1U35A

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA
publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35A00
4YS3A 2HIOA 3AZEA 3R45A 5B2JB 3AZGA 3C1BD 2YFVA 3AZNB 1P3KB 1ID3C 4DRBA 1P34D 5B24B 5GT3A 3W96C 1ZLAC 3AN2A 5AV9A 5B0YD 3LJAA 1P3AB 2HUEC 3AZHC 3RELD 5GSUB 3X1SA 3REJA 3AV2B 3X1TB 4H9NB 1KX3A 3AYWC 5AVCA 4KUDC 3X1UA 1N1JB 3AZMD 4LD9A 1P3BB 5G49A 3AZJA 5AV6C 3UTBA 3W97A 3KWQD 3REHC 5AV5B 5E5AC 4NE6A 5B33A 3W96D 1ZLAD 3AV1A 5AVBA 3AZHD 1B6WA 2LY8A 3AYWD 4ZUXA 1P3GD 3AZLA 2F8NB 1F66D 2F8NG 4XUJB 1KX5B 3X1VC 3O62B 1JFIA 5B1LA 1P3IB 5DNMD 4Z66B 5AV6A 3REHD 4AWLC 5GT0A 5GXQA 3WTPA 5E5AD 3A6ND 1BH8B 3UTAC 4QLCC 1AOIA 5B32B 5B32G 1P3KC 3LZ1A 3MGQB 5BNXA 5B24C 4WU8B 3W98A 4R8PC 5CHLB 3X1VD 2F8NK 4XZQC 5GSUC 3AV2C 2BYKB 3MGPC 3MNNB 4QLCD 1P3BC 3C1BB 3UTAA 4J8VA 4Z5TB 3WA9D 5B2JA 1M19B 4JJNB 5CPJA 3AZNA 1P3KA 5B0YB 4R8PD 2NQBB 5B24A 3RELB 4XZQD 5GSUD 1P3FA 1P3AA 4KGCC 3MGPD 3X1TA 4H9NA 1S32C 4XUJC 4J8XD 3AZMB 1P3BD 1KX5C 1N1JA 1P3IC 4Z66C 3KWQB 1ZLAB 3REIA 3TU4A 3WAAD 3LELB 5FUGB 5F99D 2HUEB 5AV5A 5AV8C 3VH6T 3KXBA 4KGCD 3AYWB 3KUYD 1P3GB 1TAFA 1F66B 4X23A 1S32D 4XUJD 2F8NA 3MVDD 3C1CD 4CSRB 5AY8C 2NZDD 5DNMB 3NQUA 4NFTA 3O62A 5E5AB 3MNNC 1P3IA 3A6NB 4UUZB 4Z66A 1Q9CA 4H9SC 5AV8D 1BH8A 3AFAB 4H9QB 2YFWB 4Z5TC 5B32A 1M19C 4JJNC 3MGQA 5B0YC 2NQBC 3X1VB 3RELC 3B0BA 5AY8D 4WU8A 3V9RB 1F1EA 5B40B 1KX4D 3AZMC 4QLCB 4WU9B 3MNNA 5B2IC 5JRGC 4Z5TD 5DNND 5B1MC 4YM6B 3KWQC 1M19D 3AZID 3WA9B 3C1BA 2L5AA 4JJND 1P3PD 2FJ7B 3LELC 1P34A 4R8PB 2NQBD 4XZQB 5BS7C 4H9OA 1P3GC 3MGPB 4CAYA 1F66C 4J8XB 3AZED 4J8WD 5B2ID 1HTAA 3AZMA 1BFMA 5JRGD 5DNMC 5B1MD 5BNVB 1U35B 2CV5C 3B6FB 3A6NC 1ID3A 3LELD 3KWQA 5CPIB 3WAAB 5F99B 3W96A 1ZLAA 3AFAC 5FUGA 4KGCB 3KUYB 3AZHA 1BH9B 5CPKC 1S32B 3AYWA 1P3OC 4KUDA 1P3GA 3MVDB 3C1CB 3W97D 2NZDB 2CV5D 5B40C 5DNMA 3REHA 4WU9C 5AV8B 5E5AA 3A6NA 3AFAD 4H9PA 4UUZA 4YM6C 1KU5A 1R4VA 4EO5B 3WA9C 5CPKD 1P3OD 1EQZC 4H9QA 3LZ0D 2YFWA 2FJ7C 1M18D 5AY8B 1HQ3C 4NE3A 5GT0D 3X1VA 4G91B 4WV4B 5B40D 1KX4B 4WU9D 4J8XC 5BO0B 3V9RA 2PYOC 3VH5W 4QLCA 4YM6D 5B0ZB 5DNNB 2AROC 3AZIB 1U35C 3WKJC 1P3PB 1EQZD 3B6FC 3WTPE 2FJ7D 3WAAC 5CPIC 5F99C 3W99C 1HQ3D 3VH6W 5JA4B 4WZSB 4R8PA 3MGRC 3KUYC 4J8UB 3AZFB 4XZQA 5GSUA 3AV2A 2PYOD 3VH5T 3KSYA 4J8WB 3MGPA 3MVDC 3AZEB 3C1CC 3MGSC 4ZBJC 5B2IB 4J8XA 1P3BA 2NZDC 5JRGB 5B1MB 2AROD 3WKJD 1U35D 5B31D 3B6FD 2BYMB 5CPID 3W99D 3X1SB 3REKC 3B0CT 5AVCB 3WAAA 3MGRD 4EO5C 1P3LC 4KGCA 3KUYA 3AZKC 1BH9A 5CP6C 3MGSD 1S32A 4XUJA 1ULYA 1KX5A 3W97B 3VH6A 3B6GC 3MVDA 3C1CA 4G91C 2CV5B 2NZDA 3TU4D 1KX4C 1M1AD 3REKD 5AV8A 5DNNC 5B0ZC 3AZIC 5CPKB 1P3LD 1P3PC 1P3OB 3AZKD 5KDMB 1H3OB 3LZ0B 4E44A 5CP6D 1M18B 1JFIB 5B1LB 3B6GD 5GT0B 4J8UC 3UT9C 3AZFC 5AY8A 2BYKA 4YS3C 2HIOC 3AZEC 4J8WC 1KX4A 1TZYD 4H9SA 5BO0A 3LZ1B 5BT1D 5B0ZD 1P3MD 4Z2MH 5GT3C 3AN2C 1EQZB 5AV9C 3LJAC 4Z5TA 5DNNA 1M19A 4JJNA 3X1SC 1HQ3B 1KX3C 5AVCC 5B0YA 4J8UD 3UT9D 3AZFD 2NQBA 3RELA 4LD9C 4YS3D 3AZJC 2HIOD 2PYOB 3AZGD 3UTBC 4J8VB 3B0DB 3W97C 4J8WA 5GT3D 2AROB 3WKJB 5B33C 5CPJB 5B2IA 3AN2D 3AV1C 5B31B 5AV9D 5JRGA 3LJAD 5B1MA 5AVBC 5B31G 3X1SD 3REJD 3W99B 2BYMA 1KX3D 4ZUXC 5AVCD 3LELA 1P3FB 3X1UD 3AZLC 3MGRB 5BS7A 4LD9D 3AZJD 3LZ0C 1F66A 3UTBD 3MGSB 1M18C 4ZBJB 5B1LC 4E45A 1WWSA 5GT0C 5GXQC 3WTPC 4CSRA 5B33D 1ID3D 1A7WA 3AV1D 2CWEA 3REIB 3TU4B 1M1AB 5AVBD 1AOIC 2CV5A 4HGAB 4H9RB 3KXBB 3REKB 4ZUXD 4DRAA 3AZLD 1B67A 1TAFB 3LZ1C 4NE5A 4X23B 3AFAA 3W98C 1P3LB 4KUDD 2JSSA 3AZKB 4KHAB 5CP6B 5CPKA 5B1LD 1P3OA 4G92C 5KDMA 1H3OA 3NQUB 4M6BA 5AV6D 5GXQD 3WTPD 3LZ0A 3B6GB 1M18A 1AOID 5B40A 1TZYB 4J8VC 3B0DC 3LZ1D 4WU9A 5B2JC 1P3MB 1WWIA 3NQJB 5CPJC 3W98D 3AZNC 5B31C 4YM6A 3WA9A 2RVQC 4WNNB 1EQZA 2FJ7A 1P3FC 1P3AC 3B0CW 3UT9B 3X1TC 1HQ3A 4YS3B 2HIOB 3R45B 2F8NH 3AZGB 3UTAD 2YFVB 4J8VD 2IO5B 2PYOA 5B2JD 5GT3B 5CPJD 3AZND 1P3KD 3AN2B 3REIC 5AV9B 3TU4C 1M1AC 3LJAB 1P34B 5B24D 5C3IB 5AV5C 2RVQD 2AROA 5BNVA 1U35A 3WKJA 4HGAC 3KXBC 3REJB 5B31A 3B6FA 3VH5A 1P3FD 1P3AD 1KX3B 4H9OB 5CPIA 5F99A 3X1UB 3AV2D 4CAYB 3X1TD 3W99A 4X23C 4LD9B 5G49B 3AZJB 3MGRA 3UTBB 3O62C 4Z2MG 3MGSA 5B33B 1ID3B 3AV1B 3REID 5AV5D 5AVBB 3W96B 3KXBD 1M1AA 4ZUXB 1TZYC 3AZHB 3AZLB 5BT1C 4H9RA 5B32C 3REKA 4X23D 1P3MC 4KUDB 2F8ND 3MGQC 4WU8C 1KX5D 1P3LA 3AZKA 5AV6B 3WTPB 5GXQB 3O62D 4KHAA 5CP6A 1P3ID 4Z66D 3B6GA 3REHB 1AOIB 3AZGC 4H9PB 2IO5C 5BNXB 5B32D 3C1BC 3W98B 1TZYA 3MGQD 5B0ZA 1P34C 5C3IC 1P3MA 3NQJA 3AZIA 4WU8D 3REJC 1P3PA 4G92B 3X1UC 4WNNA 5JA4A 4AWLB 4J8UA 3UT9A 3MNND 3AZFA 3UTAB
chains in the Genus database with same CATH superfamily
4YS3A 2HIOA 3AZEA 3R45A 5B2JB 3AZGA 3C1BD 2ZY3A 2YFVA 3AZNB 1P3KB 1ID3C 4DRBA 1P34D 5B24B 5GT3A 3W96C 1ZLAC 3AN2A 5AV9A 5B0YD 3LJAA 1P3AB 2HUEC 3AZHC 3RELD 5GSUB 3X1SA 3REJA 3AV2B 3X1TB 4H9NB 1KX3A 3AYWC 5AVCA 4KUDC 3X1UA 1N1JB 3AZMD 4LD9A 3EPLA 1P3BB 5G49A 3AZJA 5AV6C 3UTBA 3W97A 3KWQD 3REHC 5AV5B 5E5AC 4NE6A 2Y2KA 5B33A 1ZLAD 3W96D 3AV1A 5AVBA 3AZHD 1B6WA 2LY8A 3AYWD 2G5IC 4ZUXA 1P3GD 3AZLA 2F8NB 1F66D 2F8NG 4XUJB 1KX5B 2ZM5A 3X1VC 3O62B 1JFIA 5B1LA 1P3IB 5DNMD 4Z66B 5AV6A 3REHD 4AWLC 5GT0A 5GXQA 3WTPA 5E5AD 3A6ND 1BH8B 3UTAC 4QLCC 1AOIA 5B32B 2UWXA 5B32G 1P3KC 3LZ1A 3MGQB 2FFFB 5BNXA 5B24C 4WU8B 3W98A 4R8PC 5CHLB 3X1VD 2XD1A 2F8NK 4XZQC 5GSUC 3AV2C 2BYKB 2G5HC 3MGPC 3MNNB 4QLCD 2Y2OA 1P3BC 1PZRA 3C1BB 2Y2LA 3UTAA 4J8VA 4Z5TB 3WA9D 5B2JA 1M19B 4JJNB 5CPJA 3AZNA 1P3KA 5B0YB 4R8PD 2NQBB 5B24A 3RELB 4XZQD 5GSUD 1P3FA 1P3AA 4KGCC 3MGPD 3X1TA 4H9NA 3IP4C 1S32C 4XUJC 4J8XD 3AZMB 1P3BD 1KX5C 1N1JA 4DQYB 1P3IC 4Z66C 3KWQB 1ZLAB 1W2EA 3REIA 3TU4A 3WAAD 3LELB 5FUGB 5F99D 2HUEB 5AV5A 5AV8C 3VH6T 3KXBA 4KGCD 3AYWB 3KUYD 4UPKA 1P3GB 3AL0C 1TAFA 1F66B 4X23A 1S32D 4XUJD 2F8NA 3MVDD 3C1CD 4CSRB 5AY8C 2NZDD 2Y2IA 5DNMB 3NQUA 4NFTA 3O62A 5E5AB 3MNNC 1P3IA 3A6NB 3WKJA 4UUZB 4Z66A 1Q9CA 2DQNC 4H9SC 5AV8D 1BH8A 3AFAB 4H9QB 2YFWB 4Z5TC 5B32A 1M19C 4JJNC 2RIQA 3MGQA 5B0YC 2NQBC 3X1VB 2JCHA 3RELC 3B0BA 5AY8D 4WU8A 3V9RB 1F1EA 5B40B 1KX4D 3AZMC 4QLCB 4WU9B 3MNNA 5B2IC 5JRGC 4Z5TD 5DNND 5B1MC 4YM6B 3KWQC 1M19D 3AZID 3WA9B 3C1BA 2L5AA 4JJND 1P3PD 2FJ7B 3LELC 1P34A 4R8PB 2NQBD 4XZQB 5BS7C 4H9OA 1P3GC 3MGPB 4CAYA 1F66C 4J8XB 3AZED 4J8WD 2ZY5A 5B2ID 3EPHA 1HTAA 3AZMA 1BFMA 5JRGD 5DNMC 5B1MD 5BNVB 1Z2CB 3FDDA 1U35B 2CV5C 3B6FB 3A6NC 1ID3A 3LELD 3KWQA 5CPIB 3WAAB 2Y2JA 5F99B 3W96A 1ZLAA 3AFAC 5FUGA 4KGCB 3KUYB 3AZHA 1BH9B 5CPKC 1S32B 3AYWA 1P3OC 4KUDA 1P3GA 3MVDB 3C1CB 3W97D 2NZDB 2CV5D 5B40C 5DNMA 3REHA 4WU9C 5AV8B 5E5AA 3A6NA 3AFAD 4H9PA 4UUZA 2F2AC 4YM6C 1KU5A 1R4VA 4EO5B 3WA9C 5CPKD 1P3OD 1EQZC 4H9QA 3LZ0D 2YFWA 2FJ7C 1M18D 5AY8B 1HQ3C 2ZY2A 4NE3A 3EG5B 5GT0D 3X1VA 4G91B 4WV4B 5B40D 1KX4B 4WU9D 4J8XC 2XD5A 3V9RA 5BO0B 2PYOC 3VH5W 4QLCA 4YM6D 5B0ZB 5DNNB 2AROC 3A1KA 3AZIB 1U35C 3WKJC 1P3PB 1EQZD 3B6FC 3WTPE 2FJ7D 3WAAC 5CPIC 5F99C 3W99C 1HQ3D 3VH6W 5JA4B 4WZSB 4R8PA 3MGRC 3KUYC 4J8UB 3AZFB 4XZQA 5GSUA 2ZY4A 3AV2A 2PYOD 2W8SA 3VH5T 3KSYA 4J8WB 3MGPA 3MVDC 3AZEB 3C1CC 3MGSC 4ZBJC 5B2IB 4J8XA 1P3BA 2NZDC 5JRGB 5B1MB 2AROD 2Y2GA 1U35D 3WKJD 5B31D 3B6FD 2BYMB 5CPID 3W99D 2Y2PA 3X1SB 3REKC 3B0CT 5AVCB 3WAAA 3MGRD 4EO5C 1P3LC 4KGCA 3KUYA 3AZKC 1BH9A 5CP6C 3MGSD 1S32A 4XUJA 1ULYA 1KX5A 3W97B 3VH6A 2Y2MA 3B6GC 3MVDA 3C1CA 4G91C 2CV5B 2NZDA 3TU4D 1KX4C 1M1AD 3REKD 5AV8A 5DNNC 5B0ZC 2J8PA 3AZIC 5CPKB 1P3LD 1P3PC 1P3OB 3AZKD 5KDMB 1H3OB 3LZ0B 4E44A 5CP6D 1M18B 1JFIB 5B1LB 3P5JB 3B6GD 5GT0B 4J8UC 3UT9C 3AZFC 5AY8A 2BYKA 4YS3C 2BG1A 2HIOC 3AZEC 4J8WC 1KX4A 1TZYD 2JE5A 4H9SA 5BO0A 3LZ1B 5BT1D 5B0ZD 1P3MD 4Z2MH 5GT3C 3AN2C 1EQZB 5AV9C 3LJAC 4Z5TA 5DNNA 1M19A 4JJNA 3X1SC 1HQ3B 1KX3C 5AVCC 5B0YA 4J8UD 3UT9D 3AZFD 2NQBA 3RELA 3EPJA 4YS3D 4LD9C 3AZJC 2HIOD 2PYOB 3AZGD 3UTBC 4J8VB 3B0DB 3W97C 4J8WA 5GT3D 2AROB 3WKJB 5B33C 5CPJB 5B2IA 3AN2D 3AV1C 5B31B 5AV9D 5JRGA 3LJAD 5B1MA 5AVBC 5B31G 4WJ3C 3X1SD 3H0RC 3REJD 3W99B 2BYMA 1KX3D 4ZUXC 5AVCD 3LELA 1P3FB 3X1UD 3AZLC 3MGRB 5BS7A 4LD9D 3AZJD 3KFUG 3LZ0C 1F66A 3UTBD 3MGSB 1M18C 4ZBJB 5B1LC 4E45A 1WWSA 5GT0C 5GXQC 3WTPC 4CSRA 5B33D 1ID3D 1A7WA 3H0MC 3AV1D 2CWEA 3REIB 3TU4B 1M1AB 5AVBD 1AOIC 2CV5A 4HGAB 4H9RB 3KXBB 3REKB 4ZUXD 4DRAA 3AZLD 1B67A 1TAFB 3LZ1C 2Y2HA 4NE5A 4X23B 3AFAA 3W98C 1P3LB 4KUDD 2JSSA 3AZKB 4KHAB 5CP6B 5CPKA 5B1LD 1P3OA 4G92C 5KDMA 1H3OA 3NQUB 4M6BA 5AV6D 5GXQD 3WTPD 3LZ0A 3B6GB 1M18A 1AOID 5B40A 3F6TA 1TZYB 4J8VC 3B0DC 3LZ1D 4WU9A 5B2JC 1P3MB 1WWIA 3NQJB 2Y2QA 5CPJC 3AZNC 3W98D 5B31C 4YM6A 3H0LC 3WA9A 2RVQC 4WNNB 1EQZA 2FJ7A 1P3FC 1P3AC 3B0CW 3UT9B 3X1TC 1HQ3A 4YS3B 2HIOB 3R45B 2F8NH 3AZGB 3UTAD 2YFVB 4J8VD 2IO5B 2PYOA 5B2JD 5GT3B 5CPJD 3AZND 1P3KD 3AN2B 3REIC 5AV9B 3TU4C 1M1AC 3LJAB 1P34B 5C3IB 5AV5C 3A1IA 2RVQD 2AROA 5BNVA 5B24D 1U35A 4HGAC 3KXBC 3REJB 5B31A 3B6FA 3VH5A 2VQRA 1P3FD 1P3AD 1KX3B 4H9OB 5CPIA 5F99A 3X1UB 3AV2D 4CAYB 3X1TD 3W99A 4X23C 4LD9B 5G49B 3AZJB 3MGRA 2Y2NA 3UTBB 3O62C 4Z2MG 3MGSA 5B33B 2DF4C 1ID3B 3AV1B 3REID 5AV5D 5AVBB 3W96B 3KXBD 1M1AA 4ZUXB 1TZYC 3AZHB 3AZLB 5BT1C 3EPKA 4H9RA 5B32C 3REKA 4X23D 1P3MC 4KUDB 2F8ND 3MGQC 4WU8C 1KX5D 1P3LA 3AZKA 5AV6B 3WTPB 5GXQB 3O62D 4KHAA 5CP6A 1P3ID 4Z66D 3B6GA 3REHB 1AOIB 3AZGC 4H9PB 1T3UA 2IO5C 5BNXB 5B32D 3C1BC 3W98B 1TZYA 3MGQD 5B0ZA 1P34C 5C3IC 1P3MA 3NQJA 3AZIA 4WU8D 3REJC 1P3PA 4G92B 3X1UC 4WNNA 5JA4A 4AWLB 4J8UA 3UT9A 3MNND 3AZFA 3UTAB
chains in the Genus database with same CATH topology
4YS3A 2HIOA 3AZEA 3R45A 5B2JB 3AZGA 3C1BD 2ZY3A 2YFVA 3AZNB 1P3KB 1ID3C 4DRBA 1P34D 5B24B 5GT3A 3W96C 1ZLAC 3AN2A 5AV9A 5B0YD 3LJAA 1P3AB 2HUEC 3AZHC 3RELD 5GSUB 3X1SA 3REJA 3AV2B 3X1TB 4H9NB 1KX3A 3AYWC 5AVCA 4KUDC 3X1UA 1N1JB 3AZMD 4LD9A 3EPLA 1P3BB 5G49A 3AZJA 5AV6C 3UTBA 3W97A 3KWQD 3REHC 5AV5B 5E5AC 4NE6A 2Y2KA 5B33A 1ZLAD 3W96D 3AV1A 5AVBA 3AZHD 1B6WA 2LY8A 3AYWD 2G5IC 4ZUXA 1P3GD 3AZLA 2F8NB 1F66D 2F8NG 4XUJB 1KX5B 2ZM5A 3X1VC 3O62B 1JFIA 5B1LA 1P3IB 5DNMD 4Z66B 5AV6A 3REHD 4AWLC 5GT0A 5GXQA 3WTPA 5E5AD 3A6ND 1BH8B 3UTAC 4QLCC 1AOIA 5B32B 2UWXA 5B32G 1P3KC 3LZ1A 3MGQB 2FFFB 5BNXA 5B24C 4WU8B 3W98A 4R8PC 5CHLB 3X1VD 2XD1A 2F8NK 4XZQC 5GSUC 3AV2C 2BYKB 2G5HC 3MGPC 3MNNB 4QLCD 2Y2OA 1P3BC 1PZRA 3C1BB 2Y2LA 3UTAA 4J8VA 4Z5TB 3WA9D 5B2JA 1M19B 4JJNB 5CPJA 3AZNA 1P3KA 5B0YB 4R8PD 2NQBB 5B24A 3RELB 4XZQD 5GSUD 1P3FA 1P3AA 4KGCC 3MGPD 3X1TA 4H9NA 3IP4C 1S32C 4XUJC 4J8XD 3AZMB 1P3BD 1KX5C 1N1JA 4DQYB 1P3IC 4Z66C 3KWQB 1ZLAB 1W2EA 3REIA 3TU4A 3WAAD 3LELB 5FUGB 5F99D 2HUEB 5AV5A 5AV8C 3VH6T 3KXBA 4KGCD 3AYWB 3KUYD 4UPKA 1P3GB 3AL0C 1TAFA 1F66B 4X23A 1S32D 4XUJD 2F8NA 3MVDD 3C1CD 4CSRB 5AY8C 2NZDD 2Y2IA 5DNMB 3NQUA 4NFTA 3O62A 5E5AB 3MNNC 1P3IA 3A6NB 3WKJA 4UUZB 4Z66A 1Q9CA 2DQNC 4H9SC 5AV8D 1BH8A 3AFAB 4H9QB 2YFWB 4Z5TC 5B32A 1M19C 4JJNC 2RIQA 3MGQA 5B0YC 2NQBC 3X1VB 2JCHA 3RELC 3B0BA 5AY8D 4WU8A 3V9RB 1F1EA 5B40B 1KX4D 3AZMC 4QLCB 4WU9B 3MNNA 5B2IC 5JRGC 4Z5TD 5DNND 5B1MC 4YM6B 3KWQC 1M19D 3AZID 3WA9B 3C1BA 2L5AA 4JJND 1P3PD 2FJ7B 3LELC 1P34A 4R8PB 2NQBD 4XZQB 5BS7C 4H9OA 1P3GC 3MGPB 4CAYA 1F66C 4J8XB 3AZED 4J8WD 2ZY5A 5B2ID 3EPHA 1HTAA 3AZMA 1BFMA 5JRGD 5DNMC 5B1MD 5BNVB 1Z2CB 3FDDA 1U35B 2CV5C 3B6FB 3A6NC 1ID3A 3LELD 3KWQA 5CPIB 3WAAB 2Y2JA 5F99B 3W96A 1ZLAA 3AFAC 5FUGA 4KGCB 3KUYB 3AZHA 1BH9B 5CPKC 1S32B 3AYWA 1P3OC 4KUDA 1P3GA 3MVDB 3C1CB 3W97D 2NZDB 2CV5D 5B40C 5DNMA 3REHA 4WU9C 5AV8B 5E5AA 3A6NA 3AFAD 4H9PA 4UUZA 2F2AC 4YM6C 1KU5A 1R4VA 4EO5B 3WA9C 5CPKD 1P3OD 1EQZC 4H9QA 3LZ0D 2YFWA 2FJ7C 1M18D 5AY8B 1HQ3C 2ZY2A 4NE3A 3EG5B 5GT0D 3X1VA 4G91B 4WV4B 5B40D 1KX4B 4WU9D 4J8XC 2XD5A 3V9RA 5BO0B 2PYOC 3VH5W 4QLCA 4YM6D 5B0ZB 5DNNB 2AROC 3A1KA 3AZIB 1U35C 3WKJC 1P3PB 1EQZD 3B6FC 3WTPE 2FJ7D 3WAAC 5CPIC 5F99C 3W99C 1HQ3D 3VH6W 5JA4B 4WZSB 4R8PA 3MGRC 3KUYC 4J8UB 3AZFB 4XZQA 5GSUA 2ZY4A 3AV2A 2PYOD 2W8SA 3VH5T 3KSYA 4J8WB 3MGPA 3MVDC 3AZEB 3C1CC 3MGSC 4ZBJC 5B2IB 4J8XA 1P3BA 2NZDC 5JRGB 5B1MB 2AROD 2Y2GA 1U35D 3WKJD 5B31D 3B6FD 2BYMB 5CPID 3W99D 2Y2PA 3X1SB 3REKC 3B0CT 5AVCB 3WAAA 3MGRD 4EO5C 1P3LC 4KGCA 3KUYA 3AZKC 1BH9A 5CP6C 3MGSD 1S32A 4XUJA 1ULYA 1KX5A 3W97B 3VH6A 2Y2MA 3B6GC 3MVDA 3C1CA 4G91C 2CV5B 2NZDA 3TU4D 1KX4C 1M1AD 3REKD 5AV8A 5DNNC 5B0ZC 2J8PA 3AZIC 5CPKB 1P3LD 1P3PC 1P3OB 3AZKD 5KDMB 1H3OB 3LZ0B 4E44A 5CP6D 1M18B 1JFIB 5B1LB 3P5JB 3B6GD 5GT0B 4J8UC 3UT9C 3AZFC 5AY8A 2BYKA 4YS3C 2BG1A 2HIOC 3AZEC 4J8WC 1KX4A 1TZYD 2JE5A 4H9SA 5BO0A 3LZ1B 5BT1D 5B0ZD 1P3MD 4Z2MH 5GT3C 3AN2C 1EQZB 5AV9C 3LJAC 4Z5TA 5DNNA 1M19A 4JJNA 3X1SC 1HQ3B 1KX3C 5AVCC 5B0YA 4J8UD 3UT9D 3AZFD 2NQBA 3RELA 3EPJA 4YS3D 4LD9C 3AZJC 2HIOD 2PYOB 3AZGD 3UTBC 4J8VB 3B0DB 3W97C 4J8WA 5GT3D 2AROB 3WKJB 5B33C 5CPJB 5B2IA 3AN2D 3AV1C 5B31B 5AV9D 5JRGA 3LJAD 5B1MA 5AVBC 5B31G 4WJ3C 3X1SD 3H0RC 3REJD 3W99B 2BYMA 1KX3D 4ZUXC 5AVCD 3LELA 1P3FB 3X1UD 3AZLC 3MGRB 5BS7A 4LD9D 3AZJD 3KFUG 3LZ0C 1F66A 3UTBD 3MGSB 1M18C 4ZBJB 5B1LC 4E45A 1WWSA 5GT0C 5GXQC 3WTPC 4CSRA 5B33D 1ID3D 1A7WA 3H0MC 3AV1D 2CWEA 3REIB 3TU4B 1M1AB 5AVBD 1AOIC 2CV5A 4HGAB 4H9RB 3KXBB 3REKB 4ZUXD 4DRAA 3AZLD 1B67A 1TAFB 3LZ1C 2Y2HA 4NE5A 4X23B 3AFAA 3W98C 1P3LB 4KUDD 2JSSA 3AZKB 4KHAB 5CP6B 5CPKA 5B1LD 1P3OA 4G92C 5KDMA 1H3OA 3NQUB 4M6BA 5AV6D 5GXQD 3WTPD 3LZ0A 3B6GB 1M18A 1AOID 5B40A 3F6TA 1TZYB 4J8VC 3B0DC 3LZ1D 4WU9A 5B2JC 1P3MB 1WWIA 3NQJB 2Y2QA 5CPJC 3AZNC 3W98D 5B31C 4YM6A 3H0LC 3WA9A 2RVQC 4WNNB 1EQZA 2FJ7A 1P3FC 1P3AC 3B0CW 3UT9B 3X1TC 1HQ3A 4YS3B 2HIOB 3R45B 2F8NH 3AZGB 3UTAD 2YFVB 4J8VD 2IO5B 2PYOA 5B2JD 5GT3B 5CPJD 3AZND 1P3KD 3AN2B 3REIC 5AV9B 3TU4C 1M1AC 3LJAB 1P34B 5C3IB 5AV5C 3A1IA 2RVQD 2AROA 5BNVA 5B24D 1U35A 4HGAC 3KXBC 3REJB 5B31A 3B6FA 3VH5A 2VQRA 1P3FD 1P3AD 1KX3B 4H9OB 5CPIA 5F99A 3X1UB 3AV2D 4CAYB 3X1TD 3W99A 4X23C 4LD9B 5G49B 3AZJB 3MGRA 2Y2NA 3UTBB 3O62C 4Z2MG 3MGSA 5B33B 2DF4C 1ID3B 3AV1B 3REID 5AV5D 5AVBB 3W96B 3KXBD 1M1AA 4ZUXB 1TZYC 3AZHB 3AZLB 5BT1C 3EPKA 4H9RA 5B32C 3REKA 4X23D 1P3MC 4KUDB 2F8ND 3MGQC 4WU8C 1KX5D 1P3LA 3AZKA 5AV6B 3WTPB 5GXQB 3O62D 4KHAA 5CP6A 1P3ID 4Z66D 3B6GA 3REHB 1AOIB 3AZGC 4H9PB 1T3UA 2IO5C 5BNXB 5B32D 3C1BC 3W98B 1TZYA 3MGQD 5B0ZA 1P34C 5C3IC 1P3MA 3NQJA 3AZIA 4WU8D 3REJC 1P3PA 4G92B 3X1UC 4WNNA 5JA4A 4AWLB 4J8UA 3UT9A 3MNND 3AZFA 3UTAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YS3 A;  2HIO A;  3AZE A;  3R45 A;  5B2J B;  3AZG A;  3C1B D;  2YFV A;  3AZN B;  1P3K B;  1ID3 C;  4DRB A;  1P34 D;  5B24 B;  5GT3 A;  3W96 C;  1ZLA C;  3AN2 A;  5AV9 A;  5B0Y D;  3LJA A;  1P3A B;  2HUE C;  3AZH C;  3REL D;  5GSU B;  3X1S A;  3REJ A;  3AV2 B;  3X1T B;  4H9N B;  1KX3 A;  3AYW C;  5AVC A;  4KUD C;  3X1U A;  1N1J B;  3AZM D;  4LD9 A;  1P3B B;  5G49 A;  3AZJ A;  5AV6 C;  3UTB A;  3W97 A;  3KWQ D;  3REH C;  5AV5 B;  5E5A C;  4NE6 A;  5B33 A;  3W96 D;  1ZLA D;  3AV1 A;  5AVB A;  3AZH D;  1B6W A;  2LY8 A;  3AYW D;  4ZUX A;  1P3G D;  3AZL A;  2F8N B;  1F66 D;  2F8N G;  4XUJ B;  1KX5 B;  3X1V C;  3O62 B;  1JFI A;  5B1L A;  1P3I B;  5DNM D;  4Z66 B;  5AV6 A;  3REH D;  4AWL C;  5GT0 A;  5GXQ A;  3WTP A;  5E5A D;  3A6N D;  1BH8 B;  3UTA C;  4QLC C;  1AOI A;  5B32 B;  5B32 G;  1P3K C;  3LZ1 A;  3MGQ B;  5BNX A;  5B24 C;  4WU8 B;  3W98 A;  4R8P C;  5CHL B;  3X1V D;  2F8N K;  4XZQ C;  5GSU C;  3AV2 C;  2BYK B;  3MGP C;  3MNN B;  4QLC D;  1P3B C;  3C1B B;  3UTA A;  4J8V A;  4Z5T B;  3WA9 D;  5B2J A;  1M19 B;  4JJN B;  5CPJ A;  3AZN A;  1P3K A;  5B0Y B;  4R8P D;  2NQB B;  5B24 A;  3REL B;  4XZQ D;  5GSU D;  1P3F A;  1P3A A;  4KGC C;  3MGP D;  3X1T A;  4H9N A;  1S32 C;  4XUJ C;  4J8X D;  3AZM B;  1P3B D;  1KX5 C;  1N1J A;  1P3I C;  4Z66 C;  3KWQ B;  1ZLA B;  3REI A;  3TU4 A;  3WAA D;  3LEL B;  5FUG B;  5F99 D;  2HUE B;  5AV5 A;  5AV8 C;  3VH6 T;  3KXB A;  4KGC D;  3AYW B;  3KUY D;  1P3G B;  1TAF A;  1F66 B;  4X23 A;  1S32 D;  4XUJ D;  2F8N A;  3MVD D;  3C1C D;  4CSR B;  5AY8 C;  2NZD D;  5DNM B;  3NQU A;  4NFT A;  3O62 A;  5E5A B;  3MNN C;  1P3I A;  3A6N B;  4UUZ B;  4Z66 A;  1Q9C A;  4H9S C;  5AV8 D;  1BH8 A;  3AFA B;  4H9Q B;  2YFW B;  4Z5T C;  5B32 A;  1M19 C;  4JJN C;  3MGQ A;  5B0Y C;  2NQB C;  3X1V B;  3REL C;  3B0B A;  5AY8 D;  4WU8 A;  3V9R B;  1F1E A;  5B40 B;  1KX4 D;  3AZM C;  4QLC B;  4WU9 B;  3MNN A;  5B2I C;  5JRG C;  4Z5T D;  5DNN D;  5B1M C;  4YM6 B;  3KWQ C;  1M19 D;  3AZI D;  3WA9 B;  3C1B A;  2L5A A;  4JJN D;  1P3P D;  2FJ7 B;  3LEL C;  1P34 A;  4R8P B;  2NQB D;  4XZQ B;  5BS7 C;  4H9O A;  1P3G C;  3MGP B;  4CAY A;  1F66 C;  4J8X B;  3AZE D;  4J8W D;  5B2I D;  1HTA A;  3AZM A;  1BFM A;  5JRG D;  5DNM C;  5B1M D;  5BNV B;  1U35 B;  2CV5 C;  3B6F B;  3A6N C;  1ID3 A;  3LEL D;  3KWQ A;  5CPI B;  3WAA B;  5F99 B;  3W96 A;  1ZLA A;  3AFA C;  5FUG A;  4KGC B;  3KUY B;  3AZH A;  1BH9 B;  5CPK C;  1S32 B;  3AYW A;  1P3O C;  4KUD A;  1P3G A;  3MVD B;  3C1C B;  3W97 D;  2NZD B;  2CV5 D;  5B40 C;  5DNM A;  3REH A;  4WU9 C;  5AV8 B;  5E5A A;  3A6N A;  3AFA D;  4H9P A;  4UUZ A;  4YM6 C;  1KU5 A;  1R4V A;  4EO5 B;  3WA9 C;  5CPK D;  1P3O D;  1EQZ C;  4H9Q A;  3LZ0 D;  2YFW A;  2FJ7 C;  1M18 D;  5AY8 B;  1HQ3 C;  4NE3 A;  5GT0 D;  3X1V A;  4G91 B;  4WV4 B;  5B40 D;  1KX4 B;  4WU9 D;  4J8X C;  5BO0 B;  3V9R A;  2PYO C;  3VH5 W;  4QLC A;  4YM6 D;  5B0Z B;  5DNN B;  2ARO C;  3AZI B;  1U35 C;  3WKJ C;  1P3P B;  1EQZ D;  3B6F C;  3WTP E;  2FJ7 D;  3WAA C;  5CPI C;  5F99 C;  3W99 C;  1HQ3 D;  3VH6 W;  5JA4 B;  4WZS B;  4R8P A;  3MGR C;  3KUY C;  4J8U B;  3AZF B;  4XZQ A;  5GSU A;  3AV2 A;  2PYO D;  3VH5 T;  3KSY A;  4J8W B;  3MGP A;  3MVD C;  3AZE B;  3C1C C;  3MGS C;  4ZBJ C;  5B2I B;  4J8X A;  1P3B A;  2NZD C;  5JRG B;  5B1M B;  2ARO D;  3WKJ D;  1U35 D;  5B31 D;  3B6F D;  2BYM B;  5CPI D;  3W99 D;  3X1S B;  3REK C;  3B0C T;  5AVC B;  3WAA A;  3MGR D;  4EO5 C;  1P3L C;  4KGC A;  3KUY A;  3AZK C;  1BH9 A;  5CP6 C;  3MGS D;  1S32 A;  4XUJ A;  1ULY A;  1KX5 A;  3W97 B;  3VH6 A;  3B6G C;  3MVD A;  3C1C A;  4G91 C;  2CV5 B;  2NZD A;  3TU4 D;  1KX4 C;  1M1A D;  3REK D;  5AV8 A;  5DNN C;  5B0Z C;  3AZI C;  5CPK B;  1P3L D;  1P3P C;  1P3O B;  3AZK D;  5KDM B;  1H3O B;  3LZ0 B;  4E44 A;  5CP6 D;  1M18 B;  1JFI B;  5B1L B;  3B6G D;  5GT0 B;  4J8U C;  3UT9 C;  3AZF C;  5AY8 A;  2BYK A;  4YS3 C;  2HIO C;  3AZE C;  4J8W C;  1KX4 A;  1TZY D;  4H9S A;  5BO0 A;  3LZ1 B;  5BT1 D;  5B0Z D;  1P3M D;  4Z2M H;  5GT3 C;  3AN2 C;  1EQZ B;  5AV9 C;  3LJA C;  4Z5T A;  5DNN A;  1M19 A;  4JJN A;  3X1S C;  1HQ3 B;  1KX3 C;  5AVC C;  5B0Y A;  4J8U D;  3UT9 D;  3AZF D;  2NQB A;  3REL A;  4LD9 C;  4YS3 D;  3AZJ C;  2HIO D;  2PYO B;  3AZG D;  3UTB C;  4J8V B;  3B0D B;  3W97 C;  4J8W A;  5GT3 D;  2ARO B;  3WKJ B;  5B33 C;  5CPJ B;  5B2I A;  3AN2 D;  3AV1 C;  5B31 B;  5AV9 D;  5JRG A;  3LJA D;  5B1M A;  5AVB C;  5B31 G;  3X1S D;  3REJ D;  3W99 B;  2BYM A;  1KX3 D;  4ZUX C;  5AVC D;  3LEL A;  1P3F B;  3X1U D;  3AZL C;  3MGR B;  5BS7 A;  4LD9 D;  3AZJ D;  3LZ0 C;  1F66 A;  3UTB D;  3MGS B;  1M18 C;  4ZBJ B;  5B1L C;  4E45 A;  1WWS A;  5GT0 C;  5GXQ C;  3WTP C;  4CSR A;  5B33 D;  1ID3 D;  1A7W A;  3AV1 D;  2CWE A;  3REI B;  3TU4 B;  1M1A B;  5AVB D;  1AOI C;  2CV5 A;  4HGA B;  4H9R B;  3KXB B;  3REK B;  4ZUX D;  4DRA A;  3AZL D;  1B67 A;  1TAF B;  3LZ1 C;  4NE5 A;  4X23 B;  3AFA A;  3W98 C;  1P3L B;  4KUD D;  2JSS A;  3AZK B;  4KHA B;  5CP6 B;  5CPK A;  5B1L D;  1P3O A;  4G92 C;  5KDM A;  1H3O A;  3NQU B;  4M6B A;  5AV6 D;  5GXQ D;  3WTP D;  3LZ0 A;  3B6G B;  1M18 A;  1AOI D;  5B40 A;  1TZY B;  4J8V C;  3B0D C;  3LZ1 D;  4WU9 A;  5B2J C;  1P3M B;  1WWI A;  3NQJ B;  5CPJ C;  3W98 D;  3AZN C;  5B31 C;  4YM6 A;  3WA9 A;  2RVQ C;  4WNN B;  1EQZ A;  2FJ7 A;  1P3F C;  1P3A C;  3B0C W;  3UT9 B;  3X1T C;  1HQ3 A;  4YS3 B;  2HIO B;  3R45 B;  2F8N H;  3AZG B;  3UTA D;  2YFV B;  4J8V D;  2IO5 B;  2PYO A;  5B2J D;  5GT3 B;  5CPJ D;  3AZN D;  1P3K D;  3AN2 B;  3REI C;  5AV9 B;  3TU4 C;  1M1A C;  3LJA B;  1P34 B;  5B24 D;  5C3I B;  5AV5 C;  2RVQ D;  2ARO A;  5BNV A;  1U35 A;  3WKJ A;  4HGA C;  3KXB C;  3REJ B;  5B31 A;  3B6F A;  3VH5 A;  1P3F D;  1P3A D;  1KX3 B;  4H9O B;  5CPI A;  5F99 A;  3X1U B;  3AV2 D;  4CAY B;  3X1T D;  3W99 A;  4X23 C;  4LD9 B;  5G49 B;  3AZJ B;  3MGR A;  3UTB B;  3O62 C;  4Z2M G;  3MGS A;  5B33 B;  1ID3 B;  3AV1 B;  3REI D;  5AV5 D;  5AVB B;  3W96 B;  3KXB D;  1M1A A;  4ZUX B;  1TZY C;  3AZH B;  3AZL B;  5BT1 C;  4H9R A;  5B32 C;  3REK A;  4X23 D;  1P3M C;  4KUD B;  2F8N D;  3MGQ C;  4WU8 C;  1KX5 D;  1P3L A;  3AZK A;  5AV6 B;  3WTP B;  5GXQ B;  3O62 D;  4KHA A;  5CP6 A;  1P3I D;  4Z66 D;  3B6G A;  3REH B;  1AOI B;  3AZG C;  4H9P B;  2IO5 C;  5BNX B;  5B32 D;  3C1B C;  3W98 B;  1TZY A;  3MGQ D;  5B0Z A;  1P34 C;  5C3I C;  1P3M A;  3NQJ A;  3AZI A;  4WU8 D;  3REJ C;  1P3P A;  4G92 B;  3X1U C;  4WNN A;  5JA4 A;  4AWL B;  4J8U A;  3UT9 A;  3MNN D;  3AZF A;  3UTA B; 
#chains in the Genus database with same CATH topology
 4YS3 A;  2HIO A;  3AZE A;  3R45 A;  5B2J B;  3AZG A;  3C1B D;  2ZY3 A;  2YFV A;  3AZN B;  1P3K B;  1ID3 C;  4DRB A;  1P34 D;  5B24 B;  5GT3 A;  3W96 C;  1ZLA C;  3AN2 A;  5AV9 A;  5B0Y D;  3LJA A;  1P3A B;  2HUE C;  3AZH C;  3REL D;  5GSU B;  3X1S A;  3REJ A;  3AV2 B;  3X1T B;  4H9N B;  1KX3 A;  3AYW C;  5AVC A;  4KUD C;  3X1U A;  1N1J B;  3AZM D;  4LD9 A;  3EPL A;  1P3B B;  5G49 A;  3AZJ A;  5AV6 C;  3UTB A;  3W97 A;  3KWQ D;  3REH C;  5AV5 B;  5E5A C;  4NE6 A;  2Y2K A;  5B33 A;  1ZLA D;  3W96 D;  3AV1 A;  5AVB A;  3AZH D;  1B6W A;  2LY8 A;  3AYW D;  2G5I C;  4ZUX A;  1P3G D;  3AZL A;  2F8N B;  1F66 D;  2F8N G;  4XUJ B;  1KX5 B;  2ZM5 A;  3X1V C;  3O62 B;  1JFI A;  5B1L A;  1P3I B;  5DNM D;  4Z66 B;  5AV6 A;  3REH D;  4AWL C;  5GT0 A;  5GXQ A;  3WTP A;  5E5A D;  3A6N D;  1BH8 B;  3UTA C;  4QLC C;  1AOI A;  5B32 B;  2UWX A;  5B32 G;  1P3K C;  3LZ1 A;  3MGQ B;  2FFF B;  5BNX A;  5B24 C;  4WU8 B;  3W98 A;  4R8P C;  5CHL B;  3X1V D;  2XD1 A;  2F8N K;  4XZQ C;  5GSU C;  3AV2 C;  2BYK B;  2G5H C;  3MGP C;  3MNN B;  4QLC D;  2Y2O A;  1P3B C;  1PZR A;  3C1B B;  2Y2L A;  3UTA A;  4J8V A;  4Z5T B;  3WA9 D;  5B2J A;  1M19 B;  4JJN B;  5CPJ A;  3AZN A;  1P3K A;  5B0Y B;  4R8P D;  2NQB B;  5B24 A;  3REL B;  4XZQ D;  5GSU D;  1P3F A;  1P3A A;  4KGC C;  3MGP D;  3X1T A;  4H9N A;  3IP4 C;  1S32 C;  4XUJ C;  4J8X D;  3AZM B;  1P3B D;  1KX5 C;  1N1J A;  4DQY B;  1P3I C;  4Z66 C;  3KWQ B;  1ZLA B;  1W2E A;  3REI A;  3TU4 A;  3WAA D;  3LEL B;  5FUG B;  5F99 D;  2HUE B;  5AV5 A;  5AV8 C;  3VH6 T;  3KXB A;  4KGC D;  3AYW B;  3KUY D;  4UPK A;  1P3G B;  3AL0 C;  1TAF A;  1F66 B;  4X23 A;  1S32 D;  4XUJ D;  2F8N A;  3MVD D;  3C1C D;  4CSR B;  5AY8 C;  2NZD D;  2Y2I A;  5DNM B;  3NQU A;  4NFT A;  3O62 A;  5E5A B;  3MNN C;  1P3I A;  3A6N B;  3WKJ A;  4UUZ B;  4Z66 A;  1Q9C A;  2DQN C;  4H9S C;  5AV8 D;  1BH8 A;  3AFA B;  4H9Q B;  2YFW B;  4Z5T C;  5B32 A;  1M19 C;  4JJN C;  2RIQ A;  3MGQ A;  5B0Y C;  2NQB C;  3X1V B;  2JCH A;  3REL C;  3B0B A;  5AY8 D;  4WU8 A;  3V9R B;  1F1E A;  5B40 B;  1KX4 D;  3AZM C;  4QLC B;  4WU9 B;  3MNN A;  5B2I C;  5JRG C;  4Z5T D;  5DNN D;  5B1M C;  4YM6 B;  3KWQ C;  1M19 D;  3AZI D;  3WA9 B;  3C1B A;  2L5A A;  4JJN D;  1P3P D;  2FJ7 B;  3LEL C;  1P34 A;  4R8P B;  2NQB D;  4XZQ B;  5BS7 C;  4H9O A;  1P3G C;  3MGP B;  4CAY A;  1F66 C;  4J8X B;  3AZE D;  4J8W D;  2ZY5 A;  5B2I D;  3EPH A;  1HTA A;  3AZM A;  1BFM A;  5JRG D;  5DNM C;  5B1M D;  5BNV B;  1Z2C B;  3FDD A;  1U35 B;  2CV5 C;  3B6F B;  3A6N C;  1ID3 A;  3LEL D;  3KWQ A;  5CPI B;  3WAA B;  2Y2J A;  5F99 B;  3W96 A;  1ZLA A;  3AFA C;  5FUG A;  4KGC B;  3KUY B;  3AZH A;  1BH9 B;  5CPK C;  1S32 B;  3AYW A;  1P3O C;  4KUD A;  1P3G A;  3MVD B;  3C1C B;  3W97 D;  2NZD B;  2CV5 D;  5B40 C;  5DNM A;  3REH A;  4WU9 C;  5AV8 B;  5E5A A;  3A6N A;  3AFA D;  4H9P A;  4UUZ A;  2F2A C;  4YM6 C;  1KU5 A;  1R4V A;  4EO5 B;  3WA9 C;  5CPK D;  1P3O D;  1EQZ C;  4H9Q A;  3LZ0 D;  2YFW A;  2FJ7 C;  1M18 D;  5AY8 B;  1HQ3 C;  2ZY2 A;  4NE3 A;  3EG5 B;  5GT0 D;  3X1V A;  4G91 B;  4WV4 B;  5B40 D;  1KX4 B;  4WU9 D;  4J8X C;  2XD5 A;  3V9R A;  5BO0 B;  2PYO C;  3VH5 W;  4QLC A;  4YM6 D;  5B0Z B;  5DNN B;  2ARO C;  3A1K A;  3AZI B;  1U35 C;  3WKJ C;  1P3P B;  1EQZ D;  3B6F C;  3WTP E;  2FJ7 D;  3WAA C;  5CPI C;  5F99 C;  3W99 C;  1HQ3 D;  3VH6 W;  5JA4 B;  4WZS B;  4R8P A;  3MGR C;  3KUY C;  4J8U B;  3AZF B;  4XZQ A;  5GSU A;  2ZY4 A;  3AV2 A;  2PYO D;  2W8S A;  3VH5 T;  3KSY A;  4J8W B;  3MGP A;  3MVD C;  3AZE B;  3C1C C;  3MGS C;  4ZBJ C;  5B2I B;  4J8X A;  1P3B A;  2NZD C;  5JRG B;  5B1M B;  2ARO D;  2Y2G A;  1U35 D;  3WKJ D;  5B31 D;  3B6F D;  2BYM B;  5CPI D;  3W99 D;  2Y2P A;  3X1S B;  3REK C;  3B0C T;  5AVC B;  3WAA A;  3MGR D;  4EO5 C;  1P3L C;  4KGC A;  3KUY A;  3AZK C;  1BH9 A;  5CP6 C;  3MGS D;  1S32 A;  4XUJ A;  1ULY A;  1KX5 A;  3W97 B;  3VH6 A;  2Y2M A;  3B6G C;  3MVD A;  3C1C A;  4G91 C;  2CV5 B;  2NZD A;  3TU4 D;  1KX4 C;  1M1A D;  3REK D;  5AV8 A;  5DNN C;  5B0Z C;  2J8P A;  3AZI C;  5CPK B;  1P3L D;  1P3P C;  1P3O B;  3AZK D;  5KDM B;  1H3O B;  3LZ0 B;  4E44 A;  5CP6 D;  1M18 B;  1JFI B;  5B1L B;  3P5J B;  3B6G D;  5GT0 B;  4J8U C;  3UT9 C;  3AZF C;  5AY8 A;  2BYK A;  4YS3 C;  2BG1 A;  2HIO C;  3AZE C;  4J8W C;  1KX4 A;  1TZY D;  2JE5 A;  4H9S A;  5BO0 A;  3LZ1 B;  5BT1 D;  5B0Z D;  1P3M D;  4Z2M H;  5GT3 C;  3AN2 C;  1EQZ B;  5AV9 C;  3LJA C;  4Z5T A;  5DNN A;  1M19 A;  4JJN A;  3X1S C;  1HQ3 B;  1KX3 C;  5AVC C;  5B0Y A;  4J8U D;  3UT9 D;  3AZF D;  2NQB A;  3REL A;  3EPJ A;  4YS3 D;  4LD9 C;  3AZJ C;  2HIO D;  2PYO B;  3AZG D;  3UTB C;  4J8V B;  3B0D B;  3W97 C;  4J8W A;  5GT3 D;  2ARO B;  3WKJ B;  5B33 C;  5CPJ B;  5B2I A;  3AN2 D;  3AV1 C;  5B31 B;  5AV9 D;  5JRG A;  3LJA D;  5B1M A;  5AVB C;  5B31 G;  4WJ3 C;  3X1S D;  3H0R C;  3REJ D;  3W99 B;  2BYM A;  1KX3 D;  4ZUX C;  5AVC D;  3LEL A;  1P3F B;  3X1U D;  3AZL C;  3MGR B;  5BS7 A;  4LD9 D;  3AZJ D;  3KFU G;  3LZ0 C;  1F66 A;  3UTB D;  3MGS B;  1M18 C;  4ZBJ B;  5B1L C;  4E45 A;  1WWS A;  5GT0 C;  5GXQ C;  3WTP C;  4CSR A;  5B33 D;  1ID3 D;  1A7W A;  3H0M C;  3AV1 D;  2CWE A;  3REI B;  3TU4 B;  1M1A B;  5AVB D;  1AOI C;  2CV5 A;  4HGA B;  4H9R B;  3KXB B;  3REK B;  4ZUX D;  4DRA A;  3AZL D;  1B67 A;  1TAF B;  3LZ1 C;  2Y2H A;  4NE5 A;  4X23 B;  3AFA A;  3W98 C;  1P3L B;  4KUD D;  2JSS A;  3AZK B;  4KHA B;  5CP6 B;  5CPK A;  5B1L D;  1P3O A;  4G92 C;  5KDM A;  1H3O A;  3NQU B;  4M6B A;  5AV6 D;  5GXQ D;  3WTP D;  3LZ0 A;  3B6G B;  1M18 A;  1AOI D;  5B40 A;  3F6T A;  1TZY B;  4J8V C;  3B0D C;  3LZ1 D;  4WU9 A;  5B2J C;  1P3M B;  1WWI A;  3NQJ B;  2Y2Q A;  5CPJ C;  3AZN C;  3W98 D;  5B31 C;  4YM6 A;  3H0L C;  3WA9 A;  2RVQ C;  4WNN B;  1EQZ A;  2FJ7 A;  1P3F C;  1P3A C;  3B0C W;  3UT9 B;  3X1T C;  1HQ3 A;  4YS3 B;  2HIO B;  3R45 B;  2F8N H;  3AZG B;  3UTA D;  2YFV B;  4J8V D;  2IO5 B;  2PYO A;  5B2J D;  5GT3 B;  5CPJ D;  3AZN D;  1P3K D;  3AN2 B;  3REI C;  5AV9 B;  3TU4 C;  1M1A C;  3LJA B;  1P34 B;  5C3I B;  5AV5 C;  3A1I A;  2RVQ D;  2ARO A;  5BNV A;  5B24 D;  1U35 A;  4HGA C;  3KXB C;  3REJ B;  5B31 A;  3B6F A;  3VH5 A;  2VQR A;  1P3F D;  1P3A D;  1KX3 B;  4H9O B;  5CPI A;  5F99 A;  3X1U B;  3AV2 D;  4CAY B;  3X1T D;  3W99 A;  4X23 C;  4LD9 B;  5G49 B;  3AZJ B;  3MGR A;  2Y2N A;  3UTB B;  3O62 C;  4Z2M G;  3MGS A;  5B33 B;  2DF4 C;  1ID3 B;  3AV1 B;  3REI D;  5AV5 D;  5AVB B;  3W96 B;  3KXB D;  1M1A A;  4ZUX B;  1TZY C;  3AZH B;  3AZL B;  5BT1 C;  3EPK A;  4H9R A;  5B32 C;  3REK A;  4X23 D;  1P3M C;  4KUD B;  2F8N D;  3MGQ C;  4WU8 C;  1KX5 D;  1P3L A;  3AZK A;  5AV6 B;  3WTP B;  5GXQ B;  3O62 D;  4KHA A;  5CP6 A;  1P3I D;  4Z66 D;  3B6G A;  3REH B;  1AOI B;  3AZG C;  4H9P B;  1T3U A;  2IO5 C;  5BNX B;  5B32 D;  3C1B C;  3W98 B;  1TZY A;  3MGQ D;  5B0Z A;  1P34 C;  5C3I C;  1P3M A;  3NQJ A;  3AZI A;  4WU8 D;  3REJ C;  1P3P A;  4G92 B;  3X1U C;  4WNN A;  5JA4 A;  4AWL B;  4J8U A;  3UT9 A;  3MNN D;  3AZF A;  3UTA B; 
#chains in the Genus database with same CATH homology
 4YS3 A;  2HIO A;  3AZE A;  3R45 A;  5B2J B;  3AZG A;  3C1B D;  2ZY3 A;  2YFV A;  3AZN B;  1P3K B;  1ID3 C;  4DRB A;  1P34 D;  5B24 B;  5GT3 A;  3W96 C;  1ZLA C;  3AN2 A;  5AV9 A;  5B0Y D;  3LJA A;  1P3A B;  2HUE C;  3AZH C;  3REL D;  5GSU B;  3X1S A;  3REJ A;  3AV2 B;  3X1T B;  4H9N B;  1KX3 A;  3AYW C;  5AVC A;  4KUD C;  3X1U A;  1N1J B;  3AZM D;  4LD9 A;  3EPL A;  1P3B B;  5G49 A;  3AZJ A;  5AV6 C;  3UTB A;  3W97 A;  3KWQ D;  3REH C;  5AV5 B;  5E5A C;  4NE6 A;  2Y2K A;  5B33 A;  1ZLA D;  3W96 D;  3AV1 A;  5AVB A;  3AZH D;  1B6W A;  2LY8 A;  3AYW D;  2G5I C;  4ZUX A;  1P3G D;  3AZL A;  2F8N B;  1F66 D;  2F8N G;  4XUJ B;  1KX5 B;  2ZM5 A;  3X1V C;  3O62 B;  1JFI A;  5B1L A;  1P3I B;  5DNM D;  4Z66 B;  5AV6 A;  3REH D;  4AWL C;  5GT0 A;  5GXQ A;  3WTP A;  5E5A D;  3A6N D;  1BH8 B;  3UTA C;  4QLC C;  1AOI A;  5B32 B;  2UWX A;  5B32 G;  1P3K C;  3LZ1 A;  3MGQ B;  2FFF B;  5BNX A;  5B24 C;  4WU8 B;  3W98 A;  4R8P C;  5CHL B;  3X1V D;  2XD1 A;  2F8N K;  4XZQ C;  5GSU C;  3AV2 C;  2BYK B;  2G5H C;  3MGP C;  3MNN B;  4QLC D;  2Y2O A;  1P3B C;  1PZR A;  3C1B B;  2Y2L A;  3UTA A;  4J8V A;  4Z5T B;  3WA9 D;  5B2J A;  1M19 B;  4JJN B;  5CPJ A;  3AZN A;  1P3K A;  5B0Y B;  4R8P D;  2NQB B;  5B24 A;  3REL B;  4XZQ D;  5GSU D;  1P3F A;  1P3A A;  4KGC C;  3MGP D;  3X1T A;  4H9N A;  3IP4 C;  1S32 C;  4XUJ C;  4J8X D;  3AZM B;  1P3B D;  1KX5 C;  1N1J A;  4DQY B;  1P3I C;  4Z66 C;  3KWQ B;  1ZLA B;  1W2E A;  3REI A;  3TU4 A;  3WAA D;  3LEL B;  5FUG B;  5F99 D;  2HUE B;  5AV5 A;  5AV8 C;  3VH6 T;  3KXB A;  4KGC D;  3AYW B;  3KUY D;  4UPK A;  1P3G B;  3AL0 C;  1TAF A;  1F66 B;  4X23 A;  1S32 D;  4XUJ D;  2F8N A;  3MVD D;  3C1C D;  4CSR B;  5AY8 C;  2NZD D;  2Y2I A;  5DNM B;  3NQU A;  4NFT A;  3O62 A;  5E5A B;  3MNN C;  1P3I A;  3A6N B;  3WKJ A;  4UUZ B;  4Z66 A;  1Q9C A;  2DQN C;  4H9S C;  5AV8 D;  1BH8 A;  3AFA B;  4H9Q B;  2YFW B;  4Z5T C;  5B32 A;  1M19 C;  4JJN C;  2RIQ A;  3MGQ A;  5B0Y C;  2NQB C;  3X1V B;  2JCH A;  3REL C;  3B0B A;  5AY8 D;  4WU8 A;  3V9R B;  1F1E A;  5B40 B;  1KX4 D;  3AZM C;  4QLC B;  4WU9 B;  3MNN A;  5B2I C;  5JRG C;  4Z5T D;  5DNN D;  5B1M C;  4YM6 B;  3KWQ C;  1M19 D;  3AZI D;  3WA9 B;  3C1B A;  2L5A A;  4JJN D;  1P3P D;  2FJ7 B;  3LEL C;  1P34 A;  4R8P B;  2NQB D;  4XZQ B;  5BS7 C;  4H9O A;  1P3G C;  3MGP B;  4CAY A;  1F66 C;  4J8X B;  3AZE D;  4J8W D;  2ZY5 A;  5B2I D;  3EPH A;  1HTA A;  3AZM A;  1BFM A;  5JRG D;  5DNM C;  5B1M D;  5BNV B;  1Z2C B;  3FDD A;  1U35 B;  2CV5 C;  3B6F B;  3A6N C;  1ID3 A;  3LEL D;  3KWQ A;  5CPI B;  3WAA B;  2Y2J A;  5F99 B;  3W96 A;  1ZLA A;  3AFA C;  5FUG A;  4KGC B;  3KUY B;  3AZH A;  1BH9 B;  5CPK C;  1S32 B;  3AYW A;  1P3O C;  4KUD A;  1P3G A;  3MVD B;  3C1C B;  3W97 D;  2NZD B;  2CV5 D;  5B40 C;  5DNM A;  3REH A;  4WU9 C;  5AV8 B;  5E5A A;  3A6N A;  3AFA D;  4H9P A;  4UUZ A;  2F2A C;  4YM6 C;  1KU5 A;  1R4V A;  4EO5 B;  3WA9 C;  5CPK D;  1P3O D;  1EQZ C;  4H9Q A;  3LZ0 D;  2YFW A;  2FJ7 C;  1M18 D;  5AY8 B;  1HQ3 C;  2ZY2 A;  4NE3 A;  3EG5 B;  5GT0 D;  3X1V A;  4G91 B;  4WV4 B;  5B40 D;  1KX4 B;  4WU9 D;  4J8X C;  2XD5 A;  3V9R A;  5BO0 B;  2PYO C;  3VH5 W;  4QLC A;  4YM6 D;  5B0Z B;  5DNN B;  2ARO C;  3A1K A;  3AZI B;  1U35 C;  3WKJ C;  1P3P B;  1EQZ D;  3B6F C;  3WTP E;  2FJ7 D;  3WAA C;  5CPI C;  5F99 C;  3W99 C;  1HQ3 D;  3VH6 W;  5JA4 B;  4WZS B;  4R8P A;  3MGR C;  3KUY C;  4J8U B;  3AZF B;  4XZQ A;  5GSU A;  2ZY4 A;  3AV2 A;  2PYO D;  2W8S A;  3VH5 T;  3KSY A;  4J8W B;  3MGP A;  3MVD C;  3AZE B;  3C1C C;  3MGS C;  4ZBJ C;  5B2I B;  4J8X A;  1P3B A;  2NZD C;  5JRG B;  5B1M B;  2ARO D;  2Y2G A;  1U35 D;  3WKJ D;  5B31 D;  3B6F D;  2BYM B;  5CPI D;  3W99 D;  2Y2P A;  3X1S B;  3REK C;  3B0C T;  5AVC B;  3WAA A;  3MGR D;  4EO5 C;  1P3L C;  4KGC A;  3KUY A;  3AZK C;  1BH9 A;  5CP6 C;  3MGS D;  1S32 A;  4XUJ A;  1ULY A;  1KX5 A;  3W97 B;  3VH6 A;  2Y2M A;  3B6G C;  3MVD A;  3C1C A;  4G91 C;  2CV5 B;  2NZD A;  3TU4 D;  1KX4 C;  1M1A D;  3REK D;  5AV8 A;  5DNN C;  5B0Z C;  2J8P A;  3AZI C;  5CPK B;  1P3L D;  1P3P C;  1P3O B;  3AZK D;  5KDM B;  1H3O B;  3LZ0 B;  4E44 A;  5CP6 D;  1M18 B;  1JFI B;  5B1L B;  3P5J B;  3B6G D;  5GT0 B;  4J8U C;  3UT9 C;  3AZF C;  5AY8 A;  2BYK A;  4YS3 C;  2BG1 A;  2HIO C;  3AZE C;  4J8W C;  1KX4 A;  1TZY D;  2JE5 A;  4H9S A;  5BO0 A;  3LZ1 B;  5BT1 D;  5B0Z D;  1P3M D;  4Z2M H;  5GT3 C;  3AN2 C;  1EQZ B;  5AV9 C;  3LJA C;  4Z5T A;  5DNN A;  1M19 A;  4JJN A;  3X1S C;  1HQ3 B;  1KX3 C;  5AVC C;  5B0Y A;  4J8U D;  3UT9 D;  3AZF D;  2NQB A;  3REL A;  3EPJ A;  4YS3 D;  4LD9 C;  3AZJ C;  2HIO D;  2PYO B;  3AZG D;  3UTB C;  4J8V B;  3B0D B;  3W97 C;  4J8W A;  5GT3 D;  2ARO B;  3WKJ B;  5B33 C;  5CPJ B;  5B2I A;  3AN2 D;  3AV1 C;  5B31 B;  5AV9 D;  5JRG A;  3LJA D;  5B1M A;  5AVB C;  5B31 G;  4WJ3 C;  3X1S D;  3H0R C;  3REJ D;  3W99 B;  2BYM A;  1KX3 D;  4ZUX C;  5AVC D;  3LEL A;  1P3F B;  3X1U D;  3AZL C;  3MGR B;  5BS7 A;  4LD9 D;  3AZJ D;  3KFU G;  3LZ0 C;  1F66 A;  3UTB D;  3MGS B;  1M18 C;  4ZBJ B;  5B1L C;  4E45 A;  1WWS A;  5GT0 C;  5GXQ C;  3WTP C;  4CSR A;  5B33 D;  1ID3 D;  1A7W A;  3H0M C;  3AV1 D;  2CWE A;  3REI B;  3TU4 B;  1M1A B;  5AVB D;  1AOI C;  2CV5 A;  4HGA B;  4H9R B;  3KXB B;  3REK B;  4ZUX D;  4DRA A;  3AZL D;  1B67 A;  1TAF B;  3LZ1 C;  2Y2H A;  4NE5 A;  4X23 B;  3AFA A;  3W98 C;  1P3L B;  4KUD D;  2JSS A;  3AZK B;  4KHA B;  5CP6 B;  5CPK A;  5B1L D;  1P3O A;  4G92 C;  5KDM A;  1H3O A;  3NQU B;  4M6B A;  5AV6 D;  5GXQ D;  3WTP D;  3LZ0 A;  3B6G B;  1M18 A;  1AOI D;  5B40 A;  3F6T A;  1TZY B;  4J8V C;  3B0D C;  3LZ1 D;  4WU9 A;  5B2J C;  1P3M B;  1WWI A;  3NQJ B;  2Y2Q A;  5CPJ C;  3AZN C;  3W98 D;  5B31 C;  4YM6 A;  3H0L C;  3WA9 A;  2RVQ C;  4WNN B;  1EQZ A;  2FJ7 A;  1P3F C;  1P3A C;  3B0C W;  3UT9 B;  3X1T C;  1HQ3 A;  4YS3 B;  2HIO B;  3R45 B;  2F8N H;  3AZG B;  3UTA D;  2YFV B;  4J8V D;  2IO5 B;  2PYO A;  5B2J D;  5GT3 B;  5CPJ D;  3AZN D;  1P3K D;  3AN2 B;  3REI C;  5AV9 B;  3TU4 C;  1M1A C;  3LJA B;  1P34 B;  5C3I B;  5AV5 C;  3A1I A;  2RVQ D;  2ARO A;  5BNV A;  5B24 D;  1U35 A;  4HGA C;  3KXB C;  3REJ B;  5B31 A;  3B6F A;  3VH5 A;  2VQR A;  1P3F D;  1P3A D;  1KX3 B;  4H9O B;  5CPI A;  5F99 A;  3X1U B;  3AV2 D;  4CAY B;  3X1T D;  3W99 A;  4X23 C;  4LD9 B;  5G49 B;  3AZJ B;  3MGR A;  2Y2N A;  3UTB B;  3O62 C;  4Z2M G;  3MGS A;  5B33 B;  2DF4 C;  1ID3 B;  3AV1 B;  3REI D;  5AV5 D;  5AVB B;  3W96 B;  3KXB D;  1M1A A;  4ZUX B;  1TZY C;  3AZH B;  3AZL B;  5BT1 C;  3EPK A;  4H9R A;  5B32 C;  3REK A;  4X23 D;  1P3M C;  4KUD B;  2F8N D;  3MGQ C;  4WU8 C;  1KX5 D;  1P3L A;  3AZK A;  5AV6 B;  3WTP B;  5GXQ B;  3O62 D;  4KHA A;  5CP6 A;  1P3I D;  4Z66 D;  3B6G A;  3REH B;  1AOI B;  3AZG C;  4H9P B;  1T3U A;  2IO5 C;  5BNX B;  5B32 D;  3C1B C;  3W98 B;  1TZY A;  3MGQ D;  5B0Z A;  1P34 C;  5C3I C;  1P3M A;  3NQJ A;  3AZI A;  4WU8 D;  3REJ C;  1P3P A;  4G92 B;  3X1U C;  4WNN A;  5JA4 A;  4AWL B;  4J8U A;  3UT9 A;  3MNN D;  3AZF A;  3UTA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...