MGR A;  2W8S A;  1BH9 B;  3WKJ C;  2CV5 C;  3UTA C;  5CPK A;  1P3M A;  5F99 C;  5DNM B;  4EO5 C;  3UTB D;  4R8P D;  3WTP D;  5JRG D;  2ZM5 A;  3REJ A;  3C1B D;  1P3L D;  3AV1 C;  3UT9 C;  1P3B B;  4JJN B;  3X1S B;  5JRG B;  3X1U D;  4G92 B;  3MGS C; 
#chains in the Genus database with same CATH homology
 2HUE C;  4ZUX D;  1M19 C;  3W97 D;  5AY8 B;  1KX5 A;  3LZ0 C;  2Y2I A;  3REL C;  3X1U B;  5AVC A;  4ZUX B;  3B6F C;  1H3O A;  4Z66 D;  5B33 A;  5CP6 A;  3WKJ B;  3W99 C;  3LZ1 C;  2Y2L A;  2CV5 B;  1HQ3 C;  3UTA B;  4NFT A;  4DRB A;  4EO5 B;  3H0M C;  4X23 C;  5AVB D;  1PZR A;  3AZN D;  5CPI C;  3A6N A;  3MGQ A;  3C1C D;  4KGC A;  1W2E A;  5GXQ D;  3AV1 B;  3NQJ B;  3MGP A;  5B2I C;  5BT1 D;  2BYK A;  3P5J B;  3MGS B;  2HUE B;  1M19 B;  3O62 D;  5GXQ B;  1P3K D;  3LZ0 B;  3REL B;  5E5A C;  4YS3 A;  3KXB A;  1TZY A;  2LY8 A;  1Z2C B;  1P3K B;  1KX3 C;  3AZE D;  1KX4 A;  4XUJ C;  1M18 C;  5B32 C;  4X23 B;  3AN2 C;  5GT3 C;  5AV8 D;  1P3P A;  3AV2 C;  2G5I C;  4LD9 C;  2HIO C;  4XZQ C;  2PYO D;  3KSY A;  3MNN C;  5AV5 C;  5B24 A;  4Z5T C;  5AV8 B;  3X1V A;  3IP4 C;  3AYW A;  1P3O C;  5B2I B;  3AZH C;  1AOI D;  4J8U C;  4UUZ B;  1P3A A;  4J8X C;  5E5A B;  1R4V A;  3AZF A;  5FUG B;  3B6G C;  5JA4 A;  1M18 D;  1EQZ A;  1BFM A;  3REH A;  4XUJ B;  5B1M A;  3KUY C;  4LD9 D;  3AZG A;  1M18 B;  4XZQ D;  2NQB A;  5B32 B;  2NZD C;  3R45 B;  1N1J A;  4QLC A;  2Y2O A;  5GT3 B;  3W96 A;  4Z5T D;  3KWQ A;  5B0Y A;  3AV2 B;  4LD9 B;  2HIO B;  5CPJ D;  4XZQ B;  4J8V C;  2ZY4 A;  3MNN B;  5AV5 B;  4Z5T B;  5AV9 D;  1P3O B;  2FJ7 C;  3LEL D;  3AZH B;  5B31 C;  4WU8 C;  3WA9 C;  5B1L A;  5GSU A;  3EPK A;  4J8X B;  3LEL B;  3AZJ C;  4KUD A;  3B6G B;  2Y2N A;  3KUY B;  3VH6 A;  5BNV A;  3LJA A;  3REI C;  3AL0 C;  5BS7 C;  2NZD B;  3REK D;  5B2J A;  1P3G D;  1P3F A;  3AFA A;  4YM6 A;  4H9O B;  4Z2M G;  4UPK A;  2G5H C;  3V9R A;  3AZK C;  4J8V B;  5DNN A;  3TU4 A;  3WA9 D;  5B32 G;  3UTB C;  4R8P C;  3WTP C;  1P3G B;  2FJ7 B;  5JRG C;  3WAA D;  5DNM A;  3C1B C;  2ARO C;  5B31 B;  1M1A D;  3WA9 B;  1P3L C;  2ZY5 A;  3AZI A;  3X1U C;  3AZJ B;  1B6W A;  1P3B A;  3W97 C;  4JJN A;  3X1S A;  2IO5 C;  5B40 D;  3REI B;  5AY8 A;  5B0Z D;  3AZK D;  3AZL C;  4Z66 C;  3B0D B;  2JE5 A;  1ZLA D;  4CSR B;  4J8W A;  2DQN C;  4ZUX A;  1JFI B;  3AZK B;  2ARO D;  5AV6 D;  3UTB B;  1F1E A;  3WTP B;  5AVB C;  4R8P B;  1F66 D;  3WKJ A;  4H9S C;  2CV5 A;  3UTA A;  3AZN C;  4DRA A;  3C1C C;  5F99 A;  3C1B B;  2ARO B;  5AV6 B;  1P3L B;  5GXQ C;  2CWE A;  1ID3 D;  5BT1 C;  1P34 D;  3AV1 A;  3UT9 A;  3NQU A;  5KDM B;  5B31 G;  3O62 C;  3AZL D;  1P3K C;  3W97 B;  2IO5 B;  3NQJ A;  1BH8 B;  3MGS A;  1M19 A;  1P34 B;  3LZ0 A;  3AZL B;  4Z66 B;  3REL A;  1S32 D;  4WNN B;  3MGR D;  3AZE C;  3FDD A;  4E45 A;  1P3M D;  3B6F A;  1P3I C;  3VH6 T;  1S32 B;  5AVB B;  3W99 A;  5AV8 C;  3LZ1 A;  4HGA C;  1HQ3 A;  3REJ D;  3AZN B;  3C1C B;  4X23 A;  2PYO C;  5CPI A;  5BO0 B;  4WU9 D;  3REJ B;  1TAF A;  1AOI C;  1KX5 D;  3O62 B;  2YFW B;  5B2I A;  5AVC D;  4H9N B;  4UUZ A;  1KX5 B;  1P3I D;  5B33 D;  4WZS B;  5E5A A;  3AZE B;  5CP6 D;  5AVC B;  1P3I B;  1KX3 A;  5B33 B;  3B0C T;  3W98 C;  4XUJ A;  3A6N D;  4HGA B;  2F8N H;  1M18 A;  5B32 A;  3F6T A;  4KGC D;  3R45 A;  5CPJ C;  3AN2 A;  5GT3 A;  2PYO B;  5CHL B;  4H9Q B;  3AV2 A;  4LD9 A;  5AV9 C;  2HIO A;  3A6N B;  3MGP D;  4XZQ A;  3LEL C;  3MNN A;  1AOI B;  5AV5 A;  4Z5T A;  4YS3 D;  1P3O A;  3KXB D;  3MGP B;  3AZH A;  4J8U A;  2Y2J A;  4J8X A;  1KX4 D;  3KXB B;  3W98 D;  3B6G A;  3EG5 B;  5BNX B;  3REK C;  1U35 C;  1P3G C;  3W98 B;  3KUY A;  4CAY B;  2YFV B;  3AZM C;  2NZD A;  5CPJ B;  2UWX A;  5B24 D;  3X1V D;  4H9O A;  3VH6 W;  3AYW D;  5AV9 B;  4WU9 A;  3WAA C;  4J8V A;  2Y2Q A;  1M1A C;  5B24 B;  5G49 B;  5C3I C;  3X1V B;  1P3A D;  4H9R B;  2FJ7 A;  3AZF D;  4NE5 A;  5B31 A;  4WU8 A;  3WA9 A;  1EQZ D;  1KU5 A;  3REH D;  1U35 D;  3VH5 A;  5B40 C;  3AZM D;  5B1M D;  3AZJ A;  3B0D C;  3AZG D;  1ULY A;  2F8N D;  2NQB D;  5B0Z C;  4NE3 A;  4QLC D;  3REK B;  3W96 D;  3REH B;  1U35 B;  3KWQ D;  3AZM B;  2BG1 A;  1BH9 A;  5B0Y D;  3REI A;  1ZLA C;  5BS7 A;  2F8N B;  5AV6 C;  3KWQ B;  5GT0 C;  3MVD C;  1JFI A;  5B0Y B;  1F66 C;  3AZK A;  3B0C W;  3WAA B;  2ZY3 A;  1WWI A;  3UTB A;  4R8P A;  3WTP A;  1M1A B;  5B1L D;  2Y2P A;  5C3I B;  5GSU D;  5JRG A;  1ID3 C;  3EPJ A;  3C1B A;  2ARO A;  4KUD D;  1P3L A;  2L5A A;  1P34 C;  3X1T C;  5B40 B;  3X1U A;  3LJA D;  4KUD B;  3W97 A;  5B0Z B;  5B2J D;  1P3F D;  1S32 C;  4YM6 D;  5GT0 D;  3MVD D;  3MGR C;  3LJA B;  1ZLA B;  4H9P B;  5CPK C;  1P3M C;  3AZL A;  5DNN D;  4KHA B;  4Z66 A;  4NE6 A;  3TU4 D;  4WNN A;  4G91 C;  5B2J B;  2DF4 C;  2BYM B;  5GT0 B;  4YM6 B;  3MVD B;  4ZBJ C;  1F66 B;  2Y2H A;  5DNM D;  3REJ C;  5DNN B;  5AVB A;  4H9S A;  3X1T D;  3AZI D;  2XD1 A;  3AZN A;  1ID3 B;  3C1C A;  4WU9 C;  3KFU G;  1P3B D;  3H0L C;  5GXQ A;  4JJN D;  1KX5 C;  3X1S D;  3X1T B;  5BO0 A;  3AZI B;  3H0R C;  5AVC C;  5AY8 D;  3O62 A;  5CPK D;  1P3K A;  5B33 C;  2YFW A;  3MGR B;  4J8W D;  5CP6 C;  4H9N A;  3VH5 T;  1HTA A;  2FFF B;  5CPK B;  1P3M B;  4G91 B;  3AZE A;  3WKJ D;  2VQR A;  4J8W B;  4ZBJ B;  3UTA D;  2CV5 D;  3A6N C;  5F99 D;  3MGQ C;  1P3I A;  4KGC C;  4AWL C;  4Z2M H;  5AV8 A;  5F99 B;  3MGP C;  4WU9 B;  4WJ3 C;  2PYO A;  4M6B A;  3UT9 D;  3AV1 D;  4H9Q A;  4YS3 C;  3KXB C;  1TZY C;  3MGS D;  5FUG A;  1M19 D;  3A1K A;  1AOI A;  3UT9 B;  3NQU B;  3LZ0 D;  1H3O B;  3REL D;  1KX4 C;  5CP6 B;  3A1I A;  3B6F D;  3MGQ D;  1B67 A;  3W99 D;  3LZ1 D;  1P3P C;  1HQ3 D;  3B6F B;  5BNX A;  3MGQ B;  4X23 D;  4KGC B;  4AWL B;  3W98 A;  4CAY A;  2YFV A;  5B24 C;  3W99 B;  5CPI D;  3X1V C;  3WTP E;  3LZ1 B;  1HQ3 B;  3AYW C;  1TZY D;  5CPJ A;  2BYK B;  5CPI B;  5AV9 A;  1P3A C;  5B2I D;  4YS3 B;  1TZY B;  2Y2M A;  3LEL A;  3AZF C;  1TAF B;  2RVQ C;  5G49 A;  1EQZ C;  4H9R A;  4WV4 B;  5E5A D;  2JSS A;  2Y2G A;  3REH C;  1KX4 B;  1P3P D;  5B1M C;  3AZG C;  1KX3 D;  2NQB C;  4QLC C;  4XUJ D;  3W96 C;  2XD5 A;  3KWQ C;  1P3P B;  5B0Y C;  5B32 D;  1KX3 B;  3REK A;  3AN2 D;  5GT3 D;  1U35 A;  1P3G A;  3VH5 W;  3AZM A;  3AV2 D;  2HIO D;  2F8N A;  3B0B A;  3AYW B;  2RVQ D;  3MNN D;  3AN2 B;  5AV5 D;  1T3U A;  5B1L C;  5GSU C;  3EPL A;  1P3A B;  1P3O D;  3AZH D;  3WAA A;  3AZF B;  4J8U D;  4KUD C;  1M1A A;  5JA4 B;  1EQZ B;  4J8X D;  4DQY B;  3B6G D;  4J8U B;  5B1M B;  3LJA C;  3AZG B;  2NQB B;  1N1J B;  5B2J C;  5B40 A;  4QLC B;  3KUY D;  1P3F C;  3W96 B;  3AFA C;  4YM6 C;  4CSR A;  2NZD D;  5B0Z A;  4E44 A;  5DNN C;  3TU4 C;  1ZLA A;  4H9P A;  4J8V D;  4KHA A;  5DNM C;  5AV6 A;  2BYM A;  5GT0 A;  3MVD A;  1F66 A;  5B1L B;  5GSU B;  2FJ7 D;  3AZI C;  5B31 D;  4WU8 D;  1P3B C;  5KDM A;  4JJN C;  3X1S C;  1ID3 A;  3EPH A;  1A7W A;  4G92 C;  3AFA D;  3AZJ D;  1BH8 A;  4WU8 B;  2J8P A;  5BNV B;  1P34 A;  5AY8 C;  3X1T A;  2F8N K;  1P3F B;  2ZY2 A;  1WWS A;  3AFA B;  3REI D;  4J8W C;  4ZUX C;  2RIQ A;  3V9R B;  2JCH A;  2F8N G;  3TU4 B;  1Q9C A;  2F2A C;  1S32 A;  2Y2K A;  3MGR A;  2W8S A;  1BH9 B;  3WKJ C;  2CV5 C;  3UTA C;  5CPK A;  1P3M A;  5F99 C;  5DNM B;  4EO5 C;  3UTB D;  4R8P D;  3WTP D;  5JRG D;  2ZM5 A;  3REJ A;  3C1B D;  1P3L D;  3AV1 C;  3UT9 C;  1P3B B;  4JJN B;  3X1S B;  5JRG B;  3X1U D;  4G92 B;  3MGS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...