1KU5A

Crystal structure of recombinant histone hpha from hyperthermophilic archaeon pyrococcus horikoshii ot3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
66
structure length
66
Chain Sequence
b'GELPIAPVDRLIRKAGAERVSEQAAKVLAEYLEEYAIEIAKKAVEFARHAGRKTVKVEDIKLAIKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HPhA
publication title Structure based hyperthermostability of archaeal histone HPhA from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Dna binding protein
total genus 22
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1ku5A00
4J8VB 3AZJA 3X1TA 1H3OB 3AZLA 3LZ0B 1U35D 4Z66B 4J8UB 3MGPA 1Q9CA 3WAAD 5GXQD 5BO0A 5B1LA 4ZUXC 3KSYA 5GT3C 2PYOC 3C1BD 1AOID 2FJ7D 3LJAB 2F8NB 1F1EA 1S32A 1P34A 2AROC 1TZYD 3AZHB 3A6ND 5B31C 3MVDD 4DRBA 1P3MC 3AZGD 5AV5B 3W96B 3X1VC 4Z5TB 4ZUXA 4LD9C 4R8PB 1P3GD 4G92B 3W97B 1P3BB 3MGSC 4H9SC 3UTBB 3AN2D 3B6GC 5BS7C 4H9PA 1M18B 1ZLAB 3REID 3B6FC 4YM6C 5B31A 3WKJB 3REKC 5AVCD 3LZ0C 3KUYC 1F66C 4Z66C 5GT0D 3MGSA 4J8UC 4H9SA 1P3PD 3X1UD 1P3OD 4KUDC 3B6GA 5BT1D 2LY8A 5JA4B 3LJAC 3O62D 4JJNA 2YFVB 3REKA 3AZMB 5KDMA 3MGQD 3W98A 3LZ0A 3KUYA 5B32C 1F66A 4J8UA 2BYMA 4CAYB 3W96C 5AV5C 2NZDC 4KUDA 4R8PC 3AV1D 1KX3B 4H9QB 3AZKD 1P3BC 1M19C 3C1CB 3KXBC 3LJAA 5B2JC 4J8WD 3MNNA 1M18C 3AZEB 1P3KB 2CWEA 5B32A 3W99C 3WKJC 4QLCB 1EQZB 2NZDA 4UUZB 5AV9B 4NE3A 5AV6D 4R8PA 5B1MB 1M19A 1M1AC 3KXBA 5AVBA 1N1JB 4H9OB 3TU4C 5BNXB 4HGAB 5B2JA 3UT9B 2HUEB 1M18A 4KGCB 2YFWA 3X1TB 3W99A 3REJD 3AZLB 5B2ID 3MGPB 5BO0B 3WTPD 5B1LB 4J8XD 5JRGD 1M1AA 4Z2MG 3TU4A 1BFMA 1S32B 1KX3C 4WU8D 4J8VD 3REHD 4WV4B 3AZFD 4Z2MH 1KX5A 1P3LD 5AY8C 4H9NA 1P3KC 4ZUXB 3VH5W 5DNND 4XUJD 1P3AB 3UTAD 4DRAA 5B1MC 1KX3A 3A6NC 1U35A 5B31G 4H9PB 3MGRC 3VH5T 5B33B 4HGAC 4NE5A 3UT9C 3WA9D 5AY8A 4NE6A 3C1BA 3X1TC 4Z5TD 1P3FB 2FJ7A 5F99D 3MGSB 1KX4D 1TZYA 1ID3D 3UTBD 5B1MA 5B0ZD 5B1LC 3A6NA 3B6GB 3MGRA 1ZLAD 1N1JA 4H9OA 4WU9D 5BNXA 3UT9A 4JJNB 5AVCC 3RELC 5KDMB 1HQ3B 3W98B 3KUYB 1P3PC 3X1UC 1F66B 3AYWB 1P3OC 2BYMB 3AZID 3REIA 4KUDB 2F8NG 5B0YD 4M6BA 3O62C 1P3AC 3MGQC 5AVCA 3AZMD 5GT0A 3MNNB 3RELA 2F8NH 3KWQD 5B33C 1WWIA 1P3PA 4XZQD 5B32B 3X1UA 1P3OA 5DNMC 3AV2D 2NZDB 3AZKC 5GSUD 1P3FC 4YS3D 3O62A 1P3AA 1M19B 3AZND 1BH9A 5AVBB 3KXBB 3MGQA 5B2JB 5CPIC 2F8NK 5B40D 1R4VA 5B33A 2YFWB 5CP6D 3W99B 5B24D 4JJNC 3B0BA 5DNMA 3AV1A 5AV9D 3AZKA 1HQ3C 1P3FA 3W98C 2RVQC 3AYWC 1M1AB 3TU4B 5CPIA 3REJC 3X1SB 5CPJD 4KGCD 5B2IC 3AZJD 5CPKD 5AV6A 3AZLD 1KX5B 4J8XC 3MNNC 1HQ3A 4X23B 4H9NB 3AYWA 1P3IC 5AV8D 3VH5A 3REJA 1P34D 1U35B 5B2IA 5AVBC 4J8XA 5DNNC 5AY8B 3C1BB 1AOIB 2IO5C 2FJ7B 3UTAC 5GT3D 2PYOD 1P3IA 3LELC 1TZYB 2HIOC 3B0DB 3A6NB 2AROD 3MGRB 1P3LA 5B31D 1P3MD 3X1SC 5DNNA 2CV5D 5F99C 3X1VD 3AFAD 1KX4C 4LD9D 3UTAA 4ZBJC 1KX5C 3MGSD 3LELA 2NQBD 2HIOA 3REIB 3NQJA 4X23C 4WU9C 3LZ1C 3B6GD 3WA9A 3B6FD 4YM6D 5E5AD 5AVCB 3X1SA 3REKD 5F99A 1U35C 5GT0B 3RELB 1KX4A 3WAAC 1P3PB 5GXQC 3X1UB 3LZ0D 4Z66D 4J8UD 1P3OB 5FUGA 4X23A 3C1BC 1AOIC 4WU9A 2FJ7C 3LZ1A 3O62B 4WNNB 1BH9B 1TZYC 3LJAD 2F8ND 3KWQC 3MGQB 2JSSA 3B0DC 4NFTA 4XZQC 3MVDC 2BYKA 3AZGC 4H9RB 3AZIA 3AV2C 3WAAA 3AZHD 5GXQA 1B67A 5DNMB 4YS3C 5AV5D 3AV1B 1P3GC 3W96D 3AZKB 1AOIA 4R8PD 3AN2C 3W97D 1P3BD 5B40C 3KWQA 3REIC 4XZQA 5B2JD 1TAFA 4EO5C 5CP6C 5B24C 3MVDA 2L5AA 3AZGA 5CPIB 1M18D 3AV2A 5AV6B 3WKJD 4YS3A 1P3GA 5GT0C 3AZNA 1KU5A 3AN2A 5B40A 3NQUA 5BT1C 3TU4D 5CPKC 5CP6A 1B6WA 3VH6W 5B24A 3REJB 5B2IB 5B32G 4J8XB 5JRGB 1BH8B 3VH6T 3AV1C 5AV8C 4WU8B 1P3IB 5CPJA 5CPKA 3REHB 3AZFB 1WWSA 1KX3D 4WNNA 3C1CD 4J8WC 1P3LB 1JFIB 5DNNB 4H9RA 4XUJB 5AY8D 3AZED 2IO5B 5AV6C 1P3KD 5BNVA 3UTAB 4QLCD 5C3IC 4AWLC 1EQZD 5AV8A 3LELB 2HIOB 3NQJB 4KHAA 5B1MD 4J8WA 3MGRD 3WA9B 2CV5C 3R45B 3AFAC 3UT9D 5F99B 5GT3A 2PYOA 1KX4B 3X1TD 2NQBC 4ZBJB 1ID3B 5B0ZB 3WTPC 1A7WA 3V9RA 3MGPD 5JRGC 2AROA 5FUGB 5G49A 4WU9B 5B1LD 3LZ1B 1P3MA 5E5AC 4WU8C 2CV5A 3X1VA 3AFAA 4J8VC 3REHC 4LD9A 3AZFC 1S32D 3RELD 2BYKB 4CSRA 2NQBA 3AZIB 3WAAB 1P3LC 5GXQB 3WTPA 5B0YB 5BS7A 5JRGA 4XUJC 1BH8A 3B6FA 4YM6A 4ZUXD 5E5AA 4WU8A 1P3AD 4J8VA 3KWQB 3REHA 3AZFA 1H3OA 3AZHC 4XZQB 1TAFB 3MVDB 4Z66A 3WA9C 3AZGB 5CHLB 3AV2B 5B33D 1JFIA 4Z5TC 5GSUB 4YS3B 5DNMD 1P3GB 4XUJA 4G92C 3W97C 3AZNB 1P3FD 1HTAA 1ID3C 3AN2B 3UTBC 2F8NA 5B0ZC 5B40B 3NQUB 1ZLAC 3AZHA 5CP6B 4EO5B 5CPID 5B24B 5AV5A 3W96A 3WTPE 3R45A 4G91B 4Z5TA 4JJND 3VH6A 3W97A 1P3BA 3AZIC 1HQ3D 4WZSB 1ID3A 3W98D 3UTBA 2RVQD 5B0ZA 3KUYD 1F66D 3B0CW 3AYWD 5B0YC 1ZLAA 5CPJB 3AZJB 5CPKB 4KUDD 3WKJA 3AZMC 3B0CT 3MNND 5BNVB 5GSUC 5B32D 5B0YA 5AV8B 1P34B 2NZDD 1P3ID 3AZNC 3C1CC 5JA4A 4KHAB 2YFVA 4E45A 1M19D 4J8WB 3AZMA 3KXBD 5AVBD 3AZEC 4QLCC 1EQZC 4CAYA 5GT3B 2PYOB 5AV9C 4E44A 4G91C 5GSUA 3W99D 5C3IB 4AWLB 4H9QA 3V9RB 3LELD 2AROB 3C1CA 2HIOD 5G49B 5B31B 1M1AD 1P3MB 2HUEC 2CV5B 3X1VB 5CPJC 4KGCC 3AFAB 3AZJC 3AZEA 1P3KA 4LD9B 3AZLC 4QLCA 3X1SD 1EQZA 4UUZA 4CSRB 5AV9A 3MGPC 2NQBB 1KX5D 3WTPB 4X23D 3B6FB 4YM6B 3LZ1D 1ULYA 1S32C 5E5AB 1P34C 3REKB 4KGCA
chains in the Genus database with same CATH superfamily
4J8VB 3AZJA 3X1TA 2DQNC 1H3OB 3AZLA 3LZ0B 1U35D 4Z66B 4J8UB 3AL0C 3MGPA 1Q9CA 3WAAD 5GXQD 5BO0A 5B1LA 4ZUXC 3KSYA 3KFUG 5GT3C 2PYOC 3C1BD 1AOID 2FJ7D 3LJAB 2F8NB 1F1EA 1S32A 3F6TA 1P34A 2AROC 1TZYD 3AZHB 3A6ND 5B31C 3MVDD 4DRBA 1P3MC 3AZGD 5AV5B 3W96B 3X1VC 4Z5TB 4ZUXA 4LD9C 4R8PB 1P3GD 4G92B 3W97B 1P3BB 3MGSC 2W8SA 4H9SC 3UTBB 3AN2D 3B6GC 5BS7C 2XD1A 4H9PA 1M18B 1ZLAB 3REID 3B6FC 4YM6C 5B31A 3WKJB 3REKC 5AVCD 3LZ0C 3KUYC 1F66C 4Z66C 5GT0D 3MGSA 4J8UC 4H9SA 1P3PD 3X1UD 1P3OD 4KUDC 3B6GA 5BT1D 2LY8A 5JA4B 3LJAC 3O62D 4JJNA 2YFVB 3REKA 3AZMB 5KDMA 3MGQD 3W98A 3LZ0A 3KUYA 5B32C 1F66A 4J8UA 2BYMA 4CAYB 3W96C 5AV5C 2NZDC 4KUDA 4R8PC 3AV1D 1KX3B 4H9QB 3AZKD 1P3BC 1M19C 3C1CB 3KXBC 3LJAA 5B2JC 4J8WD 3MNNA 1M18C 1Z2CB 3AZEB 1P3KB 2CWEA 5B32A 3W99C 3WKJC 4QLCB 1EQZB 2NZDA 4UUZB 5AV9B 4NE3A 5AV6D 4R8PA 5B1MB 2Y2OA 2JCHA 1M19A 1M1AC 3KXBA 5AVBA 1N1JB 4H9OB 3TU4C 5BNXB 4HGAB 5B2JA 3UT9B 2HUEB 1M18A 4KGCB 2YFWA 3X1TB 3W99A 3REJD 3AZLB 5B2ID 3MGPB 5BO0B 3WTPD 5B1LB 4J8XD 5JRGD 1M1AA 4Z2MG 3TU4A 1BFMA 2BG1A 2ZY4A 1S32B 1KX3C 4WU8D 4J8VD 3REHD 4WV4B 3AZFD 4Z2MH 1KX5A 1P3LD 5AY8C 4H9NA 1P3KC 4ZUXB 3VH5W 2Y2NA 5DNND 2Y2MA 4XUJD 1P3AB 3UTAD 4DRAA 5B1MC 1KX3A 3A6NC 1U35A 5B31G 4H9PB 3MGRC 3VH5T 5B33B 4DQYB 4HGAC 4NE5A 3UT9C 3WA9D 1PZRA 5AY8A 4NE6A 3C1BA 3X1TC 4Z5TD 1P3FB 2Y2IA 2FJ7A 5F99D 2UWXA 3MGSB 1KX4D 1TZYA 1ID3D 3UTBD 5B1MA 5B0ZD 5B1LC 3A6NA 3B6GB 3MGRA 1ZLAD 1N1JA 4H9OA 4WU9D 5BNXA 3UT9A 4JJNB 5AVCC 3RELC 5KDMB 1HQ3B 3W98B 3KUYB 1P3PC 3X1UC 1F66B 3AYWB 1P3OC 2BYMB 3AZID 3REIA 4KUDB 2F8NG 5B0YD 4M6BA 3O62C 1P3AC 3MGQC 5AVCA 3AZMD 5GT0A 3MNNB 3RELA 2F8NH 3KWQD 5B33C 1WWIA 1P3PA 4XZQD 5B32B 3X1UA 1P3OA 5DNMC 3AV2D 2NZDB 3A1IA 3AZKC 5GSUD 1P3FC 4YS3D 3O62A 1P3AA 1M19B 3AZND 1BH9A 5AVBB 3KXBB 3MGQA 5B2JB 2RIQA 5CPIC 2F8NK 5B40D 1R4VA 5B33A 2YFWB 5CP6D 3W99B 5B24D 2DF4C 4JJNC 3B0BA 5DNMA 3AV1A 5AV9D 3AZKA 1HQ3C 1P3FA 3W98C 2RVQC 3FDDA 3AYWC 1M1AB 3TU4B 2Y2HA 2Y2GA 5CPIA 3REJC 3X1SB 5CPJD 4KGCD 5B2IC 3AZJD 5CPKD 5AV6A 3AZLD 1KX5B 4J8XC 3MNNC 2ZM5A 1HQ3A 4X23B 2VQRA 4H9NB 3AYWA 1P3IC 5AV8D 3VH5A 3REJA 1P34D 1U35B 5B2IA 5AVBC 4J8XA 5DNNC 5AY8B 3C1BB 1AOIB 2IO5C 2FJ7B 3UTAC 2Y2KA 2ZY5A 5GT3D 2PYOD 1P3IA 3LELC 1TZYB 2HIOC 3B0DB 3A6NB 2AROD 3MGRB 1P3LA 5B31D 1P3MD 3X1SC 5DNNA 2CV5D 5F99C 3X1VD 3AFAD 1KX4C 4LD9D 3UTAA 4ZBJC 1KX5C 3MGSD 3LELA 2NQBD 2HIOA 3REIB 3NQJA 4X23C 4WU9C 3LZ1C 3B6GD 3WA9A 2Y2QA 3A1KA 3B6FD 4YM6D 5E5AD 5AVCB 3X1SA 3REKD 5F99A 1U35C 5GT0B 3RELB 1KX4A 3WAAC 3IP4C 1P3PB 5GXQC 3X1UB 3LZ0D 4Z66D 4J8UD 1P3OB 5FUGA 4X23A 3C1BC 1AOIC 4WU9A 2FJ7C 1W2EA 3LZ1A 3EPHA 2Y2PA 3O62B 4WNNB 1BH9B 1TZYC 3LJAD 2F8ND 3KWQC 3MGQB 2JSSA 3B0DC 4NFTA 4XZQC 3MVDC 2BYKA 3AZGC 4H9RB 3AZIA 3AV2C 3WAAA 3AZHD 5GXQA 1B67A 5DNMB 4YS3C 5AV5D 3AV1B 3H0RC 1P3GC 3W96D 3AZKB 1AOIA 4R8PD 3AN2C 3W97D 1P3BD 5B40C 3KWQA 3REIC 5CP6C 5B2JD 4XZQA 1TAFA 3H0LC 4EO5C 5B24C 2L5AA 3MVDA 3AZGA 5CPIB 3AV2A 1M18D 5AV6B 3WKJD 4YS3A 1P3GA 5GT0C 3AZNA 1KU5A 3AN2A 5B40A 3NQUA 5BT1C 3TU4D 5CPKC 5CP6A 1B6WA 3VH6W 5B24A 3REJB 5B2IB 5B32G 4J8XB 5JRGB 1BH8B 3VH6T 4WJ3C 3AV1C 5AV8C 4WU8B 1P3IB 5CPJA 5CPKA 3REHB 3AZFB 1WWSA 1KX3D 4WNNA 3C1CD 4J8WC 2Y2LA 1P3LB 1JFIB 2F2AC 5DNNB 4H9RA 4XUJB 5AY8D 3AZED 2IO5B 5AV6C 1P3KD 5BNVA 3UTAB 4QLCD 5C3IC 4AWLC 1EQZD 5AV8A 3LELB 2HIOB 3NQJB 4KHAA 5B1MD 1T3UA 3EPLA 4J8WA 3MGRD 3WA9B 2CV5C 3R45B 3AFAC 3UT9D 5F99B 5GT3A 2PYOA 1KX4B 3X1TD 2NQBC 4ZBJB 2ZY2A 3EPKA 1ID3B 5B0ZB 3WTPC 1A7WA 3V9RA 3MGPD 5JRGC 2AROA 5FUGB 5G49A 4WU9B 5B1LD 3LZ1B 1P3MA 5E5AC 4WU8C 2CV5A 3X1VA 3AFAA 4J8VC 3REHC 4LD9A 3AZFC 1S32D 3RELD 2BYKB 4CSRA 2NQBA 3AZIB 3WAAB 1P3LC 5GXQB 3WTPA 5B0YB 5BS7A 5JRGA 4XUJC 1BH8A 3B6FA 4YM6A 4ZUXD 2XD5A 5E5AA 4WU8A 1P3AD 2JE5A 4J8VA 3KWQB 3REHA 3AZFA 1H3OA 3AZHC 4XZQB 1TAFB 3MVDB 4Z66A 3WA9C 3AZGB 5CHLB 3AV2B 5B33D 1JFIA 4Z5TC 5GSUB 2Y2JA 4YS3B 5DNMD 1P3GB 4XUJA 4G92C 3W97C 3AZNB 1P3FD 1HTAA 1ID3C 3AN2B 3UTBC 2F8NA 5B0ZC 5B40B 3NQUB 2J8PA 1ZLAC 3AZHA 3H0MC 5CP6B 4EO5B 5CPID 5B24B 5AV5A 3W96A 3WTPE 3R45A 4G91B 4Z5TA 4JJND 4UPKA 3VH6A 3W97A 1P3BA 3AZIC 1HQ3D 4WZSB 1ID3A 3W98D 3UTBA 2RVQD 5B0ZA 3KUYD 1F66D 3B0CW 3AYWD 5B0YC 1ZLAA 5CPJB 3AZJB 5CPKB 2ZY3A 4KUDD 3WKJA 3AZMC 3B0CT 3MNND 5BNVB 5GSUC 5B32D 5B0YA 5AV8B 1P34B 2NZDD 1P3ID 3AZNC 3C1CC 5JA4A 4KHAB 2YFVA 4E45A 1M19D 4J8WB 3AZMA 3KXBD 5AVBD 2G5HC 3AZEC 4QLCC 1EQZC 4CAYA 5GT3B 2PYOB 5AV9C 4E44A 4G91C 5GSUA 3W99D 5C3IB 4AWLB 4H9QA 3V9RB 3LELD 2FFFB 2AROB 3C1CA 2HIOD 5G49B 5B31B 1M1AD 1P3MB 2HUEC 2CV5B 3X1VB 5CPJC 4KGCC 3AFAB 3EG5B 3AZJC 3AZEA 1P3KA 4LD9B 3AZLC 4QLCA 3X1SD 1EQZA 4UUZA 4CSRB 5AV9A 3MGPC 2NQBB 1KX5D 3WTPB 3P5JB 4X23D 3B6FB 4YM6B 3LZ1D 1ULYA 1S32C 5E5AB 2G5IC 1P34C 3REKB 4KGCA 3EPJA
chains in the Genus database with same CATH topology
4J8VB 3AZJA 3X1TA 2DQNC 1H3OB 3AZLA 3LZ0B 1U35D 4Z66B 4J8UB 3AL0C 3MGPA 1Q9CA 3WAAD 5GXQD 5BO0A 5B1LA 4ZUXC 3KSYA 3KFUG 5GT3C 2PYOC 3C1BD 1AOID 2FJ7D 3LJAB 2F8NB 1F1EA 1S32A 3F6TA 1P34A 2AROC 1TZYD 3AZHB 3A6ND 5B31C 3MVDD 4DRBA 1P3MC 3AZGD 5AV5B 3W96B 3X1VC 4Z5TB 4ZUXA 4LD9C 4R8PB 1P3GD 4G92B 3W97B 1P3BB 3MGSC 2W8SA 4H9SC 3UTBB 3AN2D 3B6GC 5BS7C 2XD1A 4H9PA 1M18B 1ZLAB 3REID 3B6FC 4YM6C 5B31A 3WKJB 3REKC 5AVCD 3LZ0C 3KUYC 1F66C 4Z66C 5GT0D 3MGSA 4J8UC 4H9SA 1P3PD 3X1UD 1P3OD 4KUDC 3B6GA 5BT1D 2LY8A 5JA4B 3LJAC 3O62D 4JJNA 2YFVB 3REKA 3AZMB 5KDMA 3MGQD 3W98A 3LZ0A 3KUYA 5B32C 1F66A 4J8UA 2BYMA 4CAYB 3W96C 5AV5C 2NZDC 4KUDA 4R8PC 3AV1D 1KX3B 4H9QB 3AZKD 1P3BC 1M19C 3C1CB 3KXBC 3LJAA 5B2JC 4J8WD 3MNNA 1M18C 1Z2CB 3AZEB 1P3KB 2CWEA 5B32A 3W99C 3WKJC 4QLCB 1EQZB 2NZDA 4UUZB 5AV9B 4NE3A 5AV6D 4R8PA 5B1MB 2Y2OA 2JCHA 1M19A 1M1AC 3KXBA 5AVBA 1N1JB 4H9OB 3TU4C 5BNXB 4HGAB 5B2JA 3UT9B 2HUEB 1M18A 4KGCB 2YFWA 3X1TB 3W99A 3REJD 3AZLB 5B2ID 3MGPB 5BO0B 3WTPD 5B1LB 4J8XD 5JRGD 1M1AA 4Z2MG 3TU4A 1BFMA 2BG1A 2ZY4A 1S32B 1KX3C 4WU8D 4J8VD 3REHD 4WV4B 3AZFD 4Z2MH 1KX5A 1P3LD 5AY8C 4H9NA 1P3KC 4ZUXB 3VH5W 2Y2NA 5DNND 2Y2MA 4XUJD 1P3AB 3UTAD 4DRAA 5B1MC 1KX3A 3A6NC 1U35A 5B31G 4H9PB 3MGRC 3VH5T 5B33B 4DQYB 4HGAC 4NE5A 3UT9C 3WA9D 1PZRA 5AY8A 4NE6A 3C1BA 3X1TC 4Z5TD 1P3FB 2Y2IA 2FJ7A 5F99D 2UWXA 3MGSB 1KX4D 1TZYA 1ID3D 3UTBD 5B1MA 5B0ZD 5B1LC 3A6NA 3B6GB 3MGRA 1ZLAD 1N1JA 4H9OA 4WU9D 5BNXA 3UT9A 4JJNB 5AVCC 3RELC 5KDMB 1HQ3B 3W98B 3KUYB 1P3PC 3X1UC 1F66B 3AYWB 1P3OC 2BYMB 3AZID 3REIA 4KUDB 2F8NG 5B0YD 4M6BA 3O62C 1P3AC 3MGQC 5AVCA 3AZMD 5GT0A 3MNNB 3RELA 2F8NH 3KWQD 5B33C 1WWIA 1P3PA 4XZQD 5B32B 3X1UA 1P3OA 5DNMC 3AV2D 2NZDB 3A1IA 3AZKC 5GSUD 1P3FC 4YS3D 3O62A 1P3AA 1M19B 3AZND 1BH9A 5AVBB 3KXBB 3MGQA 5B2JB 2RIQA 5CPIC 2F8NK 5B40D 1R4VA 5B33A 2YFWB 5CP6D 3W99B 5B24D 2DF4C 4JJNC 3B0BA 5DNMA 3AV1A 5AV9D 3AZKA 1HQ3C 1P3FA 3W98C 2RVQC 3FDDA 3AYWC 1M1AB 3TU4B 2Y2HA 2Y2GA 5CPIA 3REJC 3X1SB 5CPJD 4KGCD 5B2IC 3AZJD 5CPKD 5AV6A 3AZLD 1KX5B 4J8XC 3MNNC 2ZM5A 1HQ3A 4X23B 2VQRA 4H9NB 3AYWA 1P3IC 5AV8D 3VH5A 3REJA 1P34D 1U35B 5B2IA 5AVBC 4J8XA 5DNNC 5AY8B 3C1BB 1AOIB 2IO5C 2FJ7B 3UTAC 2Y2KA 2ZY5A 5GT3D 2PYOD 1P3IA 3LELC 1TZYB 2HIOC 3B0DB 3A6NB 2AROD 3MGRB 1P3LA 5B31D 1P3MD 3X1SC 5DNNA 2CV5D 5F99C 3X1VD 3AFAD 1KX4C 4LD9D 3UTAA 4ZBJC 1KX5C 3MGSD 3LELA 2NQBD 2HIOA 3REIB 3NQJA 4X23C 4WU9C 3LZ1C 3B6GD 3WA9A 2Y2QA 3A1KA 3B6FD 4YM6D 5E5AD 5AVCB 3X1SA 3REKD 5F99A 1U35C 5GT0B 3RELB 1KX4A 3WAAC 3IP4C 1P3PB 5GXQC 3X1UB 3LZ0D 4Z66D 4J8UD 1P3OB 5FUGA 4X23A 3C1BC 1AOIC 4WU9A 2FJ7C 1W2EA 3LZ1A 3EPHA 2Y2PA 3O62B 4WNNB 1BH9B 1TZYC 3LJAD 2F8ND 3KWQC 3MGQB 2JSSA 3B0DC 4NFTA 4XZQC 3MVDC 2BYKA 3AZGC 4H9RB 3AZIA 3AV2C 3WAAA 3AZHD 5GXQA 1B67A 5DNMB 4YS3C 5AV5D 3AV1B 3H0RC 1P3GC 3W96D 3AZKB 1AOIA 4R8PD 3AN2C 3W97D 1P3BD 5B40C 3KWQA 3REIC 5CP6C 5B2JD 4XZQA 1TAFA 3H0LC 4EO5C 5B24C 2L5AA 3MVDA 3AZGA 5CPIB 3AV2A 1M18D 5AV6B 3WKJD 4YS3A 1P3GA 5GT0C 3AZNA 1KU5A 3AN2A 5B40A 3NQUA 5BT1C 3TU4D 5CPKC 5CP6A 1B6WA 3VH6W 5B24A 3REJB 5B2IB 5B32G 4J8XB 5JRGB 1BH8B 3VH6T 4WJ3C 3AV1C 5AV8C 4WU8B 1P3IB 5CPJA 5CPKA 3REHB 3AZFB 1WWSA 1KX3D 4WNNA 3C1CD 4J8WC 2Y2LA 1P3LB 1JFIB 2F2AC 5DNNB 4H9RA 4XUJB 5AY8D 3AZED 2IO5B 5AV6C 1P3KD 5BNVA 3UTAB 4QLCD 5C3IC 4AWLC 1EQZD 5AV8A 3LELB 2HIOB 3NQJB 4KHAA 5B1MD 1T3UA 3EPLA 4J8WA 3MGRD 3WA9B 2CV5C 3R45B 3AFAC 3UT9D 5F99B 5GT3A 2PYOA 1KX4B 3X1TD 2NQBC 4ZBJB 2ZY2A 3EPKA 1ID3B 5B0ZB 3WTPC 1A7WA 3V9RA 3MGPD 5JRGC 2AROA 5FUGB 5G49A 4WU9B 5B1LD 3LZ1B 1P3MA 5E5AC 4WU8C 2CV5A 3X1VA 3AFAA 4J8VC 3REHC 4LD9A 3AZFC 1S32D 3RELD 2BYKB 4CSRA 2NQBA 3AZIB 3WAAB 1P3LC 5GXQB 3WTPA 5B0YB 5BS7A 5JRGA 4XUJC 1BH8A 3B6FA 4YM6A 4ZUXD 2XD5A 5E5AA 4WU8A 1P3AD 2JE5A 4J8VA 3KWQB 3REHA 3AZFA 1H3OA 3AZHC 4XZQB 1TAFB 3MVDB 4Z66A 3WA9C 3AZGB 5CHLB 3AV2B 5B33D 1JFIA 4Z5TC 5GSUB 2Y2JA 4YS3B 5DNMD 1P3GB 4XUJA 4G92C 3W97C 3AZNB 1P3FD 1HTAA 1ID3C 3AN2B 3UTBC 2F8NA 5B0ZC 5B40B 3NQUB 2J8PA 1ZLAC 3AZHA 3H0MC 5CP6B 4EO5B 5CPID 5B24B 5AV5A 3W96A 3WTPE 3R45A 4G91B 4Z5TA 4JJND 4UPKA 3VH6A 3W97A 1P3BA 3AZIC 1HQ3D 4WZSB 1ID3A 3W98D 3UTBA 2RVQD 5B0ZA 3KUYD 1F66D 3B0CW 3AYWD 5B0YC 1ZLAA 5CPJB 3AZJB 5CPKB 2ZY3A 4KUDD 3WKJA 3AZMC 3B0CT 3MNND 5BNVB 5GSUC 5B32D 5B0YA 5AV8B 1P34B 2NZDD 1P3ID 3AZNC 3C1CC 5JA4A 4KHAB 2YFVA 4E45A 1M19D 4J8WB 3AZMA 3KXBD 5AVBD 2G5HC 3AZEC 4QLCC 1EQZC 4CAYA 5GT3B 2PYOB 5AV9C 4E44A 4G91C 5GSUA 3W99D 5C3IB 4AWLB 4H9QA 3V9RB 3LELD 2FFFB 2AROB 3C1CA 2HIOD 5G49B 5B31B 1M1AD 1P3MB 2HUEC 2CV5B 3X1VB 5CPJC 4KGCC 3AFAB 3EG5B 3AZJC 3AZEA 1P3KA 4LD9B 3AZLC 4QLCA 3X1SD 1EQZA 4UUZA 4CSRB 5AV9A 3MGPC 2NQBB 1KX5D 3WTPB 3P5JB 4X23D 3B6FB 4YM6B 3LZ1D 1ULYA 1S32C 5E5AB 2G5IC 1P34C 3REKB 4KGCA 3EPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V B;  3AZJ A;  3X1T A;  1H3O B;  3AZL A;  3LZ0 B;  1U35 D;  4Z66 B;  4J8U B;  3MGP A;  1Q9C A;  3WAA D;  5GXQ D;  5BO0 A;  5B1L A;  4ZUX C;  3KSY A;  5GT3 C;  2PYO C;  3C1B D;  1AOI D;  2FJ7 D;  3LJA B;  2F8N B;  1F1E A;  1S32 A;  1P34 A;  2ARO C;  1TZY D;  3AZH B;  3A6N D;  5B31 C;  3MVD D;  4DRB A;  1P3M C;  3AZG D;  5AV5 B;  3W96 B;  3X1V C;  4Z5T B;  4ZUX A;  4LD9 C;  4R8P B;  1P3G D;  4G92 B;  3W97 B;  1P3B B;  3MGS C;  4H9S C;  3UTB B;  3AN2 D;  3B6G C;  5BS7 C;  4H9P A;  1M18 B;  1ZLA B;  3REI D;  3B6F C;  4YM6 C;  5B31 A;  3WKJ B;  3REK C;  5AVC D;  3LZ0 C;  3KUY C;  1F66 C;  4Z66 C;  5GT0 D;  3MGS A;  4J8U C;  4H9S A;  1P3P D;  3X1U D;  1P3O D;  4KUD C;  3B6G A;  5BT1 D;  2LY8 A;  5JA4 B;  3LJA C;  3O62 D;  4JJN A;  2YFV B;  3REK A;  3AZM B;  5KDM A;  3MGQ D;  3W98 A;  3LZ0 A;  3KUY A;  5B32 C;  1F66 A;  4J8U A;  2BYM A;  4CAY B;  3W96 C;  5AV5 C;  2NZD C;  4KUD A;  4R8P C;  3AV1 D;  1KX3 B;  4H9Q B;  3AZK D;  1P3B C;  1M19 C;  3C1C B;  3KXB C;  3LJA A;  5B2J C;  4J8W D;  3MNN A;  1M18 C;  3AZE B;  1P3K B;  2CWE A;  5B32 A;  3W99 C;  3WKJ C;  4QLC B;  1EQZ B;  2NZD A;  4UUZ B;  5AV9 B;  4NE3 A;  5AV6 D;  4R8P A;  5B1M B;  1M19 A;  1M1A C;  3KXB A;  5AVB A;  1N1J B;  4H9O B;  3TU4 C;  5BNX B;  4HGA B;  5B2J A;  3UT9 B;  2HUE B;  1M18 A;  4KGC B;  2YFW A;  3X1T B;  3W99 A;  3REJ D;  3AZL B;  5B2I D;  3MGP B;  5BO0 B;  3WTP D;  5B1L B;  4J8X D;  5JRG D;  1M1A A;  4Z2M G;  3TU4 A;  1BFM A;  1S32 B;  1KX3 C;  4WU8 D;  4J8V D;  3REH D;  4WV4 B;  3AZF D;  4Z2M H;  1KX5 A;  1P3L D;  5AY8 C;  4H9N A;  1P3K C;  4ZUX B;  3VH5 W;  5DNN D;  4XUJ D;  1P3A B;  3UTA D;  4DRA A;  5B1M C;  1KX3 A;  3A6N C;  1U35 A;  5B31 G;  4H9P B;  3MGR C;  3VH5 T;  5B33 B;  4HGA C;  4NE5 A;  3UT9 C;  3WA9 D;  5AY8 A;  4NE6 A;  3C1B A;  3X1T C;  4Z5T D;  1P3F B;  2FJ7 A;  5F99 D;  3MGS B;  1KX4 D;  1TZY A;  1ID3 D;  3UTB D;  5B1M A;  5B0Z D;  5B1L C;  3A6N A;  3B6G B;  3MGR A;  1ZLA D;  1N1J A;  4H9O A;  4WU9 D;  5BNX A;  3UT9 A;  4JJN B;  5AVC C;  3REL C;  5KDM B;  1HQ3 B;  3W98 B;  3KUY B;  1P3P C;  3X1U C;  1F66 B;  3AYW B;  1P3O C;  2BYM B;  3AZI D;  3REI A;  4KUD B;  2F8N G;  5B0Y D;  4M6B A;  3O62 C;  1P3A C;  3MGQ C;  5AVC A;  3AZM D;  5GT0 A;  3MNN B;  3REL A;  2F8N H;  3KWQ D;  5B33 C;  1WWI A;  1P3P A;  4XZQ D;  5B32 B;  3X1U A;  1P3O A;  5DNM C;  3AV2 D;  2NZD B;  3AZK C;  5GSU D;  1P3F C;  4YS3 D;  3O62 A;  1P3A A;  1M19 B;  3AZN D;  1BH9 A;  5AVB B;  3KXB B;  3MGQ A;  5B2J B;  5CPI C;  2F8N K;  5B40 D;  1R4V A;  5B33 A;  2YFW B;  5CP6 D;  3W99 B;  5B24 D;  4JJN C;  3B0B A;  5DNM A;  3AV1 A;  5AV9 D;  3AZK A;  1HQ3 C;  1P3F A;  3W98 C;  2RVQ C;  3AYW C;  1M1A B;  3TU4 B;  5CPI A;  3REJ C;  3X1S B;  5CPJ D;  4KGC D;  5B2I C;  3AZJ D;  5CPK D;  5AV6 A;  3AZL D;  1KX5 B;  4J8X C;  3MNN C;  1HQ3 A;  4X23 B;  4H9N B;  3AYW A;  1P3I C;  5AV8 D;  3VH5 A;  3REJ A;  1P34 D;  1U35 B;  5B2I A;  5AVB C;  4J8X A;  5DNN C;  5AY8 B;  3C1B B;  1AOI B;  2IO5 C;  2FJ7 B;  3UTA C;  5GT3 D;  2PYO D;  1P3I A;  3LEL C;  1TZY B;  2HIO C;  3B0D B;  3A6N B;  2ARO D;  3MGR B;  1P3L A;  5B31 D;  1P3M D;  3X1S C;  5DNN A;  2CV5 D;  5F99 C;  3X1V D;  3AFA D;  1KX4 C;  4LD9 D;  3UTA A;  4ZBJ C;  1KX5 C;  3MGS D;  3LEL A;  2NQB D;  2HIO A;  3REI B;  3NQJ A;  4X23 C;  4WU9 C;  3LZ1 C;  3B6G D;  3WA9 A;  3B6F D;  4YM6 D;  5E5A D;  5AVC B;  3X1S A;  3REK D;  5F99 A;  1U35 C;  5GT0 B;  3REL B;  1KX4 A;  3WAA C;  1P3P B;  5GXQ C;  3X1U B;  3LZ0 D;  4Z66 D;  4J8U D;  1P3O B;  5FUG A;  4X23 A;  3C1B C;  1AOI C;  4WU9 A;  2FJ7 C;  3LZ1 A;  3O62 B;  4WNN B;  1BH9 B;  1TZY C;  3LJA D;  2F8N D;  3KWQ C;  3MGQ B;  2JSS A;  3B0D C;  4NFT A;  4XZQ C;  3MVD C;  2BYK A;  3AZG C;  4H9R B;  3AZI A;  3AV2 C;  3WAA A;  3AZH D;  5GXQ A;  1B67 A;  5DNM B;  4YS3 C;  5AV5 D;  3AV1 B;  1P3G C;  3W96 D;  3AZK B;  1AOI A;  4R8P D;  3AN2 C;  3W97 D;  1P3B D;  5B40 C;  3KWQ A;  3REI C;  4XZQ A;  5B2J D;  1TAF A;  4EO5 C;  5CP6 C;  5B24 C;  3MVD A;  2L5A A;  3AZG A;  5CPI B;  1M18 D;  3AV2 A;  5AV6 B;  3WKJ D;  4YS3 A;  1P3G A;  5GT0 C;  3AZN A;  1KU5 A;  3AN2 A;  5B40 A;  3NQU A;  5BT1 C;  3TU4 D;  5CPK C;  5CP6 A;  1B6W A;  3VH6 W;  5B24 A;  3REJ B;  5B2I B;  5B32 G;  4J8X B;  5JRG B;  1BH8 B;  3VH6 T;  3AV1 C;  5AV8 C;  4WU8 B;  1P3I B;  5CPJ A;  5CPK A;  3REH B;  3AZF B;  1WWS A;  1KX3 D;  4WNN A;  3C1C D;  4J8W C;  1P3L B;  1JFI B;  5DNN B;  4H9R A;  4XUJ B;  5AY8 D;  3AZE D;  2IO5 B;  5AV6 C;  1P3K D;  5BNV A;  3UTA B;  4QLC D;  5C3I C;  4AWL C;  1EQZ D;  5AV8 A;  3LEL B;  2HIO B;  3NQJ B;  4KHA A;  5B1M D;  4J8W A;  3MGR D;  3WA9 B;  2CV5 C;  3R45 B;  3AFA C;  3UT9 D;  5F99 B;  5GT3 A;  2PYO A;  1KX4 B;  3X1T D;  2NQB C;  4ZBJ B;  1ID3 B;  5B0Z B;  3WTP C;  1A7W A;  3V9R A;  3MGP D;  5JRG C;  2ARO A;  5FUG B;  5G49 A;  4WU9 B;  5B1L D;  3LZ1 B;  1P3M A;  5E5A C;  4WU8 C;  2CV5 A;  3X1V A;  3AFA A;  4J8V C;  3REH C;  4LD9 A;  3AZF C;  1S32 D;  3REL D;  2BYK B;  4CSR A;  2NQB A;  3AZI B;  3WAA B;  1P3L C;  5GXQ B;  3WTP A;  5B0Y B;  5BS7 A;  5JRG A;  4XUJ C;  1BH8 A;  3B6F A;  4YM6 A;  4ZUX D;  5E5A A;  4WU8 A;  1P3A D;  4J8V A;  3KWQ B;  3REH A;  3AZF A;  1H3O A;  3AZH C;  4XZQ B;  1TAF B;  3MVD B;  4Z66 A;  3WA9 C;  3AZG B;  5CHL B;  3AV2 B;  5B33 D;  1JFI A;  4Z5T C;  5GSU B;  4YS3 B;  5DNM D;  1P3G B;  4XUJ A;  4G92 C;  3W97 C;  3AZN B;  1P3F D;  1HTA A;  1ID3 C;  3AN2 B;  3UTB C;  2F8N A;  5B0Z C;  5B40 B;  3NQU B;  1ZLA C;  3AZH A;  5CP6 B;  4EO5 B;  5CPI D;  5B24 B;  5AV5 A;  3W96 A;  3WTP E;  3R45 A;  4G91 B;  4Z5T A;  4JJN D;  3VH6 A;  3W97 A;  1P3B A;  3AZI C;  1HQ3 D;  4WZS B;  1ID3 A;  3W98 D;  3UTB A;  2RVQ D;  5B0Z A;  3KUY D;  1F66 D;  3B0C W;  3AYW D;  5B0Y C;  1ZLA A;  5CPJ B;  3AZJ B;  5CPK B;  4KUD D;  3WKJ A;  3AZM C;  3B0C T;  3MNN D;  5BNV B;  5GSU C;  5B32 D;  5B0Y A;  5AV8 B;  1P34 B;  2NZD D;  1P3I D;  3AZN C;  3C1C C;  5JA4 A;  4KHA B;  2YFV A;  4E45 A;  1M19 D;  4J8W B;  3AZM A;  3KXB D;  5AVB D;  3AZE C;  4QLC C;  1EQZ C;  4CAY A;  5GT3 B;  2PYO B;  5AV9 C;  4E44 A;  4G91 C;  5GSU A;  3W99 D;  5C3I B;  4AWL B;  4H9Q A;  3V9R B;  3LEL D;  2ARO B;  3C1C A;  2HIO D;  5G49 B;  5B31 B;  1M1A D;  1P3M B;  2HUE C;  2CV5 B;  3X1V B;  5CPJ C;  4KGC C;  3AFA B;  3AZJ C;  3AZE A;  1P3K A;  4LD9 B;  3AZL C;  4QLC A;  3X1S D;  1EQZ A;  4UUZ A;  4CSR B;  5AV9 A;  3MGP C;  2NQB B;  1KX5 D;  3WTP B;  4X23 D;  3B6F B;  4YM6 B;  3LZ1 D;  1ULY A;  1S32 C;  5E5A B;  1P34 C;  3REK B;  4KGC A; 
#chains in the Genus database with same CATH topology
 4J8V B;  3AZJ A;  3X1T A;  2DQN C;  1H3O B;  3AZL A;  3LZ0 B;  1U35 D;  4Z66 B;  4J8U B;  3AL0 C;  3MGP A;  1Q9C A;  3WAA D;  5GXQ D;  5BO0 A;  5B1L A;  4ZUX C;  3KSY A;  3KFU G;  5GT3 C;  2PYO C;  3C1B D;  1AOI D;  2FJ7 D;  3LJA B;  2F8N B;  1F1E A;  1S32 A;  3F6T A;  1P34 A;  2ARO C;  1TZY D;  3AZH B;  3A6N D;  5B31 C;  3MVD D;  4DRB A;  1P3M C;  3AZG D;  5AV5 B;  3W96 B;  3X1V C;  4Z5T B;  4ZUX A;  4LD9 C;  4R8P B;  1P3G D;  4G92 B;  3W97 B;  1P3B B;  3MGS C;  2W8S A;  4H9S C;  3UTB B;  3AN2 D;  3B6G C;  5BS7 C;  2XD1 A;  4H9P A;  1M18 B;  1ZLA B;  3REI D;  3B6F C;  4YM6 C;  5B31 A;  3WKJ B;  3REK C;  5AVC D;  3LZ0 C;  3KUY C;  1F66 C;  4Z66 C;  5GT0 D;  3MGS A;  4J8U C;  4H9S A;  1P3P D;  3X1U D;  1P3O D;  4KUD C;  3B6G A;  5BT1 D;  2LY8 A;  5JA4 B;  3LJA C;  3O62 D;  4JJN A;  2YFV B;  3REK A;  3AZM B;  5KDM A;  3MGQ D;  3W98 A;  3LZ0 A;  3KUY A;  5B32 C;  1F66 A;  4J8U A;  2BYM A;  4CAY B;  3W96 C;  5AV5 C;  2NZD C;  4KUD A;  4R8P C;  3AV1 D;  1KX3 B;  4H9Q B;  3AZK D;  1P3B C;  1M19 C;  3C1C B;  3KXB C;  3LJA A;  5B2J C;  4J8W D;  3MNN A;  1M18 C;  1Z2C B;  3AZE B;  1P3K B;  2CWE A;  5B32 A;  3W99 C;  3WKJ C;  4QLC B;  1EQZ B;  2NZD A;  4UUZ B;  5AV9 B;  4NE3 A;  5AV6 D;  4R8P A;  5B1M B;  2Y2O A;  2JCH A;  1M19 A;  1M1A C;  3KXB A;  5AVB A;  1N1J B;  4H9O B;  3TU4 C;  5BNX B;  4HGA B;  5B2J A;  3UT9 B;  2HUE B;  1M18 A;  4KGC B;  2YFW A;  3X1T B;  3W99 A;  3REJ D;  3AZL B;  5B2I D;  3MGP B;  5BO0 B;  3WTP D;  5B1L B;  4J8X D;  5JRG D;  1M1A A;  4Z2M G;  3TU4 A;  1BFM A;  2BG1 A;  2ZY4 A;  1S32 B;  1KX3 C;  4WU8 D;  4J8V D;  3REH D;  4WV4 B;  3AZF D;  4Z2M H;  1KX5 A;  1P3L D;  5AY8 C;  4H9N A;  1P3K C;  4ZUX B;  3VH5 W;  2Y2N A;  5DNN D;  2Y2M A;  4XUJ D;  1P3A B;  3UTA D;  4DRA A;  5B1M C;  1KX3 A;  3A6N C;  1U35 A;  5B31 G;  4H9P B;  3MGR C;  3VH5 T;  5B33 B;  4DQY B;  4HGA C;  4NE5 A;  3UT9 C;  3WA9 D;  1PZR A;  5AY8 A;  4NE6 A;  3C1B A;  3X1T C;  4Z5T D;  1P3F B;  2Y2I A;  2FJ7 A;  5F99 D;  2UWX A;  3MGS B;  1KX4 D;  1TZY A;  1ID3 D;  3UTB D;  5B1M A;  5B0Z D;  5B1L C;  3A6N A;  3B6G B;  3MGR A;  1ZLA D;  1N1J A;  4H9O A;  4WU9 D;  5BNX A;  3UT9 A;  4JJN B;  5AVC C;  3REL C;  5KDM B;  1HQ3 B;  3W98 B;  3KUY B;  1P3P C;  3X1U C;  1F66 B;  3AYW B;  1P3O C;  2BYM B;  3AZI D;  3REI A;  4KUD B;  2F8N G;  5B0Y D;  4M6B A;  3O62 C;  1P3A C;  3MGQ C;  5AVC A;  3AZM D;  5GT0 A;  3MNN B;  3REL A;  2F8N H;  3KWQ D;  5B33 C;  1WWI A;  1P3P A;  4XZQ D;  5B32 B;  3X1U A;  1P3O A;  5DNM C;  3AV2 D;  2NZD B;  3A1I A;  3AZK C;  5GSU D;  1P3F C;  4YS3 D;  3O62 A;  1P3A A;  1M19 B;  3AZN D;  1BH9 A;  5AVB B;  3KXB B;  3MGQ A;  5B2J B;  2RIQ A;  5CPI C;  2F8N K;  5B40 D;  1R4V A;  5B33 A;  2YFW B;  5CP6 D;  3W99 B;  5B24 D;  2DF4 C;  4JJN C;  3B0B A;  5DNM A;  3AV1 A;  5AV9 D;  3AZK A;  1HQ3 C;  1P3F A;  3W98 C;  2RVQ C;  3FDD A;  3AYW C;  1M1A B;  3TU4 B;  2Y2H A;  2Y2G A;  5CPI A;  3REJ C;  3X1S B;  5CPJ D;  4KGC D;  5B2I C;  3AZJ D;  5CPK D;  5AV6 A;  3AZL D;  1KX5 B;  4J8X C;  3MNN C;  2ZM5 A;  1HQ3 A;  4X23 B;  2VQR A;  4H9N B;  3AYW A;  1P3I C;  5AV8 D;  3VH5 A;  3REJ A;  1P34 D;  1U35 B;  5B2I A;  5AVB C;  4J8X A;  5DNN C;  5AY8 B;  3C1B B;  1AOI B;  2IO5 C;  2FJ7 B;  3UTA C;  2Y2K A;  2ZY5 A;  5GT3 D;  2PYO D;  1P3I A;  3LEL C;  1TZY B;  2HIO C;  3B0D B;  3A6N B;  2ARO D;  3MGR B;  1P3L A;  5B31 D;  1P3M D;  3X1S C;  5DNN A;  2CV5 D;  5F99 C;  3X1V D;  3AFA D;  1KX4 C;  4LD9 D;  3UTA A;  4ZBJ C;  1KX5 C;  3MGS D;  3LEL A;  2NQB D;  2HIO A;  3REI B;  3NQJ A;  4X23 C;  4WU9 C;  3LZ1 C;  3B6G D;  3WA9 A;  2Y2Q A;  3A1K A;  3B6F D;  4YM6 D;  5E5A D;  5AVC B;  3X1S A;  3REK D;  5F99 A;  1U35 C;  5GT0 B;  3REL B;  1KX4 A;  3WAA C;  3IP4 C;  1P3P B;  5GXQ C;  3X1U B;  3LZ0 D;  4Z66 D;  4J8U D;  1P3O B;  5FUG A;  4X23 A;  3C1B C;  1AOI C;  4WU9 A;  2FJ7 C;  1W2E A;  3LZ1 A;  3EPH A;  2Y2P A;  3O62 B;  4WNN B;  1BH9 B;  1TZY C;  3LJA D;  2F8N D;  3KWQ C;  3MGQ B;  2JSS A;  3B0D C;  4NFT A;  4XZQ C;  3MVD C;  2BYK A;  3AZG C;  4H9R B;  3AZI A;  3AV2 C;  3WAA A;  3AZH D;  5GXQ A;  1B67 A;  5DNM B;  4YS3 C;  5AV5 D;  3AV1 B;  3H0R C;  1P3G C;  3W96 D;  3AZK B;  1AOI A;  4R8P D;  3AN2 C;  3W97 D;  1P3B D;  5B40 C;  3KWQ A;  3REI C;  5CP6 C;  5B2J D;  4XZQ A;  1TAF A;  3H0L C;  4EO5 C;  5B24 C;  2L5A A;  3MVD A;  3AZG A;  5CPI B;  3AV2 A;  1M18 D;  5AV6 B;  3WKJ D;  4YS3 A;  1P3G A;  5GT0 C;  3AZN A;  1KU5 A;  3AN2 A;  5B40 A;  3NQU A;  5BT1 C;  3TU4 D;  5CPK C;  5CP6 A;  1B6W A;  3VH6 W;  5B24 A;  3REJ B;  5B2I B;  5B32 G;  4J8X B;  5JRG B;  1BH8 B;  3VH6 T;  4WJ3 C;  3AV1 C;  5AV8 C;  4WU8 B;  1P3I B;  5CPJ A;  5CPK A;  3REH B;  3AZF B;  1WWS A;  1KX3 D;  4WNN A;  3C1C D;  4J8W C;  2Y2L A;  1P3L B;  1JFI B;  2F2A C;  5DNN B;  4H9R A;  4XUJ B;  5AY8 D;  3AZE D;  2IO5 B;  5AV6 C;  1P3K D;  5BNV A;  3UTA B;  4QLC D;  5C3I C;  4AWL C;  1EQZ D;  5AV8 A;  3LEL B;  2HIO B;  3NQJ B;  4KHA A;  5B1M D;  1T3U A;  3EPL A;  4J8W A;  3MGR D;  3WA9 B;  2CV5 C;  3R45 B;  3AFA C;  3UT9 D;  5F99 B;  5GT3 A;  2PYO A;  1KX4 B;  3X1T D;  2NQB C;  4ZBJ B;  2ZY2 A;  3EPK A;  1ID3 B;  5B0Z B;  3WTP C;  1A7W A;  3V9R A;  3MGP D;  5JRG C;  2ARO A;  5FUG B;  5G49 A;  4WU9 B;  5B1L D;  3LZ1 B;  1P3M A;  5E5A C;  4WU8 C;  2CV5 A;  3X1V A;  3AFA A;  4J8V C;  3REH C;  4LD9 A;  3AZF C;  1S32 D;  3REL D;  2BYK B;  4CSR A;  2NQB A;  3AZI B;  3WAA B;  1P3L C;  5GXQ B;  3WTP A;  5B0Y B;  5BS7 A;  5JRG A;  4XUJ C;  1BH8 A;  3B6F A;  4YM6 A;  4ZUX D;  2XD5 A;  5E5A A;  4WU8 A;  1P3A D;  2JE5 A;  4J8V A;  3KWQ B;  3REH A;  3AZF A;  1H3O A;  3AZH C;  4XZQ B;  1TAF B;  3MVD B;  4Z66 A;  3WA9 C;  3AZG B;  5CHL B;  3AV2 B;  5B33 D;  1JFI A;  4Z5T C;  5GSU B;  2Y2J A;  4YS3 B;  5DNM D;  1P3G B;  4XUJ A;  4G92 C;  3W97 C;  3AZN B;  1P3F D;  1HTA A;  1ID3 C;  3AN2 B;  3UTB C;  2F8N A;  5B0Z C;  5B40 B;  3NQU B;  2J8P A;  1ZLA C;  3AZH A;  3H0M C;  5CP6 B;  4EO5 B;  5CPI D;  5B24 B;  5AV5 A;  3W96 A;  3WTP E;  3R45 A;  4G91 B;  4Z5T A;  4JJN D;  4UPK A;  3VH6 A;  3W97 A;  1P3B A;  3AZI C;  1HQ3 D;  4WZS B;  1ID3 A;  3W98 D;  3UTB A;  2RVQ D;  5B0Z A;  3KUY D;  1F66 D;  3B0C W;  3AYW D;  5B0Y C;  1ZLA A;  5CPJ B;  3AZJ B;  5CPK B;  2ZY3 A;  4KUD D;  3WKJ A;  3AZM C;  3B0C T;  3MNN D;  5BNV B;  5GSU C;  5B32 D;  5B0Y A;  5AV8 B;  1P34 B;  2NZD D;  1P3I D;  3AZN C;  3C1C C;  5JA4 A;  4KHA B;  2YFV A;  4E45 A;  1M19 D;  4J8W B;  3AZM A;  3KXB D;  5AVB D;  2G5H C;  3AZE C;  4QLC C;  1EQZ C;  4CAY A;  5GT3 B;  2PYO B;  5AV9 C;  4E44 A;  4G91 C;  5GSU A;  3W99 D;  5C3I B;  4AWL B;  4H9Q A;  3V9R B;  3LEL D;  2FFF B;  2ARO B;  3C1C A;  2HIO D;  5G49 B;  5B31 B;  1M1A D;  1P3M B;  2HUE C;  2CV5 B;  3X1V B;  5CPJ C;  4KGC C;  3AFA B;  3EG5 B;  3AZJ C;  3AZE A;  1P3K A;  4LD9 B;  3AZL C;  4QLC A;  3X1S D;  1EQZ A;  4UUZ A;  4CSR B;  5AV9 A;  3MGP C;  2NQB B;  1KX5 D;  3WTP B;  3P5J B;  4X23 D;  3B6F B;  4YM6 B;  3LZ1 D;  1ULY A;  1S32 C;  5E5A B;  2G5I C;  1P34 C;  3REK B;  4KGC A;  3EPJ A; 
#chains in the Genus database with same CATH homology
 4J8V B;  3AZJ A;  3X1T A;  2DQN C;  1H3O B;  3AZL A;  3LZ0 B;  1U35 D;  4Z66 B;  4J8U B;  3AL0 C;  3MGP A;  1Q9C A;  3WAA D;  5GXQ D;  5BO0 A;  5B1L A;  4ZUX C;  3KSY A;  3KFU G;  5GT3 C;  2PYO C;  3C1B D;  1AOI D;  2FJ7 D;  3LJA B;  2F8N B;  1F1E A;  1S32 A;  3F6T A;  1P34 A;  2ARO C;  1TZY D;  3AZH B;  3A6N D;  5B31 C;  3MVD D;  4DRB A;  1P3M C;  3AZG D;  5AV5 B;  3W96 B;  3X1V C;  4Z5T B;  4ZUX A;  4LD9 C;  4R8P B;  1P3G D;  4G92 B;  3W97 B;  1P3B B;  3MGS C;  2W8S A;  4H9S C;  3UTB B;  3AN2 D;  3B6G C;  5BS7 C;  2XD1 A;  4H9P A;  1M18 B;  1ZLA B;  3REI D;  3B6F C;  4YM6 C;  5B31 A;  3WKJ B;  3REK C;  5AVC D;  3LZ0 C;  3KUY C;  1F66 C;  4Z66 C;  5GT0 D;  3MGS A;  4J8U C;  4H9S A;  1P3P D;  3X1U D;  1P3O D;  4KUD C;  3B6G A;  5BT1 D;  2LY8 A;  5JA4 B;  3LJA C;  3O62 D;  4JJN A;  2YFV B;  3REK A;  3AZM B;  5KDM A;  3MGQ D;  3W98 A;  3LZ0 A;  3KUY A;  5B32 C;  1F66 A;  4J8U A;  2BYM A;  4CAY B;  3W96 C;  5AV5 C;  2NZD C;  4KUD A;  4R8P C;  3AV1 D;  1KX3 B;  4H9Q B;  3AZK D;  1P3B C;  1M19 C;  3C1C B;  3KXB C;  3LJA A;  5B2J C;  4J8W D;  3MNN A;  1M18 C;  1Z2C B;  3AZE B;  1P3K B;  2CWE A;  5B32 A;  3W99 C;  3WKJ C;  4QLC B;  1EQZ B;  2NZD A;  4UUZ B;  5AV9 B;  4NE3 A;  5AV6 D;  4R8P A;  5B1M B;  2Y2O A;  2JCH A;  1M19 A;  1M1A C;  3KXB A;  5AVB A;  1N1J B;  4H9O B;  3TU4 C;  5BNX B;  4HGA B;  5B2J A;  3UT9 B;  2HUE B;  1M18 A;  4KGC B;  2YFW A;  3X1T B;  3W99 A;  3REJ D;  3AZL B;  5B2I D;  3MGP B;  5BO0 B;  3WTP D;  5B1L B;  4J8X D;  5JRG D;  1M1A A;  4Z2M G;  3TU4 A;  1BFM A;  2BG1 A;  2ZY4 A;  1S32 B;  1KX3 C;  4WU8 D;  4J8V D;  3REH D;  4WV4 B;  3AZF D;  4Z2M H;  1KX5 A;  1P3L D;  5AY8 C;  4H9N A;  1P3K C;  4ZUX B;  3VH5 W;  2Y2N A;  5DNN D;  2Y2M A;  4XUJ D;  1P3A B;  3UTA D;  4DRA A;  5B1M C;  1KX3 A;  3A6N C;  1U35 A;  5B31 G;  4H9P B;  3MGR C;  3VH5 T;  5B33 B;  4DQY B;  4HGA C;  4NE5 A;  3UT9 C;  3WA9 D;  1PZR A;  5AY8 A;  4NE6 A;  3C1B A;  3X1T C;  4Z5T D;  1P3F B;  2Y2I A;  2FJ7 A;  5F99 D;  2UWX A;  3MGS B;  1KX4 D;  1TZY A;  1ID3 D;  3UTB D;  5B1M A;  5B0Z D;  5B1L C;  3A6N A;  3B6G B;  3MGR A;  1ZLA D;  1N1J A;  4H9O A;  4WU9 D;  5BNX A;  3UT9 A;  4JJN B;  5AVC C;  3REL C;  5KDM B;  1HQ3 B;  3W98 B;  3KUY B;  1P3P C;  3X1U C;  1F66 B;  3AYW B;  1P3O C;  2BYM B;  3AZI D;  3REI A;  4KUD B;  2F8N G;  5B0Y D;  4M6B A;  3O62 C;  1P3A C;  3MGQ C;  5AVC A;  3AZM D;  5GT0 A;  3MNN B;  3REL A;  2F8N H;  3KWQ D;  5B33 C;  1WWI A;  1P3P A;  4XZQ D;  5B32 B;  3X1U A;  1P3O A;  5DNM C;  3AV2 D;  2NZD B;  3A1I A;  3AZK C;  5GSU D;  1P3F C;  4YS3 D;  3O62 A;  1P3A A;  1M19 B;  3AZN D;  1BH9 A;  5AVB B;  3KXB B;  3MGQ A;  5B2J B;  2RIQ A;  5CPI C;  2F8N K;  5B40 D;  1R4V A;  5B33 A;  2YFW B;  5CP6 D;  3W99 B;  5B24 D;  2DF4 C;  4JJN C;  3B0B A;  5DNM A;  3AV1 A;  5AV9 D;  3AZK A;  1HQ3 C;  1P3F A;  3W98 C;  2RVQ C;  3FDD A;  3AYW C;  1M1A B;  3TU4 B;  2Y2H A;  2Y2G A;  5CPI A;  3REJ C;  3X1S B;  5CPJ D;  4KGC D;  5B2I C;  3AZJ D;  5CPK D;  5AV6 A;  3AZL D;  1KX5 B;  4J8X C;  3MNN C;  2ZM5 A;  1HQ3 A;  4X23 B;  2VQR A;  4H9N B;  3AYW A;  1P3I C;  5AV8 D;  3VH5 A;  3REJ A;  1P34 D;  1U35 B;  5B2I A;  5AVB C;  4J8X A;  5DNN C;  5AY8 B;  3C1B B;  1AOI B;  2IO5 C;  2FJ7 B;  3UTA C;  2Y2K A;  2ZY5 A;  5GT3 D;  2PYO D;  1P3I A;  3LEL C;  1TZY B;  2HIO C;  3B0D B;  3A6N B;  2ARO D;  3MGR B;  1P3L A;  5B31 D;  1P3M D;  3X1S C;  5DNN A;  2CV5 D;  5F99 C;  3X1V D;  3AFA D;  1KX4 C;  4LD9 D;  3UTA A;  4ZBJ C;  1KX5 C;  3MGS D;  3LEL A;  2NQB D;  2HIO A;  3REI B;  3NQJ A;  4X23 C;  4WU9 C;  3LZ1 C;  3B6G D;  3WA9 A;  2Y2Q A;  3A1K A;  3B6F D;  4YM6 D;  5E5A D;  5AVC B;  3X1S A;  3REK D;  5F99 A;  1U35 C;  5GT0 B;  3REL B;  1KX4 A;  3WAA C;  3IP4 C;  1P3P B;  5GXQ C;  3X1U B;  3LZ0 D;  4Z66 D;  4J8U D;  1P3O B;  5FUG A;  4X23 A;  3C1B C;  1AOI C;  4WU9 A;  2FJ7 C;  1W2E A;  3LZ1 A;  3EPH A;  2Y2P A;  3O62 B;  4WNN B;  1BH9 B;  1TZY C;  3LJA D;  2F8N D;  3KWQ C;  3MGQ B;  2JSS A;  3B0D C;  4NFT A;  4XZQ C;  3MVD C;  2BYK A;  3AZG C;  4H9R B;  3AZI A;  3AV2 C;  3WAA A;  3AZH D;  5GXQ A;  1B67 A;  5DNM B;  4YS3 C;  5AV5 D;  3AV1 B;  3H0R C;  1P3G C;  3W96 D;  3AZK B;  1AOI A;  4R8P D;  3AN2 C;  3W97 D;  1P3B D;  5B40 C;  3KWQ A;  3REI C;  5CP6 C;  5B2J D;  4XZQ A;  1TAF A;  3H0L C;  4EO5 C;  5B24 C;  2L5A A;  3MVD A;  3AZG A;  5CPI B;  3AV2 A;  1M18 D;  5AV6 B;  3WKJ D;  4YS3 A;  1P3G A;  5GT0 C;  3AZN A;  1KU5 A;  3AN2 A;  5B40 A;  3NQU A;  5BT1 C;  3TU4 D;  5CPK C;  5CP6 A;  1B6W A;  3VH6 W;  5B24 A;  3REJ B;  5B2I B;  5B32 G;  4J8X B;  5JRG B;  1BH8 B;  3VH6 T;  4WJ3 C;  3AV1 C;  5AV8 C;  4WU8 B;  1P3I B;  5CPJ A;  5CPK A;  3REH B;  3AZF B;  1WWS A;  1KX3 D;  4WNN A;  3C1C D;  4J8W C;  2Y2L A;  1P3L B;  1JFI B;  2F2A C;  5DNN B;  4H9R A;  4XUJ B;  5AY8 D;  3AZE D;  2IO5 B;  5AV6 C;  1P3K D;  5BNV A;  3UTA B;  4QLC D;  5C3I C;  4AWL C;  1EQZ D;  5AV8 A;  3LEL B;  2HIO B;  3NQJ B;  4KHA A;  5B1M D;  1T3U A;  3EPL A;  4J8W A;  3MGR D;  3WA9 B;  2CV5 C;  3R45 B;  3AFA C;  3UT9 D;  5F99 B;  5GT3 A;  2PYO A;  1KX4 B;  3X1T D;  2NQB C;  4ZBJ B;  2ZY2 A;  3EPK A;  1ID3 B;  5B0Z B;  3WTP C;  1A7W A;  3V9R A;  3MGP D;  5JRG C;  2ARO A;  5FUG B;  5G49 A;  4WU9 B;  5B1L D;  3LZ1 B;  1P3M A;  5E5A C;  4WU8 C;  2CV5 A;  3X1V A;  3AFA A;  4J8V C;  3REH C;  4LD9 A;  3AZF C;  1S32 D;  3REL D;  2BYK B;  4CSR A;  2NQB A;  3AZI B;  3WAA B;  1P3L C;  5GXQ B;  3WTP A;  5B0Y B;  5BS7 A;  5JRG A;  4XUJ C;  1BH8 A;  3B6F A;  4YM6 A;  4ZUX D;  2XD5 A;  5E5A A;  4WU8 A;  1P3A D;  2JE5 A;  4J8V A;  3KWQ B;  3REH A;  3AZF A;  1H3O A;  3AZH C;  4XZQ B;  1TAF B;  3MVD B;  4Z66 A;  3WA9 C;  3AZG B;  5CHL B;  3AV2 B;  5B33 D;  1JFI A;  4Z5T C;  5GSU B;  2Y2J A;  4YS3 B;  5DNM D;  1P3G B;  4XUJ A;  4G92 C;  3W97 C;  3AZN B;  1P3F D;  1HTA A;  1ID3 C;  3AN2 B;  3UTB C;  2F8N A;  5B0Z C;  5B40 B;  3NQU B;  2J8P A;  1ZLA C;  3AZH A;  3H0M C;  5CP6 B;  4EO5 B;  5CPI D;  5B24 B;  5AV5 A;  3W96 A;  3WTP E;  3R45 A;  4G91 B;  4Z5T A;  4JJN D;  4UPK A;  3VH6 A;  3W97 A;  1P3B A;  3AZI C;  1HQ3 D;  4WZS B;  1ID3 A;  3W98 D;  3UTB A;  2RVQ D;  5B0Z A;  3KUY D;  1F66 D;  3B0C W;  3AYW D;  5B0Y C;  1ZLA A;  5CPJ B;  3AZJ B;  5CPK B;  2ZY3 A;  4KUD D;  3WKJ A;  3AZM C;  3B0C T;  3MNN D;  5BNV B;  5GSU C;  5B32 D;  5B0Y A;  5AV8 B;  1P34 B;  2NZD D;  1P3I D;  3AZN C;  3C1C C;  5JA4 A;  4KHA B;  2YFV A;  4E45 A;  1M19 D;  4J8W B;  3AZM A;  3KXB D;  5AVB D;  2G5H C;  3AZE C;  4QLC C;  1EQZ C;  4CAY A;  5GT3 B;  2PYO B;  5AV9 C;  4E44 A;  4G91 C;  5GSU A;  3W99 D;  5C3I B;  4AWL B;  4H9Q A;  3V9R B;  3LEL D;  2FFF B;  2ARO B;  3C1C A;  2HIO D;  5G49 B;  5B31 B;  1M1A D;  1P3M B;  2HUE C;  2CV5 B;  3X1V B;  5CPJ C;  4KGC C;  3AFA B;  3EG5 B;  3AZJ C;  3AZE A;  1P3K A;  4LD9 B;  3AZL C;  4QLC A;  3X1S D;  1EQZ A;  4UUZ A;  4CSR B;  5AV9 A;  3MGP C;  2NQB B;  1KX5 D;  3WTP B;  3P5J B;  4X23 D;  3B6F B;  4YM6 B;  3LZ1 D;  1ULY A;  1S32 C;  5E5A B;  2G5I C;  1P34 C;  3REK B;  4KGC A;  3EPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...