1P3MA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVIIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3mA00
3C1CC 5B1LB 5JRGC 3AZIB 5FUGA 4CAYB 4H9OB 2NQBC 5B32A 2YFWA 5GT3A 4J8XB 3UTBD 3C1CA 3AZJC 5JRGA 4WU8D 5BO0B 3REKC 4YM6D 2IO5B 2NQBA 4R8PB 3X1SC 3KXBD 3KUYD 3AZJA 3REKA 5B33B 3UTBB 4NFTA 3X1SA 4EO5B 1ZLAD 4KGCD 5BT1D 4J8WD 4J8UD 3MGQD 3KXBB 3AV2D 3KUYB 5GT0D 5B31D 3X1TC 5AY8C 5B0YD 5G49B 1ZLAB 5B24C 3REJB 5GT3D 3X1TA 5AY8A 3AZHC 1P34B 2YFVA 3AZLB 1P3IC 2NQBD 5B0YB 3AZJD 3AZHA 5DNND 5CPJC 3REKD 1P3IA 1P3OC 5CPIC 5AV8C 3X1SD 4H9NB 4JJND 5CPJA 3AZNB 5CHLB 3AZMD 3LELC 1P3OA 5AV8A 5CPIA 3REID 3KWQC 5DNNB 3RELC 5B40B 1M18C 3B6GB 2RVQC 3WTPC 3LELA 3WKJB 3KWQA 3RELA 1M18A 3LZ1C 3X1TD 1EQZC 4Z2MH 5AVCB 1P3GC 5B2JB 3WTPA 5B24D 1B6WA 3LZ1A 1EQZA 4NE3A 1P3GA 3B0BA 2F8NG 1P3ID 1HQ3C 4X23D 5B1MB 2AROC 2PYOB 3VH5T 4H9RA 5CPJD 4ZUXD 5CP6B 1ID3C 1HQ3A 1BH8B 1KX5D 3MGRB 1P3OD 3MVDC 2AROA 3R45B 2F8NK 4WNNA 1B67A 1ID3A 2BYKB 4X23B 3B6FA 2BYMB 4H9PA 3MNNC 1S32B 2HIOC 3MVDA 3RELD 4ZUXB 3UT9C 1H3OA 1M18D 1M19B 5GXQB 3MNNA 1AOIC 3MGPB 2HIOA 3AZGB 1WWSA 2NZDD 3LZ1D 1P3PD 1EQZD 4KUDC 4WZSB 3AZKB 4AWLB 1AOIA 1JFIB 3X1UC 4H9SC 1P3KB 5E5AB 4Z5TB 4KUDA 4DRBA 5BNVB 4YS3C 3AZFB 2NZDB 3V9RB 1HQ3D 3X1UA 1P3AC 4H9SA 3WA9C 4LD9D 1P3PB 5AVBD 3X1VC 3W97B 2AROD 2IO5C 5B31G 4YS3A 3W96D 1ID3D 3AYWD 1P3AA 3WA9A 3X1VA 3WTPE 1M1AB 3TU4B 3LZ0C 1P3BB 4LD9B 5AVBB 5AV9C 2HIOD 1F66C 3UT9D 4G91C 3AYWB 3LZ0A 5AV9A 4H9QA 1F66A 5DNMB 4KUDD 1KX4D 3A6NB 5AV5C 1P3FC 4UUZA 3W99D 3X1UD 3MGSD 3AFAC 5JA4B 5AV5A 4Z66C 1P3FA 1P3LD 5KDMB 1P3AD 3B0DB 3WA9D 3X1VD 1P3MC 4WU9C 4G92C 1KX4B 4WU8B 3AFAA 4Z66A 5CPKC 4YM6B 3O62D 3MGSB 4HGAC 3WAAC 3W99B 1N1JA 3C1BC 1P3MA 1F1EA 3AV1C 4WU9A 4M6BA 5CPKA 1P3LB 3WAAA 3LZ0D 3NQUB 4CSRB 5AV9D 3C1BA 5B2IC 4KGCB 3AV1A 4J8WB 5B32D 4J8UB 3O62B 4KHAA 3C1CD 5JRGD 3MGQB 3LJAC 3AV2B 5BNXB 5GT0B 5B31B 5C3IB 5B2JC 5B2IA 4J8VC 1WWIA 4QLCC 3LJAA 1P3FD 5FUGB 5B2JA 5B32B 2YFWB 5GT3B 4J8VA 2FJ7C 4QLCA 2F8NH 2NQBB 1P3MD 3AZJB 2FJ7A 4WU9D 3REKB 5CPKD 3VH6W 3VH6T 3X1SB 5F99C 4JJNB 3VH5A 5AY8D 2LY8A 4XUJC 3AZMB 5F99A 3REIB 3REHC 5B2ID 3MGPC 3AZGC 4XUJA 3AZHD 1TZYC 3LJAD 3REHA 1KX3C 3X1TB 5AY8B 3MGPA 3AZGA 4NE5A 5GSUC 1R4VA 4J8VD 1TZYA 2YFVB 1TAFA 3VH5W 3B6FC 1HTAA 2HUEC 5B24B 1KX3A 5AV8D 5CPID 5GSUA 3AZHB 2FJ7D 3UTAC 5AV6C 1P3IB 3NQJB 2CV5C 3LELD 3KWQD 5CPJB 3UTAA 5AV6A 2RVQD 1KX5B 4XZQC 2CV5A 3WTPD 3AN2C 5AV8B 5F99D 1P3OB 3TU4C 1KU5A 3W98C 3AZEC 5B0ZC 1U35C 1BH9A 4XUJD 1P3GD 3LELB 4XZQA 3AN2A 5B1LC 3KWQB 3RELB 3TU4A 3REHD 3AZIC 3W98A 3AZEA 1M18B 5B0ZA 1U35A 2F8NA 1TZYD 4J8XC 3WTPB 5B1LA 3A6NC 3AZIA 3LZ1B 1EQZB 4CAYA 4H9OA 1P3GB 4R8PC 4J8XA 3B6FD 3A6NA 5BO0A 5B33C 3MVDD 3UTBC 4H9RB 4R8PA 3UTAD 4EO5C 5B32G 5AV6D 1HQ3B 3MNND 5B33A 2CV5D 4WV4B 2AROB 3UTBA 4WNNB 3KXBC 3KUYC 3W96B 1ID3B 4XZQD 3AN2D 1AOID 3W98D 3AZED 3KXBA 5B0ZD 3KUYA 1U35D 1ZLAC 2F8ND 4J8WC 3REJC 4J8UC 5G49A 2HIOB 1P34C 3AZID 3AZLC 3UT9B 3AV2C 5B31C 1ZLAA 5C3IC 4J8WA 3REJA 5B0YC 4J8UA 1AOIB 4YS3D 1P34A 3AZLA 3AV2A 4E45A 5B31A 4KUDB 4R8PD 5B0YA 3X1UB 1A7WA 5B33D 3AZNC 4DRAA 2CWEA 4YS3B 5DNNC 4H9NA 5B40C 1P3AB 3WA9B 3X1VB 3AZNA 3B6GC 1F66D 3WKJC 5DNNA 4JJNC 3B0CW 3B0CT 5B40A 5AVCC 3B6GA 3AZMC 3REIC 3WKJA 4ZBJB 4JJNA 3LZ0B 3REJD 5BS7C 3VH6A 5AV5D 5AV9B 4H9QB 5AVCA 1P34D 1F66B 3AZMA 3AZLD 3REIA 4G91B 3C1CB 5B1MC 5JRGB 3AFAD 5BS7A 4Z66D 4UUZB 2PYOC 2JSSA 5CP6C 5B1MA 5AV5B 3MGRC 1P3FB 2PYOA 3WAAD 5CP6A 4X23C 3AZND 1ULYA 3C1BD 5B24A 1S32C 1BH8A 3AV1D 3AFAB 3MGRA 4Z66B 4NE6A 3R45A 4ZUXC 1N1JB 5B40D 3NQJA 2BYKA 4X23A 1P3MB 1M19C 4WU9B 2BYMA 5GXQC 4G92B 1S32A 1KX5C 3B6GD 5CPKB 3WKJD 2L5AA 4HGAB 4ZUXA 3WAAB 3C1BB 5AVCD 1M19A 1KX5A 3AV1B 5GXQA 5B2JD 3AZKC 4AWLC 4KHAB 1P3KC 4QLCD 5E5AC 4Z5TC 1Q9CA 5B2IB 3AZKA 3AZFC 2NZDC 1JFIA 5B1MD 1P3KA 3LJAB 1P3PC 5E5AA 4Z5TA 3W97C 2PYOD 5BNVA 5CP6D 3AZFA 4J8VB 4E44A 2NZDA 3V9RA 4QLCB 1P3PA 3MGRD 3W97A 1M1AC 5CPIB 2FJ7B 1P3BC 1S32D 4LD9C 5AVBC 3KSYA 3W96C 1M1AA 3AYWC 1M19D 1P3BA 5GXQD 4LD9A 5AVBA 4Z2MG 3MGPD 3AZGD 1BFMA 5DNMC 3W96A 5F99B 3AYWA 1KX3D 3AZKD 4XUJB 5GSUD 1P3KD 5E5AD 5DNMA 4Z5TD 3REHB 3AZFD 3UT9A 1TZYB 1TAFB 3B0DC 3W97D 1KX4C 4WU8C 1KX3B 5JA4A 4YM6C 3W99C 3MGSC 5GSUB 5KDMA 1KX4A 3B6FB 4WU8A 2HUEB 4H9PB 1M1AD 4YM6A 1P3LC 3MGSA 3MVDB 3W99A 3TU4D 1P3BD 3UTAB 1H3OB 5AV6B 4KGCC 5BT1C 3MNNB 2CV5B 3O62C 1P3LA 5B1LD 3MGQC 3NQUA 4CSRA 5GT0C 1BH9B 4KGCA 4XZQB 4J8XD 5DNMD 3AN2B 3O62A 4ZBJC 3MGQA 3W98B 3A6ND 3AZEB 5B0ZB 5BNXA 5GT0A 1U35B 2F8NB 5B32C 5GT3C
chains in the Genus database with same CATH superfamily
3C1CC 5B1LB 5JRGC 3AZIB 5FUGA 4CAYB 4H9OB 2DQNC 2NQBC 5B32A 2YFWA 2Y2GA 5GT3A 4J8XB 3UTBD 3C1CA 3AZJC 5JRGA 4WU8D 5BO0B 3REKC 4YM6D 2VQRA 2IO5B 2NQBA 4R8PB 3X1SC 3KXBD 3KUYD 3AZJA 3REKA 5B33B 3UTBB 4NFTA 3X1SA 4EO5B 3A1IA 1ZLAD 4KGCD 5BT1D 4J8WD 4J8UD 3MGQD 3KXBB 3AV2D 3KUYB 5GT0D 5B31D 3EPKA 3X1TC 5AY8C 5B0YD 5G49B 1Z2CB 1ZLAB 5B24C 3REJB 5GT3D 3X1TA 5AY8A 3AZHC 1P34B 2YFVA 3AZLB 1P3IC 2NQBD 5B0YB 2FFFB 3AZJD 3AZHA 5DNND 5CPJC 3REKD 1P3IA 1P3OC 5CPIC 5AV8C 3X1SD 4H9NB 4JJND 5CPJA 3AZNB 5CHLB 3A1KA 3LELC 3AZMD 1P3OA 5AV8A 5CPIA 3REID 3KWQC 5DNNB 3RELC 5B40B 1M18C 3B6GB 2Y2QA 2RVQC 3WTPC 3LELA 3WKJB 3KWQA 3RELA 1M18A 3LZ1C 3X1TD 1EQZC 4Z2MH 5AVCB 1P3GC 5B2JB 3WTPA 3AL0C 5B24D 1B6WA 3LZ1A 1EQZA 4NE3A 1P3GA 3B0BA 2F8NG 1P3ID 1HQ3C 4X23D 5B1MB 2AROC 2PYOB 3VH5T 4H9RA 5CPJD 4ZUXD 5CP6B 1ID3C 1HQ3A 1BH8B 1KX5D 3MGRB 1P3OD 3MVDC 2AROA 3R45B 2F8NK 4WNNA 1B67A 1ID3A 2BYKB 4X23B 3B6FA 2BYMB 4H9PA 3MNNC 1S32B 2HIOC 3MVDA 3RELD 4ZUXB 3UT9C 1H3OA 1M18D 1M19B 5GXQB 3MNNA 2Y2IA 1AOIC 3EPHA 3MGPB 2HIOA 3AZGB 1WWSA 2NZDD 3LZ1D 1P3PD 1EQZD 4KUDC 4WZSB 3AZKB 4AWLB 1AOIA 1JFIB 3X1UC 4H9SC 1P3KB 5E5AB 2Y2OA 4Z5TB 4KUDA 4DRBA 5BNVB 4YS3C 3AZFB 2NZDB 3V9RB 1HQ3D 3X1UA 1P3AC 4H9SA 3WA9C 4LD9D 1P3PB 5AVBD 3X1VC 2RIQA 3W97B 2AROD 2IO5C 5B31G 4YS3A 3W96D 1ID3D 3AYWD 1P3AA 3WA9A 3X1VA 3WTPE 1M1AB 1PZRA 3TU4B 3LZ0C 2Y2LA 1P3BB 4LD9B 5AVBB 5AV9C 2HIOD 1F66C 3UT9D 4G91C 3AYWB 3LZ0A 5AV9A 4H9QA 1F66A 5DNMB 1W2EA 4KUDD 1KX4D 3A6NB 5AV5C 1P3FC 4UUZA 3W99D 3X1UD 3MGSD 3AFAC 5JA4B 5AV5A 4Z66C 1P3FA 1P3LD 5KDMB 1P3AD 3B0DB 3WA9D 3EPLA 3X1VD 1P3MC 4WU9C 4G92C 1KX4B 4WU8B 3AFAA 4Z66A 5CPKC 4YM6B 3O62D 3MGSB 4HGAC 3WAAC 3W99B 1N1JA 3H0LC 3C1BC 1P3MA 1F1EA 3AV1C 4WU9A 4M6BA 5CPKA 1P3LB 3WAAA 3LZ0D 3NQUB 4CSRB 2Y2MA 5AV9D 3C1BA 5B2IC 4KGCB 3AV1A 4J8WB 5B32D 4J8UB 3O62B 4KHAA 3C1CD 5JRGD 3MGQB 3LJAC 3AV2B 5BNXB 5GT0B 5B31B 5C3IB 5B2JC 5B2IA 4J8VC 1WWIA 4QLCC 3LJAA 1P3FD 5FUGB 5B2JA 5B32B 2YFWB 5GT3B 2ZY3A 4J8VA 2FJ7C 4QLCA 2G5HC 2Y2JA 2F8NH 2NQBB 1P3MD 3AZJB 2FJ7A 4WU9D 3REKB 5CPKD 3VH6W 3VH6T 3X1SB 5F99C 4JJNB 3VH5A 5AY8D 2LY8A 4XUJC 3AZMB 5F99A 3REIB 3REHC 5B2ID 3MGPC 3AZGC 4XUJA 3AZHD 1TZYC 2Y2NA 3LJAD 3REHA 1KX3C 3X1TB 5AY8B 3MGPA 3AZGA 4NE5A 5GSUC 1R4VA 4J8VD 1TZYA 2YFVB 1TAFA 3VH5W 3B6FC 1HTAA 2HUEC 5B24B 1KX3A 5AV8D 5CPID 5GSUA 3AZHB 2FJ7D 3UTAC 5AV6C 1P3IB 3NQJB 2CV5C 3LELD 3KWQD 5CPJB 3UTAA 5AV6A 2RVQD 1KX5B 4XZQC 2CV5A 3WTPD 3AN2C 5AV8B 5F99D 1P3OB 3TU4C 1KU5A 3W98C 3AZEC 5B0ZC 1U35C 1BH9A 4XUJD 1P3GD 3LELB 4XZQA 3AN2A 5B1LC 2Y2KA 3KWQB 3RELB 3TU4A 3REHD 3AZIC 3W98A 3AZEA 1M18B 5B0ZA 1U35A 2ZY2A 2F8NA 1TZYD 4J8XC 3WTPB 5B1LA 3A6NC 3AZIA 3LZ1B 1EQZB 4CAYA 4H9OA 1P3GB 4R8PC 4J8XA 3B6FD 3A6NA 5BO0A 5B33C 3MVDD 3UTBC 4H9RB 4R8PA 3EPJA 3UTAD 4EO5C 5B32G 5AV6D 1HQ3B 3MNND 5B33A 2CV5D 2J8PA 4DQYB 4WV4B 2AROB 3UTBA 3H0MC 4WNNB 3KXBC 3KUYC 3W96B 1ID3B 2UWXA 4XZQD 3AN2D 1AOID 3P5JB 3W98D 3AZED 3KXBA 5B0ZD 3KUYA 1U35D 1ZLAC 2F8ND 4J8WC 3REJC 4J8UC 3FDDA 5G49A 2HIOB 1P34C 3AZID 3AZLC 3UT9B 3AV2C 5B31C 1ZLAA 5C3IC 4J8WA 3REJA 5B0YC 4J8UA 1AOIB 2DF4C 4YS3D 1P34A 3AZLA 3AV2A 4E45A 5B31A 4KUDB 4R8PD 5B0YA 3X1UB 3IP4C 1A7WA 5B33D 3AZNC 4DRAA 2CWEA 4YS3B 5DNNC 4H9NA 5B40C 1P3AB 3WA9B 3X1VB 3AZNA 3B6GC 1F66D 3WKJC 1T3UA 5DNNA 2XD1A 3B0CW 3B0CT 4JJNC 5B40A 5AVCC 3B6GA 3AZMC 3REIC 3WKJA 4ZBJB 4JJNA 3LZ0B 3REJD 5BS7C 3VH6A 5AV5D 5AV9B 4H9QB 5AVCA 1P34D 1F66B 3AZMA 3AZLD 3REIA 4G91B 3C1CB 5B1MC 5JRGB 3AFAD 5BS7A 4Z66D 4UUZB 2PYOC 2JSSA 5CP6C 5B1MA 5AV5B 3MGRC 1P3FB 2PYOA 3WAAD 5CP6A 4X23C 3AZND 1ULYA 3H0RC 3C1BD 5B24A 1S32C 1BH8A 3AV1D 3AFAB 3MGRA 4Z66B 4NE6A 3R45A 4ZUXC 1N1JB 5B40D 3KFUG 3NQJA 2BYKA 4X23A 1P3MB 1M19C 4WU9B 2BYMA 5GXQC 4G92B 1S32A 1KX5C 3B6GD 5CPKB 3WKJD 2L5AA 4HGAB 4ZUXA 3WAAB 3C1BB 5AVCD 1M19A 1KX5A 3AV1B 5GXQA 5B2JD 3AZKC 4AWLC 4KHAB 1P3KC 4QLCD 5E5AC 4Z5TC 1Q9CA 5B2IB 3AZKA 2ZY4A 3AZFC 2JE5A 2NZDC 1JFIA 5B1MD 1P3KA 3LJAB 1P3PC 5E5AA 4Z5TA 3W97C 2PYOD 5BNVA 5CP6D 3AZFA 4J8VB 4E44A 2NZDA 3V9RA 4QLCB 1P3PA 3MGRD 3W97A 2XD5A 1M1AC 2JCHA 5CPIB 2FJ7B 1P3BC 1S32D 4LD9C 5AVBC 3KSYA 3W96C 1M1AA 3AYWC 1M19D 1P3BA 5GXQD 4LD9A 5AVBA 4Z2MG 3MGPD 3AZGD 1BFMA 5DNMC 3W96A 5F99B 3AYWA 4UPKA 1KX3D 3AZKD 2ZY5A 4XUJB 2Y2PA 5GSUD 1P3KD 2W8SA 5E5AD 5DNMA 4Z5TD 3REHB 3AZFD 3EG5B 3UT9A 1TZYB 1TAFB 3B0DC 3W97D 1KX4C 4WU8C 1KX3B 5JA4A 4YM6C 2ZM5A 3W99C 3MGSC 5GSUB 5KDMA 1KX4A 3B6FB 4WU8A 2HUEB 4H9PB 4WJ3C 1M1AD 4YM6A 1P3LC 3MGSA 3MVDB 3W99A 3TU4D 1P3BD 3UTAB 1H3OB 5AV6B 4KGCC 5BT1C 3MNNB 2CV5B 3O62C 1P3LA 5B1LD 3MGQC 3NQUA 4CSRA 5GT0C 1BH9B 2BG1A 4KGCA 2G5IC 4XZQB 4J8XD 5DNMD 3AN2B 2Y2HA 3F6TA 4ZBJC 3O62A 3MGQA 3W98B 2F2AC 3A6ND 3AZEB 5B0ZB 5BNXA 5GT0A 1U35B 2F8NB 5B32C 5GT3C
chains in the Genus database with same CATH topology
3C1CC 5B1LB 5JRGC 3AZIB 5FUGA 4CAYB 4H9OB 2DQNC 2NQBC 5B32A 2YFWA 2Y2GA 5GT3A 4J8XB 3UTBD 3C1CA 3AZJC 5JRGA 4WU8D 5BO0B 3REKC 4YM6D 2VQRA 2IO5B 2NQBA 4R8PB 3X1SC 3KXBD 3KUYD 3AZJA 3REKA 5B33B 3UTBB 4NFTA 3X1SA 4EO5B 3A1IA 1ZLAD 4KGCD 5BT1D 4J8WD 4J8UD 3MGQD 3KXBB 3AV2D 3KUYB 5GT0D 5B31D 3EPKA 3X1TC 5AY8C 5B0YD 5G49B 1Z2CB 1ZLAB 5B24C 3REJB 5GT3D 3X1TA 5AY8A 3AZHC 1P34B 2YFVA 3AZLB 1P3IC 2NQBD 5B0YB 2FFFB 3AZJD 3AZHA 5DNND 5CPJC 3REKD 1P3IA 1P3OC 5CPIC 5AV8C 3X1SD 4H9NB 4JJND 5CPJA 3AZNB 5CHLB 3A1KA 3LELC 3AZMD 1P3OA 5AV8A 5CPIA 3REID 3KWQC 5DNNB 3RELC 5B40B 1M18C 3B6GB 2Y2QA 2RVQC 3WTPC 3LELA 3WKJB 3KWQA 3RELA 1M18A 3LZ1C 3X1TD 1EQZC 4Z2MH 5AVCB 1P3GC 5B2JB 3WTPA 3AL0C 5B24D 1B6WA 3LZ1A 1EQZA 4NE3A 1P3GA 3B0BA 2F8NG 1P3ID 1HQ3C 4X23D 5B1MB 2AROC 2PYOB 3VH5T 4H9RA 5CPJD 4ZUXD 5CP6B 1ID3C 1HQ3A 1BH8B 1KX5D 3MGRB 1P3OD 3MVDC 2AROA 3R45B 2F8NK 4WNNA 1B67A 1ID3A 2BYKB 4X23B 3B6FA 2BYMB 4H9PA 3MNNC 1S32B 2HIOC 3MVDA 3RELD 4ZUXB 3UT9C 1H3OA 1M18D 1M19B 5GXQB 3MNNA 2Y2IA 1AOIC 3EPHA 3MGPB 2HIOA 3AZGB 1WWSA 2NZDD 3LZ1D 1P3PD 1EQZD 4KUDC 4WZSB 3AZKB 4AWLB 1AOIA 1JFIB 3X1UC 4H9SC 1P3KB 5E5AB 2Y2OA 4Z5TB 4KUDA 4DRBA 5BNVB 4YS3C 3AZFB 2NZDB 3V9RB 1HQ3D 3X1UA 1P3AC 4H9SA 3WA9C 4LD9D 1P3PB 5AVBD 3X1VC 2RIQA 3W97B 2AROD 2IO5C 5B31G 4YS3A 3W96D 1ID3D 3AYWD 1P3AA 3WA9A 3X1VA 3WTPE 1M1AB 1PZRA 3TU4B 3LZ0C 2Y2LA 1P3BB 4LD9B 5AVBB 5AV9C 2HIOD 1F66C 3UT9D 4G91C 3AYWB 3LZ0A 5AV9A 4H9QA 1F66A 5DNMB 1W2EA 4KUDD 1KX4D 3A6NB 5AV5C 1P3FC 4UUZA 3W99D 3X1UD 3MGSD 3AFAC 5JA4B 5AV5A 4Z66C 1P3FA 1P3LD 5KDMB 1P3AD 3B0DB 3WA9D 3EPLA 3X1VD 1P3MC 4WU9C 4G92C 1KX4B 4WU8B 3AFAA 4Z66A 5CPKC 4YM6B 3O62D 3MGSB 4HGAC 3WAAC 3W99B 1N1JA 3H0LC 3C1BC 1P3MA 1F1EA 3AV1C 4WU9A 4M6BA 5CPKA 1P3LB 3WAAA 3LZ0D 3NQUB 4CSRB 2Y2MA 5AV9D 3C1BA 5B2IC 4KGCB 3AV1A 4J8WB 5B32D 4J8UB 3O62B 4KHAA 3C1CD 5JRGD 3MGQB 3LJAC 3AV2B 5BNXB 5GT0B 5B31B 5C3IB 5B2JC 5B2IA 4J8VC 1WWIA 4QLCC 3LJAA 1P3FD 5FUGB 5B2JA 5B32B 2YFWB 5GT3B 2ZY3A 4J8VA 2FJ7C 4QLCA 2G5HC 2Y2JA 2F8NH 2NQBB 1P3MD 3AZJB 2FJ7A 4WU9D 3REKB 5CPKD 3VH6W 3VH6T 3X1SB 5F99C 4JJNB 3VH5A 5AY8D 2LY8A 4XUJC 3AZMB 5F99A 3REIB 3REHC 5B2ID 3MGPC 3AZGC 4XUJA 3AZHD 1TZYC 2Y2NA 3LJAD 3REHA 1KX3C 3X1TB 5AY8B 3MGPA 3AZGA 4NE5A 5GSUC 1R4VA 4J8VD 1TZYA 2YFVB 1TAFA 3VH5W 3B6FC 1HTAA 2HUEC 5B24B 1KX3A 5AV8D 5CPID 5GSUA 3AZHB 2FJ7D 3UTAC 5AV6C 1P3IB 3NQJB 2CV5C 3LELD 3KWQD 5CPJB 3UTAA 5AV6A 2RVQD 1KX5B 4XZQC 2CV5A 3WTPD 3AN2C 5AV8B 5F99D 1P3OB 3TU4C 1KU5A 3W98C 3AZEC 5B0ZC 1U35C 1BH9A 4XUJD 1P3GD 3LELB 4XZQA 3AN2A 5B1LC 2Y2KA 3KWQB 3RELB 3TU4A 3REHD 3AZIC 3W98A 3AZEA 1M18B 5B0ZA 1U35A 2ZY2A 2F8NA 1TZYD 4J8XC 3WTPB 5B1LA 3A6NC 3AZIA 3LZ1B 1EQZB 4CAYA 4H9OA 1P3GB 4R8PC 4J8XA 3B6FD 3A6NA 5BO0A 5B33C 3MVDD 3UTBC 4H9RB 4R8PA 3EPJA 3UTAD 4EO5C 5B32G 5AV6D 1HQ3B 3MNND 5B33A 2CV5D 2J8PA 4DQYB 4WV4B 2AROB 3UTBA 3H0MC 4WNNB 3KXBC 3KUYC 3W96B 1ID3B 2UWXA 4XZQD 3AN2D 1AOID 3P5JB 3W98D 3AZED 3KXBA 5B0ZD 3KUYA 1U35D 1ZLAC 2F8ND 4J8WC 3REJC 4J8UC 3FDDA 5G49A 2HIOB 1P34C 3AZID 3AZLC 3UT9B 3AV2C 5B31C 1ZLAA 5C3IC 4J8WA 3REJA 5B0YC 4J8UA 1AOIB 2DF4C 4YS3D 1P34A 3AZLA 3AV2A 4E45A 5B31A 4KUDB 4R8PD 5B0YA 3X1UB 3IP4C 1A7WA 5B33D 3AZNC 4DRAA 2CWEA 4YS3B 5DNNC 4H9NA 5B40C 1P3AB 3WA9B 3X1VB 3AZNA 3B6GC 1F66D 3WKJC 1T3UA 5DNNA 2XD1A 3B0CW 3B0CT 4JJNC 5B40A 5AVCC 3B6GA 3AZMC 3REIC 3WKJA 4ZBJB 4JJNA 3LZ0B 3REJD 5BS7C 3VH6A 5AV5D 5AV9B 4H9QB 5AVCA 1P34D 1F66B 3AZMA 3AZLD 3REIA 4G91B 3C1CB 5B1MC 5JRGB 3AFAD 5BS7A 4Z66D 4UUZB 2PYOC 2JSSA 5CP6C 5B1MA 5AV5B 3MGRC 1P3FB 2PYOA 3WAAD 5CP6A 4X23C 3AZND 1ULYA 3H0RC 3C1BD 5B24A 1S32C 1BH8A 3AV1D 3AFAB 3MGRA 4Z66B 4NE6A 3R45A 4ZUXC 1N1JB 5B40D 3KFUG 3NQJA 2BYKA 4X23A 1P3MB 1M19C 4WU9B 2BYMA 5GXQC 4G92B 1S32A 1KX5C 3B6GD 5CPKB 3WKJD 2L5AA 4HGAB 4ZUXA 3WAAB 3C1BB 5AVCD 1M19A 1KX5A 3AV1B 5GXQA 5B2JD 3AZKC 4AWLC 4KHAB 1P3KC 4QLCD 5E5AC 4Z5TC 1Q9CA 5B2IB 3AZKA 2ZY4A 3AZFC 2JE5A 2NZDC 1JFIA 5B1MD 1P3KA 3LJAB 1P3PC 5E5AA 4Z5TA 3W97C 2PYOD 5BNVA 5CP6D 3AZFA 4J8VB 4E44A 2NZDA 3V9RA 4QLCB 1P3PA 3MGRD 3W97A 2XD5A 1M1AC 2JCHA 5CPIB 2FJ7B 1P3BC 1S32D 4LD9C 5AVBC 3KSYA 3W96C 1M1AA 3AYWC 1M19D 1P3BA 5GXQD 4LD9A 5AVBA 4Z2MG 3MGPD 3AZGD 1BFMA 5DNMC 3W96A 5F99B 3AYWA 4UPKA 1KX3D 3AZKD 2ZY5A 4XUJB 2Y2PA 5GSUD 1P3KD 2W8SA 5E5AD 5DNMA 4Z5TD 3REHB 3AZFD 3EG5B 3UT9A 1TZYB 1TAFB 3B0DC 3W97D 1KX4C 4WU8C 1KX3B 5JA4A 4YM6C 2ZM5A 3W99C 3MGSC 5GSUB 5KDMA 1KX4A 3B6FB 4WU8A 2HUEB 4H9PB 4WJ3C 1M1AD 4YM6A 1P3LC 3MGSA 3MVDB 3W99A 3TU4D 1P3BD 3UTAB 1H3OB 5AV6B 4KGCC 5BT1C 3MNNB 2CV5B 3O62C 1P3LA 5B1LD 3MGQC 3NQUA 4CSRA 5GT0C 1BH9B 2BG1A 4KGCA 2G5IC 4XZQB 4J8XD 5DNMD 3AN2B 2Y2HA 3F6TA 4ZBJC 3O62A 3MGQA 3W98B 2F2AC 3A6ND 3AZEB 5B0ZB 5BNXA 5GT0A 1U35B 2F8NB 5B32C 5GT3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1C C;  5B1L B;  5JRG C;  3AZI B;  5FUG A;  4CAY B;  4H9O B;  2NQB C;  5B32 A;  2YFW A;  5GT3 A;  4J8X B;  3UTB D;  3C1C A;  3AZJ C;  5JRG A;  4WU8 D;  5BO0 B;  3REK C;  4YM6 D;  2IO5 B;  2NQB A;  4R8P B;  3X1S C;  3KXB D;  3KUY D;  3AZJ A;  3REK A;  5B33 B;  3UTB B;  4NFT A;  3X1S A;  4EO5 B;  1ZLA D;  4KGC D;  5BT1 D;  4J8W D;  4J8U D;  3MGQ D;  3KXB B;  3AV2 D;  3KUY B;  5GT0 D;  5B31 D;  3X1T C;  5AY8 C;  5B0Y D;  5G49 B;  1ZLA B;  5B24 C;  3REJ B;  5GT3 D;  3X1T A;  5AY8 A;  3AZH C;  1P34 B;  2YFV A;  3AZL B;  1P3I C;  2NQB D;  5B0Y B;  3AZJ D;  3AZH A;  5DNN D;  5CPJ C;  3REK D;  1P3I A;  1P3O C;  5CPI C;  5AV8 C;  3X1S D;  4H9N B;  4JJN D;  5CPJ A;  3AZN B;  5CHL B;  3AZM D;  3LEL C;  1P3O A;  5AV8 A;  5CPI A;  3REI D;  3KWQ C;  5DNN B;  3REL C;  5B40 B;  1M18 C;  3B6G B;  2RVQ C;  3WTP C;  3LEL A;  3WKJ B;  3KWQ A;  3REL A;  1M18 A;  3LZ1 C;  3X1T D;  1EQZ C;  4Z2M H;  5AVC B;  1P3G C;  5B2J B;  3WTP A;  5B24 D;  1B6W A;  3LZ1 A;  1EQZ A;  4NE3 A;  1P3G A;  3B0B A;  2F8N G;  1P3I D;  1HQ3 C;  4X23 D;  5B1M B;  2ARO C;  2PYO B;  3VH5 T;  4H9R A;  5CPJ D;  4ZUX D;  5CP6 B;  1ID3 C;  1HQ3 A;  1BH8 B;  1KX5 D;  3MGR B;  1P3O D;  3MVD C;  2ARO A;  3R45 B;  2F8N K;  4WNN A;  1B67 A;  1ID3 A;  2BYK B;  4X23 B;  3B6F A;  2BYM B;  4H9P A;  3MNN C;  1S32 B;  2HIO C;  3MVD A;  3REL D;  4ZUX B;  3UT9 C;  1H3O A;  1M18 D;  1M19 B;  5GXQ B;  3MNN A;  1AOI C;  3MGP B;  2HIO A;  3AZG B;  1WWS A;  2NZD D;  3LZ1 D;  1P3P D;  1EQZ D;  4KUD C;  4WZS B;  3AZK B;  4AWL B;  1AOI A;  1JFI B;  3X1U C;  4H9S C;  1P3K B;  5E5A B;  4Z5T B;  4KUD A;  4DRB A;  5BNV B;  4YS3 C;  3AZF B;  2NZD B;  3V9R B;  1HQ3 D;  3X1U A;  1P3A C;  4H9S A;  3WA9 C;  4LD9 D;  1P3P B;  5AVB D;  3X1V C;  3W97 B;  2ARO D;  2IO5 C;  5B31 G;  4YS3 A;  3W96 D;  1ID3 D;  3AYW D;  1P3A A;  3WA9 A;  3X1V A;  3WTP E;  1M1A B;  3TU4 B;  3LZ0 C;  1P3B B;  4LD9 B;  5AVB B;  5AV9 C;  2HIO D;  1F66 C;  3UT9 D;  4G91 C;  3AYW B;  3LZ0 A;  5AV9 A;  4H9Q A;  1F66 A;  5DNM B;  4KUD D;  1KX4 D;  3A6N B;  5AV5 C;  1P3F C;  4UUZ A;  3W99 D;  3X1U D;  3MGS D;  3AFA C;  5JA4 B;  5AV5 A;  4Z66 C;  1P3F A;  1P3L D;  5KDM B;  1P3A D;  3B0D B;  3WA9 D;  3X1V D;  1P3M C;  4WU9 C;  4G92 C;  1KX4 B;  4WU8 B;  3AFA A;  4Z66 A;  5CPK C;  4YM6 B;  3O62 D;  3MGS B;  4HGA C;  3WAA C;  3W99 B;  1N1J A;  3C1B C;  1P3M A;  1F1E A;  3AV1 C;  4WU9 A;  4M6B A;  5CPK A;  1P3L B;  3WAA A;  3LZ0 D;  3NQU B;  4CSR B;  5AV9 D;  3C1B A;  5B2I C;  4KGC B;  3AV1 A;  4J8W B;  5B32 D;  4J8U B;  3O62 B;  4KHA A;  3C1C D;  5JRG D;  3MGQ B;  3LJA C;  3AV2 B;  5BNX B;  5GT0 B;  5B31 B;  5C3I B;  5B2J C;  5B2I A;  4J8V C;  1WWI A;  4QLC C;  3LJA A;  1P3F D;  5FUG B;  5B2J A;  5B32 B;  2YFW B;  5GT3 B;  4J8V A;  2FJ7 C;  4QLC A;  2F8N H;  2NQB B;  1P3M D;  3AZJ B;  2FJ7 A;  4WU9 D;  3REK B;  5CPK D;  3VH6 W;  3VH6 T;  3X1S B;  5F99 C;  4JJN B;  3VH5 A;  5AY8 D;  2LY8 A;  4XUJ C;  3AZM B;  5F99 A;  3REI B;  3REH C;  5B2I D;  3MGP C;  3AZG C;  4XUJ A;  3AZH D;  1TZY C;  3LJA D;  3REH A;  1KX3 C;  3X1T B;  5AY8 B;  3MGP A;  3AZG A;  4NE5 A;  5GSU C;  1R4V A;  4J8V D;  1TZY A;  2YFV B;  1TAF A;  3VH5 W;  3B6F C;  1HTA A;  2HUE C;  5B24 B;  1KX3 A;  5AV8 D;  5CPI D;  5GSU A;  3AZH B;  2FJ7 D;  3UTA C;  5AV6 C;  1P3I B;  3NQJ B;  2CV5 C;  3LEL D;  3KWQ D;  5CPJ B;  3UTA A;  5AV6 A;  2RVQ D;  1KX5 B;  4XZQ C;  2CV5 A;  3WTP D;  3AN2 C;  5AV8 B;  5F99 D;  1P3O B;  3TU4 C;  1KU5 A;  3W98 C;  3AZE C;  5B0Z C;  1U35 C;  1BH9 A;  4XUJ D;  1P3G D;  3LEL B;  4XZQ A;  3AN2 A;  5B1L C;  3KWQ B;  3REL B;  3TU4 A;  3REH D;  3AZI C;  3W98 A;  3AZE A;  1M18 B;  5B0Z A;  1U35 A;  2F8N A;  1TZY D;  4J8X C;  3WTP B;  5B1L A;  3A6N C;  3AZI A;  3LZ1 B;  1EQZ B;  4CAY A;  4H9O A;  1P3G B;  4R8P C;  4J8X A;  3B6F D;  3A6N A;  5BO0 A;  5B33 C;  3MVD D;  3UTB C;  4H9R B;  4R8P A;  3UTA D;  4EO5 C;  5B32 G;  5AV6 D;  1HQ3 B;  3MNN D;  5B33 A;  2CV5 D;  4WV4 B;  2ARO B;  3UTB A;  4WNN B;  3KXB C;  3KUY C;  3W96 B;  1ID3 B;  4XZQ D;  3AN2 D;  1AOI D;  3W98 D;  3AZE D;  3KXB A;  5B0Z D;  3KUY A;  1U35 D;  1ZLA C;  2F8N D;  4J8W C;  3REJ C;  4J8U C;  5G49 A;  2HIO B;  1P34 C;  3AZI D;  3AZL C;  3UT9 B;  3AV2 C;  5B31 C;  1ZLA A;  5C3I C;  4J8W A;  3REJ A;  5B0Y C;  4J8U A;  1AOI B;  4YS3 D;  1P34 A;  3AZL A;  3AV2 A;  4E45 A;  5B31 A;  4KUD B;  4R8P D;  5B0Y A;  3X1U B;  1A7W A;  5B33 D;  3AZN C;  4DRA A;  2CWE A;  4YS3 B;  5DNN C;  4H9N A;  5B40 C;  1P3A B;  3WA9 B;  3X1V B;  3AZN A;  3B6G C;  1F66 D;  3WKJ C;  5DNN A;  4JJN C;  3B0C W;  3B0C T;  5B40 A;  5AVC C;  3B6G A;  3AZM C;  3REI C;  3WKJ A;  4ZBJ B;  4JJN A;  3LZ0 B;  3REJ D;  5BS7 C;  3VH6 A;  5AV5 D;  5AV9 B;  4H9Q B;  5AVC A;  1P34 D;  1F66 B;  3AZM A;  3AZL D;  3REI A;  4G91 B;  3C1C B;  5B1M C;  5JRG B;  3AFA D;  5BS7 A;  4Z66 D;  4UUZ B;  2PYO C;  2JSS A;  5CP6 C;  5B1M A;  5AV5 B;  3MGR C;  1P3F B;  2PYO A;  3WAA D;  5CP6 A;  4X23 C;  3AZN D;  1ULY A;  3C1B D;  5B24 A;  1S32 C;  1BH8 A;  3AV1 D;  3AFA B;  3MGR A;  4Z66 B;  4NE6 A;  3R45 A;  4ZUX C;  1N1J B;  5B40 D;  3NQJ A;  2BYK A;  4X23 A;  1P3M B;  1M19 C;  4WU9 B;  2BYM A;  5GXQ C;  4G92 B;  1S32 A;  1KX5 C;  3B6G D;  5CPK B;  3WKJ D;  2L5A A;  4HGA B;  4ZUX A;  3WAA B;  3C1B B;  5AVC D;  1M19 A;  1KX5 A;  3AV1 B;  5GXQ A;  5B2J D;  3AZK C;  4AWL C;  4KHA B;  1P3K C;  4QLC D;  5E5A C;  4Z5T C;  1Q9C A;  5B2I B;  3AZK A;  3AZF C;  2NZD C;  1JFI A;  5B1M D;  1P3K A;  3LJA B;  1P3P C;  5E5A A;  4Z5T A;  3W97 C;  2PYO D;  5BNV A;  5CP6 D;  3AZF A;  4J8V B;  4E44 A;  2NZD A;  3V9R A;  4QLC B;  1P3P A;  3MGR D;  3W97 A;  1M1A C;  5CPI B;  2FJ7 B;  1P3B C;  1S32 D;  4LD9 C;  5AVB C;  3KSY A;  3W96 C;  1M1A A;  3AYW C;  1M19 D;  1P3B A;  5GXQ D;  4LD9 A;  5AVB A;  4Z2M G;  3MGP D;  3AZG D;  1BFM A;  5DNM C;  3W96 A;  5F99 B;  3AYW A;  1KX3 D;  3AZK D;  4XUJ B;  5GSU D;  1P3K D;  5E5A D;  5DNM A;  4Z5T D;  3REH B;  3AZF D;  3UT9 A;  1TZY B;  1TAF B;  3B0D C;  3W97 D;  1KX4 C;  4WU8 C;  1KX3 B;  5JA4 A;  4YM6 C;  3W99 C;  3MGS C;  5GSU B;  5KDM A;  1KX4 A;  3B6F B;  4WU8 A;  2HUE B;  4H9P B;  1M1A D;  4YM6 A;  1P3L C;  3MGS A;  3MVD B;  3W99 A;  3TU4 D;  1P3B D;  3UTA B;  1H3O B;  5AV6 B;  4KGC C;  5BT1 C;  3MNN B;  2CV5 B;  3O62 C;  1P3L A;  5B1L D;  3MGQ C;  3NQU A;  4CSR A;  5GT0 C;  1BH9 B;  4KGC A;  4XZQ B;  4J8X D;  5DNM D;  3AN2 B;  3O62 A;  4ZBJ C;  3MGQ A;  3W98 B;  3A6N D;  3AZE B;  5B0Z B;  5BNX A;  5GT0 A;  1U35 B;  2F8N B;  5B32 C;  5GT3 C; 
#chains in the Genus database with same CATH topology
 3C1C C;  5B1L B;  5JRG C;  3AZI B;  5FUG A;  4CAY B;  4H9O B;  2DQN C;  2NQB C;  5B32 A;  2YFW A;  2Y2G A;  5GT3 A;  4J8X B;  3UTB D;  3C1C A;  3AZJ C;  5JRG A;  4WU8 D;  5BO0 B;  3REK C;  4YM6 D;  2VQR A;  2IO5 B;  2NQB A;  4R8P B;  3X1S C;  3KXB D;  3KUY D;  3AZJ A;  3REK A;  5B33 B;  3UTB B;  4NFT A;  3X1S A;  4EO5 B;  3A1I A;  1ZLA D;  4KGC D;  5BT1 D;  4J8W D;  4J8U D;  3MGQ D;  3KXB B;  3AV2 D;  3KUY B;  5GT0 D;  5B31 D;  3EPK A;  3X1T C;  5AY8 C;  5B0Y D;  5G49 B;  1Z2C B;  1ZLA B;  5B24 C;  3REJ B;  5GT3 D;  3X1T A;  5AY8 A;  3AZH C;  1P34 B;  2YFV A;  3AZL B;  1P3I C;  2NQB D;  5B0Y B;  2FFF B;  3AZJ D;  3AZH A;  5DNN D;  5CPJ C;  3REK D;  1P3I A;  1P3O C;  5CPI C;  5AV8 C;  3X1S D;  4H9N B;  4JJN D;  5CPJ A;  3AZN B;  5CHL B;  3A1K A;  3LEL C;  3AZM D;  1P3O A;  5AV8 A;  5CPI A;  3REI D;  3KWQ C;  5DNN B;  3REL C;  5B40 B;  1M18 C;  3B6G B;  2Y2Q A;  2RVQ C;  3WTP C;  3LEL A;  3WKJ B;  3KWQ A;  3REL A;  1M18 A;  3LZ1 C;  3X1T D;  1EQZ C;  4Z2M H;  5AVC B;  1P3G C;  5B2J B;  3WTP A;  3AL0 C;  5B24 D;  1B6W A;  3LZ1 A;  1EQZ A;  4NE3 A;  1P3G A;  3B0B A;  2F8N G;  1P3I D;  1HQ3 C;  4X23 D;  5B1M B;  2ARO C;  2PYO B;  3VH5 T;  4H9R A;  5CPJ D;  4ZUX D;  5CP6 B;  1ID3 C;  1HQ3 A;  1BH8 B;  1KX5 D;  3MGR B;  1P3O D;  3MVD C;  2ARO A;  3R45 B;  2F8N K;  4WNN A;  1B67 A;  1ID3 A;  2BYK B;  4X23 B;  3B6F A;  2BYM B;  4H9P A;  3MNN C;  1S32 B;  2HIO C;  3MVD A;  3REL D;  4ZUX B;  3UT9 C;  1H3O A;  1M18 D;  1M19 B;  5GXQ B;  3MNN A;  2Y2I A;  1AOI C;  3EPH A;  3MGP B;  2HIO A;  3AZG B;  1WWS A;  2NZD D;  3LZ1 D;  1P3P D;  1EQZ D;  4KUD C;  4WZS B;  3AZK B;  4AWL B;  1AOI A;  1JFI B;  3X1U C;  4H9S C;  1P3K B;  5E5A B;  2Y2O A;  4Z5T B;  4KUD A;  4DRB A;  5BNV B;  4YS3 C;  3AZF B;  2NZD B;  3V9R B;  1HQ3 D;  3X1U A;  1P3A C;  4H9S A;  3WA9 C;  4LD9 D;  1P3P B;  5AVB D;  3X1V C;  2RIQ A;  3W97 B;  2ARO D;  2IO5 C;  5B31 G;  4YS3 A;  3W96 D;  1ID3 D;  3AYW D;  1P3A A;  3WA9 A;  3X1V A;  3WTP E;  1M1A B;  1PZR A;  3TU4 B;  3LZ0 C;  2Y2L A;  1P3B B;  4LD9 B;  5AVB B;  5AV9 C;  2HIO D;  1F66 C;  3UT9 D;  4G91 C;  3AYW B;  3LZ0 A;  5AV9 A;  4H9Q A;  1F66 A;  5DNM B;  1W2E A;  4KUD D;  1KX4 D;  3A6N B;  5AV5 C;  1P3F C;  4UUZ A;  3W99 D;  3X1U D;  3MGS D;  3AFA C;  5JA4 B;  5AV5 A;  4Z66 C;  1P3F A;  1P3L D;  5KDM B;  1P3A D;  3B0D B;  3WA9 D;  3EPL A;  3X1V D;  1P3M C;  4WU9 C;  4G92 C;  1KX4 B;  4WU8 B;  3AFA A;  4Z66 A;  5CPK C;  4YM6 B;  3O62 D;  3MGS B;  4HGA C;  3WAA C;  3W99 B;  1N1J A;  3H0L C;  3C1B C;  1P3M A;  1F1E A;  3AV1 C;  4WU9 A;  4M6B A;  5CPK A;  1P3L B;  3WAA A;  3LZ0 D;  3NQU B;  4CSR B;  2Y2M A;  5AV9 D;  3C1B A;  5B2I C;  4KGC B;  3AV1 A;  4J8W B;  5B32 D;  4J8U B;  3O62 B;  4KHA A;  3C1C D;  5JRG D;  3MGQ B;  3LJA C;  3AV2 B;  5BNX B;  5GT0 B;  5B31 B;  5C3I B;  5B2J C;  5B2I A;  4J8V C;  1WWI A;  4QLC C;  3LJA A;  1P3F D;  5FUG B;  5B2J A;  5B32 B;  2YFW B;  5GT3 B;  2ZY3 A;  4J8V A;  2FJ7 C;  4QLC A;  2G5H C;  2Y2J A;  2F8N H;  2NQB B;  1P3M D;  3AZJ B;  2FJ7 A;  4WU9 D;  3REK B;  5CPK D;  3VH6 W;  3VH6 T;  3X1S B;  5F99 C;  4JJN B;  3VH5 A;  5AY8 D;  2LY8 A;  4XUJ C;  3AZM B;  5F99 A;  3REI B;  3REH C;  5B2I D;  3MGP C;  3AZG C;  4XUJ A;  3AZH D;  1TZY C;  2Y2N A;  3LJA D;  3REH A;  1KX3 C;  3X1T B;  5AY8 B;  3MGP A;  3AZG A;  4NE5 A;  5GSU C;  1R4V A;  4J8V D;  1TZY A;  2YFV B;  1TAF A;  3VH5 W;  3B6F C;  1HTA A;  2HUE C;  5B24 B;  1KX3 A;  5AV8 D;  5CPI D;  5GSU A;  3AZH B;  2FJ7 D;  3UTA C;  5AV6 C;  1P3I B;  3NQJ B;  2CV5 C;  3LEL D;  3KWQ D;  5CPJ B;  3UTA A;  5AV6 A;  2RVQ D;  1KX5 B;  4XZQ C;  2CV5 A;  3WTP D;  3AN2 C;  5AV8 B;  5F99 D;  1P3O B;  3TU4 C;  1KU5 A;  3W98 C;  3AZE C;  5B0Z C;  1U35 C;  1BH9 A;  4XUJ D;  1P3G D;  3LEL B;  4XZQ A;  3AN2 A;  5B1L C;  2Y2K A;  3KWQ B;  3REL B;  3TU4 A;  3REH D;  3AZI C;  3W98 A;  3AZE A;  1M18 B;  5B0Z A;  1U35 A;  2ZY2 A;  2F8N A;  1TZY D;  4J8X C;  3WTP B;  5B1L A;  3A6N C;  3AZI A;  3LZ1 B;  1EQZ B;  4CAY A;  4H9O A;  1P3G B;  4R8P C;  4J8X A;  3B6F D;  3A6N A;  5BO0 A;  5B33 C;  3MVD D;  3UTB C;  4H9R B;  4R8P A;  3EPJ A;  3UTA D;  4EO5 C;  5B32 G;  5AV6 D;  1HQ3 B;  3MNN D;  5B33 A;  2CV5 D;  2J8P A;  4DQY B;  4WV4 B;  2ARO B;  3UTB A;  3H0M C;  4WNN B;  3KXB C;  3KUY C;  3W96 B;  1ID3 B;  2UWX A;  4XZQ D;  3AN2 D;  1AOI D;  3P5J B;  3W98 D;  3AZE D;  3KXB A;  5B0Z D;  3KUY A;  1U35 D;  1ZLA C;  2F8N D;  4J8W C;  3REJ C;  4J8U C;  3FDD A;  5G49 A;  2HIO B;  1P34 C;  3AZI D;  3AZL C;  3UT9 B;  3AV2 C;  5B31 C;  1ZLA A;  5C3I C;  4J8W A;  3REJ A;  5B0Y C;  4J8U A;  1AOI B;  2DF4 C;  4YS3 D;  1P34 A;  3AZL A;  3AV2 A;  4E45 A;  5B31 A;  4KUD B;  4R8P D;  5B0Y A;  3X1U B;  3IP4 C;  1A7W A;  5B33 D;  3AZN C;  4DRA A;  2CWE A;  4YS3 B;  5DNN C;  4H9N A;  5B40 C;  1P3A B;  3WA9 B;  3X1V B;  3AZN A;  3B6G C;  1F66 D;  3WKJ C;  1T3U A;  5DNN A;  2XD1 A;  3B0C W;  3B0C T;  4JJN C;  5B40 A;  5AVC C;  3B6G A;  3AZM C;  3REI C;  3WKJ A;  4ZBJ B;  4JJN A;  3LZ0 B;  3REJ D;  5BS7 C;  3VH6 A;  5AV5 D;  5AV9 B;  4H9Q B;  5AVC A;  1P34 D;  1F66 B;  3AZM A;  3AZL D;  3REI A;  4G91 B;  3C1C B;  5B1M C;  5JRG B;  3AFA D;  5BS7 A;  4Z66 D;  4UUZ B;  2PYO C;  2JSS A;  5CP6 C;  5B1M A;  5AV5 B;  3MGR C;  1P3F B;  2PYO A;  3WAA D;  5CP6 A;  4X23 C;  3AZN D;  1ULY A;  3H0R C;  3C1B D;  5B24 A;  1S32 C;  1BH8 A;  3AV1 D;  3AFA B;  3MGR A;  4Z66 B;  4NE6 A;  3R45 A;  4ZUX C;  1N1J B;  5B40 D;  3KFU G;  3NQJ A;  2BYK A;  4X23 A;  1P3M B;  1M19 C;  4WU9 B;  2BYM A;  5GXQ C;  4G92 B;  1S32 A;  1KX5 C;  3B6G D;  5CPK B;  3WKJ D;  2L5A A;  4HGA B;  4ZUX A;  3WAA B;  3C1B B;  5AVC D;  1M19 A;  1KX5 A;  3AV1 B;  5GXQ A;  5B2J D;  3AZK C;  4AWL C;  4KHA B;  1P3K C;  4QLC D;  5E5A C;  4Z5T C;  1Q9C A;  5B2I B;  3AZK A;  2ZY4 A;  3AZF C;  2JE5 A;  2NZD C;  1JFI A;  5B1M D;  1P3K A;  3LJA B;  1P3P C;  5E5A A;  4Z5T A;  3W97 C;  2PYO D;  5BNV A;  5CP6 D;  3AZF A;  4J8V B;  4E44 A;  2NZD A;  3V9R A;  4QLC B;  1P3P A;  3MGR D;  3W97 A;  2XD5 A;  1M1A C;  2JCH A;  5CPI B;  2FJ7 B;  1P3B C;  1S32 D;  4LD9 C;  5AVB C;  3KSY A;  3W96 C;  1M1A A;  3AYW C;  1M19 D;  1P3B A;  5GXQ D;  4LD9 A;  5AVB A;  4Z2M G;  3MGP D;  3AZG D;  1BFM A;  5DNM C;  3W96 A;  5F99 B;  3AYW A;  4UPK A;  1KX3 D;  3AZK D;  2ZY5 A;  4XUJ B;  2Y2P A;  5GSU D;  1P3K D;  2W8S A;  5E5A D;  5DNM A;  4Z5T D;  3REH B;  3AZF D;  3EG5 B;  3UT9 A;  1TZY B;  1TAF B;  3B0D C;  3W97 D;  1KX4 C;  4WU8 C;  1KX3 B;  5JA4 A;  4YM6 C;  2ZM5 A;  3W99 C;  3MGS C;  5GSU B;  5KDM A;  1KX4 A;  3B6F B;  4WU8 A;  2HUE B;  4H9P B;  4WJ3 C;  1M1A D;  4YM6 A;  1P3L C;  3MGS A;  3MVD B;  3W99 A;  3TU4 D;  1P3B D;  3UTA B;  1H3O B;  5AV6 B;  4KGC C;  5BT1 C;  3MNN B;  2CV5 B;  3O62 C;  1P3L A;  5B1L D;  3MGQ C;  3NQU A;  4CSR A;  5GT0 C;  1BH9 B;  2BG1 A;  4KGC A;  2G5I C;  4XZQ B;  4J8X D;  5DNM D;  3AN2 B;  2Y2H A;  3F6T A;  4ZBJ C;  3O62 A;  3MGQ A;  3W98 B;  2F2A C;  3A6N D;  3AZE B;  5B0Z B;  5BNX A;  5GT0 A;  1U35 B;  2F8N B;  5B32 C;  5GT3 C; 
#chains in the Genus database with same CATH homology
 3C1C C;  5B1L B;  5JRG C;  3AZI B;  5FUG A;  4CAY B;  4H9O B;  2DQN C;  2NQB C;  5B32 A;  2YFW A;  2Y2G A;  5GT3 A;  4J8X B;  3UTB D;  3C1C A;  3AZJ C;  5JRG A;  4WU8 D;  5BO0 B;  3REK C;  4YM6 D;  2VQR A;  2IO5 B;  2NQB A;  4R8P B;  3X1S C;  3KXB D;  3KUY D;  3AZJ A;  3REK A;  5B33 B;  3UTB B;  4NFT A;  3X1S A;  4EO5 B;  3A1I A;  1ZLA D;  4KGC D;  5BT1 D;  4J8W D;  4J8U D;  3MGQ D;  3KXB B;  3AV2 D;  3KUY B;  5GT0 D;  5B31 D;  3EPK A;  3X1T C;  5AY8 C;  5B0Y D;  5G49 B;  1Z2C B;  1ZLA B;  5B24 C;  3REJ B;  5GT3 D;  3X1T A;  5AY8 A;  3AZH C;  1P34 B;  2YFV A;  3AZL B;  1P3I C;  2NQB D;  5B0Y B;  2FFF B;  3AZJ D;  3AZH A;  5DNN D;  5CPJ C;  3REK D;  1P3I A;  1P3O C;  5CPI C;  5AV8 C;  3X1S D;  4H9N B;  4JJN D;  5CPJ A;  3AZN B;  5CHL B;  3A1K A;  3LEL C;  3AZM D;  1P3O A;  5AV8 A;  5CPI A;  3REI D;  3KWQ C;  5DNN B;  3REL C;  5B40 B;  1M18 C;  3B6G B;  2Y2Q A;  2RVQ C;  3WTP C;  3LEL A;  3WKJ B;  3KWQ A;  3REL A;  1M18 A;  3LZ1 C;  3X1T D;  1EQZ C;  4Z2M H;  5AVC B;  1P3G C;  5B2J B;  3WTP A;  3AL0 C;  5B24 D;  1B6W A;  3LZ1 A;  1EQZ A;  4NE3 A;  1P3G A;  3B0B A;  2F8N G;  1P3I D;  1HQ3 C;  4X23 D;  5B1M B;  2ARO C;  2PYO B;  3VH5 T;  4H9R A;  5CPJ D;  4ZUX D;  5CP6 B;  1ID3 C;  1HQ3 A;  1BH8 B;  1KX5 D;  3MGR B;  1P3O D;  3MVD C;  2ARO A;  3R45 B;  2F8N K;  4WNN A;  1B67 A;  1ID3 A;  2BYK B;  4X23 B;  3B6F A;  2BYM B;  4H9P A;  3MNN C;  1S32 B;  2HIO C;  3MVD A;  3REL D;  4ZUX B;  3UT9 C;  1H3O A;  1M18 D;  1M19 B;  5GXQ B;  3MNN A;  2Y2I A;  1AOI C;  3EPH A;  3MGP B;  2HIO A;  3AZG B;  1WWS A;  2NZD D;  3LZ1 D;  1P3P D;  1EQZ D;  4KUD C;  4WZS B;  3AZK B;  4AWL B;  1AOI A;  1JFI B;  3X1U C;  4H9S C;  1P3K B;  5E5A B;  2Y2O A;  4Z5T B;  4KUD A;  4DRB A;  5BNV B;  4YS3 C;  3AZF B;  2NZD B;  3V9R B;  1HQ3 D;  3X1U A;  1P3A C;  4H9S A;  3WA9 C;  4LD9 D;  1P3P B;  5AVB D;  3X1V C;  2RIQ A;  3W97 B;  2ARO D;  2IO5 C;  5B31 G;  4YS3 A;  3W96 D;  1ID3 D;  3AYW D;  1P3A A;  3WA9 A;  3X1V A;  3WTP E;  1M1A B;  1PZR A;  3TU4 B;  3LZ0 C;  2Y2L A;  1P3B B;  4LD9 B;  5AVB B;  5AV9 C;  2HIO D;  1F66 C;  3UT9 D;  4G91 C;  3AYW B;  3LZ0 A;  5AV9 A;  4H9Q A;  1F66 A;  5DNM B;  1W2E A;  4KUD D;  1KX4 D;  3A6N B;  5AV5 C;  1P3F C;  4UUZ A;  3W99 D;  3X1U D;  3MGS D;  3AFA C;  5JA4 B;  5AV5 A;  4Z66 C;  1P3F A;  1P3L D;  5KDM B;  1P3A D;  3B0D B;  3WA9 D;  3EPL A;  3X1V D;  1P3M C;  4WU9 C;  4G92 C;  1KX4 B;  4WU8 B;  3AFA A;  4Z66 A;  5CPK C;  4YM6 B;  3O62 D;  3MGS B;  4HGA C;  3WAA C;  3W99 B;  1N1J A;  3H0L C;  3C1B C;  1P3M A;  1F1E A;  3AV1 C;  4WU9 A;  4M6B A;  5CPK A;  1P3L B;  3WAA A;  3LZ0 D;  3NQU B;  4CSR B;  2Y2M A;  5AV9 D;  3C1B A;  5B2I C;  4KGC B;  3AV1 A;  4J8W B;  5B32 D;  4J8U B;  3O62 B;  4KHA A;  3C1C D;  5JRG D;  3MGQ B;  3LJA C;  3AV2 B;  5BNX B;  5GT0 B;  5B31 B;  5C3I B;  5B2J C;  5B2I A;  4J8V C;  1WWI A;  4QLC C;  3LJA A;  1P3F D;  5FUG B;  5B2J A;  5B32 B;  2YFW B;  5GT3 B;  2ZY3 A;  4J8V A;  2FJ7 C;  4QLC A;  2G5H C;  2Y2J A;  2F8N H;  2NQB B;  1P3M D;  3AZJ B;  2FJ7 A;  4WU9 D;  3REK B;  5CPK D;  3VH6 W;  3VH6 T;  3X1S B;  5F99 C;  4JJN B;  3VH5 A;  5AY8 D;  2LY8 A;  4XUJ C;  3AZM B;  5F99 A;  3REI B;  3REH C;  5B2I D;  3MGP C;  3AZG C;  4XUJ A;  3AZH D;  1TZY C;  2Y2N A;  3LJA D;  3REH A;  1KX3 C;  3X1T B;  5AY8 B;  3MGP A;  3AZG A;  4NE5 A;  5GSU C;  1R4V A;  4J8V D;  1TZY A;  2YFV B;  1TAF A;  3VH5 W;  3B6F C;  1HTA A;  2HUE C;  5B24 B;  1KX3 A;  5AV8 D;  5CPI D;  5GSU A;  3AZH B;  2FJ7 D;  3UTA C;  5AV6 C;  1P3I B;  3NQJ B;  2CV5 C;  3LEL D;  3KWQ D;  5CPJ B;  3UTA A;  5AV6 A;  2RVQ D;  1KX5 B;  4XZQ C;  2CV5 A;  3WTP D;  3AN2 C;  5AV8 B;  5F99 D;  1P3O B;  3TU4 C;  1KU5 A;  3W98 C;  3AZE C;  5B0Z C;  1U35 C;  1BH9 A;  4XUJ D;  1P3G D;  3LEL B;  4XZQ A;  3AN2 A;  5B1L C;  2Y2K A;  3KWQ B;  3REL B;  3TU4 A;  3REH D;  3AZI C;  3W98 A;  3AZE A;  1M18 B;  5B0Z A;  1U35 A;  2ZY2 A;  2F8N A;  1TZY D;  4J8X C;  3WTP B;  5B1L A;  3A6N C;  3AZI A;  3LZ1 B;  1EQZ B;  4CAY A;  4H9O A;  1P3G B;  4R8P C;  4J8X A;  3B6F D;  3A6N A;  5BO0 A;  5B33 C;  3MVD D;  3UTB C;  4H9R B;  4R8P A;  3EPJ A;  3UTA D;  4EO5 C;  5B32 G;  5AV6 D;  1HQ3 B;  3MNN D;  5B33 A;  2CV5 D;  2J8P A;  4DQY B;  4WV4 B;  2ARO B;  3UTB A;  3H0M C;  4WNN B;  3KXB C;  3KUY C;  3W96 B;  1ID3 B;  2UWX A;  4XZQ D;  3AN2 D;  1AOI D;  3P5J B;  3W98 D;  3AZE D;  3KXB A;  5B0Z D;  3KUY A;  1U35 D;  1ZLA C;  2F8N D;  4J8W C;  3REJ C;  4J8U C;  3FDD A;  5G49 A;  2HIO B;  1P34 C;  3AZI D;  3AZL C;  3UT9 B;  3AV2 C;  5B31 C;  1ZLA A;  5C3I C;  4J8W A;  3REJ A;  5B0Y C;  4J8U A;  1AOI B;  2DF4 C;  4YS3 D;  1P34 A;  3AZL A;  3AV2 A;  4E45 A;  5B31 A;  4KUD B;  4R8P D;  5B0Y A;  3X1U B;  3IP4 C;  1A7W A;  5B33 D;  3AZN C;  4DRA A;  2CWE A;  4YS3 B;  5DNN C;  4H9N A;  5B40 C;  1P3A B;  3WA9 B;  3X1V B;  3AZN A;  3B6G C;  1F66 D;  3WKJ C;  1T3U A;  5DNN A;  2XD1 A;  3B0C W;  3B0C T;  4JJN C;  5B40 A;  5AVC C;  3B6G A;  3AZM C;  3REI C;  3WKJ A;  4ZBJ B;  4JJN A;  3LZ0 B;  3REJ D;  5BS7 C;  3VH6 A;  5AV5 D;  5AV9 B;  4H9Q B;  5AVC A;  1P34 D;  1F66 B;  3AZM A;  3AZL D;  3REI A;  4G91 B;  3C1C B;  5B1M C;  5JRG B;  3AFA D;  5BS7 A;  4Z66 D;  4UUZ B;  2PYO C;  2JSS A;  5CP6 C;  5B1M A;  5AV5 B;  3MGR C;  1P3F B;  2PYO A;  3WAA D;  5CP6 A;  4X23 C;  3AZN D;  1ULY A;  3H0R C;  3C1B D;  5B24 A;  1S32 C;  1BH8 A;  3AV1 D;  3AFA B;  3MGR A;  4Z66 B;  4NE6 A;  3R45 A;  4ZUX C;  1N1J B;  5B40 D;  3KFU G;  3NQJ A;  2BYK A;  4X23 A;  1P3M B;  1M19 C;  4WU9 B;  2BYM A;  5GXQ C;  4G92 B;  1S32 A;  1KX5 C;  3B6G D;  5CPK B;  3WKJ D;  2L5A A;  4HGA B;  4ZUX A;  3WAA B;  3C1B B;  5AVC D;  1M19 A;  1KX5 A;  3AV1 B;  5GXQ A;  5B2J D;  3AZK C;  4AWL C;  4KHA B;  1P3K C;  4QLC D;  5E5A C;  4Z5T C;  1Q9C A;  5B2I B;  3AZK A;  2ZY4 A;  3AZF C;  2JE5 A;  2NZD C;  1JFI A;  5B1M D;  1P3K A;  3LJA B;  1P3P C;  5E5A A;  4Z5T A;  3W97 C;  2PYO D;  5BNV A;  5CP6 D;  3AZF A;  4J8V B;  4E44 A;  2NZD A;  3V9R A;  4QLC B;  1P3P A;  3MGR D;  3W97 A;  2XD5 A;  1M1A C;  2JCH A;  5CPI B;  2FJ7 B;  1P3B C;  1S32 D;  4LD9 C;  5AVB C;  3KSY A;  3W96 C;  1M1A A;  3AYW C;  1M19 D;  1P3B A;  5GXQ D;  4LD9 A;  5AVB A;  4Z2M G;  3MGP D;  3AZG D;  1BFM A;  5DNM C;  3W96 A;  5F99 B;  3AYW A;  4UPK A;  1KX3 D;  3AZK D;  2ZY5 A;  4XUJ B;  2Y2P A;  5GSU D;  1P3K D;  2W8S A;  5E5A D;  5DNM A;  4Z5T D;  3REH B;  3AZF D;  3EG5 B;  3UT9 A;  1TZY B;  1TAF B;  3B0D C;  3W97 D;  1KX4 C;  4WU8 C;  1KX3 B;  5JA4 A;  4YM6 C;  2ZM5 A;  3W99 C;  3MGS C;  5GSU B;  5KDM A;  1KX4 A;  3B6F B;  4WU8 A;  2HUE B;  4H9P B;  4WJ3 C;  1M1A D;  4YM6 A;  1P3L C;  3MGS A;  3MVD B;  3W99 A;  3TU4 D;  1P3B D;  3UTA B;  1H3O B;  5AV6 B;  4KGC C;  5BT1 C;  3MNN B;  2CV5 B;  3O62 C;  1P3L A;  5B1L D;  3MGQ C;  3NQU A;  4CSR A;  5GT0 C;  1BH9 B;  2BG1 A;  4KGC A;  2G5I C;  4XZQ B;  4J8X D;  5DNM D;  3AN2 B;  2Y2H A;  3F6T A;  4ZBJ C;  3O62 A;  3MGQ A;  3W98 B;  2F2A C;  3A6N D;  3AZE B;  5B0Z B;  5BNX A;  5GT0 A;  1U35 B;  2F8N B;  5B32 C;  5GT3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...