3X1TD

Crystal structure of nucleosome core particle consisting of mouse testis specific histone variants h2aa and h2ba
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
RKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1tD00
1M1AC 5GT3B 4J8XC 4HGAC 4J8UC 4J8WB 5B40C 3WA9B 5B0YB 4WU9D 3X1TC 1P3GD 3REKD 5CHLB 3LELC 3REHA 3UTAA 4ZBJB 3NQJA 4KGCD 3A6NB 3LJAC 3AZEA 4X23D 3LZ1D 1P3OD 1M18D 3AZHA 3O62D 1EQZA 5G49A 3AZKD 3AV2C 3AZIA 3W99C 4DRBA 3WKJD 3MGRC 5DNMD 3REKA 5B31C 5CPIA 3AZLB 1M18A 1ZLAB 3B6GC 3AZKA 4H9OB 5AVCC 5GXQC 1TAFA 3W96D 4YS3B 1P3AC 3AZJD 2HIOC 3VH5W 3AV1C 3AZFD 5BT1C 3AFAA 1KX3C 3REIC 5B33C 1BFMA 5E5AB 5AY8A 5CP6A 5AV9A 4YM6A 4NE3A 1P3LA 2PYOC 3AN2A 3B6FA 4WNNA 3MGRD 4NE6A 5GT0A 3X1VA 2BYKA 3REHB 5KDMA 1F66D 3UTAB 3NQJB 3MVDD 4XUJA 3AZEB 4KUDC 3C1BA 5CPKA 5B0ZC 3AZHB 1EQZB 5B24C 5G49B 1KX5A 3AZND 3AZIB 2FJ7A 1P3GB 4Z66D 3REKB 2NQBD 5BT1D 5GT3C 3AZMA 4XZQD 1F66A 3REID 5CPJA 4J8WC 3X1SC 3WA9C 5CPIB 1P3BA 3C1CC 3VH6A 1M18B 3B0BA 3AZGD 5AV8A 1P34C 1ID3D 4ZBJC 3AZKB 3WAAA 1TAFB 3W98D 4Z66A 3AYWC 1TZYA 2IO5B 3W97C 2NZDC 3AFAB 3MGQA 5B32A 3KSYA 2L5AA 5CP6B 5AY8B 5AV9B 1S32C 1P3LB 1N1JA 3AN2B 2CV5C 4Z5TD 4WNNB 5JRGA 5B0YA 3B6FB 5GT0B 5B1LD 1AOIC 3W98A 3RELD 3AZLC 3X1VB 1U35A 2BYKB 1P3FC 5KDMB 1P3IA 3REJA 3KXBC 3AZFB 5AV6A 3C1CD 1P3PA 3MNNA 4H9RA 4YS3C 5AV5D 1P34D 1P3KC 5CPKB 4CAYA 5C3IB 1KX5B 2FJ7B 3WTPE 3AYWD 2HUEB 3W97D 2NZDD 1KX4A 4H9NA 4CSRB 5B2JC 5B1MD 3AZMB 1F66B 3MVDB 3KWQA 1P3BB 1ZLAA 2CV5D 4E44A 3REHC 5AV8B 5B2ID 3UTAC 3WAAB 3MGPC 4J8VA 3TU4C 1WWIA 4UUZA 4JJND 3AZEC 1P3MC 3UTBC 1P3FD 2YFVA 4G92B 1HTAA 2LY8A 4Z66B 3X1UA 3KXBD 1TZYB 3KUYA 4ZUXC 5E5AA 3MGQB 1P3KD 5B32B 5B31G 3MGSC 2YFWA 1N1JB 1ID3B 2BYMA 5JRGB 1BH9A 4JJNA 5BS7C 4R8PD 4H9SC 3W98B 1U35B 5B2JD 5F99C 5AVBC 1P3IB 2F8NA 3REJB 4LD9C 5DNNC 2AROA 5AV6B 3UT9D 4WU8D 1P3PB 1M19D 3MNNB 4QLCD 4H9RB 2RVQC 3MGPD 3TU4D 4CAYB 2IO5C 2F8NK 1P3MD 3UTBD 4Z5TB 4WU9A 1P3GA 3AFAC 5B1LB 4YM6C 1P3LC 1KX4B 4H9NB 4ZUXD 3WTPD 4KGCA 3B6FC 1M1AD 4X23A 3LZ1A 1P3OA 3MGSD 1M19A 4J8XD 3KWQB 4J8UD 3X1VC 3O62A 5B40D 3X1TD 5GSUC 3LELD 4XUJC 4J8VB 3WKJA 5DNMA 4UUZB 4AWLB 5F99D 5AVBD 2YFVB 3LJAD 3C1BC 3X1UB 4LD9D 5DNND 5CPKC 5C3IC 3KUYB 3B0DB 3LZ0C 1JFIA 2FJ7C 2HUEC 3AV2D 4G91C 2YFWB 3W99D 4NFTA 3AZMC 2BYMB 5CPJC 1BH9B 3W96A 5B31D 4NE5A 1ULYA 4JJNB 3AZJA 3LJAA 3AZFA 2F8NB 3WAAC 2AROB 3B6GD 3AV2A 4G92C 5AVCD 4KHAA 5GSUD 5GXQD 3W99A 3MGRA 4EO5B 1HQ3C 1P3AD 2HIOD 4WU9B 3AV1D 5B32C 4CSRA 3LZ0D 4M6BA 1KX3D 5B33D 3MVDA 4KGCB 5B0YC 4X23B 3LZ1B 1P3OB 3B6GA 2PYOD 1M19B 4QLCB 1U35C 3O62B 3AZNA 1P3IC 3A6NC 3REJC 3WKJB 5DNMB 3MNNC 2NQBA 4XZQA 1KX3A 3REIA 4KUDD 1KU5A 5B0ZD 1JFIB 5B24D 4HGAB 3AZGA 1ID3A 1KX4C 1B67A 5GT3D 3W96B 3AZJB 1ZLAC 3LJAB 4J8WD 3X1SD 3WA9D 1F1EA 4AWLC 3AV2B 3A6ND 4KHAB 3X1UC 3B0CT 3W99B 4Z5TA 3MGRB 3KUYC 3B0DC 5B1LA 5E5AC 3RELA 5B31B 3C1CA 1S32D 3B6GB 5AV5A 1P34A 3AZNB 1AOID 3AZLD 1P3AB 3AYWA 3VH6W 5FUGA 3W97A 1BH8A 3AZHC 2NQBB 1EQZC 2NZDA 4WZSB 5B1MA 4XZQB 3AZIC 4YS3D 4EO5C 3REIB 1KX3B 1P3GC 3REKC 2CV5A 3AZGB 1B6WA 5B2IA 4KGCC 1R4VA 1AOIA 5CPIC 1P3OC 1P3FA 3VH5A 1M18C 3KXBA 3O62C 3AZKC 1P3KA 5DNMC 3REHD 5JA4B 5B24B 3UTAD 5BNXA 3NQUA 3AZED 3V9RA 3AZHD 4R8PA 1EQZD 3RELB 5B2JA 5AY8C 5CP6C 5AV9C 4H9QA 3AZID 3AN2C 3X1SB 3B0CW 3UT9A 5GT0C 4WU8A 3C1CB 4QLCA 3W96C 3AZJC 5AV5B 1P34B 3MGPA 3TU4A 3AZFC 5CPID 1P3MA 3UTBA 3AYWB 5FUGB 3W97B 1BH8B 1A7WA 2NZDB 1KX5C 4ZUXA 3WTPA 5B1MB 1M1AA 3MGSA 5B32G 2RVQD 4J8XA 1S32B 4J8UA 5B40A 2CV5B 3X1TA 5B2IB 3AFAD 1F66C 5BS7A 3MVDC 4H9SA 3LELA 1AOIB 5AY8D 5CP6D 5AV9D 4YM6D 5F99A 1P3FB 5AVBA 1P3BC 1P3LD 3AN2D 3B6FD 4LD9A 5DNNA 3KXBB 5GT0D 5BO0A 5AV8C 3AZNC 4H9PA 3X1VD 1P3KB 4Z66C 2NQBC 5BNXB 1TZYC 4XUJD 3NQUB 4XZQC 3C1BD 3V9RB 3MGQC 5B31A 3R45A 5CPKD 4R8PB 5B2JB 1KX5D 4H9QB 3AZGC 2JSSA 2FJ7D 4DRAA 3VH6T 5JRGC 1ID3C 3UT9B 4WU8B 3W98C 3AZMD 5AVCA 5BNVA 5GSUA 5CPJD 3MGPB 5GXQA 3TU4B 1H3OA 1P3AA 2HIOA 5AV6C 3UTBB 1P3MB 1P3BD 1P3PC 3AV1A 5AV8D 3WAAD 3LZ0A 5B33A 3WTPB 4ZUXB 4Z5TC 1M1AB 3MGSB 2PYOA 5B1LC 1TZYD 4J8XB 4J8UB 4Z2MG 3RELC 1HQ3D 5B40B 3X1TB 3MGQD 5B32D 3LELB 3KWQC 5F99B 5AVBB 5AV5C 4LD9B 5JRGD 5DNNB 5B0YD 2F8NG 4KUDA 5BO0B 4J8VC 4H9PB 1U35D 4WV4B 5B0ZA 5JA4A 5B24A 1P3ID 3REJD 1HQ3A 5AV6D 1WWSA 1P3PD 5B1MC 3MNND 5GT3A 4YM6B 3R45B 4J8WA 3X1SA 3WA9A 5B2IC 1Q9CA 4JJNC 1KX4D 3A6NA 5AVCB 5BNVB 5GSUB 5GXQB 4XUJB 1H3OB 2CWEA 2AROC 2HIOB 3KWQD 1ZLAD 3C1BB 3AV1B 4J8VD 3LZ0B 5B33B 1S32A 4WU9C 4G91B 3X1UD 4Z2MH 2PYOB 4R8PC 3KUYD 5CPJB 5E5AD 3VH5T 3AZLA 4X23C 3LZ1C 3UT9C 4WU8C 1M19C 4QLCC 4H9OA 2F8NH 4KUDB 4YS3A 3WKJC 5B0ZB 2F8ND 1HQ3B 2AROD 4E45A 3WTPC
chains in the Genus database with same CATH superfamily
1M1AC 5GT3B 4J8XC 4HGAC 4J8UC 3H0MC 4J8WB 5B40C 3WA9B 5B0YB 4WU9D 3X1TC 1P3GD 2Y2OA 3REKD 5CHLB 3LELC 3REHA 3UTAA 4ZBJB 3NQJA 4KGCD 3A6NB 3LJAC 2ZM5A 3AZEA 4X23D 3LZ1D 1P3OD 2Y2PA 1M18D 3AZHA 3O62D 1EQZA 5G49A 3AZKD 3AV2C 3AZIA 3W99C 4DRBA 3WKJD 3MGRC 5DNMD 3REKA 5B31C 5CPIA 3AZLB 1M18A 1W2EA 1ZLAB 3B6GC 3AZKA 4H9OB 5AVCC 5GXQC 1TAFA 3W96D 4YS3B 1P3AC 3AZJD 2HIOC 3VH5W 3AV1C 3AZFD 5BT1C 2ZY5A 3AFAA 1KX3C 3REIC 5B33C 1BFMA 5E5AB 5AY8A 5CP6A 5AV9A 4YM6A 4NE3A 1P3LA 2PYOC 3AN2A 3B6FA 4WNNA 3MGRD 4NE6A 5GT0A 3EPLA 3X1VA 2BYKA 3REHB 5KDMA 1F66D 3UTAB 3NQJB 3MVDD 4XUJA 1Z2CB 3AZEB 4KUDC 3C1BA 5CPKA 5B0ZC 3AZHB 1EQZB 2JCHA 5G49B 5B24C 1KX5A 3AZND 3AZIB 2FJ7A 1P3GB 4Z66D 3REKB 2NQBD 2UWXA 2ZY4A 5BT1D 5GT3C 3AZMA 4XZQD 1F66A 3REID 5CPJA 3EPKA 4J8WC 3X1SC 3WA9C 5CPIB 1P3BA 3C1CC 3VH6A 1M18B 3B0BA 3AZGD 5AV8A 1P34C 1ID3D 4ZBJC 3AZKB 3WAAA 3AL0C 1TAFB 3W98D 4Z66A 3AYWC 1TZYA 2IO5B 3W97C 2NZDC 3AFAB 3MGQA 5B32A 3KSYA 2L5AA 5CP6B 5AY8B 5AV9B 1S32C 1P3LB 1N1JA 3AN2B 2CV5C 4Z5TD 4WNNB 5JRGA 5B0YA 3B6FB 5GT0B 5B1LD 1AOIC 3W98A 3RELD 3AZLC 3X1VB 1U35A 2BYKB 1P3FC 5KDMB 1P3IA 3REJA 3KXBC 3AZFB 5AV6A 3C1CD 1P3PA 3MNNA 4H9RA 4YS3C 5AV5D 1P34D 1P3KC 5CPKB 4CAYA 5C3IB 1KX5B 2FJ7B 3WTPE 4DQYB 2HUEB 3AYWD 3W97D 2NZDD 1KX4A 4H9NA 4CSRB 5B2JC 5B1MD 3AZMB 1F66B 2J8PA 3MVDB 3KWQA 1P3BB 1ZLAA 2CV5D 4E44A 3REHC 2Y2QA 5AV8B 2DQNC 2G5HC 5B2ID 3MGPC 4J8VA 3UTAC 3TU4C 3WAAB 1WWIA 4UUZA 4JJND 3AZEC 1P3MC 3UTBC 1P3FD 2YFVA 4G92B 1HTAA 2LY8A 4Z66B 3X1UA 3KXBD 1TZYB 3KUYA 4ZUXC 5E5AA 3MGQB 1P3KD 5B32B 5B31G 3MGSC 2YFWA 1N1JB 1ID3B 2BYMA 5JRGB 1BH9A 3H0LC 4JJNA 3IP4C 5BS7C 4H9SC 4R8PD 3W98B 1U35B 5B2JD 5F99C 5AVBC 1P3IB 2F8NA 3REJB 4LD9C 5DNNC 2AROA 5AV6B 3UT9D 4WU8D 1P3PB 1M19D 3MNNB 4QLCD 4H9RB 2RVQC 2W8SA 3MGPD 4CAYB 2IO5C 3TU4D 2F2AC 2F8NK 1P3MD 3UTBD 4Z5TB 4WU9A 1P3GA 3AFAC 5B1LB 4YM6C 1P3LC 3EPHA 1KX4B 4H9NB 4ZUXD 3WTPD 4KGCA 3B6FC 1M1AD 4X23A 3LZ1A 1P3OA 3MGSD 2Y2LA 1M19A 4J8XD 3KWQB 4J8UD 3X1VC 3O62A 5B40D 3X1TD 5GSUC 3LELD 4XUJC 4J8VB 3WKJA 5DNMA 4UUZB 4AWLB 5F99D 5AVBD 2YFVB 3LJAD 3C1BC 3X1UB 4LD9D 5DNND 5CPKC 5C3IC 1T3UA 3KUYB 3B0DB 3LZ0C 1JFIA 2FJ7C 2HUEC 3AV2D 4G91C 2YFWB 3W99D 4NFTA 3AZMC 2BYMB 5CPJC 1BH9B 3W96A 5B31D 4NE5A 1ULYA 2RIQA 4JJNB 3AZJA 3LJAA 2G5IC 3AZFA 2Y2KA 2F8NB 3WAAC 2AROB 3B6GD 3AV2A 4G92C 4KHAA 5AVCD 5GSUD 5GXQD 3W99A 3MGRA 4EO5B 1HQ3C 2Y2GA 2HIOD 1P3AD 4WU9B 3AV1D 5B32C 4CSRA 3LZ0D 4M6BA 1KX3D 5B33D 3MVDA 4KGCB 5B0YC 4X23B 3LZ1B 1P3OB 3B6GA 2PYOD 1M19B 4QLCB 1U35C 3O62B 3AZNA 1P3IC 3A6NC 3REJC 3WKJB 5DNMB 3MNNC 2Y2MA 2NQBA 4XZQA 1KX3A 3REIA 4KUDD 1KU5A 5B0ZD 1JFIB 3EPJA 5B24D 4HGAB 3H0RC 3AZGA 1ID3A 2BG1A 1KX4C 1B67A 5GT3D 3W96B 3AZJB 1ZLAC 3LJAB 4J8WD 3X1SD 3WA9D 1F1EA 4AWLC 2Y2IA 3AV2B 3A6ND 3P5JB 4KHAB 3B0CT 3X1UC 3W99B 4Z5TA 3MGRB 3KUYC 3B0DC 5B1LA 5E5AC 4UPKA 5B31B 3RELA 2JE5A 3C1CA 1S32D 3B6GB 5AV5A 1P34A 3A1KA 3AZNB 1AOID 3AZLD 1P3AB 3AYWA 3VH6W 5FUGA 3W97A 1BH8A 3AZHC 2NQBB 1EQZC 1PZRA 2NZDA 4WZSB 5B1MA 4XZQB 2DF4C 4YS3D 4EO5C 3REIB 3AZIC 1KX3B 1P3GC 3REKC 2CV5A 3AZGB 1B6WA 5B2IA 4KGCC 1R4VA 1AOIA 5CPIC 1P3OC 1P3FA 3VH5A 1M18C 3KXBA 3O62C 3AZKC 1P3KA 5DNMC 3REHD 5JA4B 5B24B 3UTAD 5BNXA 3NQUA 3AZED 3V9RA 3AZHD 4R8PA 1EQZD 3RELB 5B2JA 5AY8C 5CP6C 5AV9C 4H9QA 3AZID 3AN2C 3X1SB 3B0CW 3F6TA 3UT9A 5GT0C 4WU8A 3C1CB 4QLCA 3W96C 3AZJC 5AV5B 1P34B 3MGPA 3TU4A 3AZFC 5CPID 1P3MA 3UTBA 3AYWB 5FUGB 3W97B 1BH8B 1A7WA 2NZDB 1KX5C 4ZUXA 3WTPA 5B1MB 1M1AA 3MGSA 5B32G 2RVQD 4J8XA 1S32B 4J8UA 5B40A 2CV5B 3X1TA 5B2IB 3AFAD 1F66C 5BS7A 2VQRA 4H9SA 3MVDC 3LELA 1AOIB 5AY8D 5CP6D 5AV9D 4YM6D 5F99A 1P3FB 5AVBA 1P3BC 1P3LD 3AN2D 3B6FD 4LD9A 5DNNA 3KXBB 5GT0D 5BO0A 5AV8C 3AZNC 4H9PA 3X1VD 1P3KB 4Z66C 2NQBC 5BNXB 1TZYC 4XUJD 3FDDA 3NQUB 4XZQC 3C1BD 3V9RB 3MGQC 5B31A 3R45A 5CPKD 4R8PB 2Y2NA 5B2JB 1KX5D 4H9QB 3AZGC 2JSSA 2FJ7D 4DRAA 3VH6T 5JRGC 1ID3C 3UT9B 3A1IA 4WU8B 3W98C 2XD1A 3AZMD 4WJ3C 5AVCA 5BNVA 5GSUA 5CPJD 3MGPB 5GXQA 3TU4B 1H3OA 1P3AA 2HIOA 5AV6C 3UTBB 1P3MB 1P3BD 1P3PC 3AV1A 5AV8D 3WAAD 3EG5B 3LZ0A 5B33A 3WTPB 4ZUXB 4Z5TC 1M1AB 3MGSB 2PYOA 5B1LC 1TZYD 4J8XB 4J8UB 4Z2MG 3RELC 1HQ3D 5B40B 3X1TB 3MGQD 5B32D 3LELB 3KWQC 5F99B 5AVBB 5AV5C 4LD9B 5JRGD 5DNNB 5B0YD 2F8NG 4KUDA 5BO0B 4J8VC 4H9PB 1U35D 4WV4B 5B0ZA 5JA4A 5B24A 1P3ID 3REJD 1HQ3A 5AV6D 1WWSA 1P3PD 5B1MC 3MNND 3KFUG 5GT3A 4YM6B 3R45B 2FFFB 4J8WA 3X1SA 3WA9A 5B2IC 1Q9CA 2ZY2A 4JJNC 1KX4D 2ZY3A 3A6NA 5AVCB 5BNVB 5GSUB 5GXQB 4XUJB 1H3OB 2CWEA 2AROC 2HIOB 3KWQD 1ZLAD 3C1BB 3AV1B 4J8VD 3LZ0B 5B33B 1S32A 4WU9C 4G91B 3X1UD 4Z2MH 2PYOB 4R8PC 3KUYD 5CPJB 5E5AD 3VH5T 3AZLA 4X23C 3LZ1C 3UT9C 2XD5A 4WU8C 1M19C 4QLCC 4H9OA 2F8NH 2Y2HA 4KUDB 4YS3A 3WKJC 5B0ZB 2Y2JA 2F8ND 1HQ3B 2AROD 4E45A 3WTPC
chains in the Genus database with same CATH topology
1M1AC 5GT3B 4J8XC 4HGAC 4J8UC 3H0MC 4J8WB 5B40C 3WA9B 5B0YB 4WU9D 3X1TC 1P3GD 2Y2OA 3REKD 5CHLB 3LELC 3REHA 3UTAA 4ZBJB 3NQJA 4KGCD 3A6NB 3LJAC 2ZM5A 3AZEA 4X23D 3LZ1D 1P3OD 2Y2PA 1M18D 3AZHA 3O62D 1EQZA 5G49A 3AZKD 3AV2C 3AZIA 3W99C 4DRBA 3WKJD 3MGRC 5DNMD 3REKA 5B31C 5CPIA 3AZLB 1M18A 1W2EA 1ZLAB 3B6GC 3AZKA 4H9OB 5AVCC 5GXQC 1TAFA 3W96D 4YS3B 1P3AC 3AZJD 2HIOC 3VH5W 3AV1C 3AZFD 5BT1C 2ZY5A 3AFAA 1KX3C 3REIC 5B33C 1BFMA 5E5AB 5AY8A 5CP6A 5AV9A 4YM6A 4NE3A 1P3LA 2PYOC 3AN2A 3B6FA 4WNNA 3MGRD 4NE6A 5GT0A 3EPLA 3X1VA 2BYKA 3REHB 5KDMA 1F66D 3UTAB 3NQJB 3MVDD 4XUJA 1Z2CB 3AZEB 4KUDC 3C1BA 5CPKA 5B0ZC 3AZHB 1EQZB 2JCHA 5G49B 5B24C 1KX5A 3AZND 3AZIB 2FJ7A 1P3GB 4Z66D 3REKB 2NQBD 2UWXA 2ZY4A 5BT1D 5GT3C 3AZMA 4XZQD 1F66A 3REID 5CPJA 3EPKA 4J8WC 3X1SC 3WA9C 5CPIB 1P3BA 3C1CC 3VH6A 1M18B 3B0BA 3AZGD 5AV8A 1P34C 1ID3D 4ZBJC 3AZKB 3WAAA 3AL0C 1TAFB 3W98D 4Z66A 3AYWC 1TZYA 2IO5B 3W97C 2NZDC 3AFAB 3MGQA 5B32A 3KSYA 2L5AA 5CP6B 5AY8B 5AV9B 1S32C 1P3LB 1N1JA 3AN2B 2CV5C 4Z5TD 4WNNB 5JRGA 5B0YA 3B6FB 5GT0B 5B1LD 1AOIC 3W98A 3RELD 3AZLC 3X1VB 1U35A 2BYKB 1P3FC 5KDMB 1P3IA 3REJA 3KXBC 3AZFB 5AV6A 3C1CD 1P3PA 3MNNA 4H9RA 4YS3C 5AV5D 1P34D 1P3KC 5CPKB 4CAYA 5C3IB 1KX5B 2FJ7B 3WTPE 4DQYB 2HUEB 3AYWD 3W97D 2NZDD 1KX4A 4H9NA 4CSRB 5B2JC 5B1MD 3AZMB 1F66B 2J8PA 3MVDB 3KWQA 1P3BB 1ZLAA 2CV5D 4E44A 3REHC 2Y2QA 5AV8B 2DQNC 2G5HC 5B2ID 3MGPC 4J8VA 3UTAC 3TU4C 3WAAB 1WWIA 4UUZA 4JJND 3AZEC 1P3MC 3UTBC 1P3FD 2YFVA 4G92B 1HTAA 2LY8A 4Z66B 3X1UA 3KXBD 1TZYB 3KUYA 4ZUXC 5E5AA 3MGQB 1P3KD 5B32B 5B31G 3MGSC 2YFWA 1N1JB 1ID3B 2BYMA 5JRGB 1BH9A 3H0LC 4JJNA 3IP4C 5BS7C 4H9SC 4R8PD 3W98B 1U35B 5B2JD 5F99C 5AVBC 1P3IB 2F8NA 3REJB 4LD9C 5DNNC 2AROA 5AV6B 3UT9D 4WU8D 1P3PB 1M19D 3MNNB 4QLCD 4H9RB 2RVQC 2W8SA 3MGPD 4CAYB 2IO5C 3TU4D 2F2AC 2F8NK 1P3MD 3UTBD 4Z5TB 4WU9A 1P3GA 3AFAC 5B1LB 4YM6C 1P3LC 3EPHA 1KX4B 4H9NB 4ZUXD 3WTPD 4KGCA 3B6FC 1M1AD 4X23A 3LZ1A 1P3OA 3MGSD 2Y2LA 1M19A 4J8XD 3KWQB 4J8UD 3X1VC 3O62A 5B40D 3X1TD 5GSUC 3LELD 4XUJC 4J8VB 3WKJA 5DNMA 4UUZB 4AWLB 5F99D 5AVBD 2YFVB 3LJAD 3C1BC 3X1UB 4LD9D 5DNND 5CPKC 5C3IC 1T3UA 3KUYB 3B0DB 3LZ0C 1JFIA 2FJ7C 2HUEC 3AV2D 4G91C 2YFWB 3W99D 4NFTA 3AZMC 2BYMB 5CPJC 1BH9B 3W96A 5B31D 4NE5A 1ULYA 2RIQA 4JJNB 3AZJA 3LJAA 2G5IC 3AZFA 2Y2KA 2F8NB 3WAAC 2AROB 3B6GD 3AV2A 4G92C 4KHAA 5AVCD 5GSUD 5GXQD 3W99A 3MGRA 4EO5B 1HQ3C 2Y2GA 2HIOD 1P3AD 4WU9B 3AV1D 5B32C 4CSRA 3LZ0D 4M6BA 1KX3D 5B33D 3MVDA 4KGCB 5B0YC 4X23B 3LZ1B 1P3OB 3B6GA 2PYOD 1M19B 4QLCB 1U35C 3O62B 3AZNA 1P3IC 3A6NC 3REJC 3WKJB 5DNMB 3MNNC 2Y2MA 2NQBA 4XZQA 1KX3A 3REIA 4KUDD 1KU5A 5B0ZD 1JFIB 3EPJA 5B24D 4HGAB 3H0RC 3AZGA 1ID3A 2BG1A 1KX4C 1B67A 5GT3D 3W96B 3AZJB 1ZLAC 3LJAB 4J8WD 3X1SD 3WA9D 1F1EA 4AWLC 2Y2IA 3AV2B 3A6ND 3P5JB 4KHAB 3B0CT 3X1UC 3W99B 4Z5TA 3MGRB 3KUYC 3B0DC 5B1LA 5E5AC 4UPKA 5B31B 3RELA 2JE5A 3C1CA 1S32D 3B6GB 5AV5A 1P34A 3A1KA 3AZNB 1AOID 3AZLD 1P3AB 3AYWA 3VH6W 5FUGA 3W97A 1BH8A 3AZHC 2NQBB 1EQZC 1PZRA 2NZDA 4WZSB 5B1MA 4XZQB 2DF4C 4YS3D 4EO5C 3REIB 3AZIC 1KX3B 1P3GC 3REKC 2CV5A 3AZGB 1B6WA 5B2IA 4KGCC 1R4VA 1AOIA 5CPIC 1P3OC 1P3FA 3VH5A 1M18C 3KXBA 3O62C 3AZKC 1P3KA 5DNMC 3REHD 5JA4B 5B24B 3UTAD 5BNXA 3NQUA 3AZED 3V9RA 3AZHD 4R8PA 1EQZD 3RELB 5B2JA 5AY8C 5CP6C 5AV9C 4H9QA 3AZID 3AN2C 3X1SB 3B0CW 3F6TA 3UT9A 5GT0C 4WU8A 3C1CB 4QLCA 3W96C 3AZJC 5AV5B 1P34B 3MGPA 3TU4A 3AZFC 5CPID 1P3MA 3UTBA 3AYWB 5FUGB 3W97B 1BH8B 1A7WA 2NZDB 1KX5C 4ZUXA 3WTPA 5B1MB 1M1AA 3MGSA 5B32G 2RVQD 4J8XA 1S32B 4J8UA 5B40A 2CV5B 3X1TA 5B2IB 3AFAD 1F66C 5BS7A 2VQRA 4H9SA 3MVDC 3LELA 1AOIB 5AY8D 5CP6D 5AV9D 4YM6D 5F99A 1P3FB 5AVBA 1P3BC 1P3LD 3AN2D 3B6FD 4LD9A 5DNNA 3KXBB 5GT0D 5BO0A 5AV8C 3AZNC 4H9PA 3X1VD 1P3KB 4Z66C 2NQBC 5BNXB 1TZYC 4XUJD 3FDDA 3NQUB 4XZQC 3C1BD 3V9RB 3MGQC 5B31A 3R45A 5CPKD 4R8PB 2Y2NA 5B2JB 1KX5D 4H9QB 3AZGC 2JSSA 2FJ7D 4DRAA 3VH6T 5JRGC 1ID3C 3UT9B 3A1IA 4WU8B 3W98C 2XD1A 3AZMD 4WJ3C 5AVCA 5BNVA 5GSUA 5CPJD 3MGPB 5GXQA 3TU4B 1H3OA 1P3AA 2HIOA 5AV6C 3UTBB 1P3MB 1P3BD 1P3PC 3AV1A 5AV8D 3WAAD 3EG5B 3LZ0A 5B33A 3WTPB 4ZUXB 4Z5TC 1M1AB 3MGSB 2PYOA 5B1LC 1TZYD 4J8XB 4J8UB 4Z2MG 3RELC 1HQ3D 5B40B 3X1TB 3MGQD 5B32D 3LELB 3KWQC 5F99B 5AVBB 5AV5C 4LD9B 5JRGD 5DNNB 5B0YD 2F8NG 4KUDA 5BO0B 4J8VC 4H9PB 1U35D 4WV4B 5B0ZA 5JA4A 5B24A 1P3ID 3REJD 1HQ3A 5AV6D 1WWSA 1P3PD 5B1MC 3MNND 3KFUG 5GT3A 4YM6B 3R45B 2FFFB 4J8WA 3X1SA 3WA9A 5B2IC 1Q9CA 2ZY2A 4JJNC 1KX4D 2ZY3A 3A6NA 5AVCB 5BNVB 5GSUB 5GXQB 4XUJB 1H3OB 2CWEA 2AROC 2HIOB 3KWQD 1ZLAD 3C1BB 3AV1B 4J8VD 3LZ0B 5B33B 1S32A 4WU9C 4G91B 3X1UD 4Z2MH 2PYOB 4R8PC 3KUYD 5CPJB 5E5AD 3VH5T 3AZLA 4X23C 3LZ1C 3UT9C 2XD5A 4WU8C 1M19C 4QLCC 4H9OA 2F8NH 2Y2HA 4KUDB 4YS3A 3WKJC 5B0ZB 2Y2JA 2F8ND 1HQ3B 2AROD 4E45A 3WTPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1A C;  5GT3 B;  4J8X C;  4HGA C;  4J8U C;  4J8W B;  5B40 C;  3WA9 B;  5B0Y B;  4WU9 D;  3X1T C;  1P3G D;  3REK D;  5CHL B;  3LEL C;  3REH A;  3UTA A;  4ZBJ B;  3NQJ A;  4KGC D;  3A6N B;  3LJA C;  3AZE A;  4X23 D;  3LZ1 D;  1P3O D;  1M18 D;  3AZH A;  3O62 D;  1EQZ A;  5G49 A;  3AZK D;  3AV2 C;  3AZI A;  3W99 C;  4DRB A;  3WKJ D;  3MGR C;  5DNM D;  3REK A;  5B31 C;  5CPI A;  3AZL B;  1M18 A;  1ZLA B;  3B6G C;  3AZK A;  4H9O B;  5AVC C;  5GXQ C;  1TAF A;  3W96 D;  4YS3 B;  1P3A C;  3AZJ D;  2HIO C;  3VH5 W;  3AV1 C;  3AZF D;  5BT1 C;  3AFA A;  1KX3 C;  3REI C;  5B33 C;  1BFM A;  5E5A B;  5AY8 A;  5CP6 A;  5AV9 A;  4YM6 A;  4NE3 A;  1P3L A;  2PYO C;  3AN2 A;  3B6F A;  4WNN A;  3MGR D;  4NE6 A;  5GT0 A;  3X1V A;  2BYK A;  3REH B;  5KDM A;  1F66 D;  3UTA B;  3NQJ B;  3MVD D;  4XUJ A;  3AZE B;  4KUD C;  3C1B A;  5CPK A;  5B0Z C;  3AZH B;  1EQZ B;  5B24 C;  5G49 B;  1KX5 A;  3AZN D;  3AZI B;  2FJ7 A;  1P3G B;  4Z66 D;  3REK B;  2NQB D;  5BT1 D;  5GT3 C;  3AZM A;  4XZQ D;  1F66 A;  3REI D;  5CPJ A;  4J8W C;  3X1S C;  3WA9 C;  5CPI B;  1P3B A;  3C1C C;  3VH6 A;  1M18 B;  3B0B A;  3AZG D;  5AV8 A;  1P34 C;  1ID3 D;  4ZBJ C;  3AZK B;  3WAA A;  1TAF B;  3W98 D;  4Z66 A;  3AYW C;  1TZY A;  2IO5 B;  3W97 C;  2NZD C;  3AFA B;  3MGQ A;  5B32 A;  3KSY A;  2L5A A;  5CP6 B;  5AY8 B;  5AV9 B;  1S32 C;  1P3L B;  1N1J A;  3AN2 B;  2CV5 C;  4Z5T D;  4WNN B;  5JRG A;  5B0Y A;  3B6F B;  5GT0 B;  5B1L D;  1AOI C;  3W98 A;  3REL D;  3AZL C;  3X1V B;  1U35 A;  2BYK B;  1P3F C;  5KDM B;  1P3I A;  3REJ A;  3KXB C;  3AZF B;  5AV6 A;  3C1C D;  1P3P A;  3MNN A;  4H9R A;  4YS3 C;  5AV5 D;  1P34 D;  1P3K C;  5CPK B;  4CAY A;  5C3I B;  1KX5 B;  2FJ7 B;  3WTP E;  3AYW D;  2HUE B;  3W97 D;  2NZD D;  1KX4 A;  4H9N A;  4CSR B;  5B2J C;  5B1M D;  3AZM B;  1F66 B;  3MVD B;  3KWQ A;  1P3B B;  1ZLA A;  2CV5 D;  4E44 A;  3REH C;  5AV8 B;  5B2I D;  3UTA C;  3WAA B;  3MGP C;  4J8V A;  3TU4 C;  1WWI A;  4UUZ A;  4JJN D;  3AZE C;  1P3M C;  3UTB C;  1P3F D;  2YFV A;  4G92 B;  1HTA A;  2LY8 A;  4Z66 B;  3X1U A;  3KXB D;  1TZY B;  3KUY A;  4ZUX C;  5E5A A;  3MGQ B;  1P3K D;  5B32 B;  5B31 G;  3MGS C;  2YFW A;  1N1J B;  1ID3 B;  2BYM A;  5JRG B;  1BH9 A;  4JJN A;  5BS7 C;  4R8P D;  4H9S C;  3W98 B;  1U35 B;  5B2J D;  5F99 C;  5AVB C;  1P3I B;  2F8N A;  3REJ B;  4LD9 C;  5DNN C;  2ARO A;  5AV6 B;  3UT9 D;  4WU8 D;  1P3P B;  1M19 D;  3MNN B;  4QLC D;  4H9R B;  2RVQ C;  3MGP D;  3TU4 D;  4CAY B;  2IO5 C;  2F8N K;  1P3M D;  3UTB D;  4Z5T B;  4WU9 A;  1P3G A;  3AFA C;  5B1L B;  4YM6 C;  1P3L C;  1KX4 B;  4H9N B;  4ZUX D;  3WTP D;  4KGC A;  3B6F C;  1M1A D;  4X23 A;  3LZ1 A;  1P3O A;  3MGS D;  1M19 A;  4J8X D;  3KWQ B;  4J8U D;  3X1V C;  3O62 A;  5B40 D;  3X1T D;  5GSU C;  3LEL D;  4XUJ C;  4J8V B;  3WKJ A;  5DNM A;  4UUZ B;  4AWL B;  5F99 D;  5AVB D;  2YFV B;  3LJA D;  3C1B C;  3X1U B;  4LD9 D;  5DNN D;  5CPK C;  5C3I C;  3KUY B;  3B0D B;  3LZ0 C;  1JFI A;  2FJ7 C;  2HUE C;  3AV2 D;  4G91 C;  2YFW B;  3W99 D;  4NFT A;  3AZM C;  2BYM B;  5CPJ C;  1BH9 B;  3W96 A;  5B31 D;  4NE5 A;  1ULY A;  4JJN B;  3AZJ A;  3LJA A;  3AZF A;  2F8N B;  3WAA C;  2ARO B;  3B6G D;  3AV2 A;  4G92 C;  5AVC D;  4KHA A;  5GSU D;  5GXQ D;  3W99 A;  3MGR A;  4EO5 B;  1HQ3 C;  1P3A D;  2HIO D;  4WU9 B;  3AV1 D;  5B32 C;  4CSR A;  3LZ0 D;  4M6B A;  1KX3 D;  5B33 D;  3MVD A;  4KGC B;  5B0Y C;  4X23 B;  3LZ1 B;  1P3O B;  3B6G A;  2PYO D;  1M19 B;  4QLC B;  1U35 C;  3O62 B;  3AZN A;  1P3I C;  3A6N C;  3REJ C;  3WKJ B;  5DNM B;  3MNN C;  2NQB A;  4XZQ A;  1KX3 A;  3REI A;  4KUD D;  1KU5 A;  5B0Z D;  1JFI B;  5B24 D;  4HGA B;  3AZG A;  1ID3 A;  1KX4 C;  1B67 A;  5GT3 D;  3W96 B;  3AZJ B;  1ZLA C;  3LJA B;  4J8W D;  3X1S D;  3WA9 D;  1F1E A;  4AWL C;  3AV2 B;  3A6N D;  4KHA B;  3X1U C;  3B0C T;  3W99 B;  4Z5T A;  3MGR B;  3KUY C;  3B0D C;  5B1L A;  5E5A C;  3REL A;  5B31 B;  3C1C A;  1S32 D;  3B6G B;  5AV5 A;  1P34 A;  3AZN B;  1AOI D;  3AZL D;  1P3A B;  3AYW A;  3VH6 W;  5FUG A;  3W97 A;  1BH8 A;  3AZH C;  2NQB B;  1EQZ C;  2NZD A;  4WZS B;  5B1M A;  4XZQ B;  3AZI C;  4YS3 D;  4EO5 C;  3REI B;  1KX3 B;  1P3G C;  3REK C;  2CV5 A;  3AZG B;  1B6W A;  5B2I A;  4KGC C;  1R4V A;  1AOI A;  5CPI C;  1P3O C;  1P3F A;  3VH5 A;  1M18 C;  3KXB A;  3O62 C;  3AZK C;  1P3K A;  5DNM C;  3REH D;  5JA4 B;  5B24 B;  3UTA D;  5BNX A;  3NQU A;  3AZE D;  3V9R A;  3AZH D;  4R8P A;  1EQZ D;  3REL B;  5B2J A;  5AY8 C;  5CP6 C;  5AV9 C;  4H9Q A;  3AZI D;  3AN2 C;  3X1S B;  3B0C W;  3UT9 A;  5GT0 C;  4WU8 A;  3C1C B;  4QLC A;  3W96 C;  3AZJ C;  5AV5 B;  1P34 B;  3MGP A;  3TU4 A;  3AZF C;  5CPI D;  1P3M A;  3UTB A;  3AYW B;  5FUG B;  3W97 B;  1BH8 B;  1A7W A;  2NZD B;  1KX5 C;  4ZUX A;  3WTP A;  5B1M B;  1M1A A;  3MGS A;  5B32 G;  2RVQ D;  4J8X A;  1S32 B;  4J8U A;  5B40 A;  2CV5 B;  3X1T A;  5B2I B;  3AFA D;  1F66 C;  5BS7 A;  3MVD C;  4H9S A;  3LEL A;  1AOI B;  5AY8 D;  5CP6 D;  5AV9 D;  4YM6 D;  5F99 A;  1P3F B;  5AVB A;  1P3B C;  1P3L D;  3AN2 D;  3B6F D;  4LD9 A;  5DNN A;  3KXB B;  5GT0 D;  5BO0 A;  5AV8 C;  3AZN C;  4H9P A;  3X1V D;  1P3K B;  4Z66 C;  2NQB C;  5BNX B;  1TZY C;  4XUJ D;  3NQU B;  4XZQ C;  3C1B D;  3V9R B;  3MGQ C;  5B31 A;  3R45 A;  5CPK D;  4R8P B;  5B2J B;  1KX5 D;  4H9Q B;  3AZG C;  2JSS A;  2FJ7 D;  4DRA A;  3VH6 T;  5JRG C;  1ID3 C;  3UT9 B;  4WU8 B;  3W98 C;  3AZM D;  5AVC A;  5BNV A;  5GSU A;  5CPJ D;  3MGP B;  5GXQ A;  3TU4 B;  1H3O A;  1P3A A;  2HIO A;  5AV6 C;  3UTB B;  1P3M B;  1P3B D;  1P3P C;  3AV1 A;  5AV8 D;  3WAA D;  3LZ0 A;  5B33 A;  3WTP B;  4ZUX B;  4Z5T C;  1M1A B;  3MGS B;  2PYO A;  5B1L C;  1TZY D;  4J8X B;  4J8U B;  4Z2M G;  3REL C;  1HQ3 D;  5B40 B;  3X1T B;  3MGQ D;  5B32 D;  3LEL B;  3KWQ C;  5F99 B;  5AVB B;  5AV5 C;  4LD9 B;  5JRG D;  5DNN B;  5B0Y D;  2F8N G;  4KUD A;  5BO0 B;  4J8V C;  4H9P B;  1U35 D;  4WV4 B;  5B0Z A;  5JA4 A;  5B24 A;  1P3I D;  3REJ D;  1HQ3 A;  5AV6 D;  1WWS A;  1P3P D;  5B1M C;  3MNN D;  5GT3 A;  4YM6 B;  3R45 B;  4J8W A;  3X1S A;  3WA9 A;  5B2I C;  1Q9C A;  4JJN C;  1KX4 D;  3A6N A;  5AVC B;  5BNV B;  5GSU B;  5GXQ B;  4XUJ B;  1H3O B;  2CWE A;  2ARO C;  2HIO B;  3KWQ D;  1ZLA D;  3C1B B;  3AV1 B;  4J8V D;  3LZ0 B;  5B33 B;  1S32 A;  4WU9 C;  4G91 B;  3X1U D;  4Z2M H;  2PYO B;  4R8P C;  3KUY D;  5CPJ B;  5E5A D;  3VH5 T;  3AZL A;  4X23 C;  3LZ1 C;  3UT9 C;  4WU8 C;  1M19 C;  4QLC C;  4H9O A;  2F8N H;  4KUD B;  4YS3 A;  3WKJ C;  5B0Z B;  2F8N D;  1HQ3 B;  2ARO D;  4E45 A;  3WTP C; 
#chains in the Genus database with same CATH topology
 1M1A C;  5GT3 B;  4J8X C;  4HGA C;  4J8U C;  3H0M C;  4J8W B;  5B40 C;  3WA9 B;  5B0Y B;  4WU9 D;  3X1T C;  1P3G D;  2Y2O A;  3REK D;  5CHL B;  3LEL C;  3REH A;  3UTA A;  4ZBJ B;  3NQJ A;  4KGC D;  3A6N B;  3LJA C;  2ZM5 A;  3AZE A;  4X23 D;  3LZ1 D;  1P3O D;  2Y2P A;  1M18 D;  3AZH A;  3O62 D;  1EQZ A;  5G49 A;  3AZK D;  3AV2 C;  3AZI A;  3W99 C;  4DRB A;  3WKJ D;  3MGR C;  5DNM D;  3REK A;  5B31 C;  5CPI A;  3AZL B;  1M18 A;  1W2E A;  1ZLA B;  3B6G C;  3AZK A;  4H9O B;  5AVC C;  5GXQ C;  1TAF A;  3W96 D;  4YS3 B;  1P3A C;  3AZJ D;  2HIO C;  3VH5 W;  3AV1 C;  3AZF D;  5BT1 C;  2ZY5 A;  3AFA A;  1KX3 C;  3REI C;  5B33 C;  1BFM A;  5E5A B;  5AY8 A;  5CP6 A;  5AV9 A;  4YM6 A;  4NE3 A;  1P3L A;  2PYO C;  3AN2 A;  3B6F A;  4WNN A;  3MGR D;  4NE6 A;  5GT0 A;  3EPL A;  3X1V A;  2BYK A;  3REH B;  5KDM A;  1F66 D;  3UTA B;  3NQJ B;  3MVD D;  4XUJ A;  1Z2C B;  3AZE B;  4KUD C;  3C1B A;  5CPK A;  5B0Z C;  3AZH B;  1EQZ B;  2JCH A;  5G49 B;  5B24 C;  1KX5 A;  3AZN D;  3AZI B;  2FJ7 A;  1P3G B;  4Z66 D;  3REK B;  2NQB D;  2UWX A;  2ZY4 A;  5BT1 D;  5GT3 C;  3AZM A;  4XZQ D;  1F66 A;  3REI D;  5CPJ A;  3EPK A;  4J8W C;  3X1S C;  3WA9 C;  5CPI B;  1P3B A;  3C1C C;  3VH6 A;  1M18 B;  3B0B A;  3AZG D;  5AV8 A;  1P34 C;  1ID3 D;  4ZBJ C;  3AZK B;  3WAA A;  3AL0 C;  1TAF B;  3W98 D;  4Z66 A;  3AYW C;  1TZY A;  2IO5 B;  3W97 C;  2NZD C;  3AFA B;  3MGQ A;  5B32 A;  3KSY A;  2L5A A;  5CP6 B;  5AY8 B;  5AV9 B;  1S32 C;  1P3L B;  1N1J A;  3AN2 B;  2CV5 C;  4Z5T D;  4WNN B;  5JRG A;  5B0Y A;  3B6F B;  5GT0 B;  5B1L D;  1AOI C;  3W98 A;  3REL D;  3AZL C;  3X1V B;  1U35 A;  2BYK B;  1P3F C;  5KDM B;  1P3I A;  3REJ A;  3KXB C;  3AZF B;  5AV6 A;  3C1C D;  1P3P A;  3MNN A;  4H9R A;  4YS3 C;  5AV5 D;  1P34 D;  1P3K C;  5CPK B;  4CAY A;  5C3I B;  1KX5 B;  2FJ7 B;  3WTP E;  4DQY B;  2HUE B;  3AYW D;  3W97 D;  2NZD D;  1KX4 A;  4H9N A;  4CSR B;  5B2J C;  5B1M D;  3AZM B;  1F66 B;  2J8P A;  3MVD B;  3KWQ A;  1P3B B;  1ZLA A;  2CV5 D;  4E44 A;  3REH C;  2Y2Q A;  5AV8 B;  2DQN C;  2G5H C;  5B2I D;  3MGP C;  4J8V A;  3UTA C;  3TU4 C;  3WAA B;  1WWI A;  4UUZ A;  4JJN D;  3AZE C;  1P3M C;  3UTB C;  1P3F D;  2YFV A;  4G92 B;  1HTA A;  2LY8 A;  4Z66 B;  3X1U A;  3KXB D;  1TZY B;  3KUY A;  4ZUX C;  5E5A A;  3MGQ B;  1P3K D;  5B32 B;  5B31 G;  3MGS C;  2YFW A;  1N1J B;  1ID3 B;  2BYM A;  5JRG B;  1BH9 A;  3H0L C;  4JJN A;  3IP4 C;  5BS7 C;  4H9S C;  4R8P D;  3W98 B;  1U35 B;  5B2J D;  5F99 C;  5AVB C;  1P3I B;  2F8N A;  3REJ B;  4LD9 C;  5DNN C;  2ARO A;  5AV6 B;  3UT9 D;  4WU8 D;  1P3P B;  1M19 D;  3MNN B;  4QLC D;  4H9R B;  2RVQ C;  2W8S A;  3MGP D;  4CAY B;  2IO5 C;  3TU4 D;  2F2A C;  2F8N K;  1P3M D;  3UTB D;  4Z5T B;  4WU9 A;  1P3G A;  3AFA C;  5B1L B;  4YM6 C;  1P3L C;  3EPH A;  1KX4 B;  4H9N B;  4ZUX D;  3WTP D;  4KGC A;  3B6F C;  1M1A D;  4X23 A;  3LZ1 A;  1P3O A;  3MGS D;  2Y2L A;  1M19 A;  4J8X D;  3KWQ B;  4J8U D;  3X1V C;  3O62 A;  5B40 D;  3X1T D;  5GSU C;  3LEL D;  4XUJ C;  4J8V B;  3WKJ A;  5DNM A;  4UUZ B;  4AWL B;  5F99 D;  5AVB D;  2YFV B;  3LJA D;  3C1B C;  3X1U B;  4LD9 D;  5DNN D;  5CPK C;  5C3I C;  1T3U A;  3KUY B;  3B0D B;  3LZ0 C;  1JFI A;  2FJ7 C;  2HUE C;  3AV2 D;  4G91 C;  2YFW B;  3W99 D;  4NFT A;  3AZM C;  2BYM B;  5CPJ C;  1BH9 B;  3W96 A;  5B31 D;  4NE5 A;  1ULY A;  2RIQ A;  4JJN B;  3AZJ A;  3LJA A;  2G5I C;  3AZF A;  2Y2K A;  2F8N B;  3WAA C;  2ARO B;  3B6G D;  3AV2 A;  4G92 C;  4KHA A;  5AVC D;  5GSU D;  5GXQ D;  3W99 A;  3MGR A;  4EO5 B;  1HQ3 C;  2Y2G A;  2HIO D;  1P3A D;  4WU9 B;  3AV1 D;  5B32 C;  4CSR A;  3LZ0 D;  4M6B A;  1KX3 D;  5B33 D;  3MVD A;  4KGC B;  5B0Y C;  4X23 B;  3LZ1 B;  1P3O B;  3B6G A;  2PYO D;  1M19 B;  4QLC B;  1U35 C;  3O62 B;  3AZN A;  1P3I C;  3A6N C;  3REJ C;  3WKJ B;  5DNM B;  3MNN C;  2Y2M A;  2NQB A;  4XZQ A;  1KX3 A;  3REI A;  4KUD D;  1KU5 A;  5B0Z D;  1JFI B;  3EPJ A;  5B24 D;  4HGA B;  3H0R C;  3AZG A;  1ID3 A;  2BG1 A;  1KX4 C;  1B67 A;  5GT3 D;  3W96 B;  3AZJ B;  1ZLA C;  3LJA B;  4J8W D;  3X1S D;  3WA9 D;  1F1E A;  4AWL C;  2Y2I A;  3AV2 B;  3A6N D;  3P5J B;  4KHA B;  3B0C T;  3X1U C;  3W99 B;  4Z5T A;  3MGR B;  3KUY C;  3B0D C;  5B1L A;  5E5A C;  4UPK A;  5B31 B;  3REL A;  2JE5 A;  3C1C A;  1S32 D;  3B6G B;  5AV5 A;  1P34 A;  3A1K A;  3AZN B;  1AOI D;  3AZL D;  1P3A B;  3AYW A;  3VH6 W;  5FUG A;  3W97 A;  1BH8 A;  3AZH C;  2NQB B;  1EQZ C;  1PZR A;  2NZD A;  4WZS B;  5B1M A;  4XZQ B;  2DF4 C;  4YS3 D;  4EO5 C;  3REI B;  3AZI C;  1KX3 B;  1P3G C;  3REK C;  2CV5 A;  3AZG B;  1B6W A;  5B2I A;  4KGC C;  1R4V A;  1AOI A;  5CPI C;  1P3O C;  1P3F A;  3VH5 A;  1M18 C;  3KXB A;  3O62 C;  3AZK C;  1P3K A;  5DNM C;  3REH D;  5JA4 B;  5B24 B;  3UTA D;  5BNX A;  3NQU A;  3AZE D;  3V9R A;  3AZH D;  4R8P A;  1EQZ D;  3REL B;  5B2J A;  5AY8 C;  5CP6 C;  5AV9 C;  4H9Q A;  3AZI D;  3AN2 C;  3X1S B;  3B0C W;  3F6T A;  3UT9 A;  5GT0 C;  4WU8 A;  3C1C B;  4QLC A;  3W96 C;  3AZJ C;  5AV5 B;  1P34 B;  3MGP A;  3TU4 A;  3AZF C;  5CPI D;  1P3M A;  3UTB A;  3AYW B;  5FUG B;  3W97 B;  1BH8 B;  1A7W A;  2NZD B;  1KX5 C;  4ZUX A;  3WTP A;  5B1M B;  1M1A A;  3MGS A;  5B32 G;  2RVQ D;  4J8X A;  1S32 B;  4J8U A;  5B40 A;  2CV5 B;  3X1T A;  5B2I B;  3AFA D;  1F66 C;  5BS7 A;  2VQR A;  4H9S A;  3MVD C;  3LEL A;  1AOI B;  5AY8 D;  5CP6 D;  5AV9 D;  4YM6 D;  5F99 A;  1P3F B;  5AVB A;  1P3B C;  1P3L D;  3AN2 D;  3B6F D;  4LD9 A;  5DNN A;  3KXB B;  5GT0 D;  5BO0 A;  5AV8 C;  3AZN C;  4H9P A;  3X1V D;  1P3K B;  4Z66 C;  2NQB C;  5BNX B;  1TZY C;  4XUJ D;  3FDD A;  3NQU B;  4XZQ C;  3C1B D;  3V9R B;  3MGQ C;  5B31 A;  3R45 A;  5CPK D;  4R8P B;  2Y2N A;  5B2J B;  1KX5 D;  4H9Q B;  3AZG C;  2JSS A;  2FJ7 D;  4DRA A;  3VH6 T;  5JRG C;  1ID3 C;  3UT9 B;  3A1I A;  4WU8 B;  3W98 C;  2XD1 A;  3AZM D;  4WJ3 C;  5AVC A;  5BNV A;  5GSU A;  5CPJ D;  3MGP B;  5GXQ A;  3TU4 B;  1H3O A;  1P3A A;  2HIO A;  5AV6 C;  3UTB B;  1P3M B;  1P3B D;  1P3P C;  3AV1 A;  5AV8 D;  3WAA D;  3EG5 B;  3LZ0 A;  5B33 A;  3WTP B;  4ZUX B;  4Z5T C;  1M1A B;  3MGS B;  2PYO A;  5B1L C;  1TZY D;  4J8X B;  4J8U B;  4Z2M G;  3REL C;  1HQ3 D;  5B40 B;  3X1T B;  3MGQ D;  5B32 D;  3LEL B;  3KWQ C;  5F99 B;  5AVB B;  5AV5 C;  4LD9 B;  5JRG D;  5DNN B;  5B0Y D;  2F8N G;  4KUD A;  5BO0 B;  4J8V C;  4H9P B;  1U35 D;  4WV4 B;  5B0Z A;  5JA4 A;  5B24 A;  1P3I D;  3REJ D;  1HQ3 A;  5AV6 D;  1WWS A;  1P3P D;  5B1M C;  3MNN D;  3KFU G;  5GT3 A;  4YM6 B;  3R45 B;  2FFF B;  4J8W A;  3X1S A;  3WA9 A;  5B2I C;  1Q9C A;  2ZY2 A;  4JJN C;  1KX4 D;  2ZY3 A;  3A6N A;  5AVC B;  5BNV B;  5GSU B;  5GXQ B;  4XUJ B;  1H3O B;  2CWE A;  2ARO C;  2HIO B;  3KWQ D;  1ZLA D;  3C1B B;  3AV1 B;  4J8V D;  3LZ0 B;  5B33 B;  1S32 A;  4WU9 C;  4G91 B;  3X1U D;  4Z2M H;  2PYO B;  4R8P C;  3KUY D;  5CPJ B;  5E5A D;  3VH5 T;  3AZL A;  4X23 C;  3LZ1 C;  3UT9 C;  2XD5 A;  4WU8 C;  1M19 C;  4QLC C;  4H9O A;  2F8N H;  2Y2H A;  4KUD B;  4YS3 A;  3WKJ C;  5B0Z B;  2Y2J A;  2F8N D;  1HQ3 B;  2ARO D;  4E45 A;  3WTP C; 
#chains in the Genus database with same CATH homology
 1M1A C;  5GT3 B;  4J8X C;  4HGA C;  4J8U C;  3H0M C;  4J8W B;  5B40 C;  3WA9 B;  5B0Y B;  4WU9 D;  3X1T C;  1P3G D;  2Y2O A;  3REK D;  5CHL B;  3LEL C;  3REH A;  3UTA A;  4ZBJ B;  3NQJ A;  4KGC D;  3A6N B;  3LJA C;  2ZM5 A;  3AZE A;  4X23 D;  3LZ1 D;  1P3O D;  2Y2P A;  1M18 D;  3AZH A;  3O62 D;  1EQZ A;  5G49 A;  3AZK D;  3AV2 C;  3AZI A;  3W99 C;  4DRB A;  3WKJ D;  3MGR C;  5DNM D;  3REK A;  5B31 C;  5CPI A;  3AZL B;  1M18 A;  1W2E A;  1ZLA B;  3B6G C;  3AZK A;  4H9O B;  5AVC C;  5GXQ C;  1TAF A;  3W96 D;  4YS3 B;  1P3A C;  3AZJ D;  2HIO C;  3VH5 W;  3AV1 C;  3AZF D;  5BT1 C;  2ZY5 A;  3AFA A;  1KX3 C;  3REI C;  5B33 C;  1BFM A;  5E5A B;  5AY8 A;  5CP6 A;  5AV9 A;  4YM6 A;  4NE3 A;  1P3L A;  2PYO C;  3AN2 A;  3B6F A;  4WNN A;  3MGR D;  4NE6 A;  5GT0 A;  3EPL A;  3X1V A;  2BYK A;  3REH B;  5KDM A;  1F66 D;  3UTA B;  3NQJ B;  3MVD D;  4XUJ A;  1Z2C B;  3AZE B;  4KUD C;  3C1B A;  5CPK A;  5B0Z C;  3AZH B;  1EQZ B;  2JCH A;  5G49 B;  5B24 C;  1KX5 A;  3AZN D;  3AZI B;  2FJ7 A;  1P3G B;  4Z66 D;  3REK B;  2NQB D;  2UWX A;  2ZY4 A;  5BT1 D;  5GT3 C;  3AZM A;  4XZQ D;  1F66 A;  3REI D;  5CPJ A;  3EPK A;  4J8W C;  3X1S C;  3WA9 C;  5CPI B;  1P3B A;  3C1C C;  3VH6 A;  1M18 B;  3B0B A;  3AZG D;  5AV8 A;  1P34 C;  1ID3 D;  4ZBJ C;  3AZK B;  3WAA A;  3AL0 C;  1TAF B;  3W98 D;  4Z66 A;  3AYW C;  1TZY A;  2IO5 B;  3W97 C;  2NZD C;  3AFA B;  3MGQ A;  5B32 A;  3KSY A;  2L5A A;  5CP6 B;  5AY8 B;  5AV9 B;  1S32 C;  1P3L B;  1N1J A;  3AN2 B;  2CV5 C;  4Z5T D;  4WNN B;  5JRG A;  5B0Y A;  3B6F B;  5GT0 B;  5B1L D;  1AOI C;  3W98 A;  3REL D;  3AZL C;  3X1V B;  1U35 A;  2BYK B;  1P3F C;  5KDM B;  1P3I A;  3REJ A;  3KXB C;  3AZF B;  5AV6 A;  3C1C D;  1P3P A;  3MNN A;  4H9R A;  4YS3 C;  5AV5 D;  1P34 D;  1P3K C;  5CPK B;  4CAY A;  5C3I B;  1KX5 B;  2FJ7 B;  3WTP E;  4DQY B;  2HUE B;  3AYW D;  3W97 D;  2NZD D;  1KX4 A;  4H9N A;  4CSR B;  5B2J C;  5B1M D;  3AZM B;  1F66 B;  2J8P A;  3MVD B;  3KWQ A;  1P3B B;  1ZLA A;  2CV5 D;  4E44 A;  3REH C;  2Y2Q A;  5AV8 B;  2DQN C;  2G5H C;  5B2I D;  3MGP C;  4J8V A;  3UTA C;  3TU4 C;  3WAA B;  1WWI A;  4UUZ A;  4JJN D;  3AZE C;  1P3M C;  3UTB C;  1P3F D;  2YFV A;  4G92 B;  1HTA A;  2LY8 A;  4Z66 B;  3X1U A;  3KXB D;  1TZY B;  3KUY A;  4ZUX C;  5E5A A;  3MGQ B;  1P3K D;  5B32 B;  5B31 G;  3MGS C;  2YFW A;  1N1J B;  1ID3 B;  2BYM A;  5JRG B;  1BH9 A;  3H0L C;  4JJN A;  3IP4 C;  5BS7 C;  4H9S C;  4R8P D;  3W98 B;  1U35 B;  5B2J D;  5F99 C;  5AVB C;  1P3I B;  2F8N A;  3REJ B;  4LD9 C;  5DNN C;  2ARO A;  5AV6 B;  3UT9 D;  4WU8 D;  1P3P B;  1M19 D;  3MNN B;  4QLC D;  4H9R B;  2RVQ C;  2W8S A;  3MGP D;  4CAY B;  2IO5 C;  3TU4 D;  2F2A C;  2F8N K;  1P3M D;  3UTB D;  4Z5T B;  4WU9 A;  1P3G A;  3AFA C;  5B1L B;  4YM6 C;  1P3L C;  3EPH A;  1KX4 B;  4H9N B;  4ZUX D;  3WTP D;  4KGC A;  3B6F C;  1M1A D;  4X23 A;  3LZ1 A;  1P3O A;  3MGS D;  2Y2L A;  1M19 A;  4J8X D;  3KWQ B;  4J8U D;  3X1V C;  3O62 A;  5B40 D;  3X1T D;  5GSU C;  3LEL D;  4XUJ C;  4J8V B;  3WKJ A;  5DNM A;  4UUZ B;  4AWL B;  5F99 D;  5AVB D;  2YFV B;  3LJA D;  3C1B C;  3X1U B;  4LD9 D;  5DNN D;  5CPK C;  5C3I C;  1T3U A;  3KUY B;  3B0D B;  3LZ0 C;  1JFI A;  2FJ7 C;  2HUE C;  3AV2 D;  4G91 C;  2YFW B;  3W99 D;  4NFT A;  3AZM C;  2BYM B;  5CPJ C;  1BH9 B;  3W96 A;  5B31 D;  4NE5 A;  1ULY A;  2RIQ A;  4JJN B;  3AZJ A;  3LJA A;  2G5I C;  3AZF A;  2Y2K A;  2F8N B;  3WAA C;  2ARO B;  3B6G D;  3AV2 A;  4G92 C;  4KHA A;  5AVC D;  5GSU D;  5GXQ D;  3W99 A;  3MGR A;  4EO5 B;  1HQ3 C;  2Y2G A;  2HIO D;  1P3A D;  4WU9 B;  3AV1 D;  5B32 C;  4CSR A;  3LZ0 D;  4M6B A;  1KX3 D;  5B33 D;  3MVD A;  4KGC B;  5B0Y C;  4X23 B;  3LZ1 B;  1P3O B;  3B6G A;  2PYO D;  1M19 B;  4QLC B;  1U35 C;  3O62 B;  3AZN A;  1P3I C;  3A6N C;  3REJ C;  3WKJ B;  5DNM B;  3MNN C;  2Y2M A;  2NQB A;  4XZQ A;  1KX3 A;  3REI A;  4KUD D;  1KU5 A;  5B0Z D;  1JFI B;  3EPJ A;  5B24 D;  4HGA B;  3H0R C;  3AZG A;  1ID3 A;  2BG1 A;  1KX4 C;  1B67 A;  5GT3 D;  3W96 B;  3AZJ B;  1ZLA C;  3LJA B;  4J8W D;  3X1S D;  3WA9 D;  1F1E A;  4AWL C;  2Y2I A;  3AV2 B;  3A6N D;  3P5J B;  4KHA B;  3B0C T;  3X1U C;  3W99 B;  4Z5T A;  3MGR B;  3KUY C;  3B0D C;  5B1L A;  5E5A C;  4UPK A;  5B31 B;  3REL A;  2JE5 A;  3C1C A;  1S32 D;  3B6G B;  5AV5 A;  1P34 A;  3A1K A;  3AZN B;  1AOI D;  3AZL D;  1P3A B;  3AYW A;  3VH6 W;  5FUG A;  3W97 A;  1BH8 A;  3AZH C;  2NQB B;  1EQZ C;  1PZR A;  2NZD A;  4WZS B;  5B1M A;  4XZQ B;  2DF4 C;  4YS3 D;  4EO5 C;  3REI B;  3AZI C;  1KX3 B;  1P3G C;  3REK C;  2CV5 A;  3AZG B;  1B6W A;  5B2I A;  4KGC C;  1R4V A;  1AOI A;  5CPI C;  1P3O C;  1P3F A;  3VH5 A;  1M18 C;  3KXB A;  3O62 C;  3AZK C;  1P3K A;  5DNM C;  3REH D;  5JA4 B;  5B24 B;  3UTA D;  5BNX A;  3NQU A;  3AZE D;  3V9R A;  3AZH D;  4R8P A;  1EQZ D;  3REL B;  5B2J A;  5AY8 C;  5CP6 C;  5AV9 C;  4H9Q A;  3AZI D;  3AN2 C;  3X1S B;  3B0C W;  3F6T A;  3UT9 A;  5GT0 C;  4WU8 A;  3C1C B;  4QLC A;  3W96 C;  3AZJ C;  5AV5 B;  1P34 B;  3MGP A;  3TU4 A;  3AZF C;  5CPI D;  1P3M A;  3UTB A;  3AYW B;  5FUG B;  3W97 B;  1BH8 B;  1A7W A;  2NZD B;  1KX5 C;  4ZUX A;  3WTP A;  5B1M B;  1M1A A;  3MGS A;  5B32 G;  2RVQ D;  4J8X A;  1S32 B;  4J8U A;  5B40 A;  2CV5 B;  3X1T A;  5B2I B;  3AFA D;  1F66 C;  5BS7 A;  2VQR A;  4H9S A;  3MVD C;  3LEL A;  1AOI B;  5AY8 D;  5CP6 D;  5AV9 D;  4YM6 D;  5F99 A;  1P3F B;  5AVB A;  1P3B C;  1P3L D;  3AN2 D;  3B6F D;  4LD9 A;  5DNN A;  3KXB B;  5GT0 D;  5BO0 A;  5AV8 C;  3AZN C;  4H9P A;  3X1V D;  1P3K B;  4Z66 C;  2NQB C;  5BNX B;  1TZY C;  4XUJ D;  3FDD A;  3NQU B;  4XZQ C;  3C1B D;  3V9R B;  3MGQ C;  5B31 A;  3R45 A;  5CPK D;  4R8P B;  2Y2N A;  5B2J B;  1KX5 D;  4H9Q B;  3AZG C;  2JSS A;  2FJ7 D;  4DRA A;  3VH6 T;  5JRG C;  1ID3 C;  3UT9 B;  3A1I A;  4WU8 B;  3W98 C;  2XD1 A;  3AZM D;  4WJ3 C;  5AVC A;  5BNV A;  5GSU A;  5CPJ D;  3MGP B;  5GXQ A;  3TU4 B;  1H3O A;  1P3A A;  2HIO A;  5AV6 C;  3UTB B;  1P3M B;  1P3B D;  1P3P C;  3AV1 A;  5AV8 D;  3WAA D;  3EG5 B;  3LZ0 A;  5B33 A;  3WTP B;  4ZUX B;  4Z5T C;  1M1A B;  3MGS B;  2PYO A;  5B1L C;  1TZY D;  4J8X B;  4J8U B;  4Z2M G;  3REL C;  1HQ3 D;  5B40 B;  3X1T B;  3MGQ D;  5B32 D;  3LEL B;  3KWQ C;  5F99 B;  5AVB B;  5AV5 C;  4LD9 B;  5JRG D;  5DNN B;  5B0Y D;  2F8N G;  4KUD A;  5BO0 B;  4J8V C;  4H9P B;  1U35 D;  4WV4 B;  5B0Z A;  5JA4 A;  5B24 A;  1P3I D;  3REJ D;  1HQ3 A;  5AV6 D;  1WWS A;  1P3P D;  5B1M C;  3MNN D;  3KFU G;  5GT3 A;  4YM6 B;  3R45 B;  2FFF B;  4J8W A;  3X1S A;  3WA9 A;  5B2I C;  1Q9C A;  2ZY2 A;  4JJN C;  1KX4 D;  2ZY3 A;  3A6N A;  5AVC B;  5BNV B;  5GSU B;  5GXQ B;  4XUJ B;  1H3O B;  2CWE A;  2ARO C;  2HIO B;  3KWQ D;  1ZLA D;  3C1B B;  3AV1 B;  4J8V D;  3LZ0 B;  5B33 B;  1S32 A;  4WU9 C;  4G91 B;  3X1U D;  4Z2M H;  2PYO B;  4R8P C;  3KUY D;  5CPJ B;  5E5A D;  3VH5 T;  3AZL A;  4X23 C;  3LZ1 C;  3UT9 C;  2XD5 A;  4WU8 C;  1M19 C;  4QLC C;  4H9O A;  2F8N H;  2Y2H A;  4KUD B;  4YS3 A;  3WKJ C;  5B0Z B;  2Y2J A;  2F8N D;  1HQ3 B;  2ARO D;  4E45 A;  3WTP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...