3X1TD

Crystal structure of nucleosome core particle consisting of mouse testis specific histone variants h2aa and h2ba
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
RKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1tD00
2PYOA 3O62B 5GSUD 3AZFB 1P3BC 3X1TD 3KWQC 1P3GD 3WAAD 4LD9D 3C1CA 5B0ZC 3UT9B 5G49B 5B1MA 4AWLB 1P3AD 3VH6W 3KXBD 3UTAC 3KWQD 5JA4A 1P3LC 4KHAA 1KX3A 4XZQC 4WU8C 5B0ZD 4ZBJB 3REIC 5CPKA 3REJB 3MNNB 4QLCA 4R8PA 1P3KD 4Z5TC 1P3LD 5AVBD 4WU8D 1BH8B 3REHC 4G92B 3AZJB 5B40A 2AROD 1KX4B 1M19C 4Z5TD 5B0YD 5BS7C 3W98C 5CP6C 3NQJB 5B1MB 3REHD 3AZMA 1AOIB 3TU4C 5AY8B 3X1UD 4JJNB 1BFMA 4KHAB 3RELA 4EO5C 2PYOD 4X23A 3W98D 4Z2MG 3W97B 3A6NA 4ZUXC 4Z2MH 4DRBA 4YS3C 1WWSA 3AZKB 3C1CD 3AN2C 4E44A 5B31G 5DNMB 5CPKC 2NQBA 5JRGA 3AZLC 3AV1B 5E5AA 2HIOB 4R8PC 4Z66A 3X1VB 5AVCB 1P3PA 1KX3D 4H9SA 1KX5C 5CPKD 3AZLD 1P34B 4QLCD 4R8PD 4WU9A 1U35C 1S32B 4G91B 5GT3B 4CSRB 5DNNC 1KX5D 1HQ3B 3AZMC 3MVDB 5B40D 5BO0B 3AZNC 1U35D 3B0DB 3RELC 3UTBB 3LELB 2CV5A 2CWEA 2HUEB 3VH6A 3AV2A 3AZIC 3AZMD 3LZ0A 4J8XB 1EQZB 5B32A 3AZND 1F66C 3RELD 4WZSB 3REKA 4X23D 1WWIA 3AZGC 2IO5B 3A6ND 1ULYA 4WU9B 5CPIB 4WNNB 5F99C 3VH5A 5AV5A 1B67A 3X1SB 3WTPA 2NQBD 5JRGD 3AZGD 4Z66D 3W96C 1P3PD 3W99B 1F1EA 4HGAB 1P3BA 3KWQA 5B31B 5B33B 3MGRB 3AFAC 1P3MB 1P3IC 2JSSA 4YM6B 2CV5C 3B0CW 3AZHA 3UTAA 3LJAB 1BH9B 5BNXA 4J8VA 4XZQA 4WU8A 3KUYB 2BYMB 3REIA 5GSUB 3REKC 2YFVB 5AV8A 3X1TB 2CV5D 1P3GB 3WAAB 3B6GA 4LD9B 5B2JC 3AV2D 5BNVA 5B2IA 3WKJB 4J8UA 3LZ0D 3WA9A 3REHA 5B32D 2LY8A 3AYWC 3B6FC 1P3AB 3C1BC 4CAYA 3KXBB 3REKD 1H3OB 5B2JD 1P3FC 1M19A 5CPJB 5B0ZB 4WV4B 5BS7A 3W98A 5CP6A 1M18C 3AYWD 3B6FD 3C1BD 5AV5D 1P3KB 3TU4A 3WTPD 3AZEC 5B1LC 1P3LB 1P3FD 5AVBB 2AROB 4ZUXA 3AZHC 1P3BD 4YS3A 5AV6A 3AZED 4Z5TB 4J8VC 5B0YB 3AN2A 4XUJC 1TZYA 1TAFB 3AZLA 5AV8C 3LZ1C 3X1UB 2RVQC 5GT0A 3AZHD 3UTAD 3B6GC 1P3OA 5B2IC 4J8UC 4J8VD 3WA9C 4XZQD 2PYOB 1KX5A 4XUJD 3REID 5AV8D 3LZ1D 2RVQD 1U35A 2FJ7C 3B6GD 3C1CB 5B2ID 4J8UD 3AZFC 5DNNA 4EO5B 3WA9D 4H9NA 3MGPA 4H9RA 3AZNA 5JA4B 2FJ7D 1KX3B 1M19D 5C3IC 4H9QA 3B0CT 5CP6D 5CPKB 3AZLB 3AZIA 4QLCB 4R8PB 5AV6C 4ZBJC 3TU4D 1F66A 3MNNC 1TZYC 1KX5B 3AZGA 1M1AA 5B40B 5B32G 4ZUXD 2YFWA 3V9RA 4E45A 5GT0C 5AV6D 4YS3D 3AZJC 1U35B 1P3OC 5F99A 2L5AA 3AN2D 4DRAA 3MNND 1TZYD 4KUDA 1N1JA 1KX4C 3AZMB 2F8NA 3W96A 5GT0D 1JFIA 1P3OD 3RELB 5GXQA 4X23B 3MGPC 3A6NB 5FUGA 3AFAA 4H9PA 1P3IA 2BYKA 5KDMA 5DNND 2NQBB 5JRGB 3AZGB 3R45A 5E5AB 4H9OA 3MGPD 4Z66B 5DNMC 1P3PB 2HIOC 3X1VC 1M1AC 5B2JA 3AZID 5B24A 5CHLB 1JFIB 3AYWA 1F66D 3B6FA 3C1BA 1P34C 4UUZA 4KUDC 5GT3C 1M1AD 1P3FA 4NE6A 3MGQA 1HQ3C 5F99D 1M18A 5GXQC 2CV5B 3AZEA 3AV2B 4KUDD 5B1LA 3UTBC 3LZ0B 2F8ND 3NQUA 2HUEC 3W96D 5B32B 3REKB 5GXQD 4J8XC 1EQZC 3AFAD 1R4VA 1P3ID 4XUJA 2IO5C 3B6FB 5AV9A 3C1BB 3MGSA 5AV5B 3LZ1A 5CPIC 3WTPB 4J8XD 1HTAA 5B24C 1ZLAC 1ID3C 4J8WA 1P3BB 1Q9CA 3KWQB 5BT1C 5CPID 4KGCC 2FJ7A 3O62A 3W99C 4HGAC 5B24D 3MGQC 3AZFA 1ZLAD 1ID3D 5B33C 3AZHB 3UTAB 3UT9A 5G49A 4KGCD 5BNXB 4J8VB 4XZQB 4WU8B 4XUJB 3MGQD 3REIB 1M18D 5AV8B 3LZ1B 2NZDC 3KUYC 3B6GB 5BNVB 5B2IB 5B1LD 5GSUC 3REJA 4J8UB 3X1TC 3MNNA 3WA9B 1P3GC 3WAAC 3REHB 3WKJC 5AV9C 3MGSC 4CAYB 2NZDD 1BH8A 3KUYD 2FJ7B 3AZJA 1M19B 1P3AC 3W98B 3KXBC 5CP6B 1B6WA 4J8WC 1KX4A 3WKJD 5AV9D 5CPJC 3MGSD 3TU4B 3NQJA 3O62C 5C3IB 1AOIA 1P3KC 5AY8A 4JJNA 2F8NG 4J8WD 2F8NH 4ZUXB 5AVBC 5CPJD 4YS3B 5AV6B 3UT9C 4AWLC 3O62D 3AN2B 3W97A 2AROC 3AZFD 3AZKA 1TZYB 5B0YC 5GT0B 5DNMA 1P3OB 3UT9D 3REJC 3VH5W 1KU5A 3AV1A 2HIOA 3X1UC 3X1VA 5AVCA 2PYOC 3WTPE 4G92C 3REJD 1P34A 5DNNB 4H9NB 1S32A 3C1CC 1A7WA 5GT3A 3MGPB 4CSRA 4H9RB 3AZNB 5B1MC 3AZJD 1HQ3A 1AOIC 4H9QB 3MVDA 5AY8C 5BO0A 4JJNC 1KX3C 3AZIB 1KX4D 3UTBA 3LELA 5B1MD 1F66B 3W97C 4QLCC 1AOID 3AZKC 5AY8D 4J8XA 4JJND 1EQZA 1M1AB 2YFWB 3V9RB 5F99B 3AV1C 5B40C 3W97D 5AVCC 3AZKD 5CPIA 4KUDB 1N1JB 4WNNA 2F8NB 3W96B 3X1SA 1ZLAA 5DNMD 1ID3A 3AV1D 2HIOD 5GXQB 3X1VD 1S32C 5AVCD 4G91C 4KGCA 3W99A 5FUGB 3AFAB 4H9PB 3VH6T 4X23C 1P3IB 2BYKB 5KDMB 5B31A 3A6NC 5B33A 3MVDC 1P34D 3MGRA 4NFTA 1P3MA 1S32D 3B0DC 3R45B 4H9OB 5GT3D 4YM6A 3LELC 2NQBC 5JRGC 1HQ3D 3LJAA 5E5AC 4NE3A 1BH9A 4Z66C 3MVDD 2NZDA 3KUYA 1P3PC 2BYMA 5B2JB 3VH5T 4NE5A 5GSUA 4H9SC 5B24B 3UTBD 2YFVA 3X1TA 3LELD 1ZLAB 1P3GA 3WAAA 1ID3B 3AYWB 4LD9A 3WKJA 5E5AD 4UUZB 4WU9C 1EQZD 4KGCB 4M6BA 1P3FB 1P3AA 3X1SC 3KXBA 3MGQB 1H3OA 1M18B 2F8NK 5CPJA 5B0ZA 4WU9D 3AZEB 5B1LB 3NQUB 3X1SD 1P3KA 5B31C 3AV2C 3B0BA 1P3LA 3LZ0C 3MGRC 1P3MC 5AVBA 2NZDB 5B32C 5BT1D 4YM6C 3KSYA 3W99D 2AROA 3LJAC 5B31D 5AV9B 4Z5TA 5B33D 3MGSB 5B0YA 3MGRD 1P3MD 1TAFA 4YM6D 5AV5C 3WTPC 3X1UA 4LD9C 4J8WB 3LJAD
chains in the Genus database with same CATH superfamily
2PYOA 3O62B 5GSUD 3AZFB 2Y2IA 3X1TD 1P3BC 3KWQC 1P3GD 3WAAD 4LD9D 3C1CA 5B0ZC 3UT9B 5G49B 5B1MA 4AWLB 1P3AD 3VH6W 3KXBD 3UTAC 3KWQD 5JA4A 1P3LC 4KHAA 1KX3A 4XZQC 4WU8C 5B0ZD 4ZBJB 3REIC 5CPKA 3REJB 3KFUG 3MNNB 4QLCA 4R8PA 1P3KD 4Z5TC 1P3LD 5AVBD 4WU8D 1BH8B 3REHC 4G92B 3AZJB 5B40A 2AROD 2RIQA 1KX4B 1M19C 4Z5TD 5B0YD 5BS7C 3W98C 5CP6C 3NQJB 5B1MB 3REHD 3AZMA 1AOIB 3TU4C 2FFFB 5AY8B 3X1UD 4JJNB 1BFMA 4KHAB 3RELA 4EO5C 2PYOD 4X23A 3W98D 2Y2KA 4Z2MG 3W97B 3A6NA 4ZUXC 4Z2MH 4DRBA 4YS3C 1WWSA 3AZKB 3C1CD 3AN2C 4E44A 5B31G 5DNMB 5CPKC 2NQBA 5JRGA 3AZLC 3AV1B 5E5AA 2HIOB 4R8PC 4Z66A 3X1VB 5AVCB 2DF4C 1P3PA 1KX3D 4H9SA 1KX5C 5CPKD 3AZLD 1P34B 4QLCD 4R8PD 4WU9A 1U35C 1S32B 4G91B 5GT3B 4CSRB 5DNNC 1KX5D 1HQ3B 3AZMC 3MVDB 5B40D 5BO0B 3AZNC 1U35D 3B0DB 3RELC 3UTBB 3LELB 2CV5A 2CWEA 2HUEB 3VH6A 2JE5A 3AV2A 3AZIC 3AZMD 3EPHA 3LZ0A 4J8XB 1EQZB 5B32A 3AZND 1F66C 3RELD 4WZSB 3REKA 4X23D 1WWIA 3AZGC 2IO5B 3A6ND 1ULYA 4WU9B 5CPIB 4WNNB 5F99C 3VH5A 1Z2CB 5AV5A 1B67A 3X1SB 3WTPA 2NQBD 5JRGD 3AZGD 4Z66D 3W96C 1P3PD 3W99B 1F1EA 4HGAB 1P3BA 3KWQA 5B31B 5B33B 3MGRB 3AFAC 1P3MB 1P3IC 2JSSA 4YM6B 2CV5C 3B0CW 3AZHA 3UTAA 2Y2NA 3LJAB 1BH9B 5BNXA 4J8VA 4XZQA 4WU8A 3KUYB 2BYMB 3REIA 5GSUB 3REKC 2YFVB 5AV8A 3X1TB 2CV5D 1P3GB 3WAAB 3FDDA 3B6GA 5B2JC 3AV2D 5BNVA 5B2IA 3WKJB 4LD9B 4J8UA 3LZ0D 2JCHA 3WA9A 3REHA 5B32D 2LY8A 3AYWC 3B6FC 1P3AB 2F2AC 3C1BC 4CAYA 3KXBB 3REKD 1H3OB 5B2JD 1P3FC 1M19A 5CPJB 3IP4C 5B0ZB 4WV4B 5BS7A 3W98A 5CP6A 1M18C 3AYWD 3B6FD 3C1BD 5AV5D 1P3KB 3TU4A 3WTPD 3AZEC 5B1LC 1P3LB 1P3FD 5AVBB 1W2EA 2AROB 4ZUXA 3AZHC 1P3BD 4YS3A 5AV6A 3AZED 4Z5TB 4J8VC 5B0YB 3AN2A 4XUJC 3EPKA 1TZYA 1TAFB 3H0MC 3AZLA 5AV8C 3LZ1C 3X1UB 2RVQC 5GT0A 3AZHD 3UTAD 3B6GC 1P3OA 5B2IC 4J8UC 2W8SA 4J8VD 3WA9C 4XZQD 2PYOB 1KX5A 4XUJD 3REID 2BG1A 5AV8D 3LZ1D 2RVQD 1U35A 2FJ7C 3B6GD 2Y2PA 3C1CB 5B2ID 4J8UD 3F6TA 3AZFC 1PZRA 4EO5B 5DNNA 3WA9D 4H9NA 3MGPA 4H9RA 3AZNA 5JA4B 2FJ7D 1KX3B 1M19D 5C3IC 4H9QA 3B0CT 5CP6D 5CPKB 3AZLB 3AZIA 4QLCB 4R8PB 5AV6C 4ZBJC 3TU4D 1F66A 3MNNC 1TZYC 1KX5B 3AZGA 1M1AA 5B40B 5B32G 4ZUXD 2YFWA 3V9RA 4E45A 5GT0C 5AV6D 4YS3D 3AZJC 1U35B 1P3OC 5F99A 2L5AA 3AN2D 4DRAA 3MNND 1TZYD 4KUDA 1N1JA 1KX4C 3AZMB 2F8NA 3W96A 5GT0D 1JFIA 1P3OD 3RELB 5GXQA 4X23B 3MGPC 3A6NB 5FUGA 3AFAA 4H9PA 1P3IA 2BYKA 5KDMA 5DNND 2DQNC 2NQBB 5JRGB 3AZGB 3R45A 5E5AB 4H9OA 3MGPD 4Z66B 2ZY2A 2ZY3A 5DNMC 1P3PB 2HIOC 3X1VC 4DQYB 1M1AC 5B2JA 3AZID 1T3UA 5B24A 5CHLB 1JFIB 3AYWA 1F66D 3B6FA 3C1BA 1P34C 2Y2GA 4UUZA 4KUDC 5GT3C 1M1AD 1P3FA 4NE6A 3MGQA 1HQ3C 5F99D 1M18A 5GXQC 2CV5B 3AZEA 3AV2B 4KUDD 5B1LA 3UTBC 3LZ0B 2F8ND 3NQUA 2HUEC 2Y2HA 5B32B 3W96D 3REKB 5GXQD 4J8XC 1EQZC 3A1IA 3AFAD 1R4VA 1P3ID 4XUJA 2IO5C 3B6FB 5AV9A 3C1BB 3MGSA 5AV5B 3LZ1A 5CPIC 3WTPB 4J8XD 3EG5B 1HTAA 5B24C 1ZLAC 1ID3C 4J8WA 1P3BB 1Q9CA 3KWQB 5BT1C 5CPID 4KGCC 2FJ7A 3O62A 3W99C 4HGAC 5B24D 3MGQC 3AZFA 1ZLAD 1ID3D 5B33C 3AZHB 3UTAB 3UT9A 5G49A 4KGCD 5BNXB 4J8VB 4XZQB 4WU8B 4XUJB 3MGQD 3REIB 1M18D 5AV8B 3LZ1B 2NZDC 3KUYC 3B6GB 5BNVB 5B2IB 5B1LD 5GSUC 3REJA 4J8UB 3X1TC 3MNNA 3WA9B 1P3GC 3WAAC 3REHB 3WKJC 2XD5A 5AV9C 3MGSC 4CAYB 2NZDD 1BH8A 3KUYD 2FJ7B 3AZJA 4UPKA 1P3AC 1M19B 3W98B 3KXBC 5CP6B 1B6WA 4J8WC 1KX4A 3WKJD 5AV9D 5CPJC 3MGSD 3TU4B 3AL0C 3NQJA 3O62C 5C3IB 1AOIA 1P3KC 5AY8A 4JJNA 2F8NG 4J8WD 2F8NH 4ZUXB 5AVBC 5CPJD 4YS3B 5AV6B 3UT9C 4AWLC 3O62D 3AN2B 3W97A 2AROC 3AZFD 3AZKA 1TZYB 2VQRA 5B0YC 5GT0B 3A1KA 5DNMA 1P3OB 3UT9D 3REJC 3VH5W 1KU5A 3AV1A 2HIOA 3X1UC 3X1VA 5AVCA 2UWXA 2PYOC 3WTPE 4G92C 3REJD 1P34A 5DNNB 4H9NB 1S32A 3C1CC 1A7WA 5GT3A 3MGPB 4CSRA 4H9RB 3AZNB 5B1MC 3AZJD 1HQ3A 1AOIC 4H9QB 3MVDA 5AY8C 5BO0A 4JJNC 1KX3C 3AZIB 1KX4D 3EPJA 3UTBA 3LELA 5B1MD 1F66B 3W97C 2ZY4A 4QLCC 1AOID 3AZKC 5AY8D 4J8XA 4JJND 1EQZA 1M1AB 2J8PA 2YFWB 3V9RB 2Y2QA 5F99B 3AV1C 5B40C 3W97D 5AVCC 3AZKD 5CPIA 4KUDB 1N1JB 4WNNA 2F8NB 3W96B 3X1SA 1ZLAA 5DNMD 1ID3A 2ZY5A 3AV1D 2HIOD 5GXQB 3X1VD 1S32C 5AVCD 4G91C 4KGCA 3W99A 5FUGB 3AFAB 2Y2JA 4H9PB 3VH6T 4X23C 1P3IB 2BYKB 2XD1A 5KDMB 5B31A 3EPLA 3A6NC 5B33A 3MVDC 1P34D 3MGRA 4NFTA 1P3MA 1S32D 3B0DC 3R45B 4H9OB 5GT3D 4YM6A 3LELC 2NQBC 5JRGC 1HQ3D 3LJAA 5E5AC 4NE3A 1BH9A 4Z66C 3MVDD 2NZDA 3KUYA 1P3PC 2BYMA 5B2JB 3VH5T 4NE5A 5GSUA 4H9SC 5B24B 3UTBD 2YFVA 3X1TA 3LELD 1ZLAB 1P3GA 3WAAA 1ID3B 3AYWB 4LD9A 3WKJA 5E5AD 4UUZB 4WU9C 1EQZD 4KGCB 4M6BA 1P3FB 1P3AA 3X1SC 3KXBA 3MGQB 4WJ3C 1H3OA 1M18B 2F8NK 5CPJA 5B0ZA 4WU9D 3AZEB 5B1LB 2G5HC 3NQUB 3X1SD 1P3KA 2Y2LA 5B31C 3AV2C 2Y2OA 3B0BA 1P3LA 3LZ0C 3MGRC 1P3MC 5AVBA 2NZDB 5B32C 5BT1D 4YM6C 3KSYA 3W99D 3H0RC 2AROA 3LJAC 5B31D 5AV9B 4Z5TA 5B33D 3MGSB 5B0YA 3P5JB 3MGRD 1P3MD 2G5IC 2ZM5A 1TAFA 4YM6D 5AV5C 3WTPC 2Y2MA 3X1UA 4LD9C 4J8WB 3LJAD 3H0LC
chains in the Genus database with same CATH topology
2PYOA 3O62B 5GSUD 3AZFB 2Y2IA 3X1TD 1P3BC 3KWQC 1P3GD 3WAAD 4LD9D 3C1CA 5B0ZC 3UT9B 5G49B 5B1MA 4AWLB 1P3AD 3VH6W 3KXBD 3UTAC 3KWQD 5JA4A 1P3LC 4KHAA 1KX3A 4XZQC 4WU8C 5B0ZD 4ZBJB 3REIC 5CPKA 3REJB 3KFUG 3MNNB 4QLCA 4R8PA 1P3KD 4Z5TC 1P3LD 5AVBD 4WU8D 1BH8B 3REHC 4G92B 3AZJB 5B40A 2AROD 2RIQA 1KX4B 1M19C 4Z5TD 5B0YD 5BS7C 3W98C 5CP6C 3NQJB 5B1MB 3REHD 3AZMA 1AOIB 3TU4C 2FFFB 5AY8B 3X1UD 4JJNB 1BFMA 4KHAB 3RELA 4EO5C 2PYOD 4X23A 3W98D 2Y2KA 4Z2MG 3W97B 3A6NA 4ZUXC 4Z2MH 4DRBA 4YS3C 1WWSA 3AZKB 3C1CD 3AN2C 4E44A 5B31G 5DNMB 5CPKC 2NQBA 5JRGA 3AZLC 3AV1B 5E5AA 2HIOB 4R8PC 4Z66A 3X1VB 5AVCB 2DF4C 1P3PA 1KX3D 4H9SA 1KX5C 5CPKD 3AZLD 1P34B 4QLCD 4R8PD 4WU9A 1U35C 1S32B 4G91B 5GT3B 4CSRB 5DNNC 1KX5D 1HQ3B 3AZMC 3MVDB 5B40D 5BO0B 3AZNC 1U35D 3B0DB 3RELC 3UTBB 3LELB 2CV5A 2CWEA 2HUEB 3VH6A 2JE5A 3AV2A 3AZIC 3AZMD 3EPHA 3LZ0A 4J8XB 1EQZB 5B32A 3AZND 1F66C 3RELD 4WZSB 3REKA 4X23D 1WWIA 3AZGC 2IO5B 3A6ND 1ULYA 4WU9B 5CPIB 4WNNB 5F99C 3VH5A 1Z2CB 5AV5A 1B67A 3X1SB 3WTPA 2NQBD 5JRGD 3AZGD 4Z66D 3W96C 1P3PD 3W99B 1F1EA 4HGAB 1P3BA 3KWQA 5B31B 5B33B 3MGRB 3AFAC 1P3MB 1P3IC 2JSSA 4YM6B 2CV5C 3B0CW 3AZHA 3UTAA 2Y2NA 3LJAB 1BH9B 5BNXA 4J8VA 4XZQA 4WU8A 3KUYB 2BYMB 3REIA 5GSUB 3REKC 2YFVB 5AV8A 3X1TB 2CV5D 1P3GB 3WAAB 3FDDA 3B6GA 5B2JC 3AV2D 5BNVA 5B2IA 3WKJB 4LD9B 4J8UA 3LZ0D 2JCHA 3WA9A 3REHA 5B32D 2LY8A 3AYWC 3B6FC 1P3AB 2F2AC 3C1BC 4CAYA 3KXBB 3REKD 1H3OB 5B2JD 1P3FC 1M19A 5CPJB 3IP4C 5B0ZB 4WV4B 5BS7A 3W98A 5CP6A 1M18C 3AYWD 3B6FD 3C1BD 5AV5D 1P3KB 3TU4A 3WTPD 3AZEC 5B1LC 1P3LB 1P3FD 5AVBB 1W2EA 2AROB 4ZUXA 3AZHC 1P3BD 4YS3A 5AV6A 3AZED 4Z5TB 4J8VC 5B0YB 3AN2A 4XUJC 3EPKA 1TZYA 1TAFB 3H0MC 3AZLA 5AV8C 3LZ1C 3X1UB 2RVQC 5GT0A 3AZHD 3UTAD 3B6GC 1P3OA 5B2IC 4J8UC 2W8SA 4J8VD 3WA9C 4XZQD 2PYOB 1KX5A 4XUJD 3REID 2BG1A 5AV8D 3LZ1D 2RVQD 1U35A 2FJ7C 3B6GD 2Y2PA 3C1CB 5B2ID 4J8UD 3F6TA 3AZFC 1PZRA 4EO5B 5DNNA 3WA9D 4H9NA 3MGPA 4H9RA 3AZNA 5JA4B 2FJ7D 1KX3B 1M19D 5C3IC 4H9QA 3B0CT 5CP6D 5CPKB 3AZLB 3AZIA 4QLCB 4R8PB 5AV6C 4ZBJC 3TU4D 1F66A 3MNNC 1TZYC 1KX5B 3AZGA 1M1AA 5B40B 5B32G 4ZUXD 2YFWA 3V9RA 4E45A 5GT0C 5AV6D 4YS3D 3AZJC 1U35B 1P3OC 5F99A 2L5AA 3AN2D 4DRAA 3MNND 1TZYD 4KUDA 1N1JA 1KX4C 3AZMB 2F8NA 3W96A 5GT0D 1JFIA 1P3OD 3RELB 5GXQA 4X23B 3MGPC 3A6NB 5FUGA 3AFAA 4H9PA 1P3IA 2BYKA 5KDMA 5DNND 2DQNC 2NQBB 5JRGB 3AZGB 3R45A 5E5AB 4H9OA 3MGPD 4Z66B 2ZY2A 2ZY3A 5DNMC 1P3PB 2HIOC 3X1VC 4DQYB 1M1AC 5B2JA 3AZID 1T3UA 5B24A 5CHLB 1JFIB 3AYWA 1F66D 3B6FA 3C1BA 1P34C 2Y2GA 4UUZA 4KUDC 5GT3C 1M1AD 1P3FA 4NE6A 3MGQA 1HQ3C 5F99D 1M18A 5GXQC 2CV5B 3AZEA 3AV2B 4KUDD 5B1LA 3UTBC 3LZ0B 2F8ND 3NQUA 2HUEC 2Y2HA 5B32B 3W96D 3REKB 5GXQD 4J8XC 1EQZC 3A1IA 3AFAD 1R4VA 1P3ID 4XUJA 2IO5C 3B6FB 5AV9A 3C1BB 3MGSA 5AV5B 3LZ1A 5CPIC 3WTPB 4J8XD 3EG5B 1HTAA 5B24C 1ZLAC 1ID3C 4J8WA 1P3BB 1Q9CA 3KWQB 5BT1C 5CPID 4KGCC 2FJ7A 3O62A 3W99C 4HGAC 5B24D 3MGQC 3AZFA 1ZLAD 1ID3D 5B33C 3AZHB 3UTAB 3UT9A 5G49A 4KGCD 5BNXB 4J8VB 4XZQB 4WU8B 4XUJB 3MGQD 3REIB 1M18D 5AV8B 3LZ1B 2NZDC 3KUYC 3B6GB 5BNVB 5B2IB 5B1LD 5GSUC 3REJA 4J8UB 3X1TC 3MNNA 3WA9B 1P3GC 3WAAC 3REHB 3WKJC 2XD5A 5AV9C 3MGSC 4CAYB 2NZDD 1BH8A 3KUYD 2FJ7B 3AZJA 4UPKA 1P3AC 1M19B 3W98B 3KXBC 5CP6B 1B6WA 4J8WC 1KX4A 3WKJD 5AV9D 5CPJC 3MGSD 3TU4B 3AL0C 3NQJA 3O62C 5C3IB 1AOIA 1P3KC 5AY8A 4JJNA 2F8NG 4J8WD 2F8NH 4ZUXB 5AVBC 5CPJD 4YS3B 5AV6B 3UT9C 4AWLC 3O62D 3AN2B 3W97A 2AROC 3AZFD 3AZKA 1TZYB 2VQRA 5B0YC 5GT0B 3A1KA 5DNMA 1P3OB 3UT9D 3REJC 3VH5W 1KU5A 3AV1A 2HIOA 3X1UC 3X1VA 5AVCA 2UWXA 2PYOC 3WTPE 4G92C 3REJD 1P34A 5DNNB 4H9NB 1S32A 3C1CC 1A7WA 5GT3A 3MGPB 4CSRA 4H9RB 3AZNB 5B1MC 3AZJD 1HQ3A 1AOIC 4H9QB 3MVDA 5AY8C 5BO0A 4JJNC 1KX3C 3AZIB 1KX4D 3EPJA 3UTBA 3LELA 5B1MD 1F66B 3W97C 2ZY4A 4QLCC 1AOID 3AZKC 5AY8D 4J8XA 4JJND 1EQZA 1M1AB 2J8PA 2YFWB 3V9RB 2Y2QA 5F99B 3AV1C 5B40C 3W97D 5AVCC 3AZKD 5CPIA 4KUDB 1N1JB 4WNNA 2F8NB 3W96B 3X1SA 1ZLAA 5DNMD 1ID3A 2ZY5A 3AV1D 2HIOD 5GXQB 3X1VD 1S32C 5AVCD 4G91C 4KGCA 3W99A 5FUGB 3AFAB 2Y2JA 4H9PB 3VH6T 4X23C 1P3IB 2BYKB 2XD1A 5KDMB 5B31A 3EPLA 3A6NC 5B33A 3MVDC 1P34D 3MGRA 4NFTA 1P3MA 1S32D 3B0DC 3R45B 4H9OB 5GT3D 4YM6A 3LELC 2NQBC 5JRGC 1HQ3D 3LJAA 5E5AC 4NE3A 1BH9A 4Z66C 3MVDD 2NZDA 3KUYA 1P3PC 2BYMA 5B2JB 3VH5T 4NE5A 5GSUA 4H9SC 5B24B 3UTBD 2YFVA 3X1TA 3LELD 1ZLAB 1P3GA 3WAAA 1ID3B 3AYWB 4LD9A 3WKJA 5E5AD 4UUZB 4WU9C 1EQZD 4KGCB 4M6BA 1P3FB 1P3AA 3X1SC 3KXBA 3MGQB 4WJ3C 1H3OA 1M18B 2F8NK 5CPJA 5B0ZA 4WU9D 3AZEB 5B1LB 2G5HC 3NQUB 3X1SD 1P3KA 2Y2LA 5B31C 3AV2C 2Y2OA 3B0BA 1P3LA 3LZ0C 3MGRC 1P3MC 5AVBA 2NZDB 5B32C 5BT1D 4YM6C 3KSYA 3W99D 3H0RC 2AROA 3LJAC 5B31D 5AV9B 4Z5TA 5B33D 3MGSB 5B0YA 3P5JB 3MGRD 1P3MD 2G5IC 2ZM5A 1TAFA 4YM6D 5AV5C 3WTPC 2Y2MA 3X1UA 4LD9C 4J8WB 3LJAD 3H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYO A;  3O62 B;  5GSU D;  3AZF B;  1P3B C;  3X1T D;  3KWQ C;  1P3G D;  3WAA D;  4LD9 D;  3C1C A;  5B0Z C;  3UT9 B;  5G49 B;  5B1M A;  4AWL B;  1P3A D;  3VH6 W;  3KXB D;  3UTA C;  3KWQ D;  5JA4 A;  1P3L C;  4KHA A;  1KX3 A;  4XZQ C;  4WU8 C;  5B0Z D;  4ZBJ B;  3REI C;  5CPK A;  3REJ B;  3MNN B;  4QLC A;  4R8P A;  1P3K D;  4Z5T C;  1P3L D;  5AVB D;  4WU8 D;  1BH8 B;  3REH C;  4G92 B;  3AZJ B;  5B40 A;  2ARO D;  1KX4 B;  1M19 C;  4Z5T D;  5B0Y D;  5BS7 C;  3W98 C;  5CP6 C;  3NQJ B;  5B1M B;  3REH D;  3AZM A;  1AOI B;  3TU4 C;  5AY8 B;  3X1U D;  4JJN B;  1BFM A;  4KHA B;  3REL A;  4EO5 C;  2PYO D;  4X23 A;  3W98 D;  4Z2M G;  3W97 B;  3A6N A;  4ZUX C;  4Z2M H;  4DRB A;  4YS3 C;  1WWS A;  3AZK B;  3C1C D;  3AN2 C;  4E44 A;  5B31 G;  5DNM B;  5CPK C;  2NQB A;  5JRG A;  3AZL C;  3AV1 B;  5E5A A;  2HIO B;  4R8P C;  4Z66 A;  3X1V B;  5AVC B;  1P3P A;  1KX3 D;  4H9S A;  1KX5 C;  5CPK D;  3AZL D;  1P34 B;  4QLC D;  4R8P D;  4WU9 A;  1U35 C;  1S32 B;  4G91 B;  5GT3 B;  4CSR B;  5DNN C;  1KX5 D;  1HQ3 B;  3AZM C;  3MVD B;  5B40 D;  5BO0 B;  3AZN C;  1U35 D;  3B0D B;  3REL C;  3UTB B;  3LEL B;  2CV5 A;  2CWE A;  2HUE B;  3VH6 A;  3AV2 A;  3AZI C;  3AZM D;  3LZ0 A;  4J8X B;  1EQZ B;  5B32 A;  3AZN D;  1F66 C;  3REL D;  4WZS B;  3REK A;  4X23 D;  1WWI A;  3AZG C;  2IO5 B;  3A6N D;  1ULY A;  4WU9 B;  5CPI B;  4WNN B;  5F99 C;  3VH5 A;  5AV5 A;  1B67 A;  3X1S B;  3WTP A;  2NQB D;  5JRG D;  3AZG D;  4Z66 D;  3W96 C;  1P3P D;  3W99 B;  1F1E A;  4HGA B;  1P3B A;  3KWQ A;  5B31 B;  5B33 B;  3MGR B;  3AFA C;  1P3M B;  1P3I C;  2JSS A;  4YM6 B;  2CV5 C;  3B0C W;  3AZH A;  3UTA A;  3LJA B;  1BH9 B;  5BNX A;  4J8V A;  4XZQ A;  4WU8 A;  3KUY B;  2BYM B;  3REI A;  5GSU B;  3REK C;  2YFV B;  5AV8 A;  3X1T B;  2CV5 D;  1P3G B;  3WAA B;  3B6G A;  4LD9 B;  5B2J C;  3AV2 D;  5BNV A;  5B2I A;  3WKJ B;  4J8U A;  3LZ0 D;  3WA9 A;  3REH A;  5B32 D;  2LY8 A;  3AYW C;  3B6F C;  1P3A B;  3C1B C;  4CAY A;  3KXB B;  3REK D;  1H3O B;  5B2J D;  1P3F C;  1M19 A;  5CPJ B;  5B0Z B;  4WV4 B;  5BS7 A;  3W98 A;  5CP6 A;  1M18 C;  3AYW D;  3B6F D;  3C1B D;  5AV5 D;  1P3K B;  3TU4 A;  3WTP D;  3AZE C;  5B1L C;  1P3L B;  1P3F D;  5AVB B;  2ARO B;  4ZUX A;  3AZH C;  1P3B D;  4YS3 A;  5AV6 A;  3AZE D;  4Z5T B;  4J8V C;  5B0Y B;  3AN2 A;  4XUJ C;  1TZY A;  1TAF B;  3AZL A;  5AV8 C;  3LZ1 C;  3X1U B;  2RVQ C;  5GT0 A;  3AZH D;  3UTA D;  3B6G C;  1P3O A;  5B2I C;  4J8U C;  4J8V D;  3WA9 C;  4XZQ D;  2PYO B;  1KX5 A;  4XUJ D;  3REI D;  5AV8 D;  3LZ1 D;  2RVQ D;  1U35 A;  2FJ7 C;  3B6G D;  3C1C B;  5B2I D;  4J8U D;  3AZF C;  5DNN A;  4EO5 B;  3WA9 D;  4H9N A;  3MGP A;  4H9R A;  3AZN A;  5JA4 B;  2FJ7 D;  1KX3 B;  1M19 D;  5C3I C;  4H9Q A;  3B0C T;  5CP6 D;  5CPK B;  3AZL B;  3AZI A;  4QLC B;  4R8P B;  5AV6 C;  4ZBJ C;  3TU4 D;  1F66 A;  3MNN C;  1TZY C;  1KX5 B;  3AZG A;  1M1A A;  5B40 B;  5B32 G;  4ZUX D;  2YFW A;  3V9R A;  4E45 A;  5GT0 C;  5AV6 D;  4YS3 D;  3AZJ C;  1U35 B;  1P3O C;  5F99 A;  2L5A A;  3AN2 D;  4DRA A;  3MNN D;  1TZY D;  4KUD A;  1N1J A;  1KX4 C;  3AZM B;  2F8N A;  3W96 A;  5GT0 D;  1JFI A;  1P3O D;  3REL B;  5GXQ A;  4X23 B;  3MGP C;  3A6N B;  5FUG A;  3AFA A;  4H9P A;  1P3I A;  2BYK A;  5KDM A;  5DNN D;  2NQB B;  5JRG B;  3AZG B;  3R45 A;  5E5A B;  4H9O A;  3MGP D;  4Z66 B;  5DNM C;  1P3P B;  2HIO C;  3X1V C;  1M1A C;  5B2J A;  3AZI D;  5B24 A;  5CHL B;  1JFI B;  3AYW A;  1F66 D;  3B6F A;  3C1B A;  1P34 C;  4UUZ A;  4KUD C;  5GT3 C;  1M1A D;  1P3F A;  4NE6 A;  3MGQ A;  1HQ3 C;  5F99 D;  1M18 A;  5GXQ C;  2CV5 B;  3AZE A;  3AV2 B;  4KUD D;  5B1L A;  3UTB C;  3LZ0 B;  2F8N D;  3NQU A;  2HUE C;  3W96 D;  5B32 B;  3REK B;  5GXQ D;  4J8X C;  1EQZ C;  3AFA D;  1R4V A;  1P3I D;  4XUJ A;  2IO5 C;  3B6F B;  5AV9 A;  3C1B B;  3MGS A;  5AV5 B;  3LZ1 A;  5CPI C;  3WTP B;  4J8X D;  1HTA A;  5B24 C;  1ZLA C;  1ID3 C;  4J8W A;  1P3B B;  1Q9C A;  3KWQ B;  5BT1 C;  5CPI D;  4KGC C;  2FJ7 A;  3O62 A;  3W99 C;  4HGA C;  5B24 D;  3MGQ C;  3AZF A;  1ZLA D;  1ID3 D;  5B33 C;  3AZH B;  3UTA B;  3UT9 A;  5G49 A;  4KGC D;  5BNX B;  4J8V B;  4XZQ B;  4WU8 B;  4XUJ B;  3MGQ D;  3REI B;  1M18 D;  5AV8 B;  3LZ1 B;  2NZD C;  3KUY C;  3B6G B;  5BNV B;  5B2I B;  5B1L D;  5GSU C;  3REJ A;  4J8U B;  3X1T C;  3MNN A;  3WA9 B;  1P3G C;  3WAA C;  3REH B;  3WKJ C;  5AV9 C;  3MGS C;  4CAY B;  2NZD D;  1BH8 A;  3KUY D;  2FJ7 B;  3AZJ A;  1M19 B;  1P3A C;  3W98 B;  3KXB C;  5CP6 B;  1B6W A;  4J8W C;  1KX4 A;  3WKJ D;  5AV9 D;  5CPJ C;  3MGS D;  3TU4 B;  3NQJ A;  3O62 C;  5C3I B;  1AOI A;  1P3K C;  5AY8 A;  4JJN A;  2F8N G;  4J8W D;  2F8N H;  4ZUX B;  5AVB C;  5CPJ D;  4YS3 B;  5AV6 B;  3UT9 C;  4AWL C;  3O62 D;  3AN2 B;  3W97 A;  2ARO C;  3AZF D;  3AZK A;  1TZY B;  5B0Y C;  5GT0 B;  5DNM A;  1P3O B;  3UT9 D;  3REJ C;  3VH5 W;  1KU5 A;  3AV1 A;  2HIO A;  3X1U C;  3X1V A;  5AVC A;  2PYO C;  3WTP E;  4G92 C;  3REJ D;  1P34 A;  5DNN B;  4H9N B;  1S32 A;  3C1C C;  1A7W A;  5GT3 A;  3MGP B;  4CSR A;  4H9R B;  3AZN B;  5B1M C;  3AZJ D;  1HQ3 A;  1AOI C;  4H9Q B;  3MVD A;  5AY8 C;  5BO0 A;  4JJN C;  1KX3 C;  3AZI B;  1KX4 D;  3UTB A;  3LEL A;  5B1M D;  1F66 B;  3W97 C;  4QLC C;  1AOI D;  3AZK C;  5AY8 D;  4J8X A;  4JJN D;  1EQZ A;  1M1A B;  2YFW B;  3V9R B;  5F99 B;  3AV1 C;  5B40 C;  3W97 D;  5AVC C;  3AZK D;  5CPI A;  4KUD B;  1N1J B;  4WNN A;  2F8N B;  3W96 B;  3X1S A;  1ZLA A;  5DNM D;  1ID3 A;  3AV1 D;  2HIO D;  5GXQ B;  3X1V D;  1S32 C;  5AVC D;  4G91 C;  4KGC A;  3W99 A;  5FUG B;  3AFA B;  4H9P B;  3VH6 T;  4X23 C;  1P3I B;  2BYK B;  5KDM B;  5B31 A;  3A6N C;  5B33 A;  3MVD C;  1P34 D;  3MGR A;  4NFT A;  1P3M A;  1S32 D;  3B0D C;  3R45 B;  4H9O B;  5GT3 D;  4YM6 A;  3LEL C;  2NQB C;  5JRG C;  1HQ3 D;  3LJA A;  5E5A C;  4NE3 A;  1BH9 A;  4Z66 C;  3MVD D;  2NZD A;  3KUY A;  1P3P C;  2BYM A;  5B2J B;  3VH5 T;  4NE5 A;  5GSU A;  4H9S C;  5B24 B;  3UTB D;  2YFV A;  3X1T A;  3LEL D;  1ZLA B;  1P3G A;  3WAA A;  1ID3 B;  3AYW B;  4LD9 A;  3WKJ A;  5E5A D;  4UUZ B;  4WU9 C;  1EQZ D;  4KGC B;  4M6B A;  1P3F B;  1P3A A;  3X1S C;  3KXB A;  3MGQ B;  1H3O A;  1M18 B;  2F8N K;  5CPJ A;  5B0Z A;  4WU9 D;  3AZE B;  5B1L B;  3NQU B;  3X1S D;  1P3K A;  5B31 C;  3AV2 C;  3B0B A;  1P3L A;  3LZ0 C;  3MGR C;  1P3M C;  5AVB A;  2NZD B;  5B32 C;  5BT1 D;  4YM6 C;  3KSY A;  3W99 D;  2ARO A;  3LJA C;  5B31 D;  5AV9 B;  4Z5T A;  5B33 D;  3MGS B;  5B0Y A;  3MGR D;  1P3M D;  1TAF A;  4YM6 D;  5AV5 C;  3WTP C;  3X1U A;  4LD9 C;  4J8W B;  3LJA D; 
#chains in the Genus database with same CATH topology
 2PYO A;  3O62 B;  5GSU D;  3AZF B;  2Y2I A;  3X1T D;  1P3B C;  3KWQ C;  1P3G D;  3WAA D;  4LD9 D;  3C1C A;  5B0Z C;  3UT9 B;  5G49 B;  5B1M A;  4AWL B;  1P3A D;  3VH6 W;  3KXB D;  3UTA C;  3KWQ D;  5JA4 A;  1P3L C;  4KHA A;  1KX3 A;  4XZQ C;  4WU8 C;  5B0Z D;  4ZBJ B;  3REI C;  5CPK A;  3REJ B;  3KFU G;  3MNN B;  4QLC A;  4R8P A;  1P3K D;  4Z5T C;  1P3L D;  5AVB D;  4WU8 D;  1BH8 B;  3REH C;  4G92 B;  3AZJ B;  5B40 A;  2ARO D;  2RIQ A;  1KX4 B;  1M19 C;  4Z5T D;  5B0Y D;  5BS7 C;  3W98 C;  5CP6 C;  3NQJ B;  5B1M B;  3REH D;  3AZM A;  1AOI B;  3TU4 C;  2FFF B;  5AY8 B;  3X1U D;  4JJN B;  1BFM A;  4KHA B;  3REL A;  4EO5 C;  2PYO D;  4X23 A;  3W98 D;  2Y2K A;  4Z2M G;  3W97 B;  3A6N A;  4ZUX C;  4Z2M H;  4DRB A;  4YS3 C;  1WWS A;  3AZK B;  3C1C D;  3AN2 C;  4E44 A;  5B31 G;  5DNM B;  5CPK C;  2NQB A;  5JRG A;  3AZL C;  3AV1 B;  5E5A A;  2HIO B;  4R8P C;  4Z66 A;  3X1V B;  5AVC B;  2DF4 C;  1P3P A;  1KX3 D;  4H9S A;  1KX5 C;  5CPK D;  3AZL D;  1P34 B;  4QLC D;  4R8P D;  4WU9 A;  1U35 C;  1S32 B;  4G91 B;  5GT3 B;  4CSR B;  5DNN C;  1KX5 D;  1HQ3 B;  3AZM C;  3MVD B;  5B40 D;  5BO0 B;  3AZN C;  1U35 D;  3B0D B;  3REL C;  3UTB B;  3LEL B;  2CV5 A;  2CWE A;  2HUE B;  3VH6 A;  2JE5 A;  3AV2 A;  3AZI C;  3AZM D;  3EPH A;  3LZ0 A;  4J8X B;  1EQZ B;  5B32 A;  3AZN D;  1F66 C;  3REL D;  4WZS B;  3REK A;  4X23 D;  1WWI A;  3AZG C;  2IO5 B;  3A6N D;  1ULY A;  4WU9 B;  5CPI B;  4WNN B;  5F99 C;  3VH5 A;  1Z2C B;  5AV5 A;  1B67 A;  3X1S B;  3WTP A;  2NQB D;  5JRG D;  3AZG D;  4Z66 D;  3W96 C;  1P3P D;  3W99 B;  1F1E A;  4HGA B;  1P3B A;  3KWQ A;  5B31 B;  5B33 B;  3MGR B;  3AFA C;  1P3M B;  1P3I C;  2JSS A;  4YM6 B;  2CV5 C;  3B0C W;  3AZH A;  3UTA A;  2Y2N A;  3LJA B;  1BH9 B;  5BNX A;  4J8V A;  4XZQ A;  4WU8 A;  3KUY B;  2BYM B;  3REI A;  5GSU B;  3REK C;  2YFV B;  5AV8 A;  3X1T B;  2CV5 D;  1P3G B;  3WAA B;  3FDD A;  3B6G A;  5B2J C;  3AV2 D;  5BNV A;  5B2I A;  3WKJ B;  4LD9 B;  4J8U A;  3LZ0 D;  2JCH A;  3WA9 A;  3REH A;  5B32 D;  2LY8 A;  3AYW C;  3B6F C;  1P3A B;  2F2A C;  3C1B C;  4CAY A;  3KXB B;  3REK D;  1H3O B;  5B2J D;  1P3F C;  1M19 A;  5CPJ B;  3IP4 C;  5B0Z B;  4WV4 B;  5BS7 A;  3W98 A;  5CP6 A;  1M18 C;  3AYW D;  3B6F D;  3C1B D;  5AV5 D;  1P3K B;  3TU4 A;  3WTP D;  3AZE C;  5B1L C;  1P3L B;  1P3F D;  5AVB B;  1W2E A;  2ARO B;  4ZUX A;  3AZH C;  1P3B D;  4YS3 A;  5AV6 A;  3AZE D;  4Z5T B;  4J8V C;  5B0Y B;  3AN2 A;  4XUJ C;  3EPK A;  1TZY A;  1TAF B;  3H0M C;  3AZL A;  5AV8 C;  3LZ1 C;  3X1U B;  2RVQ C;  5GT0 A;  3AZH D;  3UTA D;  3B6G C;  1P3O A;  5B2I C;  4J8U C;  2W8S A;  4J8V D;  3WA9 C;  4XZQ D;  2PYO B;  1KX5 A;  4XUJ D;  3REI D;  2BG1 A;  5AV8 D;  3LZ1 D;  2RVQ D;  1U35 A;  2FJ7 C;  3B6G D;  2Y2P A;  3C1C B;  5B2I D;  4J8U D;  3F6T A;  3AZF C;  1PZR A;  4EO5 B;  5DNN A;  3WA9 D;  4H9N A;  3MGP A;  4H9R A;  3AZN A;  5JA4 B;  2FJ7 D;  1KX3 B;  1M19 D;  5C3I C;  4H9Q A;  3B0C T;  5CP6 D;  5CPK B;  3AZL B;  3AZI A;  4QLC B;  4R8P B;  5AV6 C;  4ZBJ C;  3TU4 D;  1F66 A;  3MNN C;  1TZY C;  1KX5 B;  3AZG A;  1M1A A;  5B40 B;  5B32 G;  4ZUX D;  2YFW A;  3V9R A;  4E45 A;  5GT0 C;  5AV6 D;  4YS3 D;  3AZJ C;  1U35 B;  1P3O C;  5F99 A;  2L5A A;  3AN2 D;  4DRA A;  3MNN D;  1TZY D;  4KUD A;  1N1J A;  1KX4 C;  3AZM B;  2F8N A;  3W96 A;  5GT0 D;  1JFI A;  1P3O D;  3REL B;  5GXQ A;  4X23 B;  3MGP C;  3A6N B;  5FUG A;  3AFA A;  4H9P A;  1P3I A;  2BYK A;  5KDM A;  5DNN D;  2DQN C;  2NQB B;  5JRG B;  3AZG B;  3R45 A;  5E5A B;  4H9O A;  3MGP D;  4Z66 B;  2ZY2 A;  2ZY3 A;  5DNM C;  1P3P B;  2HIO C;  3X1V C;  4DQY B;  1M1A C;  5B2J A;  3AZI D;  1T3U A;  5B24 A;  5CHL B;  1JFI B;  3AYW A;  1F66 D;  3B6F A;  3C1B A;  1P34 C;  2Y2G A;  4UUZ A;  4KUD C;  5GT3 C;  1M1A D;  1P3F A;  4NE6 A;  3MGQ A;  1HQ3 C;  5F99 D;  1M18 A;  5GXQ C;  2CV5 B;  3AZE A;  3AV2 B;  4KUD D;  5B1L A;  3UTB C;  3LZ0 B;  2F8N D;  3NQU A;  2HUE C;  2Y2H A;  5B32 B;  3W96 D;  3REK B;  5GXQ D;  4J8X C;  1EQZ C;  3A1I A;  3AFA D;  1R4V A;  1P3I D;  4XUJ A;  2IO5 C;  3B6F B;  5AV9 A;  3C1B B;  3MGS A;  5AV5 B;  3LZ1 A;  5CPI C;  3WTP B;  4J8X D;  3EG5 B;  1HTA A;  5B24 C;  1ZLA C;  1ID3 C;  4J8W A;  1P3B B;  1Q9C A;  3KWQ B;  5BT1 C;  5CPI D;  4KGC C;  2FJ7 A;  3O62 A;  3W99 C;  4HGA C;  5B24 D;  3MGQ C;  3AZF A;  1ZLA D;  1ID3 D;  5B33 C;  3AZH B;  3UTA B;  3UT9 A;  5G49 A;  4KGC D;  5BNX B;  4J8V B;  4XZQ B;  4WU8 B;  4XUJ B;  3MGQ D;  3REI B;  1M18 D;  5AV8 B;  3LZ1 B;  2NZD C;  3KUY C;  3B6G B;  5BNV B;  5B2I B;  5B1L D;  5GSU C;  3REJ A;  4J8U B;  3X1T C;  3MNN A;  3WA9 B;  1P3G C;  3WAA C;  3REH B;  3WKJ C;  2XD5 A;  5AV9 C;  3MGS C;  4CAY B;  2NZD D;  1BH8 A;  3KUY D;  2FJ7 B;  3AZJ A;  4UPK A;  1P3A C;  1M19 B;  3W98 B;  3KXB C;  5CP6 B;  1B6W A;  4J8W C;  1KX4 A;  3WKJ D;  5AV9 D;  5CPJ C;  3MGS D;  3TU4 B;  3AL0 C;  3NQJ A;  3O62 C;  5C3I B;  1AOI A;  1P3K C;  5AY8 A;  4JJN A;  2F8N G;  4J8W D;  2F8N H;  4ZUX B;  5AVB C;  5CPJ D;  4YS3 B;  5AV6 B;  3UT9 C;  4AWL C;  3O62 D;  3AN2 B;  3W97 A;  2ARO C;  3AZF D;  3AZK A;  1TZY B;  2VQR A;  5B0Y C;  5GT0 B;  3A1K A;  5DNM A;  1P3O B;  3UT9 D;  3REJ C;  3VH5 W;  1KU5 A;  3AV1 A;  2HIO A;  3X1U C;  3X1V A;  5AVC A;  2UWX A;  2PYO C;  3WTP E;  4G92 C;  3REJ D;  1P34 A;  5DNN B;  4H9N B;  1S32 A;  3C1C C;  1A7W A;  5GT3 A;  3MGP B;  4CSR A;  4H9R B;  3AZN B;  5B1M C;  3AZJ D;  1HQ3 A;  1AOI C;  4H9Q B;  3MVD A;  5AY8 C;  5BO0 A;  4JJN C;  1KX3 C;  3AZI B;  1KX4 D;  3EPJ A;  3UTB A;  3LEL A;  5B1M D;  1F66 B;  3W97 C;  2ZY4 A;  4QLC C;  1AOI D;  3AZK C;  5AY8 D;  4J8X A;  4JJN D;  1EQZ A;  1M1A B;  2J8P A;  2YFW B;  3V9R B;  2Y2Q A;  5F99 B;  3AV1 C;  5B40 C;  3W97 D;  5AVC C;  3AZK D;  5CPI A;  4KUD B;  1N1J B;  4WNN A;  2F8N B;  3W96 B;  3X1S A;  1ZLA A;  5DNM D;  1ID3 A;  2ZY5 A;  3AV1 D;  2HIO D;  5GXQ B;  3X1V D;  1S32 C;  5AVC D;  4G91 C;  4KGC A;  3W99 A;  5FUG B;  3AFA B;  2Y2J A;  4H9P B;  3VH6 T;  4X23 C;  1P3I B;  2BYK B;  2XD1 A;  5KDM B;  5B31 A;  3EPL A;  3A6N C;  5B33 A;  3MVD C;  1P34 D;  3MGR A;  4NFT A;  1P3M A;  1S32 D;  3B0D C;  3R45 B;  4H9O B;  5GT3 D;  4YM6 A;  3LEL C;  2NQB C;  5JRG C;  1HQ3 D;  3LJA A;  5E5A C;  4NE3 A;  1BH9 A;  4Z66 C;  3MVD D;  2NZD A;  3KUY A;  1P3P C;  2BYM A;  5B2J B;  3VH5 T;  4NE5 A;  5GSU A;  4H9S C;  5B24 B;  3UTB D;  2YFV A;  3X1T A;  3LEL D;  1ZLA B;  1P3G A;  3WAA A;  1ID3 B;  3AYW B;  4LD9 A;  3WKJ A;  5E5A D;  4UUZ B;  4WU9 C;  1EQZ D;  4KGC B;  4M6B A;  1P3F B;  1P3A A;  3X1S C;  3KXB A;  3MGQ B;  4WJ3 C;  1H3O A;  1M18 B;  2F8N K;  5CPJ A;  5B0Z A;  4WU9 D;  3AZE B;  5B1L B;  2G5H C;  3NQU B;  3X1S D;  1P3K A;  2Y2L A;  5B31 C;  3AV2 C;  2Y2O A;  3B0B A;  1P3L A;  3LZ0 C;  3MGR C;  1P3M C;  5AVB A;  2NZD B;  5B32 C;  5BT1 D;  4YM6 C;  3KSY A;  3W99 D;  3H0R C;  2ARO A;  3LJA C;  5B31 D;  5AV9 B;  4Z5T A;  5B33 D;  3MGS B;  5B0Y A;  3P5J B;  3MGR D;  1P3M D;  2G5I C;  2ZM5 A;  1TAF A;  4YM6 D;  5AV5 C;  3WTP C;  2Y2M A;  3X1U A;  4LD9 C;  4J8W B;  3LJA D;  3H0L C; 
#chains in the Genus database with same CATH homology
 2PYO A;  3O62 B;  5GSU D;  3AZF B;  2Y2I A;  3X1T D;  1P3B C;  3KWQ C;  1P3G D;  3WAA D;  4LD9 D;  3C1C A;  5B0Z C;  3UT9 B;  5G49 B;  5B1M A;  4AWL B;  1P3A D;  3VH6 W;  3KXB D;  3UTA C;  3KWQ D;  5JA4 A;  1P3L C;  4KHA A;  1KX3 A;  4XZQ C;  4WU8 C;  5B0Z D;  4ZBJ B;  3REI C;  5CPK A;  3REJ B;  3KFU G;  3MNN B;  4QLC A;  4R8P A;  1P3K D;  4Z5T C;  1P3L D;  5AVB D;  4WU8 D;  1BH8 B;  3REH C;  4G92 B;  3AZJ B;  5B40 A;  2ARO D;  2RIQ A;  1KX4 B;  1M19 C;  4Z5T D;  5B0Y D;  5BS7 C;  3W98 C;  5CP6 C;  3NQJ B;  5B1M B;  3REH D;  3AZM A;  1AOI B;  3TU4 C;  2FFF B;  5AY8 B;  3X1U D;  4JJN B;  1BFM A;  4KHA B;  3REL A;  4EO5 C;  2PYO D;  4X23 A;  3W98 D;  2Y2K A;  4Z2M G;  3W97 B;  3A6N A;  4ZUX C;  4Z2M H;  4DRB A;  4YS3 C;  1WWS A;  3AZK B;  3C1C D;  3AN2 C;  4E44 A;  5B31 G;  5DNM B;  5CPK C;  2NQB A;  5JRG A;  3AZL C;  3AV1 B;  5E5A A;  2HIO B;  4R8P C;  4Z66 A;  3X1V B;  5AVC B;  2DF4 C;  1P3P A;  1KX3 D;  4H9S A;  1KX5 C;  5CPK D;  3AZL D;  1P34 B;  4QLC D;  4R8P D;  4WU9 A;  1U35 C;  1S32 B;  4G91 B;  5GT3 B;  4CSR B;  5DNN C;  1KX5 D;  1HQ3 B;  3AZM C;  3MVD B;  5B40 D;  5BO0 B;  3AZN C;  1U35 D;  3B0D B;  3REL C;  3UTB B;  3LEL B;  2CV5 A;  2CWE A;  2HUE B;  3VH6 A;  2JE5 A;  3AV2 A;  3AZI C;  3AZM D;  3EPH A;  3LZ0 A;  4J8X B;  1EQZ B;  5B32 A;  3AZN D;  1F66 C;  3REL D;  4WZS B;  3REK A;  4X23 D;  1WWI A;  3AZG C;  2IO5 B;  3A6N D;  1ULY A;  4WU9 B;  5CPI B;  4WNN B;  5F99 C;  3VH5 A;  1Z2C B;  5AV5 A;  1B67 A;  3X1S B;  3WTP A;  2NQB D;  5JRG D;  3AZG D;  4Z66 D;  3W96 C;  1P3P D;  3W99 B;  1F1E A;  4HGA B;  1P3B A;  3KWQ A;  5B31 B;  5B33 B;  3MGR B;  3AFA C;  1P3M B;  1P3I C;  2JSS A;  4YM6 B;  2CV5 C;  3B0C W;  3AZH A;  3UTA A;  2Y2N A;  3LJA B;  1BH9 B;  5BNX A;  4J8V A;  4XZQ A;  4WU8 A;  3KUY B;  2BYM B;  3REI A;  5GSU B;  3REK C;  2YFV B;  5AV8 A;  3X1T B;  2CV5 D;  1P3G B;  3WAA B;  3FDD A;  3B6G A;  5B2J C;  3AV2 D;  5BNV A;  5B2I A;  3WKJ B;  4LD9 B;  4J8U A;  3LZ0 D;  2JCH A;  3WA9 A;  3REH A;  5B32 D;  2LY8 A;  3AYW C;  3B6F C;  1P3A B;  2F2A C;  3C1B C;  4CAY A;  3KXB B;  3REK D;  1H3O B;  5B2J D;  1P3F C;  1M19 A;  5CPJ B;  3IP4 C;  5B0Z B;  4WV4 B;  5BS7 A;  3W98 A;  5CP6 A;  1M18 C;  3AYW D;  3B6F D;  3C1B D;  5AV5 D;  1P3K B;  3TU4 A;  3WTP D;  3AZE C;  5B1L C;  1P3L B;  1P3F D;  5AVB B;  1W2E A;  2ARO B;  4ZUX A;  3AZH C;  1P3B D;  4YS3 A;  5AV6 A;  3AZE D;  4Z5T B;  4J8V C;  5B0Y B;  3AN2 A;  4XUJ C;  3EPK A;  1TZY A;  1TAF B;  3H0M C;  3AZL A;  5AV8 C;  3LZ1 C;  3X1U B;  2RVQ C;  5GT0 A;  3AZH D;  3UTA D;  3B6G C;  1P3O A;  5B2I C;  4J8U C;  2W8S A;  4J8V D;  3WA9 C;  4XZQ D;  2PYO B;  1KX5 A;  4XUJ D;  3REI D;  2BG1 A;  5AV8 D;  3LZ1 D;  2RVQ D;  1U35 A;  2FJ7 C;  3B6G D;  2Y2P A;  3C1C B;  5B2I D;  4J8U D;  3F6T A;  3AZF C;  1PZR A;  4EO5 B;  5DNN A;  3WA9 D;  4H9N A;  3MGP A;  4H9R A;  3AZN A;  5JA4 B;  2FJ7 D;  1KX3 B;  1M19 D;  5C3I C;  4H9Q A;  3B0C T;  5CP6 D;  5CPK B;  3AZL B;  3AZI A;  4QLC B;  4R8P B;  5AV6 C;  4ZBJ C;  3TU4 D;  1F66 A;  3MNN C;  1TZY C;  1KX5 B;  3AZG A;  1M1A A;  5B40 B;  5B32 G;  4ZUX D;  2YFW A;  3V9R A;  4E45 A;  5GT0 C;  5AV6 D;  4YS3 D;  3AZJ C;  1U35 B;  1P3O C;  5F99 A;  2L5A A;  3AN2 D;  4DRA A;  3MNN D;  1TZY D;  4KUD A;  1N1J A;  1KX4 C;  3AZM B;  2F8N A;  3W96 A;  5GT0 D;  1JFI A;  1P3O D;  3REL B;  5GXQ A;  4X23 B;  3MGP C;  3A6N B;  5FUG A;  3AFA A;  4H9P A;  1P3I A;  2BYK A;  5KDM A;  5DNN D;  2DQN C;  2NQB B;  5JRG B;  3AZG B;  3R45 A;  5E5A B;  4H9O A;  3MGP D;  4Z66 B;  2ZY2 A;  2ZY3 A;  5DNM C;  1P3P B;  2HIO C;  3X1V C;  4DQY B;  1M1A C;  5B2J A;  3AZI D;  1T3U A;  5B24 A;  5CHL B;  1JFI B;  3AYW A;  1F66 D;  3B6F A;  3C1B A;  1P34 C;  2Y2G A;  4UUZ A;  4KUD C;  5GT3 C;  1M1A D;  1P3F A;  4NE6 A;  3MGQ A;  1HQ3 C;  5F99 D;  1M18 A;  5GXQ C;  2CV5 B;  3AZE A;  3AV2 B;  4KUD D;  5B1L A;  3UTB C;  3LZ0 B;  2F8N D;  3NQU A;  2HUE C;  2Y2H A;  5B32 B;  3W96 D;  3REK B;  5GXQ D;  4J8X C;  1EQZ C;  3A1I A;  3AFA D;  1R4V A;  1P3I D;  4XUJ A;  2IO5 C;  3B6F B;  5AV9 A;  3C1B B;  3MGS A;  5AV5 B;  3LZ1 A;  5CPI C;  3WTP B;  4J8X D;  3EG5 B;  1HTA A;  5B24 C;  1ZLA C;  1ID3 C;  4J8W A;  1P3B B;  1Q9C A;  3KWQ B;  5BT1 C;  5CPI D;  4KGC C;  2FJ7 A;  3O62 A;  3W99 C;  4HGA C;  5B24 D;  3MGQ C;  3AZF A;  1ZLA D;  1ID3 D;  5B33 C;  3AZH B;  3UTA B;  3UT9 A;  5G49 A;  4KGC D;  5BNX B;  4J8V B;  4XZQ B;  4WU8 B;  4XUJ B;  3MGQ D;  3REI B;  1M18 D;  5AV8 B;  3LZ1 B;  2NZD C;  3KUY C;  3B6G B;  5BNV B;  5B2I B;  5B1L D;  5GSU C;  3REJ A;  4J8U B;  3X1T C;  3MNN A;  3WA9 B;  1P3G C;  3WAA C;  3REH B;  3WKJ C;  2XD5 A;  5AV9 C;  3MGS C;  4CAY B;  2NZD D;  1BH8 A;  3KUY D;  2FJ7 B;  3AZJ A;  4UPK A;  1P3A C;  1M19 B;  3W98 B;  3KXB C;  5CP6 B;  1B6W A;  4J8W C;  1KX4 A;  3WKJ D;  5AV9 D;  5CPJ C;  3MGS D;  3TU4 B;  3AL0 C;  3NQJ A;  3O62 C;  5C3I B;  1AOI A;  1P3K C;  5AY8 A;  4JJN A;  2F8N G;  4J8W D;  2F8N H;  4ZUX B;  5AVB C;  5CPJ D;  4YS3 B;  5AV6 B;  3UT9 C;  4AWL C;  3O62 D;  3AN2 B;  3W97 A;  2ARO C;  3AZF D;  3AZK A;  1TZY B;  2VQR A;  5B0Y C;  5GT0 B;  3A1K A;  5DNM A;  1P3O B;  3UT9 D;  3REJ C;  3VH5 W;  1KU5 A;  3AV1 A;  2HIO A;  3X1U C;  3X1V A;  5AVC A;  2UWX A;  2PYO C;  3WTP E;  4G92 C;  3REJ D;  1P34 A;  5DNN B;  4H9N B;  1S32 A;  3C1C C;  1A7W A;  5GT3 A;  3MGP B;  4CSR A;  4H9R B;  3AZN B;  5B1M C;  3AZJ D;  1HQ3 A;  1AOI C;  4H9Q B;  3MVD A;  5AY8 C;  5BO0 A;  4JJN C;  1KX3 C;  3AZI B;  1KX4 D;  3EPJ A;  3UTB A;  3LEL A;  5B1M D;  1F66 B;  3W97 C;  2ZY4 A;  4QLC C;  1AOI D;  3AZK C;  5AY8 D;  4J8X A;  4JJN D;  1EQZ A;  1M1A B;  2J8P A;  2YFW B;  3V9R B;  2Y2Q A;  5F99 B;  3AV1 C;  5B40 C;  3W97 D;  5AVC C;  3AZK D;  5CPI A;  4KUD B;  1N1J B;  4WNN A;  2F8N B;  3W96 B;  3X1S A;  1ZLA A;  5DNM D;  1ID3 A;  2ZY5 A;  3AV1 D;  2HIO D;  5GXQ B;  3X1V D;  1S32 C;  5AVC D;  4G91 C;  4KGC A;  3W99 A;  5FUG B;  3AFA B;  2Y2J A;  4H9P B;  3VH6 T;  4X23 C;  1P3I B;  2BYK B;  2XD1 A;  5KDM B;  5B31 A;  3EPL A;  3A6N C;  5B33 A;  3MVD C;  1P34 D;  3MGR A;  4NFT A;  1P3M A;  1S32 D;  3B0D C;  3R45 B;  4H9O B;  5GT3 D;  4YM6 A;  3LEL C;  2NQB C;  5JRG C;  1HQ3 D;  3LJA A;  5E5A C;  4NE3 A;  1BH9 A;  4Z66 C;  3MVD D;  2NZD A;  3KUY A;  1P3P C;  2BYM A;  5B2J B;  3VH5 T;  4NE5 A;  5GSU A;  4H9S C;  5B24 B;  3UTB D;  2YFV A;  3X1T A;  3LEL D;  1ZLA B;  1P3G A;  3WAA A;  1ID3 B;  3AYW B;  4LD9 A;  3WKJ A;  5E5A D;  4UUZ B;  4WU9 C;  1EQZ D;  4KGC B;  4M6B A;  1P3F B;  1P3A A;  3X1S C;  3KXB A;  3MGQ B;  4WJ3 C;  1H3O A;  1M18 B;  2F8N K;  5CPJ A;  5B0Z A;  4WU9 D;  3AZE B;  5B1L B;  2G5H C;  3NQU B;  3X1S D;  1P3K A;  2Y2L A;  5B31 C;  3AV2 C;  2Y2O A;  3B0B A;  1P3L A;  3LZ0 C;  3MGR C;  1P3M C;  5AVB A;  2NZD B;  5B32 C;  5BT1 D;  4YM6 C;  3KSY A;  3W99 D;  3H0R C;  2ARO A;  3LJA C;  5B31 D;  5AV9 B;  4Z5T A;  5B33 D;  3MGS B;  5B0Y A;  3P5J B;  3MGR D;  1P3M D;  2G5I C;  2ZM5 A;  1TAF A;  4YM6 D;  5AV5 C;  3WTP C;  2Y2M A;  3X1U A;  4LD9 C;  4J8W B;  3LJA D;  3H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...