1U35A

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA
publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35A00
5B0YB 3WTPB 3V9RB 5B2JA 5DNND 1AOIA 3C1CD 2AROC 5BNVA 5AVBA 4J8VB 3O62B 2F8NH 3AZEB 5B31C 4HGAC 5CPJD 3LJAA 5B2IB 5BS7C 3KWQB 1U35C 3KXBA 3AZID 2YFVA 3UTBA 4KUDB 4Z2MH 1ZLAC 4ZBJC 5JRGC 5DNMA 3REJC 4G92C 3AZHC 2AROD 3AZKA 1P3FC 3X1UB 3TU4C 3W98B 2HUEC 5B31D 3LELB 1WWIA 3MGPA 3REKB 3UT9A 5B33C 4H9QA 4KGCD 1U35D 4HGAB 1EQZC 3AN2C 5B1MA 3REJD 3WAAA 1ZLAB 2NQBB 5JRGB 4WNNA 3REIC 3AZHB 3AV2A 5FUGA 1H3OB 5B24C 1TAFB 3B0DC 1P3AC 3X1TA 1M18D 5B33D 3MGRC 5CP6D 1TZYC 3AYWB 2RVQC 5BO0A 5GT0C 1KX3B 1KX4B 1EQZB 4CAYA 3AN2B 1F1EA 3MGSA 3W97C 3AZLB 5CPIA 1P3LC 1B67A 3LZ1D 5AV9A 3C1BC 3AZNB 3WKJC 3W99B 3NQUB 3MGRD 1TZYD 5AV5A 5E5AC 4WU8B 1P3AB 1F66B 5GT0D 3WTPE 5B1LA 3MVDC 3B6GC 2JSSA 3W96B 5AVBD 3MGQC 3W97D 1P3MC 5JA4B 1HQ3C 2PYOC 3AZGC 3O62A 3KUYC 4NFTA 2CV5D 3LJAD 3C1CA 4Z66C 1P3OC 3WKJD 5B32B 1BH9A 3KXBD 3C1BB 5BNXB 3B6FC 3MVDD 3B6GD 5CPJA 4XUJA 5E5AB 1P34C 4R8PB 4Z5TB 1HQ3D 5B40C 5GSUD 4G91C 3X1VC 3X1SB 3MGQB 4WU9B 1P3KC 4LD9C 1BH8A 1P3MB 5GT3C 1KX5D 2PYOB 2AROA 5AVCB 4EO5C 3KUYB 3AFAD 3REHB 4Z66B 5B31A 2BYMA 1S32C 3B6FD 3UTAC 1P34D 5BS7A 1ULYA 4J8XB 1M19C 1P3GC 5CHLB 1U35A 1BFMA 5B40D 1P3KD 4LD9D 3REJA 3WA9C 3R45B 5KDMA 2YFWB 4DRAA 3X1TD 1P3FA 3X1VB 3TU4A 5GT3B 5B0YC 4EO5B 3WTPC 2HIOD 1M19D 3KSYA 5B33A 1S32B 5CP6A 1P3GD 3UTAB 3MGSD 1P3PC 5CPID 3NQJB 4J8VC 3AZJD 5B31G 4JJNC 4H9SC 5AY8C 5B0ZD 4YM6B 2F8NB 4J8UB 3REIA 3WA9B 3VH6T 5B2IC 4KHAA 5AV8C 3RELB 1ID3D 5B0YD 1JFIA 5B24A 3KWQC 5G49B 3B0CW 3WTPD 3MGRA 1TZYA 3VH5T 1M1AB 5GT0A 3O62D 5CPKB 4X23C 3AZED 3X1UC 1P3PB 3W98C 3LELC 2BYKB 3W97A 3REKC 5B2ID 1P3LA 4JJNB 3KWQD 5AY8B 3C1BA 4KUDD 2FJ7C 2CV5A 3WKJA 4XUJD 5AV8B 3AV1C 2NQBC 3MVDA 3B6GA 4H9RA 3X1UD 3W98D 2NZDC 3LELD 4CSRB 3REKD 4X23B 1HQ3A 5GSUA 3AZGA 3AYWC 1P3OA 1KX5A 1B6WA 5DNNB 1KX3C 1KX4C 3AFAA 2FJ7B 3B6FA 5F99B 1ZLAD 2NQBD 5JRGD 4H9OA 3AZHD 3AV1B 3AZLC 5C3IC 1P34A 4H9PA 4XZQC 1P3FD 3AZNC 3W99C 5B40A 3TU4D 3X1VA 1P3KA 4LD9A 2NZDB 1F66C 4WU8C 3AZFC 4ZUXC 4YS3C 1KU5A 3W96C 1KX4D 1EQZD 3AN2D 2HIOA 1M19A 1P3GA 3NQJA 2L5AA 3AZND 3REID 3W99D 5C3IB 4KGCB 4XZQB 5B32C 5B24D 3AZJA 1F66D 4WU8D 1P3AD 5GXQB 5B0ZA 4QLCB 3W96D 5AV6B 2RVQD 3VH5W 1P3BB 5B0YA 4R8PC 1ID3A 3AZFB 3WTPA 3V9RA 4ZUXB 4YS3B 4Z5TC 1N1JB 4E44A 3A6NB 3X1SC 4WU9C 1P3IB 1P3PA 1P3LD 5AVCC 4J8VA 5B32D 3C1BD 4M6BA 4JJNA 3REHC 3AZEA 4H9SA 4NE6A 5AY8A 5B2IA 5E5AD 4J8XC 4R8PD 3KWQA 4KUDA 4Z5TD 4J8WB 3LZ1B 4UUZB 3X1SD 3LZ0B 3MGQD 1P3MD 2PYOD 3AZGD 4CSRA 5B2JB 3KUYD 3REHD 3X1UA 1P3OD 3W98A 4Z66D 3LELA 1AOIB 1R4VA 3REKA 4AWLB 5BNVB 5AVBB 2FJ7A 4H9NB 1ZLAA 5B1MC 2NQBA 4YM6C 5JRGA 3X1VD 3KXBB 2YFVB 4J8UC 3UTBB 3AZHA 3RELC 5GT3D 1H3OA 4NE3A 5DNMB 1TAFA 4WV4B 5BT1C 1S32D 3AZKB 3UTAD 3AYWA 1M1AC 1KX3A 3B0BA 3MGPB 3UT9B 1KX4A 5CPKC 1EQZA 4H9QB 4YM6D 3AN2A 2F8ND 4J8UD 3WA9D 3RELD 3MNNC 3AZLA 5B1MB 3AZNA 1Q9CA 5BT1D 3W99A 3NQUA 3WAAB 2IO5B 3AZMC 4WNNB 3AV2B 4WU8A 1P3AA 1F66A 5FUGB 4ZUXA 3W96A 5CPKD 1P3PD 3X1TB 4J8VD 5JA4A 4JJND 5BO0B 5AY8D 5AV8D 3MNNB 5DNNC 4CAYB 5B32A 3MGSB 1A7WA 5BNXA 5F99C 1HTAA 5AV9B 3AZMB 5E5AA 4R8PA 5AV5B 5CPJC 4Z5TA 4X23D 5B1LB 3X1SA 3MGQA 3AZIC 4WU9A 1P3MA 2F8NK 4E45A 2PYOA 5AVCA 3KUYA 3REHA 2FJ7D 4Z66A 5F99D 4NE5A 3C1CB 3AV1D 4J8XA 1BH9B 4H9NA 5B32G 4KGCC 2NZDD 5CPJB 3R45A 4XUJB 2YFWA 5GXQC 3AZIB 3AYWD 4QLCC 5AV6C 5GT3A 1P3BC 3VH6A 1KX3D 1BH8B 3A6NC 2AROB 1S32A 3UTAA 3VH5A 1P3IC 5B31B 2BYMB 3AZLD 5CP6C 1M18C 4XZQD 5GXQD 4YM6A 1U35B 2F8NA 3VH6W 4J8UA 3WA9A 4QLCD 5AV6D 3RELA 1P3BD 4ZBJB 3AZFD 5G49A 3REJB 4G92B 5KDMB 4ZUXD 4YS3D 2CWEA 4J8WC 3A6ND 3LZ1C 1P3FB 3LZ0C 1P3ID 3TU4B 2HUEB 1M1AA 5B2JC 5CPKA 1WWSA 5B33B 4WZSB 5CP6B 1M18B 1AOIC 2BYKA 3MNNA 4AWLC 5AVBC 4J8WD 5AV8A 3AZMA 3LZ0D 3REIB 2CV5C 3LJAC 4KHAB 1JFIB 2F8NG 5B24B 5B2JD 3B0CT 4WU9D 3KXBC 3B0DB 3UTBC 3MGRB 5AVCD 1TZYB 1AOID 5DNMC 4X23A 5GT0B 3AZKC 4Z2MG 5GSUC 5DNNA 4J8XD 4DRBA 3W97B 3MGPC 3UT9C 1P3LB 1KX5C 5F99A 3AFAC 3UTBD 3LJAB 3AV1A 2CV5B 3WKJB 5DNMD 3WAAC 3AZKD 2NZDA 3MVDB 3AZIA 2IO5C 3B6GB 4H9RB 3AV2C 3MGPD 3UT9D 1HQ3B 5GSUB 3X1TC 3AZGB 1P3OB 1KX5B 5B1MD 2HIOC 2LY8A 3AFAB 3WAAD 3B6FB 4KGCA 4XZQA 3MGSC 4H9OB 3AV2D 1P34B 5CPIC 5GXQA 4H9PB 3AZJC 5AV9C 4QLCA 5AV6A 5B40B 1P3BA 1M1AD 5B0ZC 3AZFA 4G91B 5AV5C 1P3KB 4LD9B 4YS3A 1ID3C 1N1JA 3A6NA 5B1LC 1P3IA 1M18A 3MNND 2HIOB 1M19B 1P3GB 5AV9D 3O62C 3AZMD 3AZEC 3C1CC 5CPIB 5AV5D 3AZJB 4J8WA 3LZ1A 4UUZA 5B0ZB 5B1LD 4KUDC 3LZ0A 4XUJC 1ID3B
chains in the Genus database with same CATH superfamily
5B0YB 3WTPB 3V9RB 5B2JA 5DNND 1AOIA 3C1CD 2AROC 5BNVA 5AVBA 4J8VB 3O62B 2F8NH 4DQYB 3AZEB 5B31C 4HGAC 2Y2LA 5CPJD 3LJAA 5B2IB 5BS7C 3KWQB 3A1KA 1U35C 3KXBA 3AZID 2XD5A 2YFVA 3UTBA 4KUDB 4Z2MH 1ZLAC 4ZBJC 5JRGC 5DNMA 3REJC 4G92C 3AZHC 2AROD 3AZKA 1P3FC 3X1UB 3TU4C 3W98B 2HUEC 5B31D 3LELB 1WWIA 3MGPA 3REKB 3UT9A 5B33C 4H9QA 4KGCD 1U35D 4HGAB 3AL0C 1EQZC 3AN2C 5B1MA 3REJD 3WAAA 2UWXA 1ZLAB 2NQBB 5JRGB 4WNNA 3REIC 3AZHB 3AV2A 5FUGA 1H3OB 2ZY3A 5B24C 1TAFB 3B0DC 1P3AC 3X1TA 1M18D 5B33D 3MGRC 5CP6D 1TZYC 3AYWB 2RVQC 5BO0A 5GT0C 1KX3B 1KX4B 1EQZB 4CAYA 3AN2B 1F1EA 3MGSA 3IP4C 3W97C 1PZRA 3AZLB 5CPIA 1P3LC 1B67A 3LZ1D 5AV9A 3C1BC 3AZNB 3WKJC 3W99B 3NQUB 3MGRD 1TZYD 5AV5A 5E5AC 4WU8B 1P3AB 1F66B 5GT0D 3WTPE 5B1LA 3MVDC 3B6GC 2W8SA 2VQRA 2JSSA 3W96B 5AVBD 3MGQC 3W97D 1P3MC 5JA4B 1HQ3C 2PYOC 3AZGC 3O62A 3KUYC 4NFTA 2CV5D 3LJAD 3C1CA 4Z66C 1P3OC 3WKJD 5B32B 1BH9A 3KXBD 3C1BB 5BNXB 3B6FC 1T3UA 3MVDD 3B6GD 5CPJA 2Y2KA 4XUJA 5E5AB 1P34C 4R8PB 4Z5TB 1HQ3D 2JE5A 5B40C 5GSUD 4G91C 3X1VC 3X1SB 3MGQB 4WU9B 1P3KC 4LD9C 1BH8A 1P3MB 5GT3C 1KX5D 2PYOB 2AROA 5AVCB 4EO5C 3KUYB 3AFAD 3REHB 4Z66B 5B31A 2BYMA 1S32C 3B6FD 3UTAC 1P34D 5BS7A 1ULYA 4J8XB 1M19C 3KFUG 1P3GC 5CHLB 1U35A 3EPHA 1BFMA 5B40D 2ZY5A 1P3KD 4LD9D 3REJA 3WA9C 3R45B 5KDMA 2YFWB 4DRAA 3X1TD 1P3FA 3X1VB 3TU4A 5GT3B 5B0YC 4EO5B 3WTPC 2HIOD 1M19D 3KSYA 5B33A 1S32B 5CP6A 1P3GD 3UTAB 3MGSD 1P3PC 3H0MC 5CPID 3NQJB 4J8VC 3AZJD 5B31G 4JJNC 4H9SC 5AY8C 5B0ZD 4YM6B 2F8NB 4J8UB 3REIA 3WA9B 3VH6T 5B2IC 4KHAA 5AV8C 3RELB 1ID3D 5B0YD 1JFIA 5B24A 3KWQC 5G49B 3B0CW 3WTPD 2RIQA 3MGRA 1TZYA 3VH5T 1M1AB 5GT0A 3O62D 5CPKB 4X23C 3AZED 3X1UC 1P3PB 3W98C 3LELC 2BYKB 3W97A 3REKC 5B2ID 1P3LA 4JJNB 3KWQD 5AY8B 3C1BA 4KUDD 2FJ7C 2CV5A 3WKJA 4XUJD 5AV8B 3AV1C 2NQBC 2ZM5A 3MVDA 3B6GA 4H9RA 3X1UD 3W98D 2Y2OA 2NZDC 3LELD 4CSRB 3REKD 4X23B 1HQ3A 5GSUA 3AZGA 3AYWC 2G5HC 1P3OA 1KX5A 1B6WA 5DNNB 1KX3C 4UPKA 1KX4C 3AFAA 2FJ7B 3B6FA 5F99B 1ZLAD 2NQBD 5JRGD 4H9OA 3AZHD 3AV1B 3AZLC 5C3IC 1P34A 4H9PA 4XZQC 1P3FD 3AZNC 3W99C 5B40A 3TU4D 3X1VA 1P3KA 4LD9A 2NZDB 1F66C 4WU8C 3AZFC 4ZUXC 4YS3C 1KU5A 3W96C 1KX4D 1EQZD 3AN2D 2HIOA 1M19A 1P3GA 3NQJA 2L5AA 3AZND 3REID 3FDDA 3W99D 5C3IB 4KGCB 4XZQB 5B32C 5B24D 3AZJA 1F66D 4WU8D 1P3AD 5GXQB 5B0ZA 4QLCB 3W96D 5AV6B 2RVQD 3VH5W 1P3BB 5B0YA 4R8PC 1ID3A 3AZFB 3WTPA 3V9RA 4ZUXB 4YS3B 4Z5TC 3EG5B 1N1JB 4E44A 3A6NB 3X1SC 4WU9C 1P3IB 1P3PA 1P3LD 5AVCC 4J8VA 5B32D 3C1BD 4M6BA 4JJNA 3REHC 3AZEA 4H9SA 4NE6A 5AY8A 5B2IA 5E5AD 4J8XC 4R8PD 3KWQA 2ZY2A 4KUDA 4Z5TD 4J8WB 3LZ1B 4UUZB 3X1SD 1Z2CB 3LZ0B 2Y2IA 3MGQD 1P3MD 2PYOD 3AZGD 4CSRA 5B2JB 3KUYD 3REHD 3X1UA 1P3OD 3W98A 4Z66D 3LELA 1AOIB 1R4VA 3REKA 4AWLB 5BNVB 5AVBB 2FJ7A 2Y2JA 4H9NB 1ZLAA 5B1MC 2NQBA 4YM6C 5JRGA 3X1VD 3KXBB 3EPKA 2YFVB 4J8UC 3UTBB 3AZHA 3RELC 5GT3D 1H3OA 4NE3A 5DNMB 1TAFA 4WV4B 5BT1C 1S32D 3AZKB 3UTAD 3AYWA 1M1AC 1KX3A 3B0BA 3MGPB 3UT9B 1KX4A 5CPKC 1EQZA 2BG1A 2Y2PA 4H9QB 4YM6D 3AN2A 2F8ND 4J8UD 3WA9D 3RELD 3MNNC 3AZLA 5B1MB 3AZNA 1Q9CA 5BT1D 3W99A 3NQUA 3WAAB 2IO5B 2DQNC 3AZMC 4WNNB 3AV2B 4WU8A 1P3AA 1F66A 5FUGB 4ZUXA 3W96A 5CPKD 1P3PD 3X1TB 4J8VD 5JA4A 4JJND 5BO0B 5AY8D 5AV8D 3MNNB 5DNNC 4CAYB 5B32A 3MGSB 1A7WA 5BNXA 5F99C 1HTAA 5AV9B 3AZMB 5E5AA 4R8PA 5AV5B 5CPJC 4Z5TA 4X23D 2G5IC 5B1LB 3X1SA 3MGQA 3AZIC 4WU9A 3F6TA 1P3MA 2F8NK 4E45A 2PYOA 5AVCA 3P5JB 3KUYA 3REHA 2FJ7D 4Z66A 5F99D 4NE5A 3C1CB 3AV1D 4J8XA 1BH9B 4H9NA 5B32G 3EPLA 4KGCC 2NZDD 5CPJB 3R45A 4XUJB 2YFWA 5GXQC 3AZIB 3AYWD 4QLCC 5AV6C 5GT3A 1P3BC 3VH6A 1KX3D 1BH8B 3A6NC 2AROB 1S32A 3UTAA 2Y2HA 3VH5A 1P3IC 5B31B 2BYMB 3AZLD 5CP6C 1M18C 4XZQD 5GXQD 4YM6A 1U35B 2F8NA 3VH6W 4J8UA 3WA9A 2Y2NA 4QLCD 5AV6D 3RELA 1P3BD 4ZBJB 3AZFD 5G49A 3REJB 4G92B 5KDMB 4ZUXD 4YS3D 2CWEA 4J8WC 3A6ND 3LZ1C 1P3FB 3LZ0C 1P3ID 3TU4B 2HUEB 1M1AA 2JCHA 5B2JC 5CPKA 1WWSA 5B33B 4WZSB 5CP6B 1M18B 1AOIC 2BYKA 3MNNA 4AWLC 5AVBC 2F2AC 4J8WD 5AV8A 3AZMA 3LZ0D 3REIB 2CV5C 3LJAC 4KHAB 1JFIB 2F8NG 5B24B 3EPJA 5B2JD 3B0CT 4WU9D 3KXBC 3B0DB 3UTBC 3MGRB 5AVCD 1TZYB 1AOID 5DNMC 4X23A 5GT0B 3AZKC 2DF4C 4Z2MG 4WJ3C 5GSUC 5DNNA 4J8XD 4DRBA 3W97B 3MGPC 3UT9C 1P3LB 1KX5C 5F99A 3AFAC 3UTBD 3LJAB 3AV1A 2CV5B 3WKJB 5DNMD 1W2EA 3WAAC 3AZKD 2NZDA 2Y2GA 3MVDB 2IO5C 3H0RC 3AZIA 3B6GB 4H9RB 3AV2C 2FFFB 2J8PA 3MGPD 3UT9D 2XD1A 1HQ3B 5GSUB 3X1TC 3AZGB 1P3OB 1KX5B 5B1MD 2HIOC 2LY8A 3AFAB 3WAAD 3B6FB 4KGCA 4XZQA 3MGSC 3H0LC 4H9OB 3AV2D 1P34B 5CPIC 5GXQA 4H9PB 3AZJC 5AV9C 4QLCA 5AV6A 5B40B 1P3BA 1M1AD 5B0ZC 3AZFA 4G91B 5AV5C 1P3KB 4LD9B 4YS3A 1ID3C 1N1JA 3A6NA 2Y2MA 5B1LC 1P3IA 2ZY4A 1M18A 3MNND 3A1IA 2HIOB 1M19B 1P3GB 5AV9D 3O62C 3AZMD 3AZEC 3C1CC 5CPIB 5AV5D 3AZJB 4J8WA 3LZ1A 4UUZA 5B0ZB 5B1LD 4KUDC 3LZ0A 2Y2QA 4XUJC 1ID3B
chains in the Genus database with same CATH topology
5B0YB 3WTPB 3V9RB 5B2JA 5DNND 1AOIA 3C1CD 2AROC 5BNVA 5AVBA 4J8VB 3O62B 2F8NH 4DQYB 3AZEB 5B31C 4HGAC 2Y2LA 5CPJD 3LJAA 5B2IB 5BS7C 3KWQB 3A1KA 1U35C 3KXBA 3AZID 2XD5A 2YFVA 3UTBA 4KUDB 4Z2MH 1ZLAC 4ZBJC 5JRGC 5DNMA 3REJC 4G92C 3AZHC 2AROD 3AZKA 1P3FC 3X1UB 3TU4C 3W98B 2HUEC 5B31D 3LELB 1WWIA 3MGPA 3REKB 3UT9A 5B33C 4H9QA 4KGCD 1U35D 4HGAB 3AL0C 1EQZC 3AN2C 5B1MA 3REJD 3WAAA 2UWXA 1ZLAB 2NQBB 5JRGB 4WNNA 3REIC 3AZHB 3AV2A 5FUGA 1H3OB 2ZY3A 5B24C 1TAFB 3B0DC 1P3AC 3X1TA 1M18D 5B33D 3MGRC 5CP6D 1TZYC 3AYWB 2RVQC 5BO0A 5GT0C 1KX3B 1KX4B 1EQZB 4CAYA 3AN2B 1F1EA 3MGSA 3IP4C 3W97C 1PZRA 3AZLB 5CPIA 1P3LC 1B67A 3LZ1D 5AV9A 3C1BC 3AZNB 3WKJC 3W99B 3NQUB 3MGRD 1TZYD 5AV5A 5E5AC 4WU8B 1P3AB 1F66B 5GT0D 3WTPE 5B1LA 3MVDC 3B6GC 2W8SA 2VQRA 2JSSA 3W96B 5AVBD 3MGQC 3W97D 1P3MC 5JA4B 1HQ3C 2PYOC 3AZGC 3O62A 3KUYC 4NFTA 2CV5D 3LJAD 3C1CA 4Z66C 1P3OC 3WKJD 5B32B 1BH9A 3KXBD 3C1BB 5BNXB 3B6FC 1T3UA 3MVDD 3B6GD 5CPJA 2Y2KA 4XUJA 5E5AB 1P34C 4R8PB 4Z5TB 1HQ3D 2JE5A 5B40C 5GSUD 4G91C 3X1VC 3X1SB 3MGQB 4WU9B 1P3KC 4LD9C 1BH8A 1P3MB 5GT3C 1KX5D 2PYOB 2AROA 5AVCB 4EO5C 3KUYB 3AFAD 3REHB 4Z66B 5B31A 2BYMA 1S32C 3B6FD 3UTAC 1P34D 5BS7A 1ULYA 4J8XB 1M19C 3KFUG 1P3GC 5CHLB 1U35A 3EPHA 1BFMA 5B40D 2ZY5A 1P3KD 4LD9D 3REJA 3WA9C 3R45B 5KDMA 2YFWB 4DRAA 3X1TD 1P3FA 3X1VB 3TU4A 5GT3B 5B0YC 4EO5B 3WTPC 2HIOD 1M19D 3KSYA 5B33A 1S32B 5CP6A 1P3GD 3UTAB 3MGSD 1P3PC 3H0MC 5CPID 3NQJB 4J8VC 3AZJD 5B31G 4JJNC 4H9SC 5AY8C 5B0ZD 4YM6B 2F8NB 4J8UB 3REIA 3WA9B 3VH6T 5B2IC 4KHAA 5AV8C 3RELB 1ID3D 5B0YD 1JFIA 5B24A 3KWQC 5G49B 3B0CW 3WTPD 2RIQA 3MGRA 1TZYA 3VH5T 1M1AB 5GT0A 3O62D 5CPKB 4X23C 3AZED 3X1UC 1P3PB 3W98C 3LELC 2BYKB 3W97A 3REKC 5B2ID 1P3LA 4JJNB 3KWQD 5AY8B 3C1BA 4KUDD 2FJ7C 2CV5A 3WKJA 4XUJD 5AV8B 3AV1C 2NQBC 2ZM5A 3MVDA 3B6GA 4H9RA 3X1UD 3W98D 2Y2OA 2NZDC 3LELD 4CSRB 3REKD 4X23B 1HQ3A 5GSUA 3AZGA 3AYWC 2G5HC 1P3OA 1KX5A 1B6WA 5DNNB 1KX3C 4UPKA 1KX4C 3AFAA 2FJ7B 3B6FA 5F99B 1ZLAD 2NQBD 5JRGD 4H9OA 3AZHD 3AV1B 3AZLC 5C3IC 1P34A 4H9PA 4XZQC 1P3FD 3AZNC 3W99C 5B40A 3TU4D 3X1VA 1P3KA 4LD9A 2NZDB 1F66C 4WU8C 3AZFC 4ZUXC 4YS3C 1KU5A 3W96C 1KX4D 1EQZD 3AN2D 2HIOA 1M19A 1P3GA 3NQJA 2L5AA 3AZND 3REID 3FDDA 3W99D 5C3IB 4KGCB 4XZQB 5B32C 5B24D 3AZJA 1F66D 4WU8D 1P3AD 5GXQB 5B0ZA 4QLCB 3W96D 5AV6B 2RVQD 3VH5W 1P3BB 5B0YA 4R8PC 1ID3A 3AZFB 3WTPA 3V9RA 4ZUXB 4YS3B 4Z5TC 3EG5B 1N1JB 4E44A 3A6NB 3X1SC 4WU9C 1P3IB 1P3PA 1P3LD 5AVCC 4J8VA 5B32D 3C1BD 4M6BA 4JJNA 3REHC 3AZEA 4H9SA 4NE6A 5AY8A 5B2IA 5E5AD 4J8XC 4R8PD 3KWQA 2ZY2A 4KUDA 4Z5TD 4J8WB 3LZ1B 4UUZB 3X1SD 1Z2CB 3LZ0B 2Y2IA 3MGQD 1P3MD 2PYOD 3AZGD 4CSRA 5B2JB 3KUYD 3REHD 3X1UA 1P3OD 3W98A 4Z66D 3LELA 1AOIB 1R4VA 3REKA 4AWLB 5BNVB 5AVBB 2FJ7A 2Y2JA 4H9NB 1ZLAA 5B1MC 2NQBA 4YM6C 5JRGA 3X1VD 3KXBB 3EPKA 2YFVB 4J8UC 3UTBB 3AZHA 3RELC 5GT3D 1H3OA 4NE3A 5DNMB 1TAFA 4WV4B 5BT1C 1S32D 3AZKB 3UTAD 3AYWA 1M1AC 1KX3A 3B0BA 3MGPB 3UT9B 1KX4A 5CPKC 1EQZA 2BG1A 2Y2PA 4H9QB 4YM6D 3AN2A 2F8ND 4J8UD 3WA9D 3RELD 3MNNC 3AZLA 5B1MB 3AZNA 1Q9CA 5BT1D 3W99A 3NQUA 3WAAB 2IO5B 2DQNC 3AZMC 4WNNB 3AV2B 4WU8A 1P3AA 1F66A 5FUGB 4ZUXA 3W96A 5CPKD 1P3PD 3X1TB 4J8VD 5JA4A 4JJND 5BO0B 5AY8D 5AV8D 3MNNB 5DNNC 4CAYB 5B32A 3MGSB 1A7WA 5BNXA 5F99C 1HTAA 5AV9B 3AZMB 5E5AA 4R8PA 5AV5B 5CPJC 4Z5TA 4X23D 2G5IC 5B1LB 3X1SA 3MGQA 3AZIC 4WU9A 3F6TA 1P3MA 2F8NK 4E45A 2PYOA 5AVCA 3P5JB 3KUYA 3REHA 2FJ7D 4Z66A 5F99D 4NE5A 3C1CB 3AV1D 4J8XA 1BH9B 4H9NA 5B32G 3EPLA 4KGCC 2NZDD 5CPJB 3R45A 4XUJB 2YFWA 5GXQC 3AZIB 3AYWD 4QLCC 5AV6C 5GT3A 1P3BC 3VH6A 1KX3D 1BH8B 3A6NC 2AROB 1S32A 3UTAA 2Y2HA 3VH5A 1P3IC 5B31B 2BYMB 3AZLD 5CP6C 1M18C 4XZQD 5GXQD 4YM6A 1U35B 2F8NA 3VH6W 4J8UA 3WA9A 2Y2NA 4QLCD 5AV6D 3RELA 1P3BD 4ZBJB 3AZFD 5G49A 3REJB 4G92B 5KDMB 4ZUXD 4YS3D 2CWEA 4J8WC 3A6ND 3LZ1C 1P3FB 3LZ0C 1P3ID 3TU4B 2HUEB 1M1AA 2JCHA 5B2JC 5CPKA 1WWSA 5B33B 4WZSB 5CP6B 1M18B 1AOIC 2BYKA 3MNNA 4AWLC 5AVBC 2F2AC 4J8WD 5AV8A 3AZMA 3LZ0D 3REIB 2CV5C 3LJAC 4KHAB 1JFIB 2F8NG 5B24B 3EPJA 5B2JD 3B0CT 4WU9D 3KXBC 3B0DB 3UTBC 3MGRB 5AVCD 1TZYB 1AOID 5DNMC 4X23A 5GT0B 3AZKC 2DF4C 4Z2MG 4WJ3C 5GSUC 5DNNA 4J8XD 4DRBA 3W97B 3MGPC 3UT9C 1P3LB 1KX5C 5F99A 3AFAC 3UTBD 3LJAB 3AV1A 2CV5B 3WKJB 5DNMD 1W2EA 3WAAC 3AZKD 2NZDA 2Y2GA 3MVDB 2IO5C 3H0RC 3AZIA 3B6GB 4H9RB 3AV2C 2FFFB 2J8PA 3MGPD 3UT9D 2XD1A 1HQ3B 5GSUB 3X1TC 3AZGB 1P3OB 1KX5B 5B1MD 2HIOC 2LY8A 3AFAB 3WAAD 3B6FB 4KGCA 4XZQA 3MGSC 3H0LC 4H9OB 3AV2D 1P34B 5CPIC 5GXQA 4H9PB 3AZJC 5AV9C 4QLCA 5AV6A 5B40B 1P3BA 1M1AD 5B0ZC 3AZFA 4G91B 5AV5C 1P3KB 4LD9B 4YS3A 1ID3C 1N1JA 3A6NA 2Y2MA 5B1LC 1P3IA 2ZY4A 1M18A 3MNND 3A1IA 2HIOB 1M19B 1P3GB 5AV9D 3O62C 3AZMD 3AZEC 3C1CC 5CPIB 5AV5D 3AZJB 4J8WA 3LZ1A 4UUZA 5B0ZB 5B1LD 4KUDC 3LZ0A 2Y2QA 4XUJC 1ID3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Y B;  3WTP B;  3V9R B;  5B2J A;  5DNN D;  1AOI A;  3C1C D;  2ARO C;  5BNV A;  5AVB A;  4J8V B;  3O62 B;  2F8N H;  3AZE B;  5B31 C;  4HGA C;  5CPJ D;  3LJA A;  5B2I B;  5BS7 C;  3KWQ B;  1U35 C;  3KXB A;  3AZI D;  2YFV A;  3UTB A;  4KUD B;  4Z2M H;  1ZLA C;  4ZBJ C;  5JRG C;  5DNM A;  3REJ C;  4G92 C;  3AZH C;  2ARO D;  3AZK A;  1P3F C;  3X1U B;  3TU4 C;  3W98 B;  2HUE C;  5B31 D;  3LEL B;  1WWI A;  3MGP A;  3REK B;  3UT9 A;  5B33 C;  4H9Q A;  4KGC D;  1U35 D;  4HGA B;  1EQZ C;  3AN2 C;  5B1M A;  3REJ D;  3WAA A;  1ZLA B;  2NQB B;  5JRG B;  4WNN A;  3REI C;  3AZH B;  3AV2 A;  5FUG A;  1H3O B;  5B24 C;  1TAF B;  3B0D C;  1P3A C;  3X1T A;  1M18 D;  5B33 D;  3MGR C;  5CP6 D;  1TZY C;  3AYW B;  2RVQ C;  5BO0 A;  5GT0 C;  1KX3 B;  1KX4 B;  1EQZ B;  4CAY A;  3AN2 B;  1F1E A;  3MGS A;  3W97 C;  3AZL B;  5CPI A;  1P3L C;  1B67 A;  3LZ1 D;  5AV9 A;  3C1B C;  3AZN B;  3WKJ C;  3W99 B;  3NQU B;  3MGR D;  1TZY D;  5AV5 A;  5E5A C;  4WU8 B;  1P3A B;  1F66 B;  5GT0 D;  3WTP E;  5B1L A;  3MVD C;  3B6G C;  2JSS A;  3W96 B;  5AVB D;  3MGQ C;  3W97 D;  1P3M C;  5JA4 B;  1HQ3 C;  2PYO C;  3AZG C;  3O62 A;  3KUY C;  4NFT A;  2CV5 D;  3LJA D;  3C1C A;  4Z66 C;  1P3O C;  3WKJ D;  5B32 B;  1BH9 A;  3KXB D;  3C1B B;  5BNX B;  3B6F C;  3MVD D;  3B6G D;  5CPJ A;  4XUJ A;  5E5A B;  1P34 C;  4R8P B;  4Z5T B;  1HQ3 D;  5B40 C;  5GSU D;  4G91 C;  3X1V C;  3X1S B;  3MGQ B;  4WU9 B;  1P3K C;  4LD9 C;  1BH8 A;  1P3M B;  5GT3 C;  1KX5 D;  2PYO B;  2ARO A;  5AVC B;  4EO5 C;  3KUY B;  3AFA D;  3REH B;  4Z66 B;  5B31 A;  2BYM A;  1S32 C;  3B6F D;  3UTA C;  1P34 D;  5BS7 A;  1ULY A;  4J8X B;  1M19 C;  1P3G C;  5CHL B;  1U35 A;  1BFM A;  5B40 D;  1P3K D;  4LD9 D;  3REJ A;  3WA9 C;  3R45 B;  5KDM A;  2YFW B;  4DRA A;  3X1T D;  1P3F A;  3X1V B;  3TU4 A;  5GT3 B;  5B0Y C;  4EO5 B;  3WTP C;  2HIO D;  1M19 D;  3KSY A;  5B33 A;  1S32 B;  5CP6 A;  1P3G D;  3UTA B;  3MGS D;  1P3P C;  5CPI D;  3NQJ B;  4J8V C;  3AZJ D;  5B31 G;  4JJN C;  4H9S C;  5AY8 C;  5B0Z D;  4YM6 B;  2F8N B;  4J8U B;  3REI A;  3WA9 B;  3VH6 T;  5B2I C;  4KHA A;  5AV8 C;  3REL B;  1ID3 D;  5B0Y D;  1JFI A;  5B24 A;  3KWQ C;  5G49 B;  3B0C W;  3WTP D;  3MGR A;  1TZY A;  3VH5 T;  1M1A B;  5GT0 A;  3O62 D;  5CPK B;  4X23 C;  3AZE D;  3X1U C;  1P3P B;  3W98 C;  3LEL C;  2BYK B;  3W97 A;  3REK C;  5B2I D;  1P3L A;  4JJN B;  3KWQ D;  5AY8 B;  3C1B A;  4KUD D;  2FJ7 C;  2CV5 A;  3WKJ A;  4XUJ D;  5AV8 B;  3AV1 C;  2NQB C;  3MVD A;  3B6G A;  4H9R A;  3X1U D;  3W98 D;  2NZD C;  3LEL D;  4CSR B;  3REK D;  4X23 B;  1HQ3 A;  5GSU A;  3AZG A;  3AYW C;  1P3O A;  1KX5 A;  1B6W A;  5DNN B;  1KX3 C;  1KX4 C;  3AFA A;  2FJ7 B;  3B6F A;  5F99 B;  1ZLA D;  2NQB D;  5JRG D;  4H9O A;  3AZH D;  3AV1 B;  3AZL C;  5C3I C;  1P34 A;  4H9P A;  4XZQ C;  1P3F D;  3AZN C;  3W99 C;  5B40 A;  3TU4 D;  3X1V A;  1P3K A;  4LD9 A;  2NZD B;  1F66 C;  4WU8 C;  3AZF C;  4ZUX C;  4YS3 C;  1KU5 A;  3W96 C;  1KX4 D;  1EQZ D;  3AN2 D;  2HIO A;  1M19 A;  1P3G A;  3NQJ A;  2L5A A;  3AZN D;  3REI D;  3W99 D;  5C3I B;  4KGC B;  4XZQ B;  5B32 C;  5B24 D;  3AZJ A;  1F66 D;  4WU8 D;  1P3A D;  5GXQ B;  5B0Z A;  4QLC B;  3W96 D;  5AV6 B;  2RVQ D;  3VH5 W;  1P3B B;  5B0Y A;  4R8P C;  1ID3 A;  3AZF B;  3WTP A;  3V9R A;  4ZUX B;  4YS3 B;  4Z5T C;  1N1J B;  4E44 A;  3A6N B;  3X1S C;  4WU9 C;  1P3I B;  1P3P A;  1P3L D;  5AVC C;  4J8V A;  5B32 D;  3C1B D;  4M6B A;  4JJN A;  3REH C;  3AZE A;  4H9S A;  4NE6 A;  5AY8 A;  5B2I A;  5E5A D;  4J8X C;  4R8P D;  3KWQ A;  4KUD A;  4Z5T D;  4J8W B;  3LZ1 B;  4UUZ B;  3X1S D;  3LZ0 B;  3MGQ D;  1P3M D;  2PYO D;  3AZG D;  4CSR A;  5B2J B;  3KUY D;  3REH D;  3X1U A;  1P3O D;  3W98 A;  4Z66 D;  3LEL A;  1AOI B;  1R4V A;  3REK A;  4AWL B;  5BNV B;  5AVB B;  2FJ7 A;  4H9N B;  1ZLA A;  5B1M C;  2NQB A;  4YM6 C;  5JRG A;  3X1V D;  3KXB B;  2YFV B;  4J8U C;  3UTB B;  3AZH A;  3REL C;  5GT3 D;  1H3O A;  4NE3 A;  5DNM B;  1TAF A;  4WV4 B;  5BT1 C;  1S32 D;  3AZK B;  3UTA D;  3AYW A;  1M1A C;  1KX3 A;  3B0B A;  3MGP B;  3UT9 B;  1KX4 A;  5CPK C;  1EQZ A;  4H9Q B;  4YM6 D;  3AN2 A;  2F8N D;  4J8U D;  3WA9 D;  3REL D;  3MNN C;  3AZL A;  5B1M B;  3AZN A;  1Q9C A;  5BT1 D;  3W99 A;  3NQU A;  3WAA B;  2IO5 B;  3AZM C;  4WNN B;  3AV2 B;  4WU8 A;  1P3A A;  1F66 A;  5FUG B;  4ZUX A;  3W96 A;  5CPK D;  1P3P D;  3X1T B;  4J8V D;  5JA4 A;  4JJN D;  5BO0 B;  5AY8 D;  5AV8 D;  3MNN B;  5DNN C;  4CAY B;  5B32 A;  3MGS B;  1A7W A;  5BNX A;  5F99 C;  1HTA A;  5AV9 B;  3AZM B;  5E5A A;  4R8P A;  5AV5 B;  5CPJ C;  4Z5T A;  4X23 D;  5B1L B;  3X1S A;  3MGQ A;  3AZI C;  4WU9 A;  1P3M A;  2F8N K;  4E45 A;  2PYO A;  5AVC A;  3KUY A;  3REH A;  2FJ7 D;  4Z66 A;  5F99 D;  4NE5 A;  3C1C B;  3AV1 D;  4J8X A;  1BH9 B;  4H9N A;  5B32 G;  4KGC C;  2NZD D;  5CPJ B;  3R45 A;  4XUJ B;  2YFW A;  5GXQ C;  3AZI B;  3AYW D;  4QLC C;  5AV6 C;  5GT3 A;  1P3B C;  3VH6 A;  1KX3 D;  1BH8 B;  3A6N C;  2ARO B;  1S32 A;  3UTA A;  3VH5 A;  1P3I C;  5B31 B;  2BYM B;  3AZL D;  5CP6 C;  1M18 C;  4XZQ D;  5GXQ D;  4YM6 A;  1U35 B;  2F8N A;  3VH6 W;  4J8U A;  3WA9 A;  4QLC D;  5AV6 D;  3REL A;  1P3B D;  4ZBJ B;  3AZF D;  5G49 A;  3REJ B;  4G92 B;  5KDM B;  4ZUX D;  4YS3 D;  2CWE A;  4J8W C;  3A6N D;  3LZ1 C;  1P3F B;  3LZ0 C;  1P3I D;  3TU4 B;  2HUE B;  1M1A A;  5B2J C;  5CPK A;  1WWS A;  5B33 B;  4WZS B;  5CP6 B;  1M18 B;  1AOI C;  2BYK A;  3MNN A;  4AWL C;  5AVB C;  4J8W D;  5AV8 A;  3AZM A;  3LZ0 D;  3REI B;  2CV5 C;  3LJA C;  4KHA B;  1JFI B;  2F8N G;  5B24 B;  5B2J D;  3B0C T;  4WU9 D;  3KXB C;  3B0D B;  3UTB C;  3MGR B;  5AVC D;  1TZY B;  1AOI D;  5DNM C;  4X23 A;  5GT0 B;  3AZK C;  4Z2M G;  5GSU C;  5DNN A;  4J8X D;  4DRB A;  3W97 B;  3MGP C;  3UT9 C;  1P3L B;  1KX5 C;  5F99 A;  3AFA C;  3UTB D;  3LJA B;  3AV1 A;  2CV5 B;  3WKJ B;  5DNM D;  3WAA C;  3AZK D;  2NZD A;  3MVD B;  3AZI A;  2IO5 C;  3B6G B;  4H9R B;  3AV2 C;  3MGP D;  3UT9 D;  1HQ3 B;  5GSU B;  3X1T C;  3AZG B;  1P3O B;  1KX5 B;  5B1M D;  2HIO C;  2LY8 A;  3AFA B;  3WAA D;  3B6F B;  4KGC A;  4XZQ A;  3MGS C;  4H9O B;  3AV2 D;  1P34 B;  5CPI C;  5GXQ A;  4H9P B;  3AZJ C;  5AV9 C;  4QLC A;  5AV6 A;  5B40 B;  1P3B A;  1M1A D;  5B0Z C;  3AZF A;  4G91 B;  5AV5 C;  1P3K B;  4LD9 B;  4YS3 A;  1ID3 C;  1N1J A;  3A6N A;  5B1L C;  1P3I A;  1M18 A;  3MNN D;  2HIO B;  1M19 B;  1P3G B;  5AV9 D;  3O62 C;  3AZM D;  3AZE C;  3C1C C;  5CPI B;  5AV5 D;  3AZJ B;  4J8W A;  3LZ1 A;  4UUZ A;  5B0Z B;  5B1L D;  4KUD C;  3LZ0 A;  4XUJ C;  1ID3 B; 
#chains in the Genus database with same CATH topology
 5B0Y B;  3WTP B;  3V9R B;  5B2J A;  5DNN D;  1AOI A;  3C1C D;  2ARO C;  5BNV A;  5AVB A;  4J8V B;  3O62 B;  2F8N H;  4DQY B;  3AZE B;  5B31 C;  4HGA C;  2Y2L A;  5CPJ D;  3LJA A;  5B2I B;  5BS7 C;  3KWQ B;  3A1K A;  1U35 C;  3KXB A;  3AZI D;  2XD5 A;  2YFV A;  3UTB A;  4KUD B;  4Z2M H;  1ZLA C;  4ZBJ C;  5JRG C;  5DNM A;  3REJ C;  4G92 C;  3AZH C;  2ARO D;  3AZK A;  1P3F C;  3X1U B;  3TU4 C;  3W98 B;  2HUE C;  5B31 D;  3LEL B;  1WWI A;  3MGP A;  3REK B;  3UT9 A;  5B33 C;  4H9Q A;  4KGC D;  1U35 D;  4HGA B;  3AL0 C;  1EQZ C;  3AN2 C;  5B1M A;  3REJ D;  3WAA A;  2UWX A;  1ZLA B;  2NQB B;  5JRG B;  4WNN A;  3REI C;  3AZH B;  3AV2 A;  5FUG A;  1H3O B;  2ZY3 A;  5B24 C;  1TAF B;  3B0D C;  1P3A C;  3X1T A;  1M18 D;  5B33 D;  3MGR C;  5CP6 D;  1TZY C;  3AYW B;  2RVQ C;  5BO0 A;  5GT0 C;  1KX3 B;  1KX4 B;  1EQZ B;  4CAY A;  3AN2 B;  1F1E A;  3MGS A;  3IP4 C;  3W97 C;  1PZR A;  3AZL B;  5CPI A;  1P3L C;  1B67 A;  3LZ1 D;  5AV9 A;  3C1B C;  3AZN B;  3WKJ C;  3W99 B;  3NQU B;  3MGR D;  1TZY D;  5AV5 A;  5E5A C;  4WU8 B;  1P3A B;  1F66 B;  5GT0 D;  3WTP E;  5B1L A;  3MVD C;  3B6G C;  2W8S A;  2VQR A;  2JSS A;  3W96 B;  5AVB D;  3MGQ C;  3W97 D;  1P3M C;  5JA4 B;  1HQ3 C;  2PYO C;  3AZG C;  3O62 A;  3KUY C;  4NFT A;  2CV5 D;  3LJA D;  3C1C A;  4Z66 C;  1P3O C;  3WKJ D;  5B32 B;  1BH9 A;  3KXB D;  3C1B B;  5BNX B;  3B6F C;  1T3U A;  3MVD D;  3B6G D;  5CPJ A;  2Y2K A;  4XUJ A;  5E5A B;  1P34 C;  4R8P B;  4Z5T B;  1HQ3 D;  2JE5 A;  5B40 C;  5GSU D;  4G91 C;  3X1V C;  3X1S B;  3MGQ B;  4WU9 B;  1P3K C;  4LD9 C;  1BH8 A;  1P3M B;  5GT3 C;  1KX5 D;  2PYO B;  2ARO A;  5AVC B;  4EO5 C;  3KUY B;  3AFA D;  3REH B;  4Z66 B;  5B31 A;  2BYM A;  1S32 C;  3B6F D;  3UTA C;  1P34 D;  5BS7 A;  1ULY A;  4J8X B;  1M19 C;  3KFU G;  1P3G C;  5CHL B;  1U35 A;  3EPH A;  1BFM A;  5B40 D;  2ZY5 A;  1P3K D;  4LD9 D;  3REJ A;  3WA9 C;  3R45 B;  5KDM A;  2YFW B;  4DRA A;  3X1T D;  1P3F A;  3X1V B;  3TU4 A;  5GT3 B;  5B0Y C;  4EO5 B;  3WTP C;  2HIO D;  1M19 D;  3KSY A;  5B33 A;  1S32 B;  5CP6 A;  1P3G D;  3UTA B;  3MGS D;  1P3P C;  3H0M C;  5CPI D;  3NQJ B;  4J8V C;  3AZJ D;  5B31 G;  4JJN C;  4H9S C;  5AY8 C;  5B0Z D;  4YM6 B;  2F8N B;  4J8U B;  3REI A;  3WA9 B;  3VH6 T;  5B2I C;  4KHA A;  5AV8 C;  3REL B;  1ID3 D;  5B0Y D;  1JFI A;  5B24 A;  3KWQ C;  5G49 B;  3B0C W;  3WTP D;  2RIQ A;  3MGR A;  1TZY A;  3VH5 T;  1M1A B;  5GT0 A;  3O62 D;  5CPK B;  4X23 C;  3AZE D;  3X1U C;  1P3P B;  3W98 C;  3LEL C;  2BYK B;  3W97 A;  3REK C;  5B2I D;  1P3L A;  4JJN B;  3KWQ D;  5AY8 B;  3C1B A;  4KUD D;  2FJ7 C;  2CV5 A;  3WKJ A;  4XUJ D;  5AV8 B;  3AV1 C;  2NQB C;  2ZM5 A;  3MVD A;  3B6G A;  4H9R A;  3X1U D;  3W98 D;  2Y2O A;  2NZD C;  3LEL D;  4CSR B;  3REK D;  4X23 B;  1HQ3 A;  5GSU A;  3AZG A;  3AYW C;  2G5H C;  1P3O A;  1KX5 A;  1B6W A;  5DNN B;  1KX3 C;  4UPK A;  1KX4 C;  3AFA A;  2FJ7 B;  3B6F A;  5F99 B;  1ZLA D;  2NQB D;  5JRG D;  4H9O A;  3AZH D;  3AV1 B;  3AZL C;  5C3I C;  1P34 A;  4H9P A;  4XZQ C;  1P3F D;  3AZN C;  3W99 C;  5B40 A;  3TU4 D;  3X1V A;  1P3K A;  4LD9 A;  2NZD B;  1F66 C;  4WU8 C;  3AZF C;  4ZUX C;  4YS3 C;  1KU5 A;  3W96 C;  1KX4 D;  1EQZ D;  3AN2 D;  2HIO A;  1M19 A;  1P3G A;  3NQJ A;  2L5A A;  3AZN D;  3REI D;  3FDD A;  3W99 D;  5C3I B;  4KGC B;  4XZQ B;  5B32 C;  5B24 D;  3AZJ A;  1F66 D;  4WU8 D;  1P3A D;  5GXQ B;  5B0Z A;  4QLC B;  3W96 D;  5AV6 B;  2RVQ D;  3VH5 W;  1P3B B;  5B0Y A;  4R8P C;  1ID3 A;  3AZF B;  3WTP A;  3V9R A;  4ZUX B;  4YS3 B;  4Z5T C;  3EG5 B;  1N1J B;  4E44 A;  3A6N B;  3X1S C;  4WU9 C;  1P3I B;  1P3P A;  1P3L D;  5AVC C;  4J8V A;  5B32 D;  3C1B D;  4M6B A;  4JJN A;  3REH C;  3AZE A;  4H9S A;  4NE6 A;  5AY8 A;  5B2I A;  5E5A D;  4J8X C;  4R8P D;  3KWQ A;  2ZY2 A;  4KUD A;  4Z5T D;  4J8W B;  3LZ1 B;  4UUZ B;  3X1S D;  1Z2C B;  3LZ0 B;  2Y2I A;  3MGQ D;  1P3M D;  2PYO D;  3AZG D;  4CSR A;  5B2J B;  3KUY D;  3REH D;  3X1U A;  1P3O D;  3W98 A;  4Z66 D;  3LEL A;  1AOI B;  1R4V A;  3REK A;  4AWL B;  5BNV B;  5AVB B;  2FJ7 A;  2Y2J A;  4H9N B;  1ZLA A;  5B1M C;  2NQB A;  4YM6 C;  5JRG A;  3X1V D;  3KXB B;  3EPK A;  2YFV B;  4J8U C;  3UTB B;  3AZH A;  3REL C;  5GT3 D;  1H3O A;  4NE3 A;  5DNM B;  1TAF A;  4WV4 B;  5BT1 C;  1S32 D;  3AZK B;  3UTA D;  3AYW A;  1M1A C;  1KX3 A;  3B0B A;  3MGP B;  3UT9 B;  1KX4 A;  5CPK C;  1EQZ A;  2BG1 A;  2Y2P A;  4H9Q B;  4YM6 D;  3AN2 A;  2F8N D;  4J8U D;  3WA9 D;  3REL D;  3MNN C;  3AZL A;  5B1M B;  3AZN A;  1Q9C A;  5BT1 D;  3W99 A;  3NQU A;  3WAA B;  2IO5 B;  2DQN C;  3AZM C;  4WNN B;  3AV2 B;  4WU8 A;  1P3A A;  1F66 A;  5FUG B;  4ZUX A;  3W96 A;  5CPK D;  1P3P D;  3X1T B;  4J8V D;  5JA4 A;  4JJN D;  5BO0 B;  5AY8 D;  5AV8 D;  3MNN B;  5DNN C;  4CAY B;  5B32 A;  3MGS B;  1A7W A;  5BNX A;  5F99 C;  1HTA A;  5AV9 B;  3AZM B;  5E5A A;  4R8P A;  5AV5 B;  5CPJ C;  4Z5T A;  4X23 D;  2G5I C;  5B1L B;  3X1S A;  3MGQ A;  3AZI C;  4WU9 A;  3F6T A;  1P3M A;  2F8N K;  4E45 A;  2PYO A;  5AVC A;  3P5J B;  3KUY A;  3REH A;  2FJ7 D;  4Z66 A;  5F99 D;  4NE5 A;  3C1C B;  3AV1 D;  4J8X A;  1BH9 B;  4H9N A;  5B32 G;  3EPL A;  4KGC C;  2NZD D;  5CPJ B;  3R45 A;  4XUJ B;  2YFW A;  5GXQ C;  3AZI B;  3AYW D;  4QLC C;  5AV6 C;  5GT3 A;  1P3B C;  3VH6 A;  1KX3 D;  1BH8 B;  3A6N C;  2ARO B;  1S32 A;  3UTA A;  2Y2H A;  3VH5 A;  1P3I C;  5B31 B;  2BYM B;  3AZL D;  5CP6 C;  1M18 C;  4XZQ D;  5GXQ D;  4YM6 A;  1U35 B;  2F8N A;  3VH6 W;  4J8U A;  3WA9 A;  2Y2N A;  4QLC D;  5AV6 D;  3REL A;  1P3B D;  4ZBJ B;  3AZF D;  5G49 A;  3REJ B;  4G92 B;  5KDM B;  4ZUX D;  4YS3 D;  2CWE A;  4J8W C;  3A6N D;  3LZ1 C;  1P3F B;  3LZ0 C;  1P3I D;  3TU4 B;  2HUE B;  1M1A A;  2JCH A;  5B2J C;  5CPK A;  1WWS A;  5B33 B;  4WZS B;  5CP6 B;  1M18 B;  1AOI C;  2BYK A;  3MNN A;  4AWL C;  5AVB C;  2F2A C;  4J8W D;  5AV8 A;  3AZM A;  3LZ0 D;  3REI B;  2CV5 C;  3LJA C;  4KHA B;  1JFI B;  2F8N G;  5B24 B;  3EPJ A;  5B2J D;  3B0C T;  4WU9 D;  3KXB C;  3B0D B;  3UTB C;  3MGR B;  5AVC D;  1TZY B;  1AOI D;  5DNM C;  4X23 A;  5GT0 B;  3AZK C;  2DF4 C;  4Z2M G;  4WJ3 C;  5GSU C;  5DNN A;  4J8X D;  4DRB A;  3W97 B;  3MGP C;  3UT9 C;  1P3L B;  1KX5 C;  5F99 A;  3AFA C;  3UTB D;  3LJA B;  3AV1 A;  2CV5 B;  3WKJ B;  5DNM D;  1W2E A;  3WAA C;  3AZK D;  2NZD A;  2Y2G A;  3MVD B;  2IO5 C;  3H0R C;  3AZI A;  3B6G B;  4H9R B;  3AV2 C;  2FFF B;  2J8P A;  3MGP D;  3UT9 D;  2XD1 A;  1HQ3 B;  5GSU B;  3X1T C;  3AZG B;  1P3O B;  1KX5 B;  5B1M D;  2HIO C;  2LY8 A;  3AFA B;  3WAA D;  3B6F B;  4KGC A;  4XZQ A;  3MGS C;  3H0L C;  4H9O B;  3AV2 D;  1P34 B;  5CPI C;  5GXQ A;  4H9P B;  3AZJ C;  5AV9 C;  4QLC A;  5AV6 A;  5B40 B;  1P3B A;  1M1A D;  5B0Z C;  3AZF A;  4G91 B;  5AV5 C;  1P3K B;  4LD9 B;  4YS3 A;  1ID3 C;  1N1J A;  3A6N A;  2Y2M A;  5B1L C;  1P3I A;  2ZY4 A;  1M18 A;  3MNN D;  3A1I A;  2HIO B;  1M19 B;  1P3G B;  5AV9 D;  3O62 C;  3AZM D;  3AZE C;  3C1C C;  5CPI B;  5AV5 D;  3AZJ B;  4J8W A;  3LZ1 A;  4UUZ A;  5B0Z B;  5B1L D;  4KUD C;  3LZ0 A;  2Y2Q A;  4XUJ C;  1ID3 B; 
#chains in the Genus database with same CATH homology
 5B0Y B;  3WTP B;  3V9R B;  5B2J A;  5DNN D;  1AOI A;  3C1C D;  2ARO C;  5BNV A;  5AVB A;  4J8V B;  3O62 B;  2F8N H;  4DQY B;  3AZE B;  5B31 C;  4HGA C;  2Y2L A;  5CPJ D;  3LJA A;  5B2I B;  5BS7 C;  3KWQ B;  3A1K A;  1U35 C;  3KXB A;  3AZI D;  2XD5 A;  2YFV A;  3UTB A;  4KUD B;  4Z2M H;  1ZLA C;  4ZBJ C;  5JRG C;  5DNM A;  3REJ C;  4G92 C;  3AZH C;  2ARO D;  3AZK A;  1P3F C;  3X1U B;  3TU4 C;  3W98 B;  2HUE C;  5B31 D;  3LEL B;  1WWI A;  3MGP A;  3REK B;  3UT9 A;  5B33 C;  4H9Q A;  4KGC D;  1U35 D;  4HGA B;  3AL0 C;  1EQZ C;  3AN2 C;  5B1M A;  3REJ D;  3WAA A;  2UWX A;  1ZLA B;  2NQB B;  5JRG B;  4WNN A;  3REI C;  3AZH B;  3AV2 A;  5FUG A;  1H3O B;  2ZY3 A;  5B24 C;  1TAF B;  3B0D C;  1P3A C;  3X1T A;  1M18 D;  5B33 D;  3MGR C;  5CP6 D;  1TZY C;  3AYW B;  2RVQ C;  5BO0 A;  5GT0 C;  1KX3 B;  1KX4 B;  1EQZ B;  4CAY A;  3AN2 B;  1F1E A;  3MGS A;  3IP4 C;  3W97 C;  1PZR A;  3AZL B;  5CPI A;  1P3L C;  1B67 A;  3LZ1 D;  5AV9 A;  3C1B C;  3AZN B;  3WKJ C;  3W99 B;  3NQU B;  3MGR D;  1TZY D;  5AV5 A;  5E5A C;  4WU8 B;  1P3A B;  1F66 B;  5GT0 D;  3WTP E;  5B1L A;  3MVD C;  3B6G C;  2W8S A;  2VQR A;  2JSS A;  3W96 B;  5AVB D;  3MGQ C;  3W97 D;  1P3M C;  5JA4 B;  1HQ3 C;  2PYO C;  3AZG C;  3O62 A;  3KUY C;  4NFT A;  2CV5 D;  3LJA D;  3C1C A;  4Z66 C;  1P3O C;  3WKJ D;  5B32 B;  1BH9 A;  3KXB D;  3C1B B;  5BNX B;  3B6F C;  1T3U A;  3MVD D;  3B6G D;  5CPJ A;  2Y2K A;  4XUJ A;  5E5A B;  1P34 C;  4R8P B;  4Z5T B;  1HQ3 D;  2JE5 A;  5B40 C;  5GSU D;  4G91 C;  3X1V C;  3X1S B;  3MGQ B;  4WU9 B;  1P3K C;  4LD9 C;  1BH8 A;  1P3M B;  5GT3 C;  1KX5 D;  2PYO B;  2ARO A;  5AVC B;  4EO5 C;  3KUY B;  3AFA D;  3REH B;  4Z66 B;  5B31 A;  2BYM A;  1S32 C;  3B6F D;  3UTA C;  1P34 D;  5BS7 A;  1ULY A;  4J8X B;  1M19 C;  3KFU G;  1P3G C;  5CHL B;  1U35 A;  3EPH A;  1BFM A;  5B40 D;  2ZY5 A;  1P3K D;  4LD9 D;  3REJ A;  3WA9 C;  3R45 B;  5KDM A;  2YFW B;  4DRA A;  3X1T D;  1P3F A;  3X1V B;  3TU4 A;  5GT3 B;  5B0Y C;  4EO5 B;  3WTP C;  2HIO D;  1M19 D;  3KSY A;  5B33 A;  1S32 B;  5CP6 A;  1P3G D;  3UTA B;  3MGS D;  1P3P C;  3H0M C;  5CPI D;  3NQJ B;  4J8V C;  3AZJ D;  5B31 G;  4JJN C;  4H9S C;  5AY8 C;  5B0Z D;  4YM6 B;  2F8N B;  4J8U B;  3REI A;  3WA9 B;  3VH6 T;  5B2I C;  4KHA A;  5AV8 C;  3REL B;  1ID3 D;  5B0Y D;  1JFI A;  5B24 A;  3KWQ C;  5G49 B;  3B0C W;  3WTP D;  2RIQ A;  3MGR A;  1TZY A;  3VH5 T;  1M1A B;  5GT0 A;  3O62 D;  5CPK B;  4X23 C;  3AZE D;  3X1U C;  1P3P B;  3W98 C;  3LEL C;  2BYK B;  3W97 A;  3REK C;  5B2I D;  1P3L A;  4JJN B;  3KWQ D;  5AY8 B;  3C1B A;  4KUD D;  2FJ7 C;  2CV5 A;  3WKJ A;  4XUJ D;  5AV8 B;  3AV1 C;  2NQB C;  2ZM5 A;  3MVD A;  3B6G A;  4H9R A;  3X1U D;  3W98 D;  2Y2O A;  2NZD C;  3LEL D;  4CSR B;  3REK D;  4X23 B;  1HQ3 A;  5GSU A;  3AZG A;  3AYW C;  2G5H C;  1P3O A;  1KX5 A;  1B6W A;  5DNN B;  1KX3 C;  4UPK A;  1KX4 C;  3AFA A;  2FJ7 B;  3B6F A;  5F99 B;  1ZLA D;  2NQB D;  5JRG D;  4H9O A;  3AZH D;  3AV1 B;  3AZL C;  5C3I C;  1P34 A;  4H9P A;  4XZQ C;  1P3F D;  3AZN C;  3W99 C;  5B40 A;  3TU4 D;  3X1V A;  1P3K A;  4LD9 A;  2NZD B;  1F66 C;  4WU8 C;  3AZF C;  4ZUX C;  4YS3 C;  1KU5 A;  3W96 C;  1KX4 D;  1EQZ D;  3AN2 D;  2HIO A;  1M19 A;  1P3G A;  3NQJ A;  2L5A A;  3AZN D;  3REI D;  3FDD A;  3W99 D;  5C3I B;  4KGC B;  4XZQ B;  5B32 C;  5B24 D;  3AZJ A;  1F66 D;  4WU8 D;  1P3A D;  5GXQ B;  5B0Z A;  4QLC B;  3W96 D;  5AV6 B;  2RVQ D;  3VH5 W;  1P3B B;  5B0Y A;  4R8P C;  1ID3 A;  3AZF B;  3WTP A;  3V9R A;  4ZUX B;  4YS3 B;  4Z5T C;  3EG5 B;  1N1J B;  4E44 A;  3A6N B;  3X1S C;  4WU9 C;  1P3I B;  1P3P A;  1P3L D;  5AVC C;  4J8V A;  5B32 D;  3C1B D;  4M6B A;  4JJN A;  3REH C;  3AZE A;  4H9S A;  4NE6 A;  5AY8 A;  5B2I A;  5E5A D;  4J8X C;  4R8P D;  3KWQ A;  2ZY2 A;  4KUD A;  4Z5T D;  4J8W B;  3LZ1 B;  4UUZ B;  3X1S D;  1Z2C B;  3LZ0 B;  2Y2I A;  3MGQ D;  1P3M D;  2PYO D;  3AZG D;  4CSR A;  5B2J B;  3KUY D;  3REH D;  3X1U A;  1P3O D;  3W98 A;  4Z66 D;  3LEL A;  1AOI B;  1R4V A;  3REK A;  4AWL B;  5BNV B;  5AVB B;  2FJ7 A;  2Y2J A;  4H9N B;  1ZLA A;  5B1M C;  2NQB A;  4YM6 C;  5JRG A;  3X1V D;  3KXB B;  3EPK A;  2YFV B;  4J8U C;  3UTB B;  3AZH A;  3REL C;  5GT3 D;  1H3O A;  4NE3 A;  5DNM B;  1TAF A;  4WV4 B;  5BT1 C;  1S32 D;  3AZK B;  3UTA D;  3AYW A;  1M1A C;  1KX3 A;  3B0B A;  3MGP B;  3UT9 B;  1KX4 A;  5CPK C;  1EQZ A;  2BG1 A;  2Y2P A;  4H9Q B;  4YM6 D;  3AN2 A;  2F8N D;  4J8U D;  3WA9 D;  3REL D;  3MNN C;  3AZL A;  5B1M B;  3AZN A;  1Q9C A;  5BT1 D;  3W99 A;  3NQU A;  3WAA B;  2IO5 B;  2DQN C;  3AZM C;  4WNN B;  3AV2 B;  4WU8 A;  1P3A A;  1F66 A;  5FUG B;  4ZUX A;  3W96 A;  5CPK D;  1P3P D;  3X1T B;  4J8V D;  5JA4 A;  4JJN D;  5BO0 B;  5AY8 D;  5AV8 D;  3MNN B;  5DNN C;  4CAY B;  5B32 A;  3MGS B;  1A7W A;  5BNX A;  5F99 C;  1HTA A;  5AV9 B;  3AZM B;  5E5A A;  4R8P A;  5AV5 B;  5CPJ C;  4Z5T A;  4X23 D;  2G5I C;  5B1L B;  3X1S A;  3MGQ A;  3AZI C;  4WU9 A;  3F6T A;  1P3M A;  2F8N K;  4E45 A;  2PYO A;  5AVC A;  3P5J B;  3KUY A;  3REH A;  2FJ7 D;  4Z66 A;  5F99 D;  4NE5 A;  3C1C B;  3AV1 D;  4J8X A;  1BH9 B;  4H9N A;  5B32 G;  3EPL A;  4KGC C;  2NZD D;  5CPJ B;  3R45 A;  4XUJ B;  2YFW A;  5GXQ C;  3AZI B;  3AYW D;  4QLC C;  5AV6 C;  5GT3 A;  1P3B C;  3VH6 A;  1KX3 D;  1BH8 B;  3A6N C;  2ARO B;  1S32 A;  3UTA A;  2Y2H A;  3VH5 A;  1P3I C;  5B31 B;  2BYM B;  3AZL D;  5CP6 C;  1M18 C;  4XZQ D;  5GXQ D;  4YM6 A;  1U35 B;  2F8N A;  3VH6 W;  4J8U A;  3WA9 A;  2Y2N A;  4QLC D;  5AV6 D;  3REL A;  1P3B D;  4ZBJ B;  3AZF D;  5G49 A;  3REJ B;  4G92 B;  5KDM B;  4ZUX D;  4YS3 D;  2CWE A;  4J8W C;  3A6N D;  3LZ1 C;  1P3F B;  3LZ0 C;  1P3I D;  3TU4 B;  2HUE B;  1M1A A;  2JCH A;  5B2J C;  5CPK A;  1WWS A;  5B33 B;  4WZS B;  5CP6 B;  1M18 B;  1AOI C;  2BYK A;  3MNN A;  4AWL C;  5AVB C;  2F2A C;  4J8W D;  5AV8 A;  3AZM A;  3LZ0 D;  3REI B;  2CV5 C;  3LJA C;  4KHA B;  1JFI B;  2F8N G;  5B24 B;  3EPJ A;  5B2J D;  3B0C T;  4WU9 D;  3KXB C;  3B0D B;  3UTB C;  3MGR B;  5AVC D;  1TZY B;  1AOI D;  5DNM C;  4X23 A;  5GT0 B;  3AZK C;  2DF4 C;  4Z2M G;  4WJ3 C;  5GSU C;  5DNN A;  4J8X D;  4DRB A;  3W97 B;  3MGP C;  3UT9 C;  1P3L B;  1KX5 C;  5F99 A;  3AFA C;  3UTB D;  3LJA B;  3AV1 A;  2CV5 B;  3WKJ B;  5DNM D;  1W2E A;  3WAA C;  3AZK D;  2NZD A;  2Y2G A;  3MVD B;  2IO5 C;  3H0R C;  3AZI A;  3B6G B;  4H9R B;  3AV2 C;  2FFF B;  2J8P A;  3MGP D;  3UT9 D;  2XD1 A;  1HQ3 B;  5GSU B;  3X1T C;  3AZG B;  1P3O B;  1KX5 B;  5B1M D;  2HIO C;  2LY8 A;  3AFA B;  3WAA D;  3B6F B;  4KGC A;  4XZQ A;  3MGS C;  3H0L C;  4H9O B;  3AV2 D;  1P34 B;  5CPI C;  5GXQ A;  4H9P B;  3AZJ C;  5AV9 C;  4QLC A;  5AV6 A;  5B40 B;  1P3B A;  1M1A D;  5B0Z C;  3AZF A;  4G91 B;  5AV5 C;  1P3K B;  4LD9 B;  4YS3 A;  1ID3 C;  1N1J A;  3A6N A;  2Y2M A;  5B1L C;  1P3I A;  2ZY4 A;  1M18 A;  3MNN D;  3A1I A;  2HIO B;  1M19 B;  1P3G B;  5AV9 D;  3O62 C;  3AZM D;  3AZE C;  3C1C C;  5CPI B;  5AV5 D;  3AZJ B;  4J8W A;  3LZ1 A;  4UUZ A;  5B0Z B;  5B1L D;  4KUD C;  3LZ0 A;  2Y2Q A;  4XUJ C;  1ID3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...