1P3MA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVIIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3mA00
2YFVB 3NQJA 1P3PD 5AV5C 3X1SC 3MGRA 5B24A 4KUDD 3WTPD 4Z5TC 4XZQA 4J8UC 5CP6D 3MVDB 3AZFB 5GXQD 5B2IB 3B0DB 5AV8D 4G92B 1TZYA 3AZHD 3AZJD 2FJ7B 4ZUXC 4LD9C 5B1MB 5CPJB 3AZMC 3AV2D 5B0ZD 3X1VC 3MGQB 5B32D 3AZEC 1H3OB 3VH6W 4Z66A 4KGCD 3LJAC 3RELC 3KSYA 3KXBC 3MVDD 3AZLC 2AROA 5B2ID 3REHD 1P3FA 3B6FA 5AVCC 3W98B 2F8NH 5AV5A 3O62D 5BNXB 2IO5B 4CSRA 3R45B 4Z5TA 5B1MD 5CPJD 4J8UA 4J8XC 4WNNA 1EQZC 3AN2A 1KU5A 3UTAC 3W97C 2NZDA 4E44A 1TAFB 3C1CB 3MGQD 5BO0A 4HGAC 3B6GA 1P3AC 5DNNC 3NQUA 3WKJA 1S32C 2F8NA 3W99A 2BYMA 5AY8A 3TU4D 4ZBJC 3X1UB 1KX5D 5GSUC 5AV6A 4QLCC 1BH8A 3AYWB 3W98D 2NQBC 5CHLB 5DNMD 5B40A 1N1JA 3LJAA 3LZ1A 3REJD 2PYOB 3AZKC 5CPKB 3LZ0B 4YM6A 1AOIC 3VH6A 5B1LB 3C1CD 1P3IA 1P3LB 4KHAA 4E45A 1P3OA 3KUYC 4H9RA 3MNNC 3MGPB 4R8PB 1R4VA 4EO5B 3X1UD 3REKA 1P3MD 5B2JB 5B33D 5FUGA 1P3GB 1KX4B 5E5AC 1S32A 3KWQB 1P3BB 1P3KB 1F66A 2PYOD 5F99A 5CPKD 5B31C 3LZ0D 4G91B 2FJ7C 4J8VD 4JJNC 3UTBC 4KUDA 1P3LD 3WTPA 4UUZB 4WU9B 5CP6A 3AZKA 1P34B 5AV8A 4X23B 3AZHA 3MGPD 1AOIA 3AZJA 4J8WB 5B2JD 3MGRC 5B24C 3AV2A 4H9QB 1P3GD 5AVBB 3MNNA 1KX4D 3AV1D 5B0ZA 4XZQC 1P3BD 5CPIB 1B67A 3UT9A 3X1TB 1P3KD 1TZYC 1P3PB 4NE5A 5B32A 5JRGB 2YFVA 5JA4B 1BFMA 2IO5C 5GXQB 4WU9D 3MVDA 3AZGA 3AZFA 1B6WA 5B2IA 1P34D 5B31A 4X23D 2FJ7A 4J8WD 1M1AB 3V9RA 5CPJA 4Z66C 3VH6T 3RELD 3KXBD 1HTAA 4H9OB 2CV5B 3WAAB 5AVCD 2AROC 1P3FC 3X1TD 3MGQA 3B6FC 5G49B 2RVQC 5JRGD 4NE6A 4KGCB 1M18B 1ID3B 1H3OA 4AWLB 4YS3C 3LELB 3REHB 3REIB 3AZIB 3AN2C 2NZDC 3O62B 4XUJC 3W98A 5B0YB 3B6GC 1M1AD 3WKJC 3R45A 3AZNC 3W99C 4DRAA 3A6NB 5AY8C 1U35B 2CV5D 3WAAD 1TAFA 4WZSB 5AV6C 3C1CA 4EO5C 2NQBD 3WA9B 5BNVB 1KX3C 1M18D 5B40C 1ID3D 3LZ1C 3TU4B 1KX5B 5GT3B 3KWQC 3LELD 3AZID 3REID 3X1UA 4YM6C 5DNMB 3WTPE 1P3IC 5AV9B 3AYWA 5B0YD 3REJB 3C1BB 1P3OC 5C3IC 4YS3A 1ZLAC 4WU8B 2PYOA 3A6ND 2BYKB 2HIOB 4XUJA 3LZ0A 3AZGB 5CPKA 1U35D 5B1LA 3REKC 1P3LA 5E5AD 3WA9D 3AZNA 5AVBC 5GT3D 5GT0B 4R8PA 1F66C 4NE3A 5F99C 1P3MB 1ULYA 5B33B 5BT1D 3AFAD 1P3PC 4KUDC 5AV9D 1KX3A 3WTPC 1P3GA 1KX4A 3C1BD 5CP6C 3KWQA 1P3BA 4WU8D 5AV8C 1P3KA 3AZHC 1HQ3D 3MGSB 3AZJC 4J8VB 2HIOD 3AZGD 3W96D 2HUEC 1M19B 3AV2C 4UUZA 1ZLAA 4XZQD 4WU9A 5B0ZC 3UT9C 5BS7A 2YFWA 5GT0D 2L5AA 3X1SB 4J8WA 5B32C 4J8UB 3AV1B 4H9QA 5AVBA 1Q9CA 3AZFC 3MVDC 5CPIA 5B2IC 3X1TA 3B0DC 1JFIB 4G92C 4ZUXB 4LD9B 1P3PA 4CAYB 3MGSD 3AZMB 2F8NG 5JRGA 1BH9B 5JA4A 2F8NB 1M19D 5B1MC 2BYMB 3X1VB 5CPJC 5GXQA 1P3FD 3AZEB 3MGQC 5AV5D 3X1SD 1M1AA 3LJAB 4Z5TD 4J8UD 3RELB 3KXBB 3AZLB 5AVCB 4H9OA 4H9SA 2CV5A 1KX5C 3WAAA 4M6BA 4H9PB 4H9NB 5G49A 4ZUXD 3W98C 4LD9D 4J8XB 3AZMD 1EQZB 3WKJD 4KGCA 1M18A 3UTAB 3W97B 2F8ND 3REJC 3X1VD 5AY8D 3LELA 3REHA 4HGAB 5AV6D 1P3AB 5DNNB 3O62A 3C1CC 3AZED 5B0YA 5B1MA 3LJAD 3LZ1D 4ZBJB 5GSUB 3AZLD 2F8NK 4QLCB 1U35A 3X1UC 2NQBB 1P3ID 3AYWC 4J8XD 1P3OD 1EQZD 3WA9A 5BNVA 3UTAD 3W97D 3TU4A 1KX5A 2PYOC 5CPKC 3LZ0C 1P3AD 5DNND 5DNMA 5B1LC 5BNXA 5AV9A 3KUYB 1P3LC 1S32D 3REJA 3C1BA 5GSUD 4WU8A 3MGPC 4R8PC 2BYKA 4QLCD 2HIOA 5E5AB 4Z2MG 3VH5W 5B2JC 1WWSA 5KDMB 5B31G 1P3GC 1KX4C 3AZKD 1F1EA 3AV1C 1P3BC 5B31B 1AOID 5GT0A 1P3KC 4JJNB 3UTBB 3AFAB 1P3MA 2LY8A 3V9RB 5B33A 4G91C 3KUYD 3MNND 3UT9D 4WU9C 1HQ3B 1P34C 5BS7C 3NQJB 4X23C 3W96B 3MGSA 3MGRB 5B24B 4J8VA 4J8WC 4XZQB 1M19A 3AZFD 1TZYB 3MGPA 1WWIA 5CPIC 5B31D 3X1TC 2FJ7D 3X1SA 4JJND 3UTBD 5B2JA 5JRGC 3AV1A 5GXQC 3VH5A 3B0BA 1JFIA 4ZUXA 4LD9A 4CAYA 4Z66B 5B24D 3MGRD 3AZMA 1M1AC 1BH9A 3X1VA 2AROB 1P3FB 3B6FB 1TZYD 1P34A 4X23A 2CV5C 4H9SC 5AV5B 3WAAC 3AZEA 4CSRB 4Z5TB 4WNNB 4YS3B 3AN2B 4KGCC 1M18C 2JSSA 3RELA 3KXBA 1ID3C 3AZLA 2NZDB 4AWLC 4XUJB 5AVCA 5BO0B 3LELC 3REHC 3REIC 3AZIC 3B6GB 3O62C 3NQUB 4H9PA 3WKJB 4H9NA 5B0YC 4Z66D 4J8XA 3AZNB 1EQZA 3W99B 5AY8B 3UTAA 3W97A 2AROD 5AV6B 3B6FD 3A6NC 1BH8B 1U35C 1P3AA 2RVQD 5DNNA 1KX3B 3AYWD 5B40B 1N1JB 3LZ1B 3WA9C 4YS3D 3AN2D 3B0CT 5GSUA 2NZDD 4YM6B 3TU4C 5GT3C 4XUJD 1P3IB 4QLCA 4KHAB 4WV4B 2NQBA 5B1LD 3B6GD 5BT1C 3AFAC 1P3OB 5DNMC 5C3IB 5AV9C 1ZLAB 4H9RB 3AZND 1ID3A 3W99D 1A7WA 3C1BC 2YFWB 3AZIA 4R8PD 3REIA 4WU8C 3REKB 1HQ3C 2HIOC 4Z2MH 3W96C 5FUGB 3AZGC 1S32B 1KX3D 5B40D 3KUYA 3VH5T 3KWQD 1F66B 5F99B 3A6NA 4NFTA 4YM6D 5GT0C 4KUDB 1P3MC 3WTPB 5E5AA 5B33C 5CP6B 3AZKB 3B0CW 1ZLAD 5KDMA 5AV8B 3AZHB 4DRBA 1AOIB 5GT3A 3AZJB 2CWEA 2HUEB 3REKD 4JJNA 3UTBA 3AFAA 3MGSC 4J8VC 3AV2B 3MNNB 5B0ZB 1M19C 3UT9B 5AVBD 5B32G 1F66D 5CPID 5F99D 1HQ3A 5B32B 3W96A
chains in the Genus database with same CATH superfamily
2YFVB 3NQJA 1P3PD 5AV5C 3X1SC 3MGRA 5B24A 4KUDD 3WTPD 4Z5TC 4XZQA 4J8UC 5CP6D 3MVDB 3AZFB 5GXQD 5B2IB 3B0DB 5AV8D 4G92B 1TZYA 3AZHD 3AZJD 2FJ7B 4ZUXC 4LD9C 5B1MB 5CPJB 3AZMC 3AV2D 5B0ZD 3X1VC 3MGQB 5B32D 3AZEC 2Y2MA 1H3OB 3VH6W 4Z66A 4KGCD 2Y2NA 2JCHA 3LJAC 3RELC 3KSYA 3KXBC 3MVDD 3AZLC 2AROA 2Y2PA 5B2ID 3REHD 1P3FA 3B6FA 5AVCC 3W98B 2F8NH 5AV5A 3O62D 1W2EA 5BNXB 2IO5B 4CSRA 3R45B 4Z5TA 5B1MD 5CPJD 4J8UA 4J8XC 4WNNA 1EQZC 2Y2JA 3AN2A 1KU5A 3UTAC 3W97C 2NZDA 4E44A 1TAFB 3C1CB 3MGQD 5BO0A 4HGAC 3B6GA 1P3AC 5DNNC 3NQUA 3WKJA 1S32C 2F8NA 3W99A 2BYMA 5AY8A 1T3UA 3TU4D 4ZBJC 3X1UB 1KX5D 5GSUC 3EPLA 5AV6A 4QLCC 1BH8A 3AYWB 3W98D 2NQBC 5CHLB 5DNMD 2RIQA 2DQNC 5B40A 1N1JA 2G5IC 3LZ1A 3LJAA 3REJD 2PYOB 3AZKC 5CPKB 3LZ0B 4YM6A 1AOIC 3VH6A 5B1LB 3C1CD 1P3IA 2J8PA 4KHAA 1P3LB 4E45A 1P3OA 3KUYC 4H9RA 3MNNC 3MGPB 4R8PB 1R4VA 4EO5B 3X1UD 3REKA 1P3MD 5B2JB 5B33D 5FUGA 1P3GB 1KX4B 5E5AC 1S32A 3KWQB 1P3BB 2XD5A 1P3KB 1F66A 2PYOD 5F99A 2ZY4A 5CPKD 5B31C 3LZ0D 4G91B 2FJ7C 4J8VD 4JJNC 3UTBC 4KUDA 1P3LD 3WTPA 4UUZB 4WU9B 5CP6A 3AZKA 1P34B 5AV8A 4X23B 3AZHA 3MGPD 1AOIA 3AZJA 4J8WB 5B2JD 3MGRC 5B24C 3AV2A 4H9QB 1P3GD 5AVBB 3MNNA 1KX4D 3AV1D 5B0ZA 4XZQC 3AL0C 1P3BD 5CPIB 1B67A 3F6TA 3UT9A 3X1TB 1P3KD 1TZYC 3H0RC 1P3PB 4NE5A 5B32A 5JRGB 2YFVA 5JA4B 1BFMA 2IO5C 2ZY5A 5GXQB 4WU9D 3MVDA 3AZGA 3AZFA 1B6WA 5B2IA 1P34D 5B31A 4X23D 2FJ7A 4J8WD 1M1AB 3V9RA 5CPJA 4Z66C 3VH6T 3RELD 3KXBD 1HTAA 4H9OB 2CV5B 3WAAB 5AVCD 2AROC 1P3FC 3X1TD 3MGQA 3B6FC 5G49B 2RVQC 5JRGD 4NE6A 4KGCB 1M18B 1ID3B 1H3OA 2VQRA 4AWLB 4YS3C 3LELB 3REHB 3REIB 3AZIB 3AN2C 2NZDC 3O62B 4XUJC 3W98A 5B0YB 3B6GC 1M1AD 3WKJC 3R45A 3AZNC 3W99C 4DRAA 3A6NB 2UWXA 5AY8C 1U35B 2CV5D 3WAAD 1TAFA 4WZSB 5AV6C 3C1CA 4EO5C 2NQBD 3EPHA 2JE5A 3WA9B 5BNVB 1KX3C 1M18D 5B40C 1ID3D 4DQYB 3LZ1C 3TU4B 1KX5B 5GT3B 3KWQC 3LELD 3AZID 3REID 3X1UA 2Y2LA 4YM6C 5DNMB 3WTPE 1P3IC 5AV9B 3AYWA 5B0YD 3H0LC 3REJB 3C1BB 1P3OC 5C3IC 4YS3A 1ZLAC 4WU8B 2Y2QA 2PYOA 3A6ND 2BYKB 2HIOB 4XUJA 3LZ0A 3AZGB 5CPKA 1U35D 5B1LA 3REKC 1P3LA 5E5AD 3WA9D 3AZNA 1Z2CB 5AVBC 5GT3D 5GT0B 4R8PA 1F66C 4NE3A 5F99C 1P3MB 1ULYA 5B33B 5BT1D 3AFAD 1P3PC 4KUDC 5AV9D 1KX3A 3WTPC 1P3GA 1KX4A 3EG5B 3C1BD 5CP6C 3KWQA 1P3BA 4WU8D 5AV8C 1P3KA 3AZHC 1HQ3D 3MGSB 3AZJC 4J8VB 2HIOD 3AZGD 3W96D 2F2AC 2HUEC 1M19B 3AV2C 4UUZA 1ZLAA 4XZQD 4WU9A 5B0ZC 2XD1A 3UT9C 5BS7A 2YFWA 5GT0D 2L5AA 2G5HC 3X1SB 4J8WA 5B32C 4J8UB 3AV1B 4H9QA 5AVBA 1Q9CA 3AZFC 3MVDC 5CPIA 5B2IC 3X1TA 3B0DC 1JFIB 4G92C 4ZUXB 4LD9B 1P3PA 4CAYB 3MGSD 3AZMB 2F8NG 5JRGA 1BH9B 5JA4A 2F8NB 1M19D 5B1MC 2BYMB 3X1VB 5CPJC 5GXQA 1P3FD 3AZEB 3MGQC 5AV5D 3X1SD 1M1AA 3LJAB 4Z5TD 4J8UD 3RELB 3KXBB 3AZLB 2Y2GA 5AVCB 4H9OA 4H9SA 2CV5A 1KX5C 3WAAA 4M6BA 4UPKA 2Y2OA 4H9PB 4H9NB 5G49A 4ZUXD 3W98C 4LD9D 4J8XB 3AZMD 1EQZB 3WKJD 4KGCA 1M18A 3UTAB 3W97B 2F8ND 3REJC 3X1VD 5AY8D 3LELA 3REHA 3IP4C 4HGAB 5AV6D 1P3AB 5DNNB 3O62A 3C1CC 3AZED 5B0YA 5B1MA 3LJAD 3LZ1D 4ZBJB 5GSUB 3AZLD 2F8NK 3FDDA 4QLCB 1U35A 3X1UC 2NQBB 1P3ID 3AYWC 4J8XD 1P3OD 1EQZD 3WA9A 5BNVA 3UTAD 3W97D 3TU4A 1KX5A 2PYOC 5CPKC 3LZ0C 1P3AD 5DNND 5DNMA 5B1LC 5BNXA 5AV9A 3KUYB 1P3LC 1S32D 3REJA 3C1BA 5GSUD 4WU8A 3MGPC 4R8PC 2BYKA 4QLCD 2HIOA 5E5AB 4Z2MG 3VH5W 5B2JC 1WWSA 5KDMB 5B31G 1P3GC 1KX4C 3AZKD 1F1EA 3AV1C 1P3BC 2FFFB 5B31B 1AOID 5GT0A 1P3KC 4JJNB 3UTBB 3AFAB 1P3MA 2LY8A 3V9RB 3A1KA 5B33A 4G91C 3KUYD 3MNND 3UT9D 4WU9C 1HQ3B 2Y2IA 1P34C 5BS7C 3NQJB 4X23C 3W96B 3MGSA 3MGRB 5B24B 4J8VA 4J8WC 4XZQB 1M19A 2DF4C 2Y2HA 3AZFD 1TZYB 3MGPA 1WWIA 3EPKA 5CPIC 5B31D 3X1TC 2FJ7D 3X1SA 4JJND 3UTBD 5B2JA 5JRGC 3AV1A 5GXQC 4WJ3C 3VH5A 3B0BA 1JFIA 3A1IA 4ZUXA 3EPJA 4LD9A 4CAYA 4Z66B 5B24D 3MGRD 3AZMA 1M1AC 1BH9A 3X1VA 2AROB 1P3FB 3B6FB 1TZYD 1P34A 4X23A 2CV5C 4H9SC 5AV5B 2ZY3A 3WAAC 3AZEA 4CSRB 4Z5TB 4WNNB 4YS3B 3AN2B 4KGCC 1M18C 2JSSA 3RELA 3KXBA 1ID3C 3AZLA 2NZDB 2Y2KA 4AWLC 4XUJB 5AVCA 5BO0B 3LELC 3REHC 3REIC 3AZIC 3B6GB 2BG1A 3O62C 3NQUB 4H9PA 3WKJB 4H9NA 5B0YC 4Z66D 4J8XA 3AZNB 1EQZA 3W99B 5AY8B 3UTAA 3W97A 2AROD 5AV6B 3B6FD 3A6NC 1BH8B 1U35C 1P3AA 2RVQD 5DNNA 1KX3B 3AYWD 5B40B 1N1JB 3LZ1B 3H0MC 3WA9C 4YS3D 3AN2D 3B0CT 5GSUA 2NZDD 4YM6B 3TU4C 3P5JB 5GT3C 4XUJD 1P3IB 4QLCA 4KHAB 4WV4B 2NQBA 5B1LD 3B6GD 5BT1C 3AFAC 1P3OB 5DNMC 5C3IB 5AV9C 1ZLAB 4H9RB 3AZND 1ID3A 3W99D 1A7WA 3C1BC 3KFUG 2YFWB 3AZIA 4R8PD 3REIA 4WU8C 2ZM5A 3REKB 1HQ3C 2HIOC 4Z2MH 3W96C 5FUGB 3AZGC 2W8SA 1S32B 1KX3D 5B40D 3KUYA 3VH5T 3KWQD 1F66B 5F99B 3A6NA 4NFTA 4YM6D 5GT0C 4KUDB 1P3MC 3WTPB 5E5AA 5B33C 5CP6B 3AZKB 3B0CW 1ZLAD 5KDMA 5AV8B 3AZHB 4DRBA 1AOIB 5GT3A 3AZJB 2CWEA 2HUEB 3REKD 4JJNA 3UTBA 3AFAA 3MGSC 4J8VC 3AV2B 3MNNB 5B0ZB 1M19C 1PZRA 3UT9B 5AVBD 5B32G 1F66D 5CPID 5F99D 1HQ3A 2ZY2A 5B32B 3W96A
chains in the Genus database with same CATH topology
2YFVB 3NQJA 1P3PD 5AV5C 3X1SC 3MGRA 5B24A 4KUDD 3WTPD 4Z5TC 4XZQA 4J8UC 5CP6D 3MVDB 3AZFB 5GXQD 5B2IB 3B0DB 5AV8D 4G92B 1TZYA 3AZHD 3AZJD 2FJ7B 4ZUXC 4LD9C 5B1MB 5CPJB 3AZMC 3AV2D 5B0ZD 3X1VC 3MGQB 5B32D 3AZEC 2Y2MA 1H3OB 3VH6W 4Z66A 4KGCD 2Y2NA 2JCHA 3LJAC 3RELC 3KSYA 3KXBC 3MVDD 3AZLC 2AROA 2Y2PA 5B2ID 3REHD 1P3FA 3B6FA 5AVCC 3W98B 2F8NH 5AV5A 3O62D 1W2EA 5BNXB 2IO5B 4CSRA 3R45B 4Z5TA 5B1MD 5CPJD 4J8UA 4J8XC 4WNNA 1EQZC 2Y2JA 3AN2A 1KU5A 3UTAC 3W97C 2NZDA 4E44A 1TAFB 3C1CB 3MGQD 5BO0A 4HGAC 3B6GA 1P3AC 5DNNC 3NQUA 3WKJA 1S32C 2F8NA 3W99A 2BYMA 5AY8A 1T3UA 3TU4D 4ZBJC 3X1UB 1KX5D 5GSUC 3EPLA 5AV6A 4QLCC 1BH8A 3AYWB 3W98D 2NQBC 5CHLB 5DNMD 2RIQA 2DQNC 5B40A 1N1JA 2G5IC 3LZ1A 3LJAA 3REJD 2PYOB 3AZKC 5CPKB 3LZ0B 4YM6A 1AOIC 3VH6A 5B1LB 3C1CD 1P3IA 2J8PA 4KHAA 1P3LB 4E45A 1P3OA 3KUYC 4H9RA 3MNNC 3MGPB 4R8PB 1R4VA 4EO5B 3X1UD 3REKA 1P3MD 5B2JB 5B33D 5FUGA 1P3GB 1KX4B 5E5AC 1S32A 3KWQB 1P3BB 2XD5A 1P3KB 1F66A 2PYOD 5F99A 2ZY4A 5CPKD 5B31C 3LZ0D 4G91B 2FJ7C 4J8VD 4JJNC 3UTBC 4KUDA 1P3LD 3WTPA 4UUZB 4WU9B 5CP6A 3AZKA 1P34B 5AV8A 4X23B 3AZHA 3MGPD 1AOIA 3AZJA 4J8WB 5B2JD 3MGRC 5B24C 3AV2A 4H9QB 1P3GD 5AVBB 3MNNA 1KX4D 3AV1D 5B0ZA 4XZQC 3AL0C 1P3BD 5CPIB 1B67A 3F6TA 3UT9A 3X1TB 1P3KD 1TZYC 3H0RC 1P3PB 4NE5A 5B32A 5JRGB 2YFVA 5JA4B 1BFMA 2IO5C 2ZY5A 5GXQB 4WU9D 3MVDA 3AZGA 3AZFA 1B6WA 5B2IA 1P34D 5B31A 4X23D 2FJ7A 4J8WD 1M1AB 3V9RA 5CPJA 4Z66C 3VH6T 3RELD 3KXBD 1HTAA 4H9OB 2CV5B 3WAAB 5AVCD 2AROC 1P3FC 3X1TD 3MGQA 3B6FC 5G49B 2RVQC 5JRGD 4NE6A 4KGCB 1M18B 1ID3B 1H3OA 2VQRA 4AWLB 4YS3C 3LELB 3REHB 3REIB 3AZIB 3AN2C 2NZDC 3O62B 4XUJC 3W98A 5B0YB 3B6GC 1M1AD 3WKJC 3R45A 3AZNC 3W99C 4DRAA 3A6NB 2UWXA 5AY8C 1U35B 2CV5D 3WAAD 1TAFA 4WZSB 5AV6C 3C1CA 4EO5C 2NQBD 3EPHA 2JE5A 3WA9B 5BNVB 1KX3C 1M18D 5B40C 1ID3D 4DQYB 3LZ1C 3TU4B 1KX5B 5GT3B 3KWQC 3LELD 3AZID 3REID 3X1UA 2Y2LA 4YM6C 5DNMB 3WTPE 1P3IC 5AV9B 3AYWA 5B0YD 3H0LC 3REJB 3C1BB 1P3OC 5C3IC 4YS3A 1ZLAC 4WU8B 2Y2QA 2PYOA 3A6ND 2BYKB 2HIOB 4XUJA 3LZ0A 3AZGB 5CPKA 1U35D 5B1LA 3REKC 1P3LA 5E5AD 3WA9D 3AZNA 1Z2CB 5AVBC 5GT3D 5GT0B 4R8PA 1F66C 4NE3A 5F99C 1P3MB 1ULYA 5B33B 5BT1D 3AFAD 1P3PC 4KUDC 5AV9D 1KX3A 3WTPC 1P3GA 1KX4A 3EG5B 3C1BD 5CP6C 3KWQA 1P3BA 4WU8D 5AV8C 1P3KA 3AZHC 1HQ3D 3MGSB 3AZJC 4J8VB 2HIOD 3AZGD 3W96D 2F2AC 2HUEC 1M19B 3AV2C 4UUZA 1ZLAA 4XZQD 4WU9A 5B0ZC 2XD1A 3UT9C 5BS7A 2YFWA 5GT0D 2L5AA 2G5HC 3X1SB 4J8WA 5B32C 4J8UB 3AV1B 4H9QA 5AVBA 1Q9CA 3AZFC 3MVDC 5CPIA 5B2IC 3X1TA 3B0DC 1JFIB 4G92C 4ZUXB 4LD9B 1P3PA 4CAYB 3MGSD 3AZMB 2F8NG 5JRGA 1BH9B 5JA4A 2F8NB 1M19D 5B1MC 2BYMB 3X1VB 5CPJC 5GXQA 1P3FD 3AZEB 3MGQC 5AV5D 3X1SD 1M1AA 3LJAB 4Z5TD 4J8UD 3RELB 3KXBB 3AZLB 2Y2GA 5AVCB 4H9OA 4H9SA 2CV5A 1KX5C 3WAAA 4M6BA 4UPKA 2Y2OA 4H9PB 4H9NB 5G49A 4ZUXD 3W98C 4LD9D 4J8XB 3AZMD 1EQZB 3WKJD 4KGCA 1M18A 3UTAB 3W97B 2F8ND 3REJC 3X1VD 5AY8D 3LELA 3REHA 3IP4C 4HGAB 5AV6D 1P3AB 5DNNB 3O62A 3C1CC 3AZED 5B0YA 5B1MA 3LJAD 3LZ1D 4ZBJB 5GSUB 3AZLD 2F8NK 3FDDA 4QLCB 1U35A 3X1UC 2NQBB 1P3ID 3AYWC 4J8XD 1P3OD 1EQZD 3WA9A 5BNVA 3UTAD 3W97D 3TU4A 1KX5A 2PYOC 5CPKC 3LZ0C 1P3AD 5DNND 5DNMA 5B1LC 5BNXA 5AV9A 3KUYB 1P3LC 1S32D 3REJA 3C1BA 5GSUD 4WU8A 3MGPC 4R8PC 2BYKA 4QLCD 2HIOA 5E5AB 4Z2MG 3VH5W 5B2JC 1WWSA 5KDMB 5B31G 1P3GC 1KX4C 3AZKD 1F1EA 3AV1C 1P3BC 2FFFB 5B31B 1AOID 5GT0A 1P3KC 4JJNB 3UTBB 3AFAB 1P3MA 2LY8A 3V9RB 3A1KA 5B33A 4G91C 3KUYD 3MNND 3UT9D 4WU9C 1HQ3B 2Y2IA 1P34C 5BS7C 3NQJB 4X23C 3W96B 3MGSA 3MGRB 5B24B 4J8VA 4J8WC 4XZQB 1M19A 2DF4C 2Y2HA 3AZFD 1TZYB 3MGPA 1WWIA 3EPKA 5CPIC 5B31D 3X1TC 2FJ7D 3X1SA 4JJND 3UTBD 5B2JA 5JRGC 3AV1A 5GXQC 4WJ3C 3VH5A 3B0BA 1JFIA 3A1IA 4ZUXA 3EPJA 4LD9A 4CAYA 4Z66B 5B24D 3MGRD 3AZMA 1M1AC 1BH9A 3X1VA 2AROB 1P3FB 3B6FB 1TZYD 1P34A 4X23A 2CV5C 4H9SC 5AV5B 2ZY3A 3WAAC 3AZEA 4CSRB 4Z5TB 4WNNB 4YS3B 3AN2B 4KGCC 1M18C 2JSSA 3RELA 3KXBA 1ID3C 3AZLA 2NZDB 2Y2KA 4AWLC 4XUJB 5AVCA 5BO0B 3LELC 3REHC 3REIC 3AZIC 3B6GB 2BG1A 3O62C 3NQUB 4H9PA 3WKJB 4H9NA 5B0YC 4Z66D 4J8XA 3AZNB 1EQZA 3W99B 5AY8B 3UTAA 3W97A 2AROD 5AV6B 3B6FD 3A6NC 1BH8B 1U35C 1P3AA 2RVQD 5DNNA 1KX3B 3AYWD 5B40B 1N1JB 3LZ1B 3H0MC 3WA9C 4YS3D 3AN2D 3B0CT 5GSUA 2NZDD 4YM6B 3TU4C 3P5JB 5GT3C 4XUJD 1P3IB 4QLCA 4KHAB 4WV4B 2NQBA 5B1LD 3B6GD 5BT1C 3AFAC 1P3OB 5DNMC 5C3IB 5AV9C 1ZLAB 4H9RB 3AZND 1ID3A 3W99D 1A7WA 3C1BC 3KFUG 2YFWB 3AZIA 4R8PD 3REIA 4WU8C 2ZM5A 3REKB 1HQ3C 2HIOC 4Z2MH 3W96C 5FUGB 3AZGC 2W8SA 1S32B 1KX3D 5B40D 3KUYA 3VH5T 3KWQD 1F66B 5F99B 3A6NA 4NFTA 4YM6D 5GT0C 4KUDB 1P3MC 3WTPB 5E5AA 5B33C 5CP6B 3AZKB 3B0CW 1ZLAD 5KDMA 5AV8B 3AZHB 4DRBA 1AOIB 5GT3A 3AZJB 2CWEA 2HUEB 3REKD 4JJNA 3UTBA 3AFAA 3MGSC 4J8VC 3AV2B 3MNNB 5B0ZB 1M19C 1PZRA 3UT9B 5AVBD 5B32G 1F66D 5CPID 5F99D 1HQ3A 2ZY2A 5B32B 3W96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFV B;  3NQJ A;  1P3P D;  5AV5 C;  3X1S C;  3MGR A;  5B24 A;  4KUD D;  3WTP D;  4Z5T C;  4XZQ A;  4J8U C;  5CP6 D;  3MVD B;  3AZF B;  5GXQ D;  5B2I B;  3B0D B;  5AV8 D;  4G92 B;  1TZY A;  3AZH D;  3AZJ D;  2FJ7 B;  4ZUX C;  4LD9 C;  5B1M B;  5CPJ B;  3AZM C;  3AV2 D;  5B0Z D;  3X1V C;  3MGQ B;  5B32 D;  3AZE C;  1H3O B;  3VH6 W;  4Z66 A;  4KGC D;  3LJA C;  3REL C;  3KSY A;  3KXB C;  3MVD D;  3AZL C;  2ARO A;  5B2I D;  3REH D;  1P3F A;  3B6F A;  5AVC C;  3W98 B;  2F8N H;  5AV5 A;  3O62 D;  5BNX B;  2IO5 B;  4CSR A;  3R45 B;  4Z5T A;  5B1M D;  5CPJ D;  4J8U A;  4J8X C;  4WNN A;  1EQZ C;  3AN2 A;  1KU5 A;  3UTA C;  3W97 C;  2NZD A;  4E44 A;  1TAF B;  3C1C B;  3MGQ D;  5BO0 A;  4HGA C;  3B6G A;  1P3A C;  5DNN C;  3NQU A;  3WKJ A;  1S32 C;  2F8N A;  3W99 A;  2BYM A;  5AY8 A;  3TU4 D;  4ZBJ C;  3X1U B;  1KX5 D;  5GSU C;  5AV6 A;  4QLC C;  1BH8 A;  3AYW B;  3W98 D;  2NQB C;  5CHL B;  5DNM D;  5B40 A;  1N1J A;  3LJA A;  3LZ1 A;  3REJ D;  2PYO B;  3AZK C;  5CPK B;  3LZ0 B;  4YM6 A;  1AOI C;  3VH6 A;  5B1L B;  3C1C D;  1P3I A;  1P3L B;  4KHA A;  4E45 A;  1P3O A;  3KUY C;  4H9R A;  3MNN C;  3MGP B;  4R8P B;  1R4V A;  4EO5 B;  3X1U D;  3REK A;  1P3M D;  5B2J B;  5B33 D;  5FUG A;  1P3G B;  1KX4 B;  5E5A C;  1S32 A;  3KWQ B;  1P3B B;  1P3K B;  1F66 A;  2PYO D;  5F99 A;  5CPK D;  5B31 C;  3LZ0 D;  4G91 B;  2FJ7 C;  4J8V D;  4JJN C;  3UTB C;  4KUD A;  1P3L D;  3WTP A;  4UUZ B;  4WU9 B;  5CP6 A;  3AZK A;  1P34 B;  5AV8 A;  4X23 B;  3AZH A;  3MGP D;  1AOI A;  3AZJ A;  4J8W B;  5B2J D;  3MGR C;  5B24 C;  3AV2 A;  4H9Q B;  1P3G D;  5AVB B;  3MNN A;  1KX4 D;  3AV1 D;  5B0Z A;  4XZQ C;  1P3B D;  5CPI B;  1B67 A;  3UT9 A;  3X1T B;  1P3K D;  1TZY C;  1P3P B;  4NE5 A;  5B32 A;  5JRG B;  2YFV A;  5JA4 B;  1BFM A;  2IO5 C;  5GXQ B;  4WU9 D;  3MVD A;  3AZG A;  3AZF A;  1B6W A;  5B2I A;  1P34 D;  5B31 A;  4X23 D;  2FJ7 A;  4J8W D;  1M1A B;  3V9R A;  5CPJ A;  4Z66 C;  3VH6 T;  3REL D;  3KXB D;  1HTA A;  4H9O B;  2CV5 B;  3WAA B;  5AVC D;  2ARO C;  1P3F C;  3X1T D;  3MGQ A;  3B6F C;  5G49 B;  2RVQ C;  5JRG D;  4NE6 A;  4KGC B;  1M18 B;  1ID3 B;  1H3O A;  4AWL B;  4YS3 C;  3LEL B;  3REH B;  3REI B;  3AZI B;  3AN2 C;  2NZD C;  3O62 B;  4XUJ C;  3W98 A;  5B0Y B;  3B6G C;  1M1A D;  3WKJ C;  3R45 A;  3AZN C;  3W99 C;  4DRA A;  3A6N B;  5AY8 C;  1U35 B;  2CV5 D;  3WAA D;  1TAF A;  4WZS B;  5AV6 C;  3C1C A;  4EO5 C;  2NQB D;  3WA9 B;  5BNV B;  1KX3 C;  1M18 D;  5B40 C;  1ID3 D;  3LZ1 C;  3TU4 B;  1KX5 B;  5GT3 B;  3KWQ C;  3LEL D;  3AZI D;  3REI D;  3X1U A;  4YM6 C;  5DNM B;  3WTP E;  1P3I C;  5AV9 B;  3AYW A;  5B0Y D;  3REJ B;  3C1B B;  1P3O C;  5C3I C;  4YS3 A;  1ZLA C;  4WU8 B;  2PYO A;  3A6N D;  2BYK B;  2HIO B;  4XUJ A;  3LZ0 A;  3AZG B;  5CPK A;  1U35 D;  5B1L A;  3REK C;  1P3L A;  5E5A D;  3WA9 D;  3AZN A;  5AVB C;  5GT3 D;  5GT0 B;  4R8P A;  1F66 C;  4NE3 A;  5F99 C;  1P3M B;  1ULY A;  5B33 B;  5BT1 D;  3AFA D;  1P3P C;  4KUD C;  5AV9 D;  1KX3 A;  3WTP C;  1P3G A;  1KX4 A;  3C1B D;  5CP6 C;  3KWQ A;  1P3B A;  4WU8 D;  5AV8 C;  1P3K A;  3AZH C;  1HQ3 D;  3MGS B;  3AZJ C;  4J8V B;  2HIO D;  3AZG D;  3W96 D;  2HUE C;  1M19 B;  3AV2 C;  4UUZ A;  1ZLA A;  4XZQ D;  4WU9 A;  5B0Z C;  3UT9 C;  5BS7 A;  2YFW A;  5GT0 D;  2L5A A;  3X1S B;  4J8W A;  5B32 C;  4J8U B;  3AV1 B;  4H9Q A;  5AVB A;  1Q9C A;  3AZF C;  3MVD C;  5CPI A;  5B2I C;  3X1T A;  3B0D C;  1JFI B;  4G92 C;  4ZUX B;  4LD9 B;  1P3P A;  4CAY B;  3MGS D;  3AZM B;  2F8N G;  5JRG A;  1BH9 B;  5JA4 A;  2F8N B;  1M19 D;  5B1M C;  2BYM B;  3X1V B;  5CPJ C;  5GXQ A;  1P3F D;  3AZE B;  3MGQ C;  5AV5 D;  3X1S D;  1M1A A;  3LJA B;  4Z5T D;  4J8U D;  3REL B;  3KXB B;  3AZL B;  5AVC B;  4H9O A;  4H9S A;  2CV5 A;  1KX5 C;  3WAA A;  4M6B A;  4H9P B;  4H9N B;  5G49 A;  4ZUX D;  3W98 C;  4LD9 D;  4J8X B;  3AZM D;  1EQZ B;  3WKJ D;  4KGC A;  1M18 A;  3UTA B;  3W97 B;  2F8N D;  3REJ C;  3X1V D;  5AY8 D;  3LEL A;  3REH A;  4HGA B;  5AV6 D;  1P3A B;  5DNN B;  3O62 A;  3C1C C;  3AZE D;  5B0Y A;  5B1M A;  3LJA D;  3LZ1 D;  4ZBJ B;  5GSU B;  3AZL D;  2F8N K;  4QLC B;  1U35 A;  3X1U C;  2NQB B;  1P3I D;  3AYW C;  4J8X D;  1P3O D;  1EQZ D;  3WA9 A;  5BNV A;  3UTA D;  3W97 D;  3TU4 A;  1KX5 A;  2PYO C;  5CPK C;  3LZ0 C;  1P3A D;  5DNN D;  5DNM A;  5B1L C;  5BNX A;  5AV9 A;  3KUY B;  1P3L C;  1S32 D;  3REJ A;  3C1B A;  5GSU D;  4WU8 A;  3MGP C;  4R8P C;  2BYK A;  4QLC D;  2HIO A;  5E5A B;  4Z2M G;  3VH5 W;  5B2J C;  1WWS A;  5KDM B;  5B31 G;  1P3G C;  1KX4 C;  3AZK D;  1F1E A;  3AV1 C;  1P3B C;  5B31 B;  1AOI D;  5GT0 A;  1P3K C;  4JJN B;  3UTB B;  3AFA B;  1P3M A;  2LY8 A;  3V9R B;  5B33 A;  4G91 C;  3KUY D;  3MNN D;  3UT9 D;  4WU9 C;  1HQ3 B;  1P34 C;  5BS7 C;  3NQJ B;  4X23 C;  3W96 B;  3MGS A;  3MGR B;  5B24 B;  4J8V A;  4J8W C;  4XZQ B;  1M19 A;  3AZF D;  1TZY B;  3MGP A;  1WWI A;  5CPI C;  5B31 D;  3X1T C;  2FJ7 D;  3X1S A;  4JJN D;  3UTB D;  5B2J A;  5JRG C;  3AV1 A;  5GXQ C;  3VH5 A;  3B0B A;  1JFI A;  4ZUX A;  4LD9 A;  4CAY A;  4Z66 B;  5B24 D;  3MGR D;  3AZM A;  1M1A C;  1BH9 A;  3X1V A;  2ARO B;  1P3F B;  3B6F B;  1TZY D;  1P34 A;  4X23 A;  2CV5 C;  4H9S C;  5AV5 B;  3WAA C;  3AZE A;  4CSR B;  4Z5T B;  4WNN B;  4YS3 B;  3AN2 B;  4KGC C;  1M18 C;  2JSS A;  3REL A;  3KXB A;  1ID3 C;  3AZL A;  2NZD B;  4AWL C;  4XUJ B;  5AVC A;  5BO0 B;  3LEL C;  3REH C;  3REI C;  3AZI C;  3B6G B;  3O62 C;  3NQU B;  4H9P A;  3WKJ B;  4H9N A;  5B0Y C;  4Z66 D;  4J8X A;  3AZN B;  1EQZ A;  3W99 B;  5AY8 B;  3UTA A;  3W97 A;  2ARO D;  5AV6 B;  3B6F D;  3A6N C;  1BH8 B;  1U35 C;  1P3A A;  2RVQ D;  5DNN A;  1KX3 B;  3AYW D;  5B40 B;  1N1J B;  3LZ1 B;  3WA9 C;  4YS3 D;  3AN2 D;  3B0C T;  5GSU A;  2NZD D;  4YM6 B;  3TU4 C;  5GT3 C;  4XUJ D;  1P3I B;  4QLC A;  4KHA B;  4WV4 B;  2NQB A;  5B1L D;  3B6G D;  5BT1 C;  3AFA C;  1P3O B;  5DNM C;  5C3I B;  5AV9 C;  1ZLA B;  4H9R B;  3AZN D;  1ID3 A;  3W99 D;  1A7W A;  3C1B C;  2YFW B;  3AZI A;  4R8P D;  3REI A;  4WU8 C;  3REK B;  1HQ3 C;  2HIO C;  4Z2M H;  3W96 C;  5FUG B;  3AZG C;  1S32 B;  1KX3 D;  5B40 D;  3KUY A;  3VH5 T;  3KWQ D;  1F66 B;  5F99 B;  3A6N A;  4NFT A;  4YM6 D;  5GT0 C;  4KUD B;  1P3M C;  3WTP B;  5E5A A;  5B33 C;  5CP6 B;  3AZK B;  3B0C W;  1ZLA D;  5KDM A;  5AV8 B;  3AZH B;  4DRB A;  1AOI B;  5GT3 A;  3AZJ B;  2CWE A;  2HUE B;  3REK D;  4JJN A;  3UTB A;  3AFA A;  3MGS C;  4J8V C;  3AV2 B;  3MNN B;  5B0Z B;  1M19 C;  3UT9 B;  5AVB D;  5B32 G;  1F66 D;  5CPI D;  5F99 D;  1HQ3 A;  5B32 B;  3W96 A; 
#chains in the Genus database with same CATH topology
 2YFV B;  3NQJ A;  1P3P D;  5AV5 C;  3X1S C;  3MGR A;  5B24 A;  4KUD D;  3WTP D;  4Z5T C;  4XZQ A;  4J8U C;  5CP6 D;  3MVD B;  3AZF B;  5GXQ D;  5B2I B;  3B0D B;  5AV8 D;  4G92 B;  1TZY A;  3AZH D;  3AZJ D;  2FJ7 B;  4ZUX C;  4LD9 C;  5B1M B;  5CPJ B;  3AZM C;  3AV2 D;  5B0Z D;  3X1V C;  3MGQ B;  5B32 D;  3AZE C;  2Y2M A;  1H3O B;  3VH6 W;  4Z66 A;  4KGC D;  2Y2N A;  2JCH A;  3LJA C;  3REL C;  3KSY A;  3KXB C;  3MVD D;  3AZL C;  2ARO A;  2Y2P A;  5B2I D;  3REH D;  1P3F A;  3B6F A;  5AVC C;  3W98 B;  2F8N H;  5AV5 A;  3O62 D;  1W2E A;  5BNX B;  2IO5 B;  4CSR A;  3R45 B;  4Z5T A;  5B1M D;  5CPJ D;  4J8U A;  4J8X C;  4WNN A;  1EQZ C;  2Y2J A;  3AN2 A;  1KU5 A;  3UTA C;  3W97 C;  2NZD A;  4E44 A;  1TAF B;  3C1C B;  3MGQ D;  5BO0 A;  4HGA C;  3B6G A;  1P3A C;  5DNN C;  3NQU A;  3WKJ A;  1S32 C;  2F8N A;  3W99 A;  2BYM A;  5AY8 A;  1T3U A;  3TU4 D;  4ZBJ C;  3X1U B;  1KX5 D;  5GSU C;  3EPL A;  5AV6 A;  4QLC C;  1BH8 A;  3AYW B;  3W98 D;  2NQB C;  5CHL B;  5DNM D;  2RIQ A;  2DQN C;  5B40 A;  1N1J A;  2G5I C;  3LZ1 A;  3LJA A;  3REJ D;  2PYO B;  3AZK C;  5CPK B;  3LZ0 B;  4YM6 A;  1AOI C;  3VH6 A;  5B1L B;  3C1C D;  1P3I A;  2J8P A;  4KHA A;  1P3L B;  4E45 A;  1P3O A;  3KUY C;  4H9R A;  3MNN C;  3MGP B;  4R8P B;  1R4V A;  4EO5 B;  3X1U D;  3REK A;  1P3M D;  5B2J B;  5B33 D;  5FUG A;  1P3G B;  1KX4 B;  5E5A C;  1S32 A;  3KWQ B;  1P3B B;  2XD5 A;  1P3K B;  1F66 A;  2PYO D;  5F99 A;  2ZY4 A;  5CPK D;  5B31 C;  3LZ0 D;  4G91 B;  2FJ7 C;  4J8V D;  4JJN C;  3UTB C;  4KUD A;  1P3L D;  3WTP A;  4UUZ B;  4WU9 B;  5CP6 A;  3AZK A;  1P34 B;  5AV8 A;  4X23 B;  3AZH A;  3MGP D;  1AOI A;  3AZJ A;  4J8W B;  5B2J D;  3MGR C;  5B24 C;  3AV2 A;  4H9Q B;  1P3G D;  5AVB B;  3MNN A;  1KX4 D;  3AV1 D;  5B0Z A;  4XZQ C;  3AL0 C;  1P3B D;  5CPI B;  1B67 A;  3F6T A;  3UT9 A;  3X1T B;  1P3K D;  1TZY C;  3H0R C;  1P3P B;  4NE5 A;  5B32 A;  5JRG B;  2YFV A;  5JA4 B;  1BFM A;  2IO5 C;  2ZY5 A;  5GXQ B;  4WU9 D;  3MVD A;  3AZG A;  3AZF A;  1B6W A;  5B2I A;  1P34 D;  5B31 A;  4X23 D;  2FJ7 A;  4J8W D;  1M1A B;  3V9R A;  5CPJ A;  4Z66 C;  3VH6 T;  3REL D;  3KXB D;  1HTA A;  4H9O B;  2CV5 B;  3WAA B;  5AVC D;  2ARO C;  1P3F C;  3X1T D;  3MGQ A;  3B6F C;  5G49 B;  2RVQ C;  5JRG D;  4NE6 A;  4KGC B;  1M18 B;  1ID3 B;  1H3O A;  2VQR A;  4AWL B;  4YS3 C;  3LEL B;  3REH B;  3REI B;  3AZI B;  3AN2 C;  2NZD C;  3O62 B;  4XUJ C;  3W98 A;  5B0Y B;  3B6G C;  1M1A D;  3WKJ C;  3R45 A;  3AZN C;  3W99 C;  4DRA A;  3A6N B;  2UWX A;  5AY8 C;  1U35 B;  2CV5 D;  3WAA D;  1TAF A;  4WZS B;  5AV6 C;  3C1C A;  4EO5 C;  2NQB D;  3EPH A;  2JE5 A;  3WA9 B;  5BNV B;  1KX3 C;  1M18 D;  5B40 C;  1ID3 D;  4DQY B;  3LZ1 C;  3TU4 B;  1KX5 B;  5GT3 B;  3KWQ C;  3LEL D;  3AZI D;  3REI D;  3X1U A;  2Y2L A;  4YM6 C;  5DNM B;  3WTP E;  1P3I C;  5AV9 B;  3AYW A;  5B0Y D;  3H0L C;  3REJ B;  3C1B B;  1P3O C;  5C3I C;  4YS3 A;  1ZLA C;  4WU8 B;  2Y2Q A;  2PYO A;  3A6N D;  2BYK B;  2HIO B;  4XUJ A;  3LZ0 A;  3AZG B;  5CPK A;  1U35 D;  5B1L A;  3REK C;  1P3L A;  5E5A D;  3WA9 D;  3AZN A;  1Z2C B;  5AVB C;  5GT3 D;  5GT0 B;  4R8P A;  1F66 C;  4NE3 A;  5F99 C;  1P3M B;  1ULY A;  5B33 B;  5BT1 D;  3AFA D;  1P3P C;  4KUD C;  5AV9 D;  1KX3 A;  3WTP C;  1P3G A;  1KX4 A;  3EG5 B;  3C1B D;  5CP6 C;  3KWQ A;  1P3B A;  4WU8 D;  5AV8 C;  1P3K A;  3AZH C;  1HQ3 D;  3MGS B;  3AZJ C;  4J8V B;  2HIO D;  3AZG D;  3W96 D;  2F2A C;  2HUE C;  1M19 B;  3AV2 C;  4UUZ A;  1ZLA A;  4XZQ D;  4WU9 A;  5B0Z C;  2XD1 A;  3UT9 C;  5BS7 A;  2YFW A;  5GT0 D;  2L5A A;  2G5H C;  3X1S B;  4J8W A;  5B32 C;  4J8U B;  3AV1 B;  4H9Q A;  5AVB A;  1Q9C A;  3AZF C;  3MVD C;  5CPI A;  5B2I C;  3X1T A;  3B0D C;  1JFI B;  4G92 C;  4ZUX B;  4LD9 B;  1P3P A;  4CAY B;  3MGS D;  3AZM B;  2F8N G;  5JRG A;  1BH9 B;  5JA4 A;  2F8N B;  1M19 D;  5B1M C;  2BYM B;  3X1V B;  5CPJ C;  5GXQ A;  1P3F D;  3AZE B;  3MGQ C;  5AV5 D;  3X1S D;  1M1A A;  3LJA B;  4Z5T D;  4J8U D;  3REL B;  3KXB B;  3AZL B;  2Y2G A;  5AVC B;  4H9O A;  4H9S A;  2CV5 A;  1KX5 C;  3WAA A;  4M6B A;  4UPK A;  2Y2O A;  4H9P B;  4H9N B;  5G49 A;  4ZUX D;  3W98 C;  4LD9 D;  4J8X B;  3AZM D;  1EQZ B;  3WKJ D;  4KGC A;  1M18 A;  3UTA B;  3W97 B;  2F8N D;  3REJ C;  3X1V D;  5AY8 D;  3LEL A;  3REH A;  3IP4 C;  4HGA B;  5AV6 D;  1P3A B;  5DNN B;  3O62 A;  3C1C C;  3AZE D;  5B0Y A;  5B1M A;  3LJA D;  3LZ1 D;  4ZBJ B;  5GSU B;  3AZL D;  2F8N K;  3FDD A;  4QLC B;  1U35 A;  3X1U C;  2NQB B;  1P3I D;  3AYW C;  4J8X D;  1P3O D;  1EQZ D;  3WA9 A;  5BNV A;  3UTA D;  3W97 D;  3TU4 A;  1KX5 A;  2PYO C;  5CPK C;  3LZ0 C;  1P3A D;  5DNN D;  5DNM A;  5B1L C;  5BNX A;  5AV9 A;  3KUY B;  1P3L C;  1S32 D;  3REJ A;  3C1B A;  5GSU D;  4WU8 A;  3MGP C;  4R8P C;  2BYK A;  4QLC D;  2HIO A;  5E5A B;  4Z2M G;  3VH5 W;  5B2J C;  1WWS A;  5KDM B;  5B31 G;  1P3G C;  1KX4 C;  3AZK D;  1F1E A;  3AV1 C;  1P3B C;  2FFF B;  5B31 B;  1AOI D;  5GT0 A;  1P3K C;  4JJN B;  3UTB B;  3AFA B;  1P3M A;  2LY8 A;  3V9R B;  3A1K A;  5B33 A;  4G91 C;  3KUY D;  3MNN D;  3UT9 D;  4WU9 C;  1HQ3 B;  2Y2I A;  1P34 C;  5BS7 C;  3NQJ B;  4X23 C;  3W96 B;  3MGS A;  3MGR B;  5B24 B;  4J8V A;  4J8W C;  4XZQ B;  1M19 A;  2DF4 C;  2Y2H A;  3AZF D;  1TZY B;  3MGP A;  1WWI A;  3EPK A;  5CPI C;  5B31 D;  3X1T C;  2FJ7 D;  3X1S A;  4JJN D;  3UTB D;  5B2J A;  5JRG C;  3AV1 A;  5GXQ C;  4WJ3 C;  3VH5 A;  3B0B A;  1JFI A;  3A1I A;  4ZUX A;  3EPJ A;  4LD9 A;  4CAY A;  4Z66 B;  5B24 D;  3MGR D;  3AZM A;  1M1A C;  1BH9 A;  3X1V A;  2ARO B;  1P3F B;  3B6F B;  1TZY D;  1P34 A;  4X23 A;  2CV5 C;  4H9S C;  5AV5 B;  2ZY3 A;  3WAA C;  3AZE A;  4CSR B;  4Z5T B;  4WNN B;  4YS3 B;  3AN2 B;  4KGC C;  1M18 C;  2JSS A;  3REL A;  3KXB A;  1ID3 C;  3AZL A;  2NZD B;  2Y2K A;  4AWL C;  4XUJ B;  5AVC A;  5BO0 B;  3LEL C;  3REH C;  3REI C;  3AZI C;  3B6G B;  2BG1 A;  3O62 C;  3NQU B;  4H9P A;  3WKJ B;  4H9N A;  5B0Y C;  4Z66 D;  4J8X A;  3AZN B;  1EQZ A;  3W99 B;  5AY8 B;  3UTA A;  3W97 A;  2ARO D;  5AV6 B;  3B6F D;  3A6N C;  1BH8 B;  1U35 C;  1P3A A;  2RVQ D;  5DNN A;  1KX3 B;  3AYW D;  5B40 B;  1N1J B;  3LZ1 B;  3H0M C;  3WA9 C;  4YS3 D;  3AN2 D;  3B0C T;  5GSU A;  2NZD D;  4YM6 B;  3TU4 C;  3P5J B;  5GT3 C;  4XUJ D;  1P3I B;  4QLC A;  4KHA B;  4WV4 B;  2NQB A;  5B1L D;  3B6G D;  5BT1 C;  3AFA C;  1P3O B;  5DNM C;  5C3I B;  5AV9 C;  1ZLA B;  4H9R B;  3AZN D;  1ID3 A;  3W99 D;  1A7W A;  3C1B C;  3KFU G;  2YFW B;  3AZI A;  4R8P D;  3REI A;  4WU8 C;  2ZM5 A;  3REK B;  1HQ3 C;  2HIO C;  4Z2M H;  3W96 C;  5FUG B;  3AZG C;  2W8S A;  1S32 B;  1KX3 D;  5B40 D;  3KUY A;  3VH5 T;  3KWQ D;  1F66 B;  5F99 B;  3A6N A;  4NFT A;  4YM6 D;  5GT0 C;  4KUD B;  1P3M C;  3WTP B;  5E5A A;  5B33 C;  5CP6 B;  3AZK B;  3B0C W;  1ZLA D;  5KDM A;  5AV8 B;  3AZH B;  4DRB A;  1AOI B;  5GT3 A;  3AZJ B;  2CWE A;  2HUE B;  3REK D;  4JJN A;  3UTB A;  3AFA A;  3MGS C;  4J8V C;  3AV2 B;  3MNN B;  5B0Z B;  1M19 C;  1PZR A;  3UT9 B;  5AVB D;  5B32 G;  1F66 D;  5CPI D;  5F99 D;  1HQ3 A;  2ZY2 A;  5B32 B;  3W96 A; 
#chains in the Genus database with same CATH homology
 2YFV B;  3NQJ A;  1P3P D;  5AV5 C;  3X1S C;  3MGR A;  5B24 A;  4KUD D;  3WTP D;  4Z5T C;  4XZQ A;  4J8U C;  5CP6 D;  3MVD B;  3AZF B;  5GXQ D;  5B2I B;  3B0D B;  5AV8 D;  4G92 B;  1TZY A;  3AZH D;  3AZJ D;  2FJ7 B;  4ZUX C;  4LD9 C;  5B1M B;  5CPJ B;  3AZM C;  3AV2 D;  5B0Z D;  3X1V C;  3MGQ B;  5B32 D;  3AZE C;  2Y2M A;  1H3O B;  3VH6 W;  4Z66 A;  4KGC D;  2Y2N A;  2JCH A;  3LJA C;  3REL C;  3KSY A;  3KXB C;  3MVD D;  3AZL C;  2ARO A;  2Y2P A;  5B2I D;  3REH D;  1P3F A;  3B6F A;  5AVC C;  3W98 B;  2F8N H;  5AV5 A;  3O62 D;  1W2E A;  5BNX B;  2IO5 B;  4CSR A;  3R45 B;  4Z5T A;  5B1M D;  5CPJ D;  4J8U A;  4J8X C;  4WNN A;  1EQZ C;  2Y2J A;  3AN2 A;  1KU5 A;  3UTA C;  3W97 C;  2NZD A;  4E44 A;  1TAF B;  3C1C B;  3MGQ D;  5BO0 A;  4HGA C;  3B6G A;  1P3A C;  5DNN C;  3NQU A;  3WKJ A;  1S32 C;  2F8N A;  3W99 A;  2BYM A;  5AY8 A;  1T3U A;  3TU4 D;  4ZBJ C;  3X1U B;  1KX5 D;  5GSU C;  3EPL A;  5AV6 A;  4QLC C;  1BH8 A;  3AYW B;  3W98 D;  2NQB C;  5CHL B;  5DNM D;  2RIQ A;  2DQN C;  5B40 A;  1N1J A;  2G5I C;  3LZ1 A;  3LJA A;  3REJ D;  2PYO B;  3AZK C;  5CPK B;  3LZ0 B;  4YM6 A;  1AOI C;  3VH6 A;  5B1L B;  3C1C D;  1P3I A;  2J8P A;  4KHA A;  1P3L B;  4E45 A;  1P3O A;  3KUY C;  4H9R A;  3MNN C;  3MGP B;  4R8P B;  1R4V A;  4EO5 B;  3X1U D;  3REK A;  1P3M D;  5B2J B;  5B33 D;  5FUG A;  1P3G B;  1KX4 B;  5E5A C;  1S32 A;  3KWQ B;  1P3B B;  2XD5 A;  1P3K B;  1F66 A;  2PYO D;  5F99 A;  2ZY4 A;  5CPK D;  5B31 C;  3LZ0 D;  4G91 B;  2FJ7 C;  4J8V D;  4JJN C;  3UTB C;  4KUD A;  1P3L D;  3WTP A;  4UUZ B;  4WU9 B;  5CP6 A;  3AZK A;  1P34 B;  5AV8 A;  4X23 B;  3AZH A;  3MGP D;  1AOI A;  3AZJ A;  4J8W B;  5B2J D;  3MGR C;  5B24 C;  3AV2 A;  4H9Q B;  1P3G D;  5AVB B;  3MNN A;  1KX4 D;  3AV1 D;  5B0Z A;  4XZQ C;  3AL0 C;  1P3B D;  5CPI B;  1B67 A;  3F6T A;  3UT9 A;  3X1T B;  1P3K D;  1TZY C;  3H0R C;  1P3P B;  4NE5 A;  5B32 A;  5JRG B;  2YFV A;  5JA4 B;  1BFM A;  2IO5 C;  2ZY5 A;  5GXQ B;  4WU9 D;  3MVD A;  3AZG A;  3AZF A;  1B6W A;  5B2I A;  1P34 D;  5B31 A;  4X23 D;  2FJ7 A;  4J8W D;  1M1A B;  3V9R A;  5CPJ A;  4Z66 C;  3VH6 T;  3REL D;  3KXB D;  1HTA A;  4H9O B;  2CV5 B;  3WAA B;  5AVC D;  2ARO C;  1P3F C;  3X1T D;  3MGQ A;  3B6F C;  5G49 B;  2RVQ C;  5JRG D;  4NE6 A;  4KGC B;  1M18 B;  1ID3 B;  1H3O A;  2VQR A;  4AWL B;  4YS3 C;  3LEL B;  3REH B;  3REI B;  3AZI B;  3AN2 C;  2NZD C;  3O62 B;  4XUJ C;  3W98 A;  5B0Y B;  3B6G C;  1M1A D;  3WKJ C;  3R45 A;  3AZN C;  3W99 C;  4DRA A;  3A6N B;  2UWX A;  5AY8 C;  1U35 B;  2CV5 D;  3WAA D;  1TAF A;  4WZS B;  5AV6 C;  3C1C A;  4EO5 C;  2NQB D;  3EPH A;  2JE5 A;  3WA9 B;  5BNV B;  1KX3 C;  1M18 D;  5B40 C;  1ID3 D;  4DQY B;  3LZ1 C;  3TU4 B;  1KX5 B;  5GT3 B;  3KWQ C;  3LEL D;  3AZI D;  3REI D;  3X1U A;  2Y2L A;  4YM6 C;  5DNM B;  3WTP E;  1P3I C;  5AV9 B;  3AYW A;  5B0Y D;  3H0L C;  3REJ B;  3C1B B;  1P3O C;  5C3I C;  4YS3 A;  1ZLA C;  4WU8 B;  2Y2Q A;  2PYO A;  3A6N D;  2BYK B;  2HIO B;  4XUJ A;  3LZ0 A;  3AZG B;  5CPK A;  1U35 D;  5B1L A;  3REK C;  1P3L A;  5E5A D;  3WA9 D;  3AZN A;  1Z2C B;  5AVB C;  5GT3 D;  5GT0 B;  4R8P A;  1F66 C;  4NE3 A;  5F99 C;  1P3M B;  1ULY A;  5B33 B;  5BT1 D;  3AFA D;  1P3P C;  4KUD C;  5AV9 D;  1KX3 A;  3WTP C;  1P3G A;  1KX4 A;  3EG5 B;  3C1B D;  5CP6 C;  3KWQ A;  1P3B A;  4WU8 D;  5AV8 C;  1P3K A;  3AZH C;  1HQ3 D;  3MGS B;  3AZJ C;  4J8V B;  2HIO D;  3AZG D;  3W96 D;  2F2A C;  2HUE C;  1M19 B;  3AV2 C;  4UUZ A;  1ZLA A;  4XZQ D;  4WU9 A;  5B0Z C;  2XD1 A;  3UT9 C;  5BS7 A;  2YFW A;  5GT0 D;  2L5A A;  2G5H C;  3X1S B;  4J8W A;  5B32 C;  4J8U B;  3AV1 B;  4H9Q A;  5AVB A;  1Q9C A;  3AZF C;  3MVD C;  5CPI A;  5B2I C;  3X1T A;  3B0D C;  1JFI B;  4G92 C;  4ZUX B;  4LD9 B;  1P3P A;  4CAY B;  3MGS D;  3AZM B;  2F8N G;  5JRG A;  1BH9 B;  5JA4 A;  2F8N B;  1M19 D;  5B1M C;  2BYM B;  3X1V B;  5CPJ C;  5GXQ A;  1P3F D;  3AZE B;  3MGQ C;  5AV5 D;  3X1S D;  1M1A A;  3LJA B;  4Z5T D;  4J8U D;  3REL B;  3KXB B;  3AZL B;  2Y2G A;  5AVC B;  4H9O A;  4H9S A;  2CV5 A;  1KX5 C;  3WAA A;  4M6B A;  4UPK A;  2Y2O A;  4H9P B;  4H9N B;  5G49 A;  4ZUX D;  3W98 C;  4LD9 D;  4J8X B;  3AZM D;  1EQZ B;  3WKJ D;  4KGC A;  1M18 A;  3UTA B;  3W97 B;  2F8N D;  3REJ C;  3X1V D;  5AY8 D;  3LEL A;  3REH A;  3IP4 C;  4HGA B;  5AV6 D;  1P3A B;  5DNN B;  3O62 A;  3C1C C;  3AZE D;  5B0Y A;  5B1M A;  3LJA D;  3LZ1 D;  4ZBJ B;  5GSU B;  3AZL D;  2F8N K;  3FDD A;  4QLC B;  1U35 A;  3X1U C;  2NQB B;  1P3I D;  3AYW C;  4J8X D;  1P3O D;  1EQZ D;  3WA9 A;  5BNV A;  3UTA D;  3W97 D;  3TU4 A;  1KX5 A;  2PYO C;  5CPK C;  3LZ0 C;  1P3A D;  5DNN D;  5DNM A;  5B1L C;  5BNX A;  5AV9 A;  3KUY B;  1P3L C;  1S32 D;  3REJ A;  3C1B A;  5GSU D;  4WU8 A;  3MGP C;  4R8P C;  2BYK A;  4QLC D;  2HIO A;  5E5A B;  4Z2M G;  3VH5 W;  5B2J C;  1WWS A;  5KDM B;  5B31 G;  1P3G C;  1KX4 C;  3AZK D;  1F1E A;  3AV1 C;  1P3B C;  2FFF B;  5B31 B;  1AOI D;  5GT0 A;  1P3K C;  4JJN B;  3UTB B;  3AFA B;  1P3M A;  2LY8 A;  3V9R B;  3A1K A;  5B33 A;  4G91 C;  3KUY D;  3MNN D;  3UT9 D;  4WU9 C;  1HQ3 B;  2Y2I A;  1P34 C;  5BS7 C;  3NQJ B;  4X23 C;  3W96 B;  3MGS A;  3MGR B;  5B24 B;  4J8V A;  4J8W C;  4XZQ B;  1M19 A;  2DF4 C;  2Y2H A;  3AZF D;  1TZY B;  3MGP A;  1WWI A;  3EPK A;  5CPI C;  5B31 D;  3X1T C;  2FJ7 D;  3X1S A;  4JJN D;  3UTB D;  5B2J A;  5JRG C;  3AV1 A;  5GXQ C;  4WJ3 C;  3VH5 A;  3B0B A;  1JFI A;  3A1I A;  4ZUX A;  3EPJ A;  4LD9 A;  4CAY A;  4Z66 B;  5B24 D;  3MGR D;  3AZM A;  1M1A C;  1BH9 A;  3X1V A;  2ARO B;  1P3F B;  3B6F B;  1TZY D;  1P34 A;  4X23 A;  2CV5 C;  4H9S C;  5AV5 B;  2ZY3 A;  3WAA C;  3AZE A;  4CSR B;  4Z5T B;  4WNN B;  4YS3 B;  3AN2 B;  4KGC C;  1M18 C;  2JSS A;  3REL A;  3KXB A;  1ID3 C;  3AZL A;  2NZD B;  2Y2K A;  4AWL C;  4XUJ B;  5AVC A;  5BO0 B;  3LEL C;  3REH C;  3REI C;  3AZI C;  3B6G B;  2BG1 A;  3O62 C;  3NQU B;  4H9P A;  3WKJ B;  4H9N A;  5B0Y C;  4Z66 D;  4J8X A;  3AZN B;  1EQZ A;  3W99 B;  5AY8 B;  3UTA A;  3W97 A;  2ARO D;  5AV6 B;  3B6F D;  3A6N C;  1BH8 B;  1U35 C;  1P3A A;  2RVQ D;  5DNN A;  1KX3 B;  3AYW D;  5B40 B;  1N1J B;  3LZ1 B;  3H0M C;  3WA9 C;  4YS3 D;  3AN2 D;  3B0C T;  5GSU A;  2NZD D;  4YM6 B;  3TU4 C;  3P5J B;  5GT3 C;  4XUJ D;  1P3I B;  4QLC A;  4KHA B;  4WV4 B;  2NQB A;  5B1L D;  3B6G D;  5BT1 C;  3AFA C;  1P3O B;  5DNM C;  5C3I B;  5AV9 C;  1ZLA B;  4H9R B;  3AZN D;  1ID3 A;  3W99 D;  1A7W A;  3C1B C;  3KFU G;  2YFW B;  3AZI A;  4R8P D;  3REI A;  4WU8 C;  2ZM5 A;  3REK B;  1HQ3 C;  2HIO C;  4Z2M H;  3W96 C;  5FUG B;  3AZG C;  2W8S A;  1S32 B;  1KX3 D;  5B40 D;  3KUY A;  3VH5 T;  3KWQ D;  1F66 B;  5F99 B;  3A6N A;  4NFT A;  4YM6 D;  5GT0 C;  4KUD B;  1P3M C;  3WTP B;  5E5A A;  5B33 C;  5CP6 B;  3AZK B;  3B0C W;  1ZLA D;  5KDM A;  5AV8 B;  3AZH B;  4DRB A;  1AOI B;  5GT3 A;  3AZJ B;  2CWE A;  2HUE B;  3REK D;  4JJN A;  3UTB A;  3AFA A;  3MGS C;  4J8V C;  3AV2 B;  3MNN B;  5B0Z B;  1M19 C;  1PZR A;  3UT9 B;  5AVB D;  5B32 G;  1F66 D;  5CPI D;  5F99 D;  1HQ3 A;  2ZY2 A;  5B32 B;  3W96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...