1U35A

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA
publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35A00
3AZJA 4YM6A 3TU4C 4WU9C 5AY8C 4NE6A 4CSRA 2PYOC 1H3OB 4UUZA 5AVBB 3O62B 3C1BA 4WV4B 3W96B 1KX5D 1P3AA 5CHLB 5CPJA 3AZGB 2HUEC 1M19B 1ZLAD 4QLCB 1A7WA 4Z5TB 5AV8C 4J8WC 1KX5A 3X1TB 5BNVB 4WU8B 5AV5B 4KUDC 3LZ1D 3UTBC 4H9PB 3RELC 2CWEA 1KX4D 3B0DB 3AZFB 4JJND 4ZBJC 1S32B 5B1LC 3B0BA 5B33B 5CPKC 5JRGC 4R8PD 3LZ1A 4H9NB 1KX4A 4JJNA 5GXQB 3W98D 4NFTA 3AZKB 1M19C 4G92B 3B0CT 1ZLAC 4R8PA 1P34C 3REIC 5F99B 1ID3C 3X1SD 1EQZB 3W97B 5JA4B 5AVCC 4H9SC 5GT3C 3MGRC 2FJ7B 5B31G 3W98A 3AZLC 4DRBA 5GSUB 5AV5C 4LD9D 2AROC 3LZ0C 2HIOB 4HGAB 1KX4C 1TZYD 3X1SA 5B40B 2F8NG 1P3MB 3WAAD 4LD9A 3KUYC 3REKB 4WZSB 3MVDB 5BT1D 1P3LC 5B1MB 1P3FD 1TZYA 5B2JD 5KDMB 3AZMD 3AZHD 5CPID 2BYKB 4XZQD 3WAAA 3WTPE 2F8ND 4XUJD 1AOID 1P3KC 2JSSA 1P3IB 3AZNB 3VH5W 3V9RB 3AV2D 3LELB 1U35B 1P3FA 5B2JA 5B32G 5C3IC 3AZMA 3AZHA 5CPIA 4XZQA 5DNND 3REJD 2F8NA 4XUJA 1AOIA 1BH8A 3AV2A 4H9RA 5AV6B 4YS3C 1KX3D 5B31C 1P3PB 3UTAB 4ZUXD 3WKJD 5DNNA 5B32D 3REJA 3B6FB 3TU4D 4WU9D 5AV9B 5FUGB 5AY8D 2PYOD 5B2JC 1R4VA 3B6GC 3R45B 3AYWC 2CV5B 3AZMC 5E5AD 4G91C 4XZQC 3MGQC 1KX3A 3WA9C 4XUJC 4ZUXA 3WKJA 5B32A 3MGSB 3WTPC 3VH6T 3TU4A 4WU9A 5AY8A 3KXBB 2PYOA 5GT0C 4WNNB 5AV8D 4J8XC 2NQBB 3REHC 4E45A 4J8WD 5E5AA 1P3GD 4KGCC 1F66B 4KUDD 2F8NK 1WWSA 4AWLC 3UTBD 3RELD 3KWQB 4Z66C 5AV8A 5B1LD 3AZEC 4J8WA 3WKJC 5CPKD 1M1AC 5B32C 5B0YB 5B0ZC 1P3GA 5JRGD 2BYMB 1HQ3B 5AVBD 4KUDA 3A6NB 3UTBA 3MGPC 1P3OB 3W96D 1F1EA 3RELA 2NZDB 4J8VB 4NE5A 5E5AC 5B1LA 1P3BB 3AZGD 3AZIB 1M19D 5B2IC 2YFVA 4EO5C 4X23B 5CPKA 3AZJB 4YM6B 5JRGA 1P34D 3REID 1ID3D 3MNNB 4CSRB 5AVBA 4UUZB 3C1BB 3W96A 3X1UC 5BS7C 5AVCD 5GT3D 3MGRD 1P3AB 5CPJB 1P3GC 3AZLD 3AZGA 1M19A 5AV5D 1ZLAA 3AN2C 1P34A 2AROD 3LZ0D 3REIA 3AV1C 1ID3A 5DNMB 4Z2MH 5B33D 4H9QA 5AVCA 3NQUB 4H9SA 5GT3A 3MGRA 1KX5B 5BNXA 3AZLA 5AV5A 5AVBC 3KUYD 3O62C 2AROA 3LZ0A 3W96C 1WWIA 1P3LD 5GXQD 3AZKD 4DRAA 5B33A 3AZGC 3NQJA 5BO0A 2RVQC 4QLCC 4Z5TC 1P3KD 3KUYA 3LZ1B 5G49A 1EQZD 1P3LA 5CP6B 3AZKA 4JJNB 3X1TC 3X1VB 4WU8C 4R8PB 1B6WA 5DNMC 3B0DC 1P3KA 3AZFC 1BH9A 4NE3A 1S32C 1EQZA 5JA4A 4J8UB 5B33C 3W98B 4YS3D 5B31D 5B1MD 3KSYA 5GXQC 3AZKC 3W99B 3X1SB 1JFIA 4G92C 3AYWD 3B6GD 3C1CB 4YS3A 3MGQD 5F99C 5B31A 3WA9D 4LD9B 3AZND 3LJAB 1EQZC 3W97C 5B1MA 5CP6C 3WTPD 2FJ7C 3AFAB 1TZYB 5GT0D 5GSUC 4J8XD 3B6GA 3AYWA 3REHD 3WAAB 3MGQA 2HIOC 3WA9A 4HGAC 4CAYB 4KGCD 5B40C 3WTPA 1P3FB 2YFWB 1P3MC 3UT9B 4Z66D 5GT0A 1M18B 4J8XA 1P3PD 3REHA 2L5AA 3AZHB 3REKC 3AZED 3MVDC 5CPIB 1M1AD 2F8NB 5B0ZD 5B1MC 1AOIB 4KGCA 1BH8B 3MGPD 3AV2B 2CV5D 4Z66A 4H9RB 5B24B 1P3PA 3AZEA 5B2ID 5DNNB 1P3IC 1M1AA 3REJB 3AZNC 5B0ZA 1U35C 3LELC 5FUGA 3MGPA 3R45A 2CV5A 3X1UD 4KHAA 3B0CW 1KX3B 5B2IA 3AN2D 3TU4B 3AV1D 4WU9B 5AY8B 2PYOB 5AV6C 1P3PC 3X1UA 5BS7A 3UTAC 3B6FC 1N1JA 5AV9C 2HUEB 1BFMA 4Z2MG 3O62D 3AN2A 4H9OB 3AV1A 2NZDD 2CV5C 1TAFB 5AV8B 4J8WB 3MGSC 2RVQD 4QLCD 3MNND 3KXBC 4Z5TD 1H3OA 4KUDB 3O62A 3UTBB 2NZDA 2NQBC 3RELB 4ZBJB 5B1LB 3X1TD 4WU8D 2YFVB 5CPKB 4QLCA 1F66C 5JRGB 3MNNA 5DNMD 4Z5TA 4E44A 3KWQC 3AZFD 1S32D 3VH5T 5B0YC 3X1TA 5BNVA 1HQ3C 4WU8A 1ZLAB 3A6NC 1P3OC 4H9PA 3VH6A 1P34B 3REIB 1ID3B 5DNMA 4J8VC 2NZDC 3AZFA 1S32A 1P3BC 3AZIC 3NQUA 4H9QB 5AVCB 5GT3B 4X23C 3MGRB 5BNXB 1Q9CA 4YM6C 3AZJC 3AZLB 5F99D 3MNNC 3C1BC 2IO5B 3W97D 2AROB 4H9NA 3LZ0B 5CP6D 2FJ7D 1KX4B 5GXQA 1P3AC 5CPJC 3X1VD 5GSUD 3NQJB 5BO0B 1HTAA 3VH6W 5F99A 2HIOD 3KUYB 4J8UD 5G49B 3W97A 5B40D 5CP6A 2FJ7A 1P3LB 1KX5C 1P3MD 3X1VA 5GSUA 3REKD 3MVDD 2HIOA 1ULYA 1P3KB 3W99D 1BH9B 4J8UA 5B40A 1P3MA 3C1CD 5C3IB 2IO5C 3LZ1C 3LJAD 3MVDA 3REKA 1P3ID 3AFAD 3LELD 1U35D 3W99A 4JJNC 5KDMA 3VH5A 3X1VC 1JFIB 2BYKA 3C1CA 4R8PC 4YS3B 5B31B 3LJAA 1P3IA 3AZNA 4J8UC 3V9RA 3AFAA 3LELA 1U35A 3UT9D 3W98C 1M18D 5B2JB 5AV6D 3B6GB 3UTAD 3AYWB 3AZMB 4XZQB 4G91B 3MGQB 3B6FD 4CAYA 3WA9B 4XUJB 5AV9D 3W99C 3X1SC 3WTPB 2YFWA 2LY8A 3UT9A 1M18A 3C1CC 5AV6A 5GT0B 5B24D 4J8XB 2F8NH 3UTAA 4LD9C 3REHB 3MGSD 3LJAC 3B6FA 3AFAC 5AV9A 1KU5A 1TZYC 3KXBD 4KGCB 4AWLB 2NQBD 3WAAC 4Z66B 5B24A 3AZEB 3WKJB 4ZUXB 3MGSA 1M1AB 1F66D 5BT1C 5B32B 5B0ZB 1P3FC 3KXBA 3UT9C 1B67A 3KWQD 1M18C 4WNNA 3MGPB 4M6BA 2NQBA 4KHAB 3AZHC 5CPIC 5E5AB 5B0YD 1AOIC 1HQ3D 5B2IB 4EO5B 1F66A 3A6ND 1P3OD 3AV2C 4J8VD 3KWQA 5B24C 1P3BD 3X1UB 3AZID 5DNNC 4X23D 3REJC 5B0YA 3AZJD 4YM6D 1N1JB 2BYMA 1P3GB 1HQ3A 3A6NA 3C1BD 4H9OA 3AN2B 1P3OA 3AV1B 1TAFA 4J8VA 1KX3C 1P3AD 1P3BA 5CPJD 3AZIA 4ZUXC 4X23A
chains in the Genus database with same CATH superfamily
3AZJA 4YM6A 1W2EA 3TU4C 4WU9C 5AY8C 4NE6A 4CSRA 3EPLA 2DQNC 2PYOC 1H3OB 4UUZA 5AVBB 3O62B 3C1BA 4WV4B 3W96B 1KX5D 1P3AA 5CHLB 5CPJA 3AZGB 2HUEC 1M19B 1ZLAD 4QLCB 2ZY4A 1A7WA 4Z5TB 5AV8C 4J8WC 1KX5A 2RIQA 3X1TB 5BNVB 4WU8B 5AV5B 4KUDC 3LZ1D 3UTBC 4H9PB 3RELC 2CWEA 1KX4D 3B0DB 3AZFB 4JJND 4ZBJC 1S32B 5B1LC 3B0BA 5B33B 5CPKC 2UWXA 3EPJA 5JRGC 3AL0C 4R8PD 3LZ1A 4H9NB 3A1KA 1KX4A 4JJNA 5GXQB 3W98D 4NFTA 3AZKB 1M19C 4G92B 3B0CT 1ZLAC 4R8PA 1P34C 3REIC 5F99B 1ID3C 3X1SD 1EQZB 3W97B 5JA4B 5AVCC 4H9SC 5GT3C 3MGRC 2FJ7B 5B31G 3W98A 3AZLC 4DRBA 5GSUB 5AV5C 4LD9D 2AROC 3LZ0C 2HIOB 4HGAB 1KX4C 1TZYD 3X1SA 5B40B 2F8NG 1P3MB 3WAAD 4LD9A 3KUYC 3REKB 4WZSB 3MVDB 5BT1D 1P3LC 5B1MB 1P3FD 1TZYA 5B2JD 5KDMB 3AZMD 3AZHD 5CPID 2BYKB 4XZQD 3WAAA 3WTPE 2F8ND 4XUJD 1AOID 1P3KC 2JSSA 1P3IB 2G5HC 3AZNB 3VH5W 3V9RB 3AV2D 3LELB 1U35B 1P3FA 5B2JA 5B32G 5C3IC 3AZMA 3AZHA 5CPIA 4XZQA 5DNND 3P5JB 3REJD 2F8NA 4XUJA 1AOIA 1BH8A 3AV2A 4H9RA 5AV6B 4YS3C 1KX3D 5B31C 1P3PB 3UTAB 4ZUXD 3WKJD 5DNNA 5B32D 3REJA 3B6FB 3TU4D 4WU9D 5AV9B 5FUGB 5AY8D 2PYOD 5B2JC 1R4VA 3B6GC 3R45B 3AYWC 2CV5B 3AZMC 5E5AD 4G91C 4XZQC 3MGQC 1KX3A 3WA9C 4XUJC 4ZUXA 3WKJA 5B32A 3MGSB 3WTPC 3VH6T 3TU4A 4WU9A 5AY8A 3KXBB 3FDDA 2PYOA 5GT0C 4WNNB 5AV8D 4J8XC 2NQBB 3REHC 4E45A 4J8WD 5E5AA 1P3GD 2JCHA 4KGCC 1F66B 4KUDD 2F8NK 1WWSA 2FFFB 4AWLC 3UTBD 3RELD 2Y2GA 3KWQB 4Z66C 4WJ3C 5AV8A 5B1LD 3AZEC 4J8WA 3WKJC 5CPKD 1M1AC 5B32C 5B0YB 5B0ZC 1P3GA 5JRGD 2BYMB 2BG1A 1HQ3B 5AVBD 4KUDA 3A6NB 3UTBA 3MGPC 1P3OB 3W96D 1F1EA 3RELA 2NZDB 4J8VB 4NE5A 5E5AC 5B1LA 1P3BB 3AZGD 3AZIB 1M19D 2Y2NA 2YFVA 4EO5C 5B2IC 4X23B 5CPKA 3AZJB 4YM6B 5JRGA 1P34D 3REID 1ID3D 3MNNB 4CSRB 3F6TA 5AVBA 4UUZB 3C1BB 3W96A 3X1UC 5BS7C 5AVCD 5GT3D 3MGRD 1P3AB 5CPJB 1P3GC 3AZLD 3AZGA 1M19A 2F2AC 5AV5D 1ZLAA 1PZRA 3AN2C 1P34A 2AROD 3LZ0D 3REIA 3AV1C 1ID3A 5DNMB 4Z2MH 5B33D 4H9QA 5AVCA 3NQUB 2W8SA 4H9SA 5GT3A 3MGRA 5BNXA 1KX5B 3AZLA 5AV5A 5AVBC 3KUYD 3O62C 2AROA 3LZ0A 3W96C 1WWIA 1P3LD 5GXQD 3AZKD 2JE5A 4DRAA 5B33A 1Z2CB 3AZGC 3NQJA 5BO0A 2RVQC 4QLCC 4Z5TC 1P3KD 3KUYA 3LZ1B 5G49A 1EQZD 1P3LA 5CP6B 3AZKA 4JJNB 3H0MC 3X1TC 3X1VB 4WU8C 4R8PB 1B6WA 5DNMC 3B0DC 1P3KA 3AZFC 1BH9A 4NE3A 1S32C 1EQZA 5JA4A 4J8UB 5B33C 3W98B 4YS3D 5B31D 5B1MD 3KSYA 5GXQC 3AZKC 3W99B 4DQYB 3X1SB 2Y2JA 1JFIA 4G92C 3AYWD 3B6GD 3C1CB 3A1IA 4YS3A 3MGQD 5F99C 5B31A 3WA9D 4LD9B 2Y2QA 3AZND 3LJAB 1EQZC 3W97C 5B1MA 5CP6C 3WTPD 2FJ7C 3AFAB 1TZYB 5GT0D 5GSUC 4J8XD 3B6GA 3AYWA 3REHD 3WAAB 2ZY2A 3MGQA 2HIOC 3WA9A 4HGAC 4CAYB 4KGCD 5B40C 3WTPA 1P3FB 2YFWB 1P3MC 3UT9B 4Z66D 5GT0A 1M18B 4J8XA 1P3PD 3REHA 2L5AA 3AZHB 3REKC 3AZED 3MVDC 5CPIB 1M1AD 2F8NB 5B0ZD 5B1MC 1AOIB 2DF4C 4KGCA 1BH8B 3MGPD 3AV2B 2CV5D 3EPHA 3H0RC 4Z66A 4H9RB 5B24B 1P3PA 3AZEA 5B2ID 5DNNB 1P3IC 1M1AA 3REJB 3AZNC 5B0ZA 1U35C 3LELC 2ZY5A 5FUGA 3MGPA 3R45A 2CV5A 3X1UD 4KHAA 3B0CW 1KX3B 5B2IA 2XD1A 2Y2KA 3AN2D 4UPKA 3TU4B 3AV1D 4WU9B 5AY8B 2PYOB 2Y2LA 5AV6C 1P3PC 3X1UA 5BS7A 3UTAC 3EG5B 3B6FC 1N1JA 5AV9C 2HUEB 1BFMA 4Z2MG 3O62D 3AN2A 4H9OB 3AV1A 2NZDD 2CV5C 3KFUG 1TAFB 5AV8B 4J8WB 2VQRA 3MGSC 2RVQD 4QLCD 3MNND 3KXBC 4Z5TD 1H3OA 4KUDB 3O62A 3UTBB 2NZDA 2NQBC 3RELB 4ZBJB 5B1LB 3X1TD 4WU8D 2YFVB 5CPKB 4QLCA 1F66C 5JRGB 3MNNA 5DNMD 4Z5TA 4E44A 3KWQC 3AZFD 1S32D 3VH5T 5B0YC 3X1TA 5BNVA 1HQ3C 4WU8A 1ZLAB 3A6NC 1P3OC 4H9PA 3VH6A 1P34B 3REIB 1ID3B 5DNMA 4J8VC 2NZDC 3AZFA 1S32A 1P3BC 3AZIC 3NQUA 4H9QB 5AVCB 5GT3B 4X23C 3MGRB 5BNXB 1Q9CA 4YM6C 3AZJC 3AZLB 5F99D 3MNNC 3C1BC 2IO5B 3W97D 2AROB 4H9NA 3LZ0B 5CP6D 2FJ7D 1KX4B 5GXQA 1P3AC 5CPJC 3X1VD 5GSUD 3NQJB 5BO0B 1HTAA 3VH6W 5F99A 2HIOD 3KUYB 4J8UD 5G49B 3W97A 5B40D 5CP6A 2Y2HA 1P3LB 2FJ7A 1KX5C 1P3MD 3X1VA 5GSUA 3REKD 3MVDD 2HIOA 1ULYA 3EPKA 1P3KB 3W99D 1BH9B 4J8UA 5B40A 1P3MA 3C1CD 5C3IB 2IO5C 3LZ1C 3LJAD 3MVDA 3REKA 1P3ID 2Y2IA 3AFAD 3LELD 1U35D 3W99A 4JJNC 5KDMA 3VH5A 3X1VC 1JFIB 2BYKA 3C1CA 4R8PC 4YS3B 5B31B 2Y2PA 3LJAA 1P3IA 3AZNA 4J8UC 3V9RA 3AFAA 3LELA 1U35A 3UT9D 3W98C 1M18D 5B2JB 5AV6D 2G5IC 3UTAD 3AYWB 3B6GB 3AZMB 4XZQB 4G91B 3MGQB 3B6FD 4CAYA 3WA9B 4XUJB 5AV9D 3W99C 3X1SC 3WTPB 2YFWA 2LY8A 3UT9A 1M18A 2J8PA 3C1CC 5AV6A 2ZY3A 5GT0B 5B24D 4J8XB 2F8NH 3UTAA 4LD9C 3REHB 3H0LC 3MGSD 3LJAC 3B6FA 2ZM5A 3AFAC 5AV9A 1KU5A 1TZYC 3KXBD 4KGCB 4AWLB 2NQBD 3WAAC 4Z66B 5B24A 3AZEB 3WKJB 4ZUXB 3MGSA 1M1AB 1F66D 2Y2OA 5BT1C 5B32B 5B0ZB 1P3FC 3KXBA 3UT9C 1B67A 3KWQD 1M18C 4WNNA 3MGPB 4M6BA 2NQBA 4KHAB 3AZHC 5CPIC 2Y2MA 5E5AB 5B0YD 1AOIC 1HQ3D 5B2IB 4EO5B 1F66A 3IP4C 3A6ND 1P3OD 3AV2C 4J8VD 3KWQA 5B24C 1P3BD 2XD5A 3X1UB 3AZID 5DNNC 4X23D 3REJC 5B0YA 3AZJD 4YM6D 1N1JB 2BYMA 1P3GB 1HQ3A 3A6NA 3C1BD 4H9OA 3AN2B 1P3OA 3AV1B 1TAFA 4J8VA 1KX3C 1P3AD 1P3BA 5CPJD 3AZIA 4ZUXC 4X23A 1T3UA
chains in the Genus database with same CATH topology
3AZJA 4YM6A 1W2EA 3TU4C 4WU9C 5AY8C 4NE6A 4CSRA 3EPLA 2DQNC 2PYOC 1H3OB 4UUZA 5AVBB 3O62B 3C1BA 4WV4B 3W96B 1KX5D 1P3AA 5CHLB 5CPJA 3AZGB 2HUEC 1M19B 1ZLAD 4QLCB 2ZY4A 1A7WA 4Z5TB 5AV8C 4J8WC 1KX5A 2RIQA 3X1TB 5BNVB 4WU8B 5AV5B 4KUDC 3LZ1D 3UTBC 4H9PB 3RELC 2CWEA 1KX4D 3B0DB 3AZFB 4JJND 4ZBJC 1S32B 5B1LC 3B0BA 5B33B 5CPKC 2UWXA 3EPJA 5JRGC 3AL0C 4R8PD 3LZ1A 4H9NB 3A1KA 1KX4A 4JJNA 5GXQB 3W98D 4NFTA 3AZKB 1M19C 4G92B 3B0CT 1ZLAC 4R8PA 1P34C 3REIC 5F99B 1ID3C 3X1SD 1EQZB 3W97B 5JA4B 5AVCC 4H9SC 5GT3C 3MGRC 2FJ7B 5B31G 3W98A 3AZLC 4DRBA 5GSUB 5AV5C 4LD9D 2AROC 3LZ0C 2HIOB 4HGAB 1KX4C 1TZYD 3X1SA 5B40B 2F8NG 1P3MB 3WAAD 4LD9A 3KUYC 3REKB 4WZSB 3MVDB 5BT1D 1P3LC 5B1MB 1P3FD 1TZYA 5B2JD 5KDMB 3AZMD 3AZHD 5CPID 2BYKB 4XZQD 3WAAA 3WTPE 2F8ND 4XUJD 1AOID 1P3KC 2JSSA 1P3IB 2G5HC 3AZNB 3VH5W 3V9RB 3AV2D 3LELB 1U35B 1P3FA 5B2JA 5B32G 5C3IC 3AZMA 3AZHA 5CPIA 4XZQA 5DNND 3P5JB 3REJD 2F8NA 4XUJA 1AOIA 1BH8A 3AV2A 4H9RA 5AV6B 4YS3C 1KX3D 5B31C 1P3PB 3UTAB 4ZUXD 3WKJD 5DNNA 5B32D 3REJA 3B6FB 3TU4D 4WU9D 5AV9B 5FUGB 5AY8D 2PYOD 5B2JC 1R4VA 3B6GC 3R45B 3AYWC 2CV5B 3AZMC 5E5AD 4G91C 4XZQC 3MGQC 1KX3A 3WA9C 4XUJC 4ZUXA 3WKJA 5B32A 3MGSB 3WTPC 3VH6T 3TU4A 4WU9A 5AY8A 3KXBB 3FDDA 2PYOA 5GT0C 4WNNB 5AV8D 4J8XC 2NQBB 3REHC 4E45A 4J8WD 5E5AA 1P3GD 2JCHA 4KGCC 1F66B 4KUDD 2F8NK 1WWSA 2FFFB 4AWLC 3UTBD 3RELD 2Y2GA 3KWQB 4Z66C 4WJ3C 5AV8A 5B1LD 3AZEC 4J8WA 3WKJC 5CPKD 1M1AC 5B32C 5B0YB 5B0ZC 1P3GA 5JRGD 2BYMB 2BG1A 1HQ3B 5AVBD 4KUDA 3A6NB 3UTBA 3MGPC 1P3OB 3W96D 1F1EA 3RELA 2NZDB 4J8VB 4NE5A 5E5AC 5B1LA 1P3BB 3AZGD 3AZIB 1M19D 2Y2NA 2YFVA 4EO5C 5B2IC 4X23B 5CPKA 3AZJB 4YM6B 5JRGA 1P34D 3REID 1ID3D 3MNNB 4CSRB 3F6TA 5AVBA 4UUZB 3C1BB 3W96A 3X1UC 5BS7C 5AVCD 5GT3D 3MGRD 1P3AB 5CPJB 1P3GC 3AZLD 3AZGA 1M19A 2F2AC 5AV5D 1ZLAA 1PZRA 3AN2C 1P34A 2AROD 3LZ0D 3REIA 3AV1C 1ID3A 5DNMB 4Z2MH 5B33D 4H9QA 5AVCA 3NQUB 2W8SA 4H9SA 5GT3A 3MGRA 5BNXA 1KX5B 3AZLA 5AV5A 5AVBC 3KUYD 3O62C 2AROA 3LZ0A 3W96C 1WWIA 1P3LD 5GXQD 3AZKD 2JE5A 4DRAA 5B33A 1Z2CB 3AZGC 3NQJA 5BO0A 2RVQC 4QLCC 4Z5TC 1P3KD 3KUYA 3LZ1B 5G49A 1EQZD 1P3LA 5CP6B 3AZKA 4JJNB 3H0MC 3X1TC 3X1VB 4WU8C 4R8PB 1B6WA 5DNMC 3B0DC 1P3KA 3AZFC 1BH9A 4NE3A 1S32C 1EQZA 5JA4A 4J8UB 5B33C 3W98B 4YS3D 5B31D 5B1MD 3KSYA 5GXQC 3AZKC 3W99B 4DQYB 3X1SB 2Y2JA 1JFIA 4G92C 3AYWD 3B6GD 3C1CB 3A1IA 4YS3A 3MGQD 5F99C 5B31A 3WA9D 4LD9B 2Y2QA 3AZND 3LJAB 1EQZC 3W97C 5B1MA 5CP6C 3WTPD 2FJ7C 3AFAB 1TZYB 5GT0D 5GSUC 4J8XD 3B6GA 3AYWA 3REHD 3WAAB 2ZY2A 3MGQA 2HIOC 3WA9A 4HGAC 4CAYB 4KGCD 5B40C 3WTPA 1P3FB 2YFWB 1P3MC 3UT9B 4Z66D 5GT0A 1M18B 4J8XA 1P3PD 3REHA 2L5AA 3AZHB 3REKC 3AZED 3MVDC 5CPIB 1M1AD 2F8NB 5B0ZD 5B1MC 1AOIB 2DF4C 4KGCA 1BH8B 3MGPD 3AV2B 2CV5D 3EPHA 3H0RC 4Z66A 4H9RB 5B24B 1P3PA 3AZEA 5B2ID 5DNNB 1P3IC 1M1AA 3REJB 3AZNC 5B0ZA 1U35C 3LELC 2ZY5A 5FUGA 3MGPA 3R45A 2CV5A 3X1UD 4KHAA 3B0CW 1KX3B 5B2IA 2XD1A 2Y2KA 3AN2D 4UPKA 3TU4B 3AV1D 4WU9B 5AY8B 2PYOB 2Y2LA 5AV6C 1P3PC 3X1UA 5BS7A 3UTAC 3EG5B 3B6FC 1N1JA 5AV9C 2HUEB 1BFMA 4Z2MG 3O62D 3AN2A 4H9OB 3AV1A 2NZDD 2CV5C 3KFUG 1TAFB 5AV8B 4J8WB 2VQRA 3MGSC 2RVQD 4QLCD 3MNND 3KXBC 4Z5TD 1H3OA 4KUDB 3O62A 3UTBB 2NZDA 2NQBC 3RELB 4ZBJB 5B1LB 3X1TD 4WU8D 2YFVB 5CPKB 4QLCA 1F66C 5JRGB 3MNNA 5DNMD 4Z5TA 4E44A 3KWQC 3AZFD 1S32D 3VH5T 5B0YC 3X1TA 5BNVA 1HQ3C 4WU8A 1ZLAB 3A6NC 1P3OC 4H9PA 3VH6A 1P34B 3REIB 1ID3B 5DNMA 4J8VC 2NZDC 3AZFA 1S32A 1P3BC 3AZIC 3NQUA 4H9QB 5AVCB 5GT3B 4X23C 3MGRB 5BNXB 1Q9CA 4YM6C 3AZJC 3AZLB 5F99D 3MNNC 3C1BC 2IO5B 3W97D 2AROB 4H9NA 3LZ0B 5CP6D 2FJ7D 1KX4B 5GXQA 1P3AC 5CPJC 3X1VD 5GSUD 3NQJB 5BO0B 1HTAA 3VH6W 5F99A 2HIOD 3KUYB 4J8UD 5G49B 3W97A 5B40D 5CP6A 2Y2HA 1P3LB 2FJ7A 1KX5C 1P3MD 3X1VA 5GSUA 3REKD 3MVDD 2HIOA 1ULYA 3EPKA 1P3KB 3W99D 1BH9B 4J8UA 5B40A 1P3MA 3C1CD 5C3IB 2IO5C 3LZ1C 3LJAD 3MVDA 3REKA 1P3ID 2Y2IA 3AFAD 3LELD 1U35D 3W99A 4JJNC 5KDMA 3VH5A 3X1VC 1JFIB 2BYKA 3C1CA 4R8PC 4YS3B 5B31B 2Y2PA 3LJAA 1P3IA 3AZNA 4J8UC 3V9RA 3AFAA 3LELA 1U35A 3UT9D 3W98C 1M18D 5B2JB 5AV6D 2G5IC 3UTAD 3AYWB 3B6GB 3AZMB 4XZQB 4G91B 3MGQB 3B6FD 4CAYA 3WA9B 4XUJB 5AV9D 3W99C 3X1SC 3WTPB 2YFWA 2LY8A 3UT9A 1M18A 2J8PA 3C1CC 5AV6A 2ZY3A 5GT0B 5B24D 4J8XB 2F8NH 3UTAA 4LD9C 3REHB 3H0LC 3MGSD 3LJAC 3B6FA 2ZM5A 3AFAC 5AV9A 1KU5A 1TZYC 3KXBD 4KGCB 4AWLB 2NQBD 3WAAC 4Z66B 5B24A 3AZEB 3WKJB 4ZUXB 3MGSA 1M1AB 1F66D 2Y2OA 5BT1C 5B32B 5B0ZB 1P3FC 3KXBA 3UT9C 1B67A 3KWQD 1M18C 4WNNA 3MGPB 4M6BA 2NQBA 4KHAB 3AZHC 5CPIC 2Y2MA 5E5AB 5B0YD 1AOIC 1HQ3D 5B2IB 4EO5B 1F66A 3IP4C 3A6ND 1P3OD 3AV2C 4J8VD 3KWQA 5B24C 1P3BD 2XD5A 3X1UB 3AZID 5DNNC 4X23D 3REJC 5B0YA 3AZJD 4YM6D 1N1JB 2BYMA 1P3GB 1HQ3A 3A6NA 3C1BD 4H9OA 3AN2B 1P3OA 3AV1B 1TAFA 4J8VA 1KX3C 1P3AD 1P3BA 5CPJD 3AZIA 4ZUXC 4X23A 1T3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZJ A;  4YM6 A;  3TU4 C;  4WU9 C;  5AY8 C;  4NE6 A;  4CSR A;  2PYO C;  1H3O B;  4UUZ A;  5AVB B;  3O62 B;  3C1B A;  4WV4 B;  3W96 B;  1KX5 D;  1P3A A;  5CHL B;  5CPJ A;  3AZG B;  2HUE C;  1M19 B;  1ZLA D;  4QLC B;  1A7W A;  4Z5T B;  5AV8 C;  4J8W C;  1KX5 A;  3X1T B;  5BNV B;  4WU8 B;  5AV5 B;  4KUD C;  3LZ1 D;  3UTB C;  4H9P B;  3REL C;  2CWE A;  1KX4 D;  3B0D B;  3AZF B;  4JJN D;  4ZBJ C;  1S32 B;  5B1L C;  3B0B A;  5B33 B;  5CPK C;  5JRG C;  4R8P D;  3LZ1 A;  4H9N B;  1KX4 A;  4JJN A;  5GXQ B;  3W98 D;  4NFT A;  3AZK B;  1M19 C;  4G92 B;  3B0C T;  1ZLA C;  4R8P A;  1P34 C;  3REI C;  5F99 B;  1ID3 C;  3X1S D;  1EQZ B;  3W97 B;  5JA4 B;  5AVC C;  4H9S C;  5GT3 C;  3MGR C;  2FJ7 B;  5B31 G;  3W98 A;  3AZL C;  4DRB A;  5GSU B;  5AV5 C;  4LD9 D;  2ARO C;  3LZ0 C;  2HIO B;  4HGA B;  1KX4 C;  1TZY D;  3X1S A;  5B40 B;  2F8N G;  1P3M B;  3WAA D;  4LD9 A;  3KUY C;  3REK B;  4WZS B;  3MVD B;  5BT1 D;  1P3L C;  5B1M B;  1P3F D;  1TZY A;  5B2J D;  5KDM B;  3AZM D;  3AZH D;  5CPI D;  2BYK B;  4XZQ D;  3WAA A;  3WTP E;  2F8N D;  4XUJ D;  1AOI D;  1P3K C;  2JSS A;  1P3I B;  3AZN B;  3VH5 W;  3V9R B;  3AV2 D;  3LEL B;  1U35 B;  1P3F A;  5B2J A;  5B32 G;  5C3I C;  3AZM A;  3AZH A;  5CPI A;  4XZQ A;  5DNN D;  3REJ D;  2F8N A;  4XUJ A;  1AOI A;  1BH8 A;  3AV2 A;  4H9R A;  5AV6 B;  4YS3 C;  1KX3 D;  5B31 C;  1P3P B;  3UTA B;  4ZUX D;  3WKJ D;  5DNN A;  5B32 D;  3REJ A;  3B6F B;  3TU4 D;  4WU9 D;  5AV9 B;  5FUG B;  5AY8 D;  2PYO D;  5B2J C;  1R4V A;  3B6G C;  3R45 B;  3AYW C;  2CV5 B;  3AZM C;  5E5A D;  4G91 C;  4XZQ C;  3MGQ C;  1KX3 A;  3WA9 C;  4XUJ C;  4ZUX A;  3WKJ A;  5B32 A;  3MGS B;  3WTP C;  3VH6 T;  3TU4 A;  4WU9 A;  5AY8 A;  3KXB B;  2PYO A;  5GT0 C;  4WNN B;  5AV8 D;  4J8X C;  2NQB B;  3REH C;  4E45 A;  4J8W D;  5E5A A;  1P3G D;  4KGC C;  1F66 B;  4KUD D;  2F8N K;  1WWS A;  4AWL C;  3UTB D;  3REL D;  3KWQ B;  4Z66 C;  5AV8 A;  5B1L D;  3AZE C;  4J8W A;  3WKJ C;  5CPK D;  1M1A C;  5B32 C;  5B0Y B;  5B0Z C;  1P3G A;  5JRG D;  2BYM B;  1HQ3 B;  5AVB D;  4KUD A;  3A6N B;  3UTB A;  3MGP C;  1P3O B;  3W96 D;  1F1E A;  3REL A;  2NZD B;  4J8V B;  4NE5 A;  5E5A C;  5B1L A;  1P3B B;  3AZG D;  3AZI B;  1M19 D;  5B2I C;  2YFV A;  4EO5 C;  4X23 B;  5CPK A;  3AZJ B;  4YM6 B;  5JRG A;  1P34 D;  3REI D;  1ID3 D;  3MNN B;  4CSR B;  5AVB A;  4UUZ B;  3C1B B;  3W96 A;  3X1U C;  5BS7 C;  5AVC D;  5GT3 D;  3MGR D;  1P3A B;  5CPJ B;  1P3G C;  3AZL D;  3AZG A;  1M19 A;  5AV5 D;  1ZLA A;  3AN2 C;  1P34 A;  2ARO D;  3LZ0 D;  3REI A;  3AV1 C;  1ID3 A;  5DNM B;  4Z2M H;  5B33 D;  4H9Q A;  5AVC A;  3NQU B;  4H9S A;  5GT3 A;  3MGR A;  1KX5 B;  5BNX A;  3AZL A;  5AV5 A;  5AVB C;  3KUY D;  3O62 C;  2ARO A;  3LZ0 A;  3W96 C;  1WWI A;  1P3L D;  5GXQ D;  3AZK D;  4DRA A;  5B33 A;  3AZG C;  3NQJ A;  5BO0 A;  2RVQ C;  4QLC C;  4Z5T C;  1P3K D;  3KUY A;  3LZ1 B;  5G49 A;  1EQZ D;  1P3L A;  5CP6 B;  3AZK A;  4JJN B;  3X1T C;  3X1V B;  4WU8 C;  4R8P B;  1B6W A;  5DNM C;  3B0D C;  1P3K A;  3AZF C;  1BH9 A;  4NE3 A;  1S32 C;  1EQZ A;  5JA4 A;  4J8U B;  5B33 C;  3W98 B;  4YS3 D;  5B31 D;  5B1M D;  3KSY A;  5GXQ C;  3AZK C;  3W99 B;  3X1S B;  1JFI A;  4G92 C;  3AYW D;  3B6G D;  3C1C B;  4YS3 A;  3MGQ D;  5F99 C;  5B31 A;  3WA9 D;  4LD9 B;  3AZN D;  3LJA B;  1EQZ C;  3W97 C;  5B1M A;  5CP6 C;  3WTP D;  2FJ7 C;  3AFA B;  1TZY B;  5GT0 D;  5GSU C;  4J8X D;  3B6G A;  3AYW A;  3REH D;  3WAA B;  3MGQ A;  2HIO C;  3WA9 A;  4HGA C;  4CAY B;  4KGC D;  5B40 C;  3WTP A;  1P3F B;  2YFW B;  1P3M C;  3UT9 B;  4Z66 D;  5GT0 A;  1M18 B;  4J8X A;  1P3P D;  3REH A;  2L5A A;  3AZH B;  3REK C;  3AZE D;  3MVD C;  5CPI B;  1M1A D;  2F8N B;  5B0Z D;  5B1M C;  1AOI B;  4KGC A;  1BH8 B;  3MGP D;  3AV2 B;  2CV5 D;  4Z66 A;  4H9R B;  5B24 B;  1P3P A;  3AZE A;  5B2I D;  5DNN B;  1P3I C;  1M1A A;  3REJ B;  3AZN C;  5B0Z A;  1U35 C;  3LEL C;  5FUG A;  3MGP A;  3R45 A;  2CV5 A;  3X1U D;  4KHA A;  3B0C W;  1KX3 B;  5B2I A;  3AN2 D;  3TU4 B;  3AV1 D;  4WU9 B;  5AY8 B;  2PYO B;  5AV6 C;  1P3P C;  3X1U A;  5BS7 A;  3UTA C;  3B6F C;  1N1J A;  5AV9 C;  2HUE B;  1BFM A;  4Z2M G;  3O62 D;  3AN2 A;  4H9O B;  3AV1 A;  2NZD D;  2CV5 C;  1TAF B;  5AV8 B;  4J8W B;  3MGS C;  2RVQ D;  4QLC D;  3MNN D;  3KXB C;  4Z5T D;  1H3O A;  4KUD B;  3O62 A;  3UTB B;  2NZD A;  2NQB C;  3REL B;  4ZBJ B;  5B1L B;  3X1T D;  4WU8 D;  2YFV B;  5CPK B;  4QLC A;  1F66 C;  5JRG B;  3MNN A;  5DNM D;  4Z5T A;  4E44 A;  3KWQ C;  3AZF D;  1S32 D;  3VH5 T;  5B0Y C;  3X1T A;  5BNV A;  1HQ3 C;  4WU8 A;  1ZLA B;  3A6N C;  1P3O C;  4H9P A;  3VH6 A;  1P34 B;  3REI B;  1ID3 B;  5DNM A;  4J8V C;  2NZD C;  3AZF A;  1S32 A;  1P3B C;  3AZI C;  3NQU A;  4H9Q B;  5AVC B;  5GT3 B;  4X23 C;  3MGR B;  5BNX B;  1Q9C A;  4YM6 C;  3AZJ C;  3AZL B;  5F99 D;  3MNN C;  3C1B C;  2IO5 B;  3W97 D;  2ARO B;  4H9N A;  3LZ0 B;  5CP6 D;  2FJ7 D;  1KX4 B;  5GXQ A;  1P3A C;  5CPJ C;  3X1V D;  5GSU D;  3NQJ B;  5BO0 B;  1HTA A;  3VH6 W;  5F99 A;  2HIO D;  3KUY B;  4J8U D;  5G49 B;  3W97 A;  5B40 D;  5CP6 A;  2FJ7 A;  1P3L B;  1KX5 C;  1P3M D;  3X1V A;  5GSU A;  3REK D;  3MVD D;  2HIO A;  1ULY A;  1P3K B;  3W99 D;  1BH9 B;  4J8U A;  5B40 A;  1P3M A;  3C1C D;  5C3I B;  2IO5 C;  3LZ1 C;  3LJA D;  3MVD A;  3REK A;  1P3I D;  3AFA D;  3LEL D;  1U35 D;  3W99 A;  4JJN C;  5KDM A;  3VH5 A;  3X1V C;  1JFI B;  2BYK A;  3C1C A;  4R8P C;  4YS3 B;  5B31 B;  3LJA A;  1P3I A;  3AZN A;  4J8U C;  3V9R A;  3AFA A;  3LEL A;  1U35 A;  3UT9 D;  3W98 C;  1M18 D;  5B2J B;  5AV6 D;  3B6G B;  3UTA D;  3AYW B;  3AZM B;  4XZQ B;  4G91 B;  3MGQ B;  3B6F D;  4CAY A;  3WA9 B;  4XUJ B;  5AV9 D;  3W99 C;  3X1S C;  3WTP B;  2YFW A;  2LY8 A;  3UT9 A;  1M18 A;  3C1C C;  5AV6 A;  5GT0 B;  5B24 D;  4J8X B;  2F8N H;  3UTA A;  4LD9 C;  3REH B;  3MGS D;  3LJA C;  3B6F A;  3AFA C;  5AV9 A;  1KU5 A;  1TZY C;  3KXB D;  4KGC B;  4AWL B;  2NQB D;  3WAA C;  4Z66 B;  5B24 A;  3AZE B;  3WKJ B;  4ZUX B;  3MGS A;  1M1A B;  1F66 D;  5BT1 C;  5B32 B;  5B0Z B;  1P3F C;  3KXB A;  3UT9 C;  1B67 A;  3KWQ D;  1M18 C;  4WNN A;  3MGP B;  4M6B A;  2NQB A;  4KHA B;  3AZH C;  5CPI C;  5E5A B;  5B0Y D;  1AOI C;  1HQ3 D;  5B2I B;  4EO5 B;  1F66 A;  3A6N D;  1P3O D;  3AV2 C;  4J8V D;  3KWQ A;  5B24 C;  1P3B D;  3X1U B;  3AZI D;  5DNN C;  4X23 D;  3REJ C;  5B0Y A;  3AZJ D;  4YM6 D;  1N1J B;  2BYM A;  1P3G B;  1HQ3 A;  3A6N A;  3C1B D;  4H9O A;  3AN2 B;  1P3O A;  3AV1 B;  1TAF A;  4J8V A;  1KX3 C;  1P3A D;  1P3B A;  5CPJ D;  3AZI A;  4ZUX C;  4X23 A; 
#chains in the Genus database with same CATH topology
 3AZJ A;  4YM6 A;  1W2E A;  3TU4 C;  4WU9 C;  5AY8 C;  4NE6 A;  4CSR A;  3EPL A;  2DQN C;  2PYO C;  1H3O B;  4UUZ A;  5AVB B;  3O62 B;  3C1B A;  4WV4 B;  3W96 B;  1KX5 D;  1P3A A;  5CHL B;  5CPJ A;  3AZG B;  2HUE C;  1M19 B;  1ZLA D;  4QLC B;  2ZY4 A;  1A7W A;  4Z5T B;  5AV8 C;  4J8W C;  1KX5 A;  2RIQ A;  3X1T B;  5BNV B;  4WU8 B;  5AV5 B;  4KUD C;  3LZ1 D;  3UTB C;  4H9P B;  3REL C;  2CWE A;  1KX4 D;  3B0D B;  3AZF B;  4JJN D;  4ZBJ C;  1S32 B;  5B1L C;  3B0B A;  5B33 B;  5CPK C;  2UWX A;  3EPJ A;  5JRG C;  3AL0 C;  4R8P D;  3LZ1 A;  4H9N B;  3A1K A;  1KX4 A;  4JJN A;  5GXQ B;  3W98 D;  4NFT A;  3AZK B;  1M19 C;  4G92 B;  3B0C T;  1ZLA C;  4R8P A;  1P34 C;  3REI C;  5F99 B;  1ID3 C;  3X1S D;  1EQZ B;  3W97 B;  5JA4 B;  5AVC C;  4H9S C;  5GT3 C;  3MGR C;  2FJ7 B;  5B31 G;  3W98 A;  3AZL C;  4DRB A;  5GSU B;  5AV5 C;  4LD9 D;  2ARO C;  3LZ0 C;  2HIO B;  4HGA B;  1KX4 C;  1TZY D;  3X1S A;  5B40 B;  2F8N G;  1P3M B;  3WAA D;  4LD9 A;  3KUY C;  3REK B;  4WZS B;  3MVD B;  5BT1 D;  1P3L C;  5B1M B;  1P3F D;  1TZY A;  5B2J D;  5KDM B;  3AZM D;  3AZH D;  5CPI D;  2BYK B;  4XZQ D;  3WAA A;  3WTP E;  2F8N D;  4XUJ D;  1AOI D;  1P3K C;  2JSS A;  1P3I B;  2G5H C;  3AZN B;  3VH5 W;  3V9R B;  3AV2 D;  3LEL B;  1U35 B;  1P3F A;  5B2J A;  5B32 G;  5C3I C;  3AZM A;  3AZH A;  5CPI A;  4XZQ A;  5DNN D;  3P5J B;  3REJ D;  2F8N A;  4XUJ A;  1AOI A;  1BH8 A;  3AV2 A;  4H9R A;  5AV6 B;  4YS3 C;  1KX3 D;  5B31 C;  1P3P B;  3UTA B;  4ZUX D;  3WKJ D;  5DNN A;  5B32 D;  3REJ A;  3B6F B;  3TU4 D;  4WU9 D;  5AV9 B;  5FUG B;  5AY8 D;  2PYO D;  5B2J C;  1R4V A;  3B6G C;  3R45 B;  3AYW C;  2CV5 B;  3AZM C;  5E5A D;  4G91 C;  4XZQ C;  3MGQ C;  1KX3 A;  3WA9 C;  4XUJ C;  4ZUX A;  3WKJ A;  5B32 A;  3MGS B;  3WTP C;  3VH6 T;  3TU4 A;  4WU9 A;  5AY8 A;  3KXB B;  3FDD A;  2PYO A;  5GT0 C;  4WNN B;  5AV8 D;  4J8X C;  2NQB B;  3REH C;  4E45 A;  4J8W D;  5E5A A;  1P3G D;  2JCH A;  4KGC C;  1F66 B;  4KUD D;  2F8N K;  1WWS A;  2FFF B;  4AWL C;  3UTB D;  3REL D;  2Y2G A;  3KWQ B;  4Z66 C;  4WJ3 C;  5AV8 A;  5B1L D;  3AZE C;  4J8W A;  3WKJ C;  5CPK D;  1M1A C;  5B32 C;  5B0Y B;  5B0Z C;  1P3G A;  5JRG D;  2BYM B;  2BG1 A;  1HQ3 B;  5AVB D;  4KUD A;  3A6N B;  3UTB A;  3MGP C;  1P3O B;  3W96 D;  1F1E A;  3REL A;  2NZD B;  4J8V B;  4NE5 A;  5E5A C;  5B1L A;  1P3B B;  3AZG D;  3AZI B;  1M19 D;  2Y2N A;  2YFV A;  4EO5 C;  5B2I C;  4X23 B;  5CPK A;  3AZJ B;  4YM6 B;  5JRG A;  1P34 D;  3REI D;  1ID3 D;  3MNN B;  4CSR B;  3F6T A;  5AVB A;  4UUZ B;  3C1B B;  3W96 A;  3X1U C;  5BS7 C;  5AVC D;  5GT3 D;  3MGR D;  1P3A B;  5CPJ B;  1P3G C;  3AZL D;  3AZG A;  1M19 A;  2F2A C;  5AV5 D;  1ZLA A;  1PZR A;  3AN2 C;  1P34 A;  2ARO D;  3LZ0 D;  3REI A;  3AV1 C;  1ID3 A;  5DNM B;  4Z2M H;  5B33 D;  4H9Q A;  5AVC A;  3NQU B;  2W8S A;  4H9S A;  5GT3 A;  3MGR A;  5BNX A;  1KX5 B;  3AZL A;  5AV5 A;  5AVB C;  3KUY D;  3O62 C;  2ARO A;  3LZ0 A;  3W96 C;  1WWI A;  1P3L D;  5GXQ D;  3AZK D;  2JE5 A;  4DRA A;  5B33 A;  1Z2C B;  3AZG C;  3NQJ A;  5BO0 A;  2RVQ C;  4QLC C;  4Z5T C;  1P3K D;  3KUY A;  3LZ1 B;  5G49 A;  1EQZ D;  1P3L A;  5CP6 B;  3AZK A;  4JJN B;  3H0M C;  3X1T C;  3X1V B;  4WU8 C;  4R8P B;  1B6W A;  5DNM C;  3B0D C;  1P3K A;  3AZF C;  1BH9 A;  4NE3 A;  1S32 C;  1EQZ A;  5JA4 A;  4J8U B;  5B33 C;  3W98 B;  4YS3 D;  5B31 D;  5B1M D;  3KSY A;  5GXQ C;  3AZK C;  3W99 B;  4DQY B;  3X1S B;  2Y2J A;  1JFI A;  4G92 C;  3AYW D;  3B6G D;  3C1C B;  3A1I A;  4YS3 A;  3MGQ D;  5F99 C;  5B31 A;  3WA9 D;  4LD9 B;  2Y2Q A;  3AZN D;  3LJA B;  1EQZ C;  3W97 C;  5B1M A;  5CP6 C;  3WTP D;  2FJ7 C;  3AFA B;  1TZY B;  5GT0 D;  5GSU C;  4J8X D;  3B6G A;  3AYW A;  3REH D;  3WAA B;  2ZY2 A;  3MGQ A;  2HIO C;  3WA9 A;  4HGA C;  4CAY B;  4KGC D;  5B40 C;  3WTP A;  1P3F B;  2YFW B;  1P3M C;  3UT9 B;  4Z66 D;  5GT0 A;  1M18 B;  4J8X A;  1P3P D;  3REH A;  2L5A A;  3AZH B;  3REK C;  3AZE D;  3MVD C;  5CPI B;  1M1A D;  2F8N B;  5B0Z D;  5B1M C;  1AOI B;  2DF4 C;  4KGC A;  1BH8 B;  3MGP D;  3AV2 B;  2CV5 D;  3EPH A;  3H0R C;  4Z66 A;  4H9R B;  5B24 B;  1P3P A;  3AZE A;  5B2I D;  5DNN B;  1P3I C;  1M1A A;  3REJ B;  3AZN C;  5B0Z A;  1U35 C;  3LEL C;  2ZY5 A;  5FUG A;  3MGP A;  3R45 A;  2CV5 A;  3X1U D;  4KHA A;  3B0C W;  1KX3 B;  5B2I A;  2XD1 A;  2Y2K A;  3AN2 D;  4UPK A;  3TU4 B;  3AV1 D;  4WU9 B;  5AY8 B;  2PYO B;  2Y2L A;  5AV6 C;  1P3P C;  3X1U A;  5BS7 A;  3UTA C;  3EG5 B;  3B6F C;  1N1J A;  5AV9 C;  2HUE B;  1BFM A;  4Z2M G;  3O62 D;  3AN2 A;  4H9O B;  3AV1 A;  2NZD D;  2CV5 C;  3KFU G;  1TAF B;  5AV8 B;  4J8W B;  2VQR A;  3MGS C;  2RVQ D;  4QLC D;  3MNN D;  3KXB C;  4Z5T D;  1H3O A;  4KUD B;  3O62 A;  3UTB B;  2NZD A;  2NQB C;  3REL B;  4ZBJ B;  5B1L B;  3X1T D;  4WU8 D;  2YFV B;  5CPK B;  4QLC A;  1F66 C;  5JRG B;  3MNN A;  5DNM D;  4Z5T A;  4E44 A;  3KWQ C;  3AZF D;  1S32 D;  3VH5 T;  5B0Y C;  3X1T A;  5BNV A;  1HQ3 C;  4WU8 A;  1ZLA B;  3A6N C;  1P3O C;  4H9P A;  3VH6 A;  1P34 B;  3REI B;  1ID3 B;  5DNM A;  4J8V C;  2NZD C;  3AZF A;  1S32 A;  1P3B C;  3AZI C;  3NQU A;  4H9Q B;  5AVC B;  5GT3 B;  4X23 C;  3MGR B;  5BNX B;  1Q9C A;  4YM6 C;  3AZJ C;  3AZL B;  5F99 D;  3MNN C;  3C1B C;  2IO5 B;  3W97 D;  2ARO B;  4H9N A;  3LZ0 B;  5CP6 D;  2FJ7 D;  1KX4 B;  5GXQ A;  1P3A C;  5CPJ C;  3X1V D;  5GSU D;  3NQJ B;  5BO0 B;  1HTA A;  3VH6 W;  5F99 A;  2HIO D;  3KUY B;  4J8U D;  5G49 B;  3W97 A;  5B40 D;  5CP6 A;  2Y2H A;  1P3L B;  2FJ7 A;  1KX5 C;  1P3M D;  3X1V A;  5GSU A;  3REK D;  3MVD D;  2HIO A;  1ULY A;  3EPK A;  1P3K B;  3W99 D;  1BH9 B;  4J8U A;  5B40 A;  1P3M A;  3C1C D;  5C3I B;  2IO5 C;  3LZ1 C;  3LJA D;  3MVD A;  3REK A;  1P3I D;  2Y2I A;  3AFA D;  3LEL D;  1U35 D;  3W99 A;  4JJN C;  5KDM A;  3VH5 A;  3X1V C;  1JFI B;  2BYK A;  3C1C A;  4R8P C;  4YS3 B;  5B31 B;  2Y2P A;  3LJA A;  1P3I A;  3AZN A;  4J8U C;  3V9R A;  3AFA A;  3LEL A;  1U35 A;  3UT9 D;  3W98 C;  1M18 D;  5B2J B;  5AV6 D;  2G5I C;  3UTA D;  3AYW B;  3B6G B;  3AZM B;  4XZQ B;  4G91 B;  3MGQ B;  3B6F D;  4CAY A;  3WA9 B;  4XUJ B;  5AV9 D;  3W99 C;  3X1S C;  3WTP B;  2YFW A;  2LY8 A;  3UT9 A;  1M18 A;  2J8P A;  3C1C C;  5AV6 A;  2ZY3 A;  5GT0 B;  5B24 D;  4J8X B;  2F8N H;  3UTA A;  4LD9 C;  3REH B;  3H0L C;  3MGS D;  3LJA C;  3B6F A;  2ZM5 A;  3AFA C;  5AV9 A;  1KU5 A;  1TZY C;  3KXB D;  4KGC B;  4AWL B;  2NQB D;  3WAA C;  4Z66 B;  5B24 A;  3AZE B;  3WKJ B;  4ZUX B;  3MGS A;  1M1A B;  1F66 D;  2Y2O A;  5BT1 C;  5B32 B;  5B0Z B;  1P3F C;  3KXB A;  3UT9 C;  1B67 A;  3KWQ D;  1M18 C;  4WNN A;  3MGP B;  4M6B A;  2NQB A;  4KHA B;  3AZH C;  5CPI C;  2Y2M A;  5E5A B;  5B0Y D;  1AOI C;  1HQ3 D;  5B2I B;  4EO5 B;  1F66 A;  3IP4 C;  3A6N D;  1P3O D;  3AV2 C;  4J8V D;  3KWQ A;  5B24 C;  1P3B D;  2XD5 A;  3X1U B;  3AZI D;  5DNN C;  4X23 D;  3REJ C;  5B0Y A;  3AZJ D;  4YM6 D;  1N1J B;  2BYM A;  1P3G B;  1HQ3 A;  3A6N A;  3C1B D;  4H9O A;  3AN2 B;  1P3O A;  3AV1 B;  1TAF A;  4J8V A;  1KX3 C;  1P3A D;  1P3B A;  5CPJ D;  3AZI A;  4ZUX C;  4X23 A;  1T3U A; 
#chains in the Genus database with same CATH homology
 3AZJ A;  4YM6 A;  1W2E A;  3TU4 C;  4WU9 C;  5AY8 C;  4NE6 A;  4CSR A;  3EPL A;  2DQN C;  2PYO C;  1H3O B;  4UUZ A;  5AVB B;  3O62 B;  3C1B A;  4WV4 B;  3W96 B;  1KX5 D;  1P3A A;  5CHL B;  5CPJ A;  3AZG B;  2HUE C;  1M19 B;  1ZLA D;  4QLC B;  2ZY4 A;  1A7W A;  4Z5T B;  5AV8 C;  4J8W C;  1KX5 A;  2RIQ A;  3X1T B;  5BNV B;  4WU8 B;  5AV5 B;  4KUD C;  3LZ1 D;  3UTB C;  4H9P B;  3REL C;  2CWE A;  1KX4 D;  3B0D B;  3AZF B;  4JJN D;  4ZBJ C;  1S32 B;  5B1L C;  3B0B A;  5B33 B;  5CPK C;  2UWX A;  3EPJ A;  5JRG C;  3AL0 C;  4R8P D;  3LZ1 A;  4H9N B;  3A1K A;  1KX4 A;  4JJN A;  5GXQ B;  3W98 D;  4NFT A;  3AZK B;  1M19 C;  4G92 B;  3B0C T;  1ZLA C;  4R8P A;  1P34 C;  3REI C;  5F99 B;  1ID3 C;  3X1S D;  1EQZ B;  3W97 B;  5JA4 B;  5AVC C;  4H9S C;  5GT3 C;  3MGR C;  2FJ7 B;  5B31 G;  3W98 A;  3AZL C;  4DRB A;  5GSU B;  5AV5 C;  4LD9 D;  2ARO C;  3LZ0 C;  2HIO B;  4HGA B;  1KX4 C;  1TZY D;  3X1S A;  5B40 B;  2F8N G;  1P3M B;  3WAA D;  4LD9 A;  3KUY C;  3REK B;  4WZS B;  3MVD B;  5BT1 D;  1P3L C;  5B1M B;  1P3F D;  1TZY A;  5B2J D;  5KDM B;  3AZM D;  3AZH D;  5CPI D;  2BYK B;  4XZQ D;  3WAA A;  3WTP E;  2F8N D;  4XUJ D;  1AOI D;  1P3K C;  2JSS A;  1P3I B;  2G5H C;  3AZN B;  3VH5 W;  3V9R B;  3AV2 D;  3LEL B;  1U35 B;  1P3F A;  5B2J A;  5B32 G;  5C3I C;  3AZM A;  3AZH A;  5CPI A;  4XZQ A;  5DNN D;  3P5J B;  3REJ D;  2F8N A;  4XUJ A;  1AOI A;  1BH8 A;  3AV2 A;  4H9R A;  5AV6 B;  4YS3 C;  1KX3 D;  5B31 C;  1P3P B;  3UTA B;  4ZUX D;  3WKJ D;  5DNN A;  5B32 D;  3REJ A;  3B6F B;  3TU4 D;  4WU9 D;  5AV9 B;  5FUG B;  5AY8 D;  2PYO D;  5B2J C;  1R4V A;  3B6G C;  3R45 B;  3AYW C;  2CV5 B;  3AZM C;  5E5A D;  4G91 C;  4XZQ C;  3MGQ C;  1KX3 A;  3WA9 C;  4XUJ C;  4ZUX A;  3WKJ A;  5B32 A;  3MGS B;  3WTP C;  3VH6 T;  3TU4 A;  4WU9 A;  5AY8 A;  3KXB B;  3FDD A;  2PYO A;  5GT0 C;  4WNN B;  5AV8 D;  4J8X C;  2NQB B;  3REH C;  4E45 A;  4J8W D;  5E5A A;  1P3G D;  2JCH A;  4KGC C;  1F66 B;  4KUD D;  2F8N K;  1WWS A;  2FFF B;  4AWL C;  3UTB D;  3REL D;  2Y2G A;  3KWQ B;  4Z66 C;  4WJ3 C;  5AV8 A;  5B1L D;  3AZE C;  4J8W A;  3WKJ C;  5CPK D;  1M1A C;  5B32 C;  5B0Y B;  5B0Z C;  1P3G A;  5JRG D;  2BYM B;  2BG1 A;  1HQ3 B;  5AVB D;  4KUD A;  3A6N B;  3UTB A;  3MGP C;  1P3O B;  3W96 D;  1F1E A;  3REL A;  2NZD B;  4J8V B;  4NE5 A;  5E5A C;  5B1L A;  1P3B B;  3AZG D;  3AZI B;  1M19 D;  2Y2N A;  2YFV A;  4EO5 C;  5B2I C;  4X23 B;  5CPK A;  3AZJ B;  4YM6 B;  5JRG A;  1P34 D;  3REI D;  1ID3 D;  3MNN B;  4CSR B;  3F6T A;  5AVB A;  4UUZ B;  3C1B B;  3W96 A;  3X1U C;  5BS7 C;  5AVC D;  5GT3 D;  3MGR D;  1P3A B;  5CPJ B;  1P3G C;  3AZL D;  3AZG A;  1M19 A;  2F2A C;  5AV5 D;  1ZLA A;  1PZR A;  3AN2 C;  1P34 A;  2ARO D;  3LZ0 D;  3REI A;  3AV1 C;  1ID3 A;  5DNM B;  4Z2M H;  5B33 D;  4H9Q A;  5AVC A;  3NQU B;  2W8S A;  4H9S A;  5GT3 A;  3MGR A;  5BNX A;  1KX5 B;  3AZL A;  5AV5 A;  5AVB C;  3KUY D;  3O62 C;  2ARO A;  3LZ0 A;  3W96 C;  1WWI A;  1P3L D;  5GXQ D;  3AZK D;  2JE5 A;  4DRA A;  5B33 A;  1Z2C B;  3AZG C;  3NQJ A;  5BO0 A;  2RVQ C;  4QLC C;  4Z5T C;  1P3K D;  3KUY A;  3LZ1 B;  5G49 A;  1EQZ D;  1P3L A;  5CP6 B;  3AZK A;  4JJN B;  3H0M C;  3X1T C;  3X1V B;  4WU8 C;  4R8P B;  1B6W A;  5DNM C;  3B0D C;  1P3K A;  3AZF C;  1BH9 A;  4NE3 A;  1S32 C;  1EQZ A;  5JA4 A;  4J8U B;  5B33 C;  3W98 B;  4YS3 D;  5B31 D;  5B1M D;  3KSY A;  5GXQ C;  3AZK C;  3W99 B;  4DQY B;  3X1S B;  2Y2J A;  1JFI A;  4G92 C;  3AYW D;  3B6G D;  3C1C B;  3A1I A;  4YS3 A;  3MGQ D;  5F99 C;  5B31 A;  3WA9 D;  4LD9 B;  2Y2Q A;  3AZN D;  3LJA B;  1EQZ C;  3W97 C;  5B1M A;  5CP6 C;  3WTP D;  2FJ7 C;  3AFA B;  1TZY B;  5GT0 D;  5GSU C;  4J8X D;  3B6G A;  3AYW A;  3REH D;  3WAA B;  2ZY2 A;  3MGQ A;  2HIO C;  3WA9 A;  4HGA C;  4CAY B;  4KGC D;  5B40 C;  3WTP A;  1P3F B;  2YFW B;  1P3M C;  3UT9 B;  4Z66 D;  5GT0 A;  1M18 B;  4J8X A;  1P3P D;  3REH A;  2L5A A;  3AZH B;  3REK C;  3AZE D;  3MVD C;  5CPI B;  1M1A D;  2F8N B;  5B0Z D;  5B1M C;  1AOI B;  2DF4 C;  4KGC A;  1BH8 B;  3MGP D;  3AV2 B;  2CV5 D;  3EPH A;  3H0R C;  4Z66 A;  4H9R B;  5B24 B;  1P3P A;  3AZE A;  5B2I D;  5DNN B;  1P3I C;  1M1A A;  3REJ B;  3AZN C;  5B0Z A;  1U35 C;  3LEL C;  2ZY5 A;  5FUG A;  3MGP A;  3R45 A;  2CV5 A;  3X1U D;  4KHA A;  3B0C W;  1KX3 B;  5B2I A;  2XD1 A;  2Y2K A;  3AN2 D;  4UPK A;  3TU4 B;  3AV1 D;  4WU9 B;  5AY8 B;  2PYO B;  2Y2L A;  5AV6 C;  1P3P C;  3X1U A;  5BS7 A;  3UTA C;  3EG5 B;  3B6F C;  1N1J A;  5AV9 C;  2HUE B;  1BFM A;  4Z2M G;  3O62 D;  3AN2 A;  4H9O B;  3AV1 A;  2NZD D;  2CV5 C;  3KFU G;  1TAF B;  5AV8 B;  4J8W B;  2VQR A;  3MGS C;  2RVQ D;  4QLC D;  3MNN D;  3KXB C;  4Z5T D;  1H3O A;  4KUD B;  3O62 A;  3UTB B;  2NZD A;  2NQB C;  3REL B;  4ZBJ B;  5B1L B;  3X1T D;  4WU8 D;  2YFV B;  5CPK B;  4QLC A;  1F66 C;  5JRG B;  3MNN A;  5DNM D;  4Z5T A;  4E44 A;  3KWQ C;  3AZF D;  1S32 D;  3VH5 T;  5B0Y C;  3X1T A;  5BNV A;  1HQ3 C;  4WU8 A;  1ZLA B;  3A6N C;  1P3O C;  4H9P A;  3VH6 A;  1P34 B;  3REI B;  1ID3 B;  5DNM A;  4J8V C;  2NZD C;  3AZF A;  1S32 A;  1P3B C;  3AZI C;  3NQU A;  4H9Q B;  5AVC B;  5GT3 B;  4X23 C;  3MGR B;  5BNX B;  1Q9C A;  4YM6 C;  3AZJ C;  3AZL B;  5F99 D;  3MNN C;  3C1B C;  2IO5 B;  3W97 D;  2ARO B;  4H9N A;  3LZ0 B;  5CP6 D;  2FJ7 D;  1KX4 B;  5GXQ A;  1P3A C;  5CPJ C;  3X1V D;  5GSU D;  3NQJ B;  5BO0 B;  1HTA A;  3VH6 W;  5F99 A;  2HIO D;  3KUY B;  4J8U D;  5G49 B;  3W97 A;  5B40 D;  5CP6 A;  2Y2H A;  1P3L B;  2FJ7 A;  1KX5 C;  1P3M D;  3X1V A;  5GSU A;  3REK D;  3MVD D;  2HIO A;  1ULY A;  3EPK A;  1P3K B;  3W99 D;  1BH9 B;  4J8U A;  5B40 A;  1P3M A;  3C1C D;  5C3I B;  2IO5 C;  3LZ1 C;  3LJA D;  3MVD A;  3REK A;  1P3I D;  2Y2I A;  3AFA D;  3LEL D;  1U35 D;  3W99 A;  4JJN C;  5KDM A;  3VH5 A;  3X1V C;  1JFI B;  2BYK A;  3C1C A;  4R8P C;  4YS3 B;  5B31 B;  2Y2P A;  3LJA A;  1P3I A;  3AZN A;  4J8U C;  3V9R A;  3AFA A;  3LEL A;  1U35 A;  3UT9 D;  3W98 C;  1M18 D;  5B2J B;  5AV6 D;  2G5I C;  3UTA D;  3AYW B;  3B6G B;  3AZM B;  4XZQ B;  4G91 B;  3MGQ B;  3B6F D;  4CAY A;  3WA9 B;  4XUJ B;  5AV9 D;  3W99 C;  3X1S C;  3WTP B;  2YFW A;  2LY8 A;  3UT9 A;  1M18 A;  2J8P A;  3C1C C;  5AV6 A;  2ZY3 A;  5GT0 B;  5B24 D;  4J8X B;  2F8N H;  3UTA A;  4LD9 C;  3REH B;  3H0L C;  3MGS D;  3LJA C;  3B6F A;  2ZM5 A;  3AFA C;  5AV9 A;  1KU5 A;  1TZY C;  3KXB D;  4KGC B;  4AWL B;  2NQB D;  3WAA C;  4Z66 B;  5B24 A;  3AZE B;  3WKJ B;  4ZUX B;  3MGS A;  1M1A B;  1F66 D;  2Y2O A;  5BT1 C;  5B32 B;  5B0Z B;  1P3F C;  3KXB A;  3UT9 C;  1B67 A;  3KWQ D;  1M18 C;  4WNN A;  3MGP B;  4M6B A;  2NQB A;  4KHA B;  3AZH C;  5CPI C;  2Y2M A;  5E5A B;  5B0Y D;  1AOI C;  1HQ3 D;  5B2I B;  4EO5 B;  1F66 A;  3IP4 C;  3A6N D;  1P3O D;  3AV2 C;  4J8V D;  3KWQ A;  5B24 C;  1P3B D;  2XD5 A;  3X1U B;  3AZI D;  5DNN C;  4X23 D;  3REJ C;  5B0Y A;  3AZJ D;  4YM6 D;  1N1J B;  2BYM A;  1P3G B;  1HQ3 A;  3A6N A;  3C1B D;  4H9O A;  3AN2 B;  1P3O A;  3AV1 B;  1TAF A;  4J8V A;  1KX3 C;  1P3A D;  1P3B A;  5CPJ D;  3AZI A;  4ZUX C;  4X23 A;  1T3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...