1KU5A

Crystal structure of recombinant histone hpha from hyperthermophilic archaeon pyrococcus horikoshii ot3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
66
structure length
66
Chain Sequence
GELPIAPVDRLIRKAGAERVSEQAAKVLAEYLEEYAIEIAKKAVEFARHAGRKTVKVEDIKLAIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HPhA
publication title Structure based hyperthermostability of archaeal histone HPhA from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Dna binding protein
total genus 22
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1ku5A00
5F99B 3X1SC 4KGCC 1KX3D 3REIA 5E5AA 1P3AB 1EQZB 2CWEA 3REJC 5AY8B 5B31A 3AN2C 4Z66D 2NQBC 4QLCA 3AZHA 3REHC 3KUYC 3AZEC 1M19B 5KDMA 2YFVA 5AV9D 1ID3D 3X1SD 4KGCD 4QLCB 4E45A 3REJD 3AZHB 3AN2D 1HQ3A 5KDMB 3TU4C 2YFVB 1B6WA 2NQBD 3MNNB 2F8NG 5CPIC 3REHD 1U35C 3VH6A 3AZED 4WNNA 3KXBA 1HQ3B 4G91C 5GT3C 5AVBA 1AOIB 3C1CA 4J8VC 3LZ0C 5CPJC 3AZLA 5GXQC 3AYWA 3TU4D 2F8ND 3KXBB 1KX3A 5AVBB 5CPID 5AV5B 4Z66A 1WWIA 1U35D 3AZLB 4H9SA 4DRBA 5BS7A 3X1UC 4J8WA 5GT3D 5CPKA 1HTAA 1H3OB 5JA4A 3LZ0D 5CPJD 3MGPA 4YS3C 5AV9A 5GXQD 1P3FC 3UT9A 4J8WB 5CPKB 3MGPB 5JA4B 3MVDB 3AZMC 1B67A 5AV9B 3X1UD 4J8XC 5B1LC 3LELC 3UT9B 3AZNC 4ZBJC 3AZFC 2IO5C 3KUYA 3AZEA 1Q9CA 4KHAB 4YS3D 1P3LC 2F8NK 1P3FD 5AV8C 3B0BA 5B0ZB 3WTPC 4JJNC 5B1MB 1P3IC 3KUYB 5AV6C 3TU4A 3AZMD 3AZKC 2F8NH 4J8XD 4Z2MH 5B1LD 3LELD 3AZND 5BT1C 5CPIA 3AZFD 5GSUC 1U35A 3KWQA 2CV5B 1P3LD 3R45A 5AV8D 3W99C 4NE5A 3WTPD 4J8VA 1F66B 3W96C 4Z5TB 4JJND 3AZGC 3LZ1B 1P3ID 2PYOA 5GXQA 3KWQB 5AV6D 4H9PA 4EO5B 3LJAC 3R45B 3AZKD 2FJ7A 4M6BA 5B33B 3RELA 5BT1D 4J8VB 5GSUD 2JSSA 5B32C 5GXQB 2PYOB 5JRGA 4H9PB 2L5AA 3W99D 1ZLAA 2FJ7B 3RELB 3W97A 3WKJA 3W96D 3AZGD 3UTBC 1KX4C 1P3FA 4XZQB 3LJAD 1KX5C 5JRGB 5GT0C 3X1VC 3AV2C 1ZLAB 3W97B 3WKJB 3AZMA 5B2IC 4CSRA 5B32D 5AVCC 3A6NC 4J8XA 3AZNA 3AZFA 4G92B 4WZSB 4HGAB 3UTBD 5B2JC 1P3LA 1KX4D 3AZMB 3MGQA 4J8UB 5AV8A 1KX5D 3WTPA 5GT0D 3AV2D 3X1VD 3AZNB 4JJNA 3AZFB 1P3IA 3O62A 1N1JA 4WU9A 3W98A 5B2ID 1M18C 1KU5A 5AVCD 3A6ND 1P3LB 3REKA 3MGQB 3AZKA 3WTPB 5GSUA 2HUEB 3V9RA 3B6FC 5B2JD 1N1JB 3O62B 5E5AB 3REIB 4WU9B 3W98B 5B31B 3REKB 3W99A 2HIOC 4WU8C 3AFAA 3B6GC 1S32C 3MGRC 3V9RB 4LD9C 3AV1C 1M18D 4KUDA 3AFAB 5CP6A 2NZDC 2BYMA 4X23C 5B32A 3B6FD 1P34C 4KUDB 2HIOD 4WU8D 3B6GD 1S32D 3MGRD 3UTBA 1P3OC 5CP6B 2BYMB 3X1TC 3AZIA 5B32B 3AV1D 4LD9D 5GT0A 3X1VA 1TZYA 4WNNB 4UUZA 3VH5W 4NE3A 2NZDD 5B2IA 4X23D 3UTBB 4AWLB 3C1CB 1P34D 1P3PC 3AZIB 5DNNC 5GT0B 1TZYB 3AYWB 4R8PC 4UUZB 1P3MC 1KX3B 1P3OD 5B2JA 5B24C 3X1TD 4Z66B 5C3IC 2YFWA 1ID3A 3B0DB 5DNMC 3X1SA 4KGCA 1M18A 3REJA 3AN2A 1P3PD 1TAFA 2YFWB 5DNND 5B40C 1P3KC 2NQBA 1ID3B 4NE6A 4R8PD 3X1SB 1P3MD 4KGCB 3B6FA 3REHA 4ZUXC 5FUGA 5B24D 3REJB 1M1AD 3NQUA 3AN2B 2HIOA 4WU8A 1TAFB 5DNMD 2NQBB 1P3BC 4LD9A 3REHB 5FUGB 3AZEB 2F8NA 5B40D 3WA9C 1P3KD 1ULYA 3MGSC 3VH5T 4ZUXD 4LD9B 1P3GC 4CAYA 3WAAC 3VH6W 3C1BC 3KSYA 3TU4B 2F8NB 5GT3A 5F99C 3X1TA 1P3BD 3LZ0A 5CPJA 1P3AC 1EQZC 5CPIB 5AY8C 1U35B 4CAYB 3WA9D 4G91B 3MGSD 5GT3B 2BYKA 3X1TB 3LZ0B 5CPJB 1P3GD 4XUJD 5DNNA 3C1BD 1M19C 3WAAD 3X1UA 5B31G 5BNXA 4R8PA 5F99D 3AZJC 4QLCC 2BYKB 1EQZD 1P3AD 3AZHC 5AY8D 4YS3A 3X1UB 3MNNC 5BNXB 4R8PB 1BH8A 5C3IB 5B40A 4YS3B 1M19D 1P3FB 1HQ3C 5B1LA 3LELA 4ZUXA 3AZJD 1AOIC 4QLCD 1JFIA 2AROC 1F1EA 3AZHD 1BH8B 4CSRB 4J8XB 5G49A 3MNND 5B1LB 3LELB 4ZBJB 5AVBC 2IO5B 5AV5C 1JFIB 3NQJA 5AV6A 3WTPE 3AZLC 3MGSA 1HQ3D 5AV8B 5G49B 1AOID 5CHLB 4JJNB 1P3IB 2AROD 3C1BA 3NQJB 5AV6B 4E44A 5BS7C 3AZKB 4J8WC 1P3AA 3W96A 3AZGA 5AVBD 5CPKC 5GSUB 5AV5D 3MGPC 3MVDC 3LJAA 3AZLD 3UTAC 3W99B 3UT9C 3W96B 3AZGB 1M19A 3LJAB 5BNVA 3AZJA 5B0ZC 4J8WD 5B1MC 5CPKD 1KX4A 3MGPD 3MVDD 1KX5A 3MNNA 4H9QA 3AV2A 3UTAD 5BNVB 3UT9D 3AZJB 3B0CW 1KX4B 5AVCA 3A6NA 2CV5C 1A7WA 1KX5B 4H9QB 3AV2B 5B0YC 3X1VB 1AOIA 5B0ZD 4Z2MG 1F66C 2AROA 4Z5TC 5B1MD 3LZ1C 1BFMA 3KUYD 5B2IB 1M1AC 3KWQC 5AVCB 3A6NB 4EO5C 1R4VA 5B33C 5AV5A 2AROB 5B2JB 2PYOC 4YM6C 2CV5D 2FJ7C 5B0YD 3RELC 1H3OA 4H9RA 1F66D 4Z5TD 3LZ1D 2RVQC 1M18B 1BH9A 4XZQC 3KWQD 5JRGC 5B33D 3B6GA 1WWSA 1S32A 1ZLAC 3MGRA 4H9RB 3MVDA 4J8VD 3W97C 3WKJC 3AV1A 3B6FB 2PYOD 4YM6D 1BH9B 3UTAA 3NQUB 2HIOB 4WU8B 2FJ7D 3RELD 3B6GB 2NZDA 3B0CT 1S32B 4G92C 4X23A 3MGRB 4KHAA 4HGAC 2RVQD 1P34A 3AV1B 4XZQD 4J8UC 4XUJC 3UTAB 5JRGD 5B0ZA 1ZLAD 5B1MA 1P3OA 2NZDB 4X23B 3W97D 3WKJD 1P34B 4H9NA 3MGQC 2HUEC 1P3OB 2CV5A 3O62C 3REIC 4WU9C 5E5AC 1P3PA 3W98C 4J8UD 4H9NB 5B31C 3REKC 5B0YA 1F66A 1P3MA 4Z5TA 3LZ1A 1M1AA 5B24A 1P3PB 4DRAA 3MGQD 5B33A 5DNNB 5DNMA 5B0YB 5BO0A 3AFAC 1P3MB 4YM6A 3O62D 5B24B 4WU9D 5E5AD 3REID 1M1AB 3W98D 5B31D 3REKD 1P3KA 4KUDC 4H9OA 5DNMB 5BO0B 4WV4B 5CP6C 4XZQA 4YM6B 3VH6T 5B32G 5B40B 1P3KB 3KXBC 3AFAD 4H9OB 1P3BA 4ZUXB 4AWLC 3C1CC 3AZIC 3WA9A 4KUDD 1TZYC 3AYWC 3VH5A 1KX3C 5CP6D 1P3BB 4J8UA 4XUJA 1P3GA 3WAAA 4Z66C 2LY8A 3B0DC 3WA9B 5F99A 4H9SC 3MGSB 4NFTA 3KXBD 1EQZA 5AY8A 3C1CD 1P3GB 4XUJB 3AZID 3C1BB 3WAAB 5AV9C 1ID3C 1TZYD 3AYWD
chains in the Genus database with same CATH superfamily
5F99B 3X1SC 4KGCC 1KX3D 3REIA 2W8SA 5E5AA 1P3AB 1EQZB 2CWEA 3REJC 2Y2GA 5B31A 5AY8B 3AN2C 4Z66D 2NQBC 4QLCA 3AZHA 3REHC 3KUYC 3AZEC 1M19B 5KDMA 2YFVA 5AV9D 1ID3D 2Y2HA 3X1SD 4KGCD 4QLCB 4E45A 3REJD 3AZHB 3AN2D 1HQ3A 5KDMB 3TU4C 2F2AC 2YFVB 1B6WA 2NQBD 3MNNB 2F8NG 3H0MC 5CPIC 3REHD 1U35C 3VH6A 3AZED 4WNNA 3KXBA 1HQ3B 4G91C 5GT3C 5AVBA 1AOIB 2ZY5A 3C1CA 4J8VC 3LZ0C 5CPJC 3AZLA 2BG1A 5GXQC 3AYWA 3TU4D 2F8ND 3KXBB 1KX3A 5AVBB 5CPID 5AV5B 4Z66A 1WWIA 1U35D 3AZLB 4H9SA 4DRBA 5BS7A 3X1UC 4J8WA 5GT3D 5CPKA 1HTAA 1H3OB 5JA4A 3LZ0D 2G5IC 2Y2JA 5CPJD 3MGPA 4YS3C 5AV9A 5GXQD 1P3FC 3UT9A 3AL0C 4J8WB 3EPLA 2Y2QA 5CPKB 2J8PA 5JA4B 3MVDB 3MGPB 3AZMC 1B67A 5AV9B 3X1UD 4J8XC 5B1LC 3LELC 3UT9B 3AZNC 4ZBJC 3AZFC 2IO5C 4DQYB 3KUYA 3AZEA 1Q9CA 4KHAB 4YS3D 1P3LC 2F8NK 1P3FD 5AV8C 3B0BA 5B0ZB 3WTPC 4JJNC 5B1MB 1P3IC 3KUYB 5AV6C 3TU4A 3AZMD 3AZKC 2F8NH 4J8XD 4Z2MH 5B1LD 3LELD 3AZND 5BT1C 5CPIA 3AZFD 5GSUC 1U35A 3KWQA 2CV5B 1P3LD 3R45A 5AV8D 3W99C 4NE5A 3WTPD 4J8VA 1F66B 2Y2MA 3W96C 4Z5TB 4JJND 3AZGC 3LZ1B 1P3ID 2PYOA 5GXQA 3KWQB 5AV6D 4H9PA 4EO5B 3LJAC 3R45B 3AZKD 2FJ7A 2VQRA 4M6BA 5B33B 3RELA 5BT1D 4J8VB 5GSUD 2JSSA 5B32C 5GXQB 2PYOB 5JRGA 4H9PB 2FFFB 2L5AA 3W99D 1ZLAA 2FJ7B 3RELB 3P5JB 3W97A 3WKJA 3W96D 3AZGD 3UTBC 1KX4C 2ZY2A 1P3FA 4XZQB 3LJAD 1KX5C 5JRGB 5GT0C 3X1VC 3AV2C 1ZLAB 3A1IA 3W97B 3WKJB 3AZMA 5B2IC 4CSRA 5B32D 5AVCC 3A6NC 4J8XA 3AZNA 3AZFA 4G92B 4WZSB 4HGAB 3UTBD 5B2JC 1P3LA 1KX4D 3AZMB 3MGQA 4J8UB 5AV8A 1KX5D 3WTPA 5GT0D 1T3UA 3AV2D 3AZNB 3X1VD 4JJNA 3AZFB 1P3IA 3O62A 1N1JA 4WU9A 3W98A 5B2ID 1M18C 1KU5A 5AVCD 3A6ND 1P3LB 3REKA 3MGQB 3AZKA 3WTPB 5GSUA 2HUEB 3V9RA 2ZM5A 3B6FC 5B2JD 1N1JB 3O62B 5E5AB 3REIB 4WU9B 3W98B 5B31B 3REKB 3W99A 2HIOC 4WU8C 3AFAA 3B6GC 1S32C 3MGRC 3V9RB 4LD9C 3AV1C 1M18D 4KUDA 3AFAB 5CP6A 2NZDC 2BYMA 4X23C 5B32A 3B6FD 1P34C 1W2EA 4KUDB 2HIOD 4WU8D 3IP4C 3B6GD 1S32D 3FDDA 3MGRD 3UTBA 1P3OC 5CP6B 2BYMB 3X1TC 3AZIA 5B32B 3AV1D 4LD9D 5GT0A 3X1VA 1TZYA 4WNNB 4UUZA 3VH5W 4NE3A 2NZDD 5B2IA 4X23D 3UTBB 4AWLB 3C1CB 1P34D 1P3PC 3AZIB 5DNNC 5GT0B 1TZYB 3AYWB 4R8PC 2Y2NA 4UUZB 1P3MC 1KX3B 1P3OD 5B2JA 5B24C 3X1TD 4Z66B 5C3IC 2YFWA 3EPHA 1ID3A 3B0DB 5DNMC 3X1SA 4KGCA 1M18A 3REJA 3AN2A 1P3PD 2JE5A 1TAFA 2YFWB 5DNND 5B40C 1P3KC 2NQBA 1ID3B 4NE6A 4R8PD 3X1SB 1P3MD 4KGCB 3B6FA 3REHA 4ZUXC 5FUGA 5B24D 3REJB 1M1AD 2JCHA 3NQUA 3AN2B 2HIOA 4WU8A 1TAFB 5DNMD 2NQBB 3EPJA 1P3BC 4LD9A 3REHB 1PZRA 5FUGB 3AZEB 2F8NA 5B40D 3WA9C 1P3KD 1ULYA 3MGSC 3VH5T 4ZUXD 4LD9B 1P3GC 2DQNC 4CAYA 3WAAC 3VH6W 3C1BC 3KSYA 3TU4B 2F8NB 5GT3A 5F99C 3X1TA 1P3BD 3LZ0A 5CPJA 1P3AC 1EQZC 5CPIB 5AY8C 1U35B 2XD1A 4CAYB 3WA9D 4G91B 3MGSD 5GT3B 2BYKA 4WJ3C 3X1TB 3LZ0B 5CPJB 1P3GD 4XUJD 5DNNA 3C1BD 1M19C 3WAAD 3X1UA 5B31G 5BNXA 4R8PA 5F99D 3AZJC 4QLCC 2BYKB 1EQZD 1P3AD 3AZHC 5AY8D 4YS3A 3X1UB 3MNNC 5BNXB 4R8PB 1BH8A 5C3IB 5B40A 4YS3B 1M19D 1P3FB 1HQ3C 5B1LA 3LELA 4ZUXA 3AZJD 1AOIC 4QLCD 1JFIA 2AROC 1F1EA 3AZHD 1BH8B 4CSRB 4J8XB 5G49A 3MNND 5B1LB 3LELB 4ZBJB 5AVBC 2IO5B 5AV5C 1JFIB 3NQJA 5AV6A 3WTPE 3AZLC 2RIQA 3MGSA 1HQ3D 5AV8B 5G49B 3F6TA 1AOID 5CHLB 4JJNB 1P3IB 2AROD 3C1BA 3NQJB 5AV6B 4E44A 5BS7C 3AZKB 2Y2OA 4J8WC 1P3AA 3W96A 3AZGA 5AVBD 3EPKA 5CPKC 5GSUB 5AV5D 3MGPC 3MVDC 3LJAA 3AZLD 3UTAC 2Y2KA 2Y2PA 3W99B 3UT9C 3W96B 3AZGB 1M19A 3LJAB 5BNVA 3AZJA 5B0ZC 4J8WD 5B1MC 5CPKD 1KX4A 3MGPD 3MVDD 1KX5A 3MNNA 4H9QA 3AV2A 3UTAD 5BNVB 3UT9D 3AZJB 3B0CW 1KX4B 5AVCA 3A6NA 2Y2IA 2CV5C 1A7WA 1KX5B 2XD5A 4H9QB 3AV2B 5B0YC 3X1VB 1AOIA 5B0ZD 4Z2MG 1F66C 2AROA 4Z5TC 5B1MD 3LZ1C 1BFMA 3KUYD 2Y2LA 5B2IB 3KWQC 1M1AC 5AVCB 3A6NB 4EO5C 1R4VA 5B33C 5AV5A 2AROB 5B2JB 2PYOC 4YM6C 2CV5D 2FJ7C 5B0YD 3RELC 1H3OA 4H9RA 1F66D 4Z5TD 3LZ1D 2RVQC 1M18B 1BH9A 4XZQC 3KWQD 3A1KA 5JRGC 5B33D 3B6GA 1WWSA 1S32A 1ZLAC 3MGRA 4H9RB 3MVDA 4J8VD 3W97C 3WKJC 3AV1A 3B6FB 2PYOD 4YM6D 1BH9B 1Z2CB 3UTAA 3H0RC 3NQUB 2HIOB 4WU8B 2FJ7D 3RELD 3B6GB 2NZDA 3B0CT 1S32B 4G92C 4X23A 3MGRB 4KHAA 4HGAC 2RVQD 1P34A 2ZY4A 4XZQD 3AV1B 4J8UC 4XUJC 3UTAB 2G5HC 5JRGD 5B0ZA 1ZLAD 5B1MA 1P3OA 2NZDB 4X23B 3W97D 3WKJD 1P34B 4H9NA 3MGQC 4UPKA 2HUEC 1P3OB 2CV5A 3O62C 3REIC 4WU9C 5E5AC 1P3PA 3W98C 4J8UD 4H9NB 5B31C 3REKC 5B0YA 1F66A 1P3MA 4Z5TA 3LZ1A 1M1AA 5B24A 1P3PB 4DRAA 3MGQD 5B33A 5DNNB 5DNMA 5B0YB 3EG5B 5BO0A 3AFAC 1P3MB 4YM6A 3KFUG 3O62D 5B24B 4WU9D 5E5AD 3REID 1M1AB 3W98D 3H0LC 5B31D 3REKD 1P3KA 4KUDC 4H9OA 5DNMB 5BO0B 4WV4B 5CP6C 4XZQA 4YM6B 3VH6T 5B32G 5B40B 1P3KB 3KXBC 3AFAD 4H9OB 1P3BA 2ZY3A 4ZUXB 4AWLC 3C1CC 3AZIC 3WA9A 4KUDD 1TZYC 3AYWC 3VH5A 1KX3C 5CP6D 1P3BB 4J8UA 4XUJA 1P3GA 3WAAA 4Z66C 2LY8A 2UWXA 3B0DC 3WA9B 5F99A 4H9SC 3MGSB 4NFTA 3KXBD 1EQZA 5AY8A 3C1CD 1P3GB 4XUJB 3AZID 3C1BB 3WAAB 2DF4C 5AV9C 1ID3C 1TZYD 3AYWD
chains in the Genus database with same CATH topology
5F99B 3X1SC 4KGCC 1KX3D 3REIA 2W8SA 5E5AA 1P3AB 1EQZB 2CWEA 3REJC 2Y2GA 5B31A 5AY8B 3AN2C 4Z66D 2NQBC 4QLCA 3AZHA 3REHC 3KUYC 3AZEC 1M19B 5KDMA 2YFVA 5AV9D 1ID3D 2Y2HA 3X1SD 4KGCD 4QLCB 4E45A 3REJD 3AZHB 3AN2D 1HQ3A 5KDMB 3TU4C 2F2AC 2YFVB 1B6WA 2NQBD 3MNNB 2F8NG 3H0MC 5CPIC 3REHD 1U35C 3VH6A 3AZED 4WNNA 3KXBA 1HQ3B 4G91C 5GT3C 5AVBA 1AOIB 2ZY5A 3C1CA 4J8VC 3LZ0C 5CPJC 3AZLA 2BG1A 5GXQC 3AYWA 3TU4D 2F8ND 3KXBB 1KX3A 5AVBB 5CPID 5AV5B 4Z66A 1WWIA 1U35D 3AZLB 4H9SA 4DRBA 5BS7A 3X1UC 4J8WA 5GT3D 5CPKA 1HTAA 1H3OB 5JA4A 3LZ0D 2G5IC 2Y2JA 5CPJD 3MGPA 4YS3C 5AV9A 5GXQD 1P3FC 3UT9A 3AL0C 4J8WB 3EPLA 2Y2QA 5CPKB 2J8PA 5JA4B 3MVDB 3MGPB 3AZMC 1B67A 5AV9B 3X1UD 4J8XC 5B1LC 3LELC 3UT9B 3AZNC 4ZBJC 3AZFC 2IO5C 4DQYB 3KUYA 3AZEA 1Q9CA 4KHAB 4YS3D 1P3LC 2F8NK 1P3FD 5AV8C 3B0BA 5B0ZB 3WTPC 4JJNC 5B1MB 1P3IC 3KUYB 5AV6C 3TU4A 3AZMD 3AZKC 2F8NH 4J8XD 4Z2MH 5B1LD 3LELD 3AZND 5BT1C 5CPIA 3AZFD 5GSUC 1U35A 3KWQA 2CV5B 1P3LD 3R45A 5AV8D 3W99C 4NE5A 3WTPD 4J8VA 1F66B 2Y2MA 3W96C 4Z5TB 4JJND 3AZGC 3LZ1B 1P3ID 2PYOA 5GXQA 3KWQB 5AV6D 4H9PA 4EO5B 3LJAC 3R45B 3AZKD 2FJ7A 2VQRA 4M6BA 5B33B 3RELA 5BT1D 4J8VB 5GSUD 2JSSA 5B32C 5GXQB 2PYOB 5JRGA 4H9PB 2FFFB 2L5AA 3W99D 1ZLAA 2FJ7B 3RELB 3P5JB 3W97A 3WKJA 3W96D 3AZGD 3UTBC 1KX4C 2ZY2A 1P3FA 4XZQB 3LJAD 1KX5C 5JRGB 5GT0C 3X1VC 3AV2C 1ZLAB 3A1IA 3W97B 3WKJB 3AZMA 5B2IC 4CSRA 5B32D 5AVCC 3A6NC 4J8XA 3AZNA 3AZFA 4G92B 4WZSB 4HGAB 3UTBD 5B2JC 1P3LA 1KX4D 3AZMB 3MGQA 4J8UB 5AV8A 1KX5D 3WTPA 5GT0D 1T3UA 3AV2D 3AZNB 3X1VD 4JJNA 3AZFB 1P3IA 3O62A 1N1JA 4WU9A 3W98A 5B2ID 1M18C 1KU5A 5AVCD 3A6ND 1P3LB 3REKA 3MGQB 3AZKA 3WTPB 5GSUA 2HUEB 3V9RA 2ZM5A 3B6FC 5B2JD 1N1JB 3O62B 5E5AB 3REIB 4WU9B 3W98B 5B31B 3REKB 3W99A 2HIOC 4WU8C 3AFAA 3B6GC 1S32C 3MGRC 3V9RB 4LD9C 3AV1C 1M18D 4KUDA 3AFAB 5CP6A 2NZDC 2BYMA 4X23C 5B32A 3B6FD 1P34C 1W2EA 4KUDB 2HIOD 4WU8D 3IP4C 3B6GD 1S32D 3FDDA 3MGRD 3UTBA 1P3OC 5CP6B 2BYMB 3X1TC 3AZIA 5B32B 3AV1D 4LD9D 5GT0A 3X1VA 1TZYA 4WNNB 4UUZA 3VH5W 4NE3A 2NZDD 5B2IA 4X23D 3UTBB 4AWLB 3C1CB 1P34D 1P3PC 3AZIB 5DNNC 5GT0B 1TZYB 3AYWB 4R8PC 2Y2NA 4UUZB 1P3MC 1KX3B 1P3OD 5B2JA 5B24C 3X1TD 4Z66B 5C3IC 2YFWA 3EPHA 1ID3A 3B0DB 5DNMC 3X1SA 4KGCA 1M18A 3REJA 3AN2A 1P3PD 2JE5A 1TAFA 2YFWB 5DNND 5B40C 1P3KC 2NQBA 1ID3B 4NE6A 4R8PD 3X1SB 1P3MD 4KGCB 3B6FA 3REHA 4ZUXC 5FUGA 5B24D 3REJB 1M1AD 2JCHA 3NQUA 3AN2B 2HIOA 4WU8A 1TAFB 5DNMD 2NQBB 3EPJA 1P3BC 4LD9A 3REHB 1PZRA 5FUGB 3AZEB 2F8NA 5B40D 3WA9C 1P3KD 1ULYA 3MGSC 3VH5T 4ZUXD 4LD9B 1P3GC 2DQNC 4CAYA 3WAAC 3VH6W 3C1BC 3KSYA 3TU4B 2F8NB 5GT3A 5F99C 3X1TA 1P3BD 3LZ0A 5CPJA 1P3AC 1EQZC 5CPIB 5AY8C 1U35B 2XD1A 4CAYB 3WA9D 4G91B 3MGSD 5GT3B 2BYKA 4WJ3C 3X1TB 3LZ0B 5CPJB 1P3GD 4XUJD 5DNNA 3C1BD 1M19C 3WAAD 3X1UA 5B31G 5BNXA 4R8PA 5F99D 3AZJC 4QLCC 2BYKB 1EQZD 1P3AD 3AZHC 5AY8D 4YS3A 3X1UB 3MNNC 5BNXB 4R8PB 1BH8A 5C3IB 5B40A 4YS3B 1M19D 1P3FB 1HQ3C 5B1LA 3LELA 4ZUXA 3AZJD 1AOIC 4QLCD 1JFIA 2AROC 1F1EA 3AZHD 1BH8B 4CSRB 4J8XB 5G49A 3MNND 5B1LB 3LELB 4ZBJB 5AVBC 2IO5B 5AV5C 1JFIB 3NQJA 5AV6A 3WTPE 3AZLC 2RIQA 3MGSA 1HQ3D 5AV8B 5G49B 3F6TA 1AOID 5CHLB 4JJNB 1P3IB 2AROD 3C1BA 3NQJB 5AV6B 4E44A 5BS7C 3AZKB 2Y2OA 4J8WC 1P3AA 3W96A 3AZGA 5AVBD 3EPKA 5CPKC 5GSUB 5AV5D 3MGPC 3MVDC 3LJAA 3AZLD 3UTAC 2Y2KA 2Y2PA 3W99B 3UT9C 3W96B 3AZGB 1M19A 3LJAB 5BNVA 3AZJA 5B0ZC 4J8WD 5B1MC 5CPKD 1KX4A 3MGPD 3MVDD 1KX5A 3MNNA 4H9QA 3AV2A 3UTAD 5BNVB 3UT9D 3AZJB 3B0CW 1KX4B 5AVCA 3A6NA 2Y2IA 2CV5C 1A7WA 1KX5B 2XD5A 4H9QB 3AV2B 5B0YC 3X1VB 1AOIA 5B0ZD 4Z2MG 1F66C 2AROA 4Z5TC 5B1MD 3LZ1C 1BFMA 3KUYD 2Y2LA 5B2IB 3KWQC 1M1AC 5AVCB 3A6NB 4EO5C 1R4VA 5B33C 5AV5A 2AROB 5B2JB 2PYOC 4YM6C 2CV5D 2FJ7C 5B0YD 3RELC 1H3OA 4H9RA 1F66D 4Z5TD 3LZ1D 2RVQC 1M18B 1BH9A 4XZQC 3KWQD 3A1KA 5JRGC 5B33D 3B6GA 1WWSA 1S32A 1ZLAC 3MGRA 4H9RB 3MVDA 4J8VD 3W97C 3WKJC 3AV1A 3B6FB 2PYOD 4YM6D 1BH9B 1Z2CB 3UTAA 3H0RC 3NQUB 2HIOB 4WU8B 2FJ7D 3RELD 3B6GB 2NZDA 3B0CT 1S32B 4G92C 4X23A 3MGRB 4KHAA 4HGAC 2RVQD 1P34A 2ZY4A 4XZQD 3AV1B 4J8UC 4XUJC 3UTAB 2G5HC 5JRGD 5B0ZA 1ZLAD 5B1MA 1P3OA 2NZDB 4X23B 3W97D 3WKJD 1P34B 4H9NA 3MGQC 4UPKA 2HUEC 1P3OB 2CV5A 3O62C 3REIC 4WU9C 5E5AC 1P3PA 3W98C 4J8UD 4H9NB 5B31C 3REKC 5B0YA 1F66A 1P3MA 4Z5TA 3LZ1A 1M1AA 5B24A 1P3PB 4DRAA 3MGQD 5B33A 5DNNB 5DNMA 5B0YB 3EG5B 5BO0A 3AFAC 1P3MB 4YM6A 3KFUG 3O62D 5B24B 4WU9D 5E5AD 3REID 1M1AB 3W98D 3H0LC 5B31D 3REKD 1P3KA 4KUDC 4H9OA 5DNMB 5BO0B 4WV4B 5CP6C 4XZQA 4YM6B 3VH6T 5B32G 5B40B 1P3KB 3KXBC 3AFAD 4H9OB 1P3BA 2ZY3A 4ZUXB 4AWLC 3C1CC 3AZIC 3WA9A 4KUDD 1TZYC 3AYWC 3VH5A 1KX3C 5CP6D 1P3BB 4J8UA 4XUJA 1P3GA 3WAAA 4Z66C 2LY8A 2UWXA 3B0DC 3WA9B 5F99A 4H9SC 3MGSB 4NFTA 3KXBD 1EQZA 5AY8A 3C1CD 1P3GB 4XUJB 3AZID 3C1BB 3WAAB 2DF4C 5AV9C 1ID3C 1TZYD 3AYWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F99 B;  3X1S C;  4KGC C;  1KX3 D;  3REI A;  5E5A A;  1P3A B;  1EQZ B;  2CWE A;  3REJ C;  5AY8 B;  5B31 A;  3AN2 C;  4Z66 D;  2NQB C;  4QLC A;  3AZH A;  3REH C;  3KUY C;  3AZE C;  1M19 B;  5KDM A;  2YFV A;  5AV9 D;  1ID3 D;  3X1S D;  4KGC D;  4QLC B;  4E45 A;  3REJ D;  3AZH B;  3AN2 D;  1HQ3 A;  5KDM B;  3TU4 C;  2YFV B;  1B6W A;  2NQB D;  3MNN B;  2F8N G;  5CPI C;  3REH D;  1U35 C;  3VH6 A;  3AZE D;  4WNN A;  3KXB A;  1HQ3 B;  4G91 C;  5GT3 C;  5AVB A;  1AOI B;  3C1C A;  4J8V C;  3LZ0 C;  5CPJ C;  3AZL A;  5GXQ C;  3AYW A;  3TU4 D;  2F8N D;  3KXB B;  1KX3 A;  5AVB B;  5CPI D;  5AV5 B;  4Z66 A;  1WWI A;  1U35 D;  3AZL B;  4H9S A;  4DRB A;  5BS7 A;  3X1U C;  4J8W A;  5GT3 D;  5CPK A;  1HTA A;  1H3O B;  5JA4 A;  3LZ0 D;  5CPJ D;  3MGP A;  4YS3 C;  5AV9 A;  5GXQ D;  1P3F C;  3UT9 A;  4J8W B;  5CPK B;  3MGP B;  5JA4 B;  3MVD B;  3AZM C;  1B67 A;  5AV9 B;  3X1U D;  4J8X C;  5B1L C;  3LEL C;  3UT9 B;  3AZN C;  4ZBJ C;  3AZF C;  2IO5 C;  3KUY A;  3AZE A;  1Q9C A;  4KHA B;  4YS3 D;  1P3L C;  2F8N K;  1P3F D;  5AV8 C;  3B0B A;  5B0Z B;  3WTP C;  4JJN C;  5B1M B;  1P3I C;  3KUY B;  5AV6 C;  3TU4 A;  3AZM D;  3AZK C;  2F8N H;  4J8X D;  4Z2M H;  5B1L D;  3LEL D;  3AZN D;  5BT1 C;  5CPI A;  3AZF D;  5GSU C;  1U35 A;  3KWQ A;  2CV5 B;  1P3L D;  3R45 A;  5AV8 D;  3W99 C;  4NE5 A;  3WTP D;  4J8V A;  1F66 B;  3W96 C;  4Z5T B;  4JJN D;  3AZG C;  3LZ1 B;  1P3I D;  2PYO A;  5GXQ A;  3KWQ B;  5AV6 D;  4H9P A;  4EO5 B;  3LJA C;  3R45 B;  3AZK D;  2FJ7 A;  4M6B A;  5B33 B;  3REL A;  5BT1 D;  4J8V B;  5GSU D;  2JSS A;  5B32 C;  5GXQ B;  2PYO B;  5JRG A;  4H9P B;  2L5A A;  3W99 D;  1ZLA A;  2FJ7 B;  3REL B;  3W97 A;  3WKJ A;  3W96 D;  3AZG D;  3UTB C;  1KX4 C;  1P3F A;  4XZQ B;  3LJA D;  1KX5 C;  5JRG B;  5GT0 C;  3X1V C;  3AV2 C;  1ZLA B;  3W97 B;  3WKJ B;  3AZM A;  5B2I C;  4CSR A;  5B32 D;  5AVC C;  3A6N C;  4J8X A;  3AZN A;  3AZF A;  4G92 B;  4WZS B;  4HGA B;  3UTB D;  5B2J C;  1P3L A;  1KX4 D;  3AZM B;  3MGQ A;  4J8U B;  5AV8 A;  1KX5 D;  3WTP A;  5GT0 D;  3AV2 D;  3X1V D;  3AZN B;  4JJN A;  3AZF B;  1P3I A;  3O62 A;  1N1J A;  4WU9 A;  3W98 A;  5B2I D;  1M18 C;  1KU5 A;  5AVC D;  3A6N D;  1P3L B;  3REK A;  3MGQ B;  3AZK A;  3WTP B;  5GSU A;  2HUE B;  3V9R A;  3B6F C;  5B2J D;  1N1J B;  3O62 B;  5E5A B;  3REI B;  4WU9 B;  3W98 B;  5B31 B;  3REK B;  3W99 A;  2HIO C;  4WU8 C;  3AFA A;  3B6G C;  1S32 C;  3MGR C;  3V9R B;  4LD9 C;  3AV1 C;  1M18 D;  4KUD A;  3AFA B;  5CP6 A;  2NZD C;  2BYM A;  4X23 C;  5B32 A;  3B6F D;  1P34 C;  4KUD B;  2HIO D;  4WU8 D;  3B6G D;  1S32 D;  3MGR D;  3UTB A;  1P3O C;  5CP6 B;  2BYM B;  3X1T C;  3AZI A;  5B32 B;  3AV1 D;  4LD9 D;  5GT0 A;  3X1V A;  1TZY A;  4WNN B;  4UUZ A;  3VH5 W;  4NE3 A;  2NZD D;  5B2I A;  4X23 D;  3UTB B;  4AWL B;  3C1C B;  1P34 D;  1P3P C;  3AZI B;  5DNN C;  5GT0 B;  1TZY B;  3AYW B;  4R8P C;  4UUZ B;  1P3M C;  1KX3 B;  1P3O D;  5B2J A;  5B24 C;  3X1T D;  4Z66 B;  5C3I C;  2YFW A;  1ID3 A;  3B0D B;  5DNM C;  3X1S A;  4KGC A;  1M18 A;  3REJ A;  3AN2 A;  1P3P D;  1TAF A;  2YFW B;  5DNN D;  5B40 C;  1P3K C;  2NQB A;  1ID3 B;  4NE6 A;  4R8P D;  3X1S B;  1P3M D;  4KGC B;  3B6F A;  3REH A;  4ZUX C;  5FUG A;  5B24 D;  3REJ B;  1M1A D;  3NQU A;  3AN2 B;  2HIO A;  4WU8 A;  1TAF B;  5DNM D;  2NQB B;  1P3B C;  4LD9 A;  3REH B;  5FUG B;  3AZE B;  2F8N A;  5B40 D;  3WA9 C;  1P3K D;  1ULY A;  3MGS C;  3VH5 T;  4ZUX D;  4LD9 B;  1P3G C;  4CAY A;  3WAA C;  3VH6 W;  3C1B C;  3KSY A;  3TU4 B;  2F8N B;  5GT3 A;  5F99 C;  3X1T A;  1P3B D;  3LZ0 A;  5CPJ A;  1P3A C;  1EQZ C;  5CPI B;  5AY8 C;  1U35 B;  4CAY B;  3WA9 D;  4G91 B;  3MGS D;  5GT3 B;  2BYK A;  3X1T B;  3LZ0 B;  5CPJ B;  1P3G D;  4XUJ D;  5DNN A;  3C1B D;  1M19 C;  3WAA D;  3X1U A;  5B31 G;  5BNX A;  4R8P A;  5F99 D;  3AZJ C;  4QLC C;  2BYK B;  1EQZ D;  1P3A D;  3AZH C;  5AY8 D;  4YS3 A;  3X1U B;  3MNN C;  5BNX B;  4R8P B;  1BH8 A;  5C3I B;  5B40 A;  4YS3 B;  1M19 D;  1P3F B;  1HQ3 C;  5B1L A;  3LEL A;  4ZUX A;  3AZJ D;  1AOI C;  4QLC D;  1JFI A;  2ARO C;  1F1E A;  3AZH D;  1BH8 B;  4CSR B;  4J8X B;  5G49 A;  3MNN D;  5B1L B;  3LEL B;  4ZBJ B;  5AVB C;  2IO5 B;  5AV5 C;  1JFI B;  3NQJ A;  5AV6 A;  3WTP E;  3AZL C;  3MGS A;  1HQ3 D;  5AV8 B;  5G49 B;  1AOI D;  5CHL B;  4JJN B;  1P3I B;  2ARO D;  3C1B A;  3NQJ B;  5AV6 B;  4E44 A;  5BS7 C;  3AZK B;  4J8W C;  1P3A A;  3W96 A;  3AZG A;  5AVB D;  5CPK C;  5GSU B;  5AV5 D;  3MGP C;  3MVD C;  3LJA A;  3AZL D;  3UTA C;  3W99 B;  3UT9 C;  3W96 B;  3AZG B;  1M19 A;  3LJA B;  5BNV A;  3AZJ A;  5B0Z C;  4J8W D;  5B1M C;  5CPK D;  1KX4 A;  3MGP D;  3MVD D;  1KX5 A;  3MNN A;  4H9Q A;  3AV2 A;  3UTA D;  5BNV B;  3UT9 D;  3AZJ B;  3B0C W;  1KX4 B;  5AVC A;  3A6N A;  2CV5 C;  1A7W A;  1KX5 B;  4H9Q B;  3AV2 B;  5B0Y C;  3X1V B;  1AOI A;  5B0Z D;  4Z2M G;  1F66 C;  2ARO A;  4Z5T C;  5B1M D;  3LZ1 C;  1BFM A;  3KUY D;  5B2I B;  1M1A C;  3KWQ C;  5AVC B;  3A6N B;  4EO5 C;  1R4V A;  5B33 C;  5AV5 A;  2ARO B;  5B2J B;  2PYO C;  4YM6 C;  2CV5 D;  2FJ7 C;  5B0Y D;  3REL C;  1H3O A;  4H9R A;  1F66 D;  4Z5T D;  3LZ1 D;  2RVQ C;  1M18 B;  1BH9 A;  4XZQ C;  3KWQ D;  5JRG C;  5B33 D;  3B6G A;  1WWS A;  1S32 A;  1ZLA C;  3MGR A;  4H9R B;  3MVD A;  4J8V D;  3W97 C;  3WKJ C;  3AV1 A;  3B6F B;  2PYO D;  4YM6 D;  1BH9 B;  3UTA A;  3NQU B;  2HIO B;  4WU8 B;  2FJ7 D;  3REL D;  3B6G B;  2NZD A;  3B0C T;  1S32 B;  4G92 C;  4X23 A;  3MGR B;  4KHA A;  4HGA C;  2RVQ D;  1P34 A;  3AV1 B;  4XZQ D;  4J8U C;  4XUJ C;  3UTA B;  5JRG D;  5B0Z A;  1ZLA D;  5B1M A;  1P3O A;  2NZD B;  4X23 B;  3W97 D;  3WKJ D;  1P34 B;  4H9N A;  3MGQ C;  2HUE C;  1P3O B;  2CV5 A;  3O62 C;  3REI C;  4WU9 C;  5E5A C;  1P3P A;  3W98 C;  4J8U D;  4H9N B;  5B31 C;  3REK C;  5B0Y A;  1F66 A;  1P3M A;  4Z5T A;  3LZ1 A;  1M1A A;  5B24 A;  1P3P B;  4DRA A;  3MGQ D;  5B33 A;  5DNN B;  5DNM A;  5B0Y B;  5BO0 A;  3AFA C;  1P3M B;  4YM6 A;  3O62 D;  5B24 B;  4WU9 D;  5E5A D;  3REI D;  1M1A B;  3W98 D;  5B31 D;  3REK D;  1P3K A;  4KUD C;  4H9O A;  5DNM B;  5BO0 B;  4WV4 B;  5CP6 C;  4XZQ A;  4YM6 B;  3VH6 T;  5B32 G;  5B40 B;  1P3K B;  3KXB C;  3AFA D;  4H9O B;  1P3B A;  4ZUX B;  4AWL C;  3C1C C;  3AZI C;  3WA9 A;  4KUD D;  1TZY C;  3AYW C;  3VH5 A;  1KX3 C;  5CP6 D;  1P3B B;  4J8U A;  4XUJ A;  1P3G A;  3WAA A;  4Z66 C;  2LY8 A;  3B0D C;  3WA9 B;  5F99 A;  4H9S C;  3MGS B;  4NFT A;  3KXB D;  1EQZ A;  5AY8 A;  3C1C D;  1P3G B;  4XUJ B;  3AZI D;  3C1B B;  3WAA B;  5AV9 C;  1ID3 C;  1TZY D;  3AYW D; 
#chains in the Genus database with same CATH topology
 5F99 B;  3X1S C;  4KGC C;  1KX3 D;  3REI A;  2W8S A;  5E5A A;  1P3A B;  1EQZ B;  2CWE A;  3REJ C;  2Y2G A;  5B31 A;  5AY8 B;  3AN2 C;  4Z66 D;  2NQB C;  4QLC A;  3AZH A;  3REH C;  3KUY C;  3AZE C;  1M19 B;  5KDM A;  2YFV A;  5AV9 D;  1ID3 D;  2Y2H A;  3X1S D;  4KGC D;  4QLC B;  4E45 A;  3REJ D;  3AZH B;  3AN2 D;  1HQ3 A;  5KDM B;  3TU4 C;  2F2A C;  2YFV B;  1B6W A;  2NQB D;  3MNN B;  2F8N G;  3H0M C;  5CPI C;  3REH D;  1U35 C;  3VH6 A;  3AZE D;  4WNN A;  3KXB A;  1HQ3 B;  4G91 C;  5GT3 C;  5AVB A;  1AOI B;  2ZY5 A;  3C1C A;  4J8V C;  3LZ0 C;  5CPJ C;  3AZL A;  2BG1 A;  5GXQ C;  3AYW A;  3TU4 D;  2F8N D;  3KXB B;  1KX3 A;  5AVB B;  5CPI D;  5AV5 B;  4Z66 A;  1WWI A;  1U35 D;  3AZL B;  4H9S A;  4DRB A;  5BS7 A;  3X1U C;  4J8W A;  5GT3 D;  5CPK A;  1HTA A;  1H3O B;  5JA4 A;  3LZ0 D;  2G5I C;  2Y2J A;  5CPJ D;  3MGP A;  4YS3 C;  5AV9 A;  5GXQ D;  1P3F C;  3UT9 A;  3AL0 C;  4J8W B;  3EPL A;  2Y2Q A;  5CPK B;  2J8P A;  5JA4 B;  3MVD B;  3MGP B;  3AZM C;  1B67 A;  5AV9 B;  3X1U D;  4J8X C;  5B1L C;  3LEL C;  3UT9 B;  3AZN C;  4ZBJ C;  3AZF C;  2IO5 C;  4DQY B;  3KUY A;  3AZE A;  1Q9C A;  4KHA B;  4YS3 D;  1P3L C;  2F8N K;  1P3F D;  5AV8 C;  3B0B A;  5B0Z B;  3WTP C;  4JJN C;  5B1M B;  1P3I C;  3KUY B;  5AV6 C;  3TU4 A;  3AZM D;  3AZK C;  2F8N H;  4J8X D;  4Z2M H;  5B1L D;  3LEL D;  3AZN D;  5BT1 C;  5CPI A;  3AZF D;  5GSU C;  1U35 A;  3KWQ A;  2CV5 B;  1P3L D;  3R45 A;  5AV8 D;  3W99 C;  4NE5 A;  3WTP D;  4J8V A;  1F66 B;  2Y2M A;  3W96 C;  4Z5T B;  4JJN D;  3AZG C;  3LZ1 B;  1P3I D;  2PYO A;  5GXQ A;  3KWQ B;  5AV6 D;  4H9P A;  4EO5 B;  3LJA C;  3R45 B;  3AZK D;  2FJ7 A;  2VQR A;  4M6B A;  5B33 B;  3REL A;  5BT1 D;  4J8V B;  5GSU D;  2JSS A;  5B32 C;  5GXQ B;  2PYO B;  5JRG A;  4H9P B;  2FFF B;  2L5A A;  3W99 D;  1ZLA A;  2FJ7 B;  3REL B;  3P5J B;  3W97 A;  3WKJ A;  3W96 D;  3AZG D;  3UTB C;  1KX4 C;  2ZY2 A;  1P3F A;  4XZQ B;  3LJA D;  1KX5 C;  5JRG B;  5GT0 C;  3X1V C;  3AV2 C;  1ZLA B;  3A1I A;  3W97 B;  3WKJ B;  3AZM A;  5B2I C;  4CSR A;  5B32 D;  5AVC C;  3A6N C;  4J8X A;  3AZN A;  3AZF A;  4G92 B;  4WZS B;  4HGA B;  3UTB D;  5B2J C;  1P3L A;  1KX4 D;  3AZM B;  3MGQ A;  4J8U B;  5AV8 A;  1KX5 D;  3WTP A;  5GT0 D;  1T3U A;  3AV2 D;  3AZN B;  3X1V D;  4JJN A;  3AZF B;  1P3I A;  3O62 A;  1N1J A;  4WU9 A;  3W98 A;  5B2I D;  1M18 C;  1KU5 A;  5AVC D;  3A6N D;  1P3L B;  3REK A;  3MGQ B;  3AZK A;  3WTP B;  5GSU A;  2HUE B;  3V9R A;  2ZM5 A;  3B6F C;  5B2J D;  1N1J B;  3O62 B;  5E5A B;  3REI B;  4WU9 B;  3W98 B;  5B31 B;  3REK B;  3W99 A;  2HIO C;  4WU8 C;  3AFA A;  3B6G C;  1S32 C;  3MGR C;  3V9R B;  4LD9 C;  3AV1 C;  1M18 D;  4KUD A;  3AFA B;  5CP6 A;  2NZD C;  2BYM A;  4X23 C;  5B32 A;  3B6F D;  1P34 C;  1W2E A;  4KUD B;  2HIO D;  4WU8 D;  3IP4 C;  3B6G D;  1S32 D;  3FDD A;  3MGR D;  3UTB A;  1P3O C;  5CP6 B;  2BYM B;  3X1T C;  3AZI A;  5B32 B;  3AV1 D;  4LD9 D;  5GT0 A;  3X1V A;  1TZY A;  4WNN B;  4UUZ A;  3VH5 W;  4NE3 A;  2NZD D;  5B2I A;  4X23 D;  3UTB B;  4AWL B;  3C1C B;  1P34 D;  1P3P C;  3AZI B;  5DNN C;  5GT0 B;  1TZY B;  3AYW B;  4R8P C;  2Y2N A;  4UUZ B;  1P3M C;  1KX3 B;  1P3O D;  5B2J A;  5B24 C;  3X1T D;  4Z66 B;  5C3I C;  2YFW A;  3EPH A;  1ID3 A;  3B0D B;  5DNM C;  3X1S A;  4KGC A;  1M18 A;  3REJ A;  3AN2 A;  1P3P D;  2JE5 A;  1TAF A;  2YFW B;  5DNN D;  5B40 C;  1P3K C;  2NQB A;  1ID3 B;  4NE6 A;  4R8P D;  3X1S B;  1P3M D;  4KGC B;  3B6F A;  3REH A;  4ZUX C;  5FUG A;  5B24 D;  3REJ B;  1M1A D;  2JCH A;  3NQU A;  3AN2 B;  2HIO A;  4WU8 A;  1TAF B;  5DNM D;  2NQB B;  3EPJ A;  1P3B C;  4LD9 A;  3REH B;  1PZR A;  5FUG B;  3AZE B;  2F8N A;  5B40 D;  3WA9 C;  1P3K D;  1ULY A;  3MGS C;  3VH5 T;  4ZUX D;  4LD9 B;  1P3G C;  2DQN C;  4CAY A;  3WAA C;  3VH6 W;  3C1B C;  3KSY A;  3TU4 B;  2F8N B;  5GT3 A;  5F99 C;  3X1T A;  1P3B D;  3LZ0 A;  5CPJ A;  1P3A C;  1EQZ C;  5CPI B;  5AY8 C;  1U35 B;  2XD1 A;  4CAY B;  3WA9 D;  4G91 B;  3MGS D;  5GT3 B;  2BYK A;  4WJ3 C;  3X1T B;  3LZ0 B;  5CPJ B;  1P3G D;  4XUJ D;  5DNN A;  3C1B D;  1M19 C;  3WAA D;  3X1U A;  5B31 G;  5BNX A;  4R8P A;  5F99 D;  3AZJ C;  4QLC C;  2BYK B;  1EQZ D;  1P3A D;  3AZH C;  5AY8 D;  4YS3 A;  3X1U B;  3MNN C;  5BNX B;  4R8P B;  1BH8 A;  5C3I B;  5B40 A;  4YS3 B;  1M19 D;  1P3F B;  1HQ3 C;  5B1L A;  3LEL A;  4ZUX A;  3AZJ D;  1AOI C;  4QLC D;  1JFI A;  2ARO C;  1F1E A;  3AZH D;  1BH8 B;  4CSR B;  4J8X B;  5G49 A;  3MNN D;  5B1L B;  3LEL B;  4ZBJ B;  5AVB C;  2IO5 B;  5AV5 C;  1JFI B;  3NQJ A;  5AV6 A;  3WTP E;  3AZL C;  2RIQ A;  3MGS A;  1HQ3 D;  5AV8 B;  5G49 B;  3F6T A;  1AOI D;  5CHL B;  4JJN B;  1P3I B;  2ARO D;  3C1B A;  3NQJ B;  5AV6 B;  4E44 A;  5BS7 C;  3AZK B;  2Y2O A;  4J8W C;  1P3A A;  3W96 A;  3AZG A;  5AVB D;  3EPK A;  5CPK C;  5GSU B;  5AV5 D;  3MGP C;  3MVD C;  3LJA A;  3AZL D;  3UTA C;  2Y2K A;  2Y2P A;  3W99 B;  3UT9 C;  3W96 B;  3AZG B;  1M19 A;  3LJA B;  5BNV A;  3AZJ A;  5B0Z C;  4J8W D;  5B1M C;  5CPK D;  1KX4 A;  3MGP D;  3MVD D;  1KX5 A;  3MNN A;  4H9Q A;  3AV2 A;  3UTA D;  5BNV B;  3UT9 D;  3AZJ B;  3B0C W;  1KX4 B;  5AVC A;  3A6N A;  2Y2I A;  2CV5 C;  1A7W A;  1KX5 B;  2XD5 A;  4H9Q B;  3AV2 B;  5B0Y C;  3X1V B;  1AOI A;  5B0Z D;  4Z2M G;  1F66 C;  2ARO A;  4Z5T C;  5B1M D;  3LZ1 C;  1BFM A;  3KUY D;  2Y2L A;  5B2I B;  3KWQ C;  1M1A C;  5AVC B;  3A6N B;  4EO5 C;  1R4V A;  5B33 C;  5AV5 A;  2ARO B;  5B2J B;  2PYO C;  4YM6 C;  2CV5 D;  2FJ7 C;  5B0Y D;  3REL C;  1H3O A;  4H9R A;  1F66 D;  4Z5T D;  3LZ1 D;  2RVQ C;  1M18 B;  1BH9 A;  4XZQ C;  3KWQ D;  3A1K A;  5JRG C;  5B33 D;  3B6G A;  1WWS A;  1S32 A;  1ZLA C;  3MGR A;  4H9R B;  3MVD A;  4J8V D;  3W97 C;  3WKJ C;  3AV1 A;  3B6F B;  2PYO D;  4YM6 D;  1BH9 B;  1Z2C B;  3UTA A;  3H0R C;  3NQU B;  2HIO B;  4WU8 B;  2FJ7 D;  3REL D;  3B6G B;  2NZD A;  3B0C T;  1S32 B;  4G92 C;  4X23 A;  3MGR B;  4KHA A;  4HGA C;  2RVQ D;  1P34 A;  2ZY4 A;  4XZQ D;  3AV1 B;  4J8U C;  4XUJ C;  3UTA B;  2G5H C;  5JRG D;  5B0Z A;  1ZLA D;  5B1M A;  1P3O A;  2NZD B;  4X23 B;  3W97 D;  3WKJ D;  1P34 B;  4H9N A;  3MGQ C;  4UPK A;  2HUE C;  1P3O B;  2CV5 A;  3O62 C;  3REI C;  4WU9 C;  5E5A C;  1P3P A;  3W98 C;  4J8U D;  4H9N B;  5B31 C;  3REK C;  5B0Y A;  1F66 A;  1P3M A;  4Z5T A;  3LZ1 A;  1M1A A;  5B24 A;  1P3P B;  4DRA A;  3MGQ D;  5B33 A;  5DNN B;  5DNM A;  5B0Y B;  3EG5 B;  5BO0 A;  3AFA C;  1P3M B;  4YM6 A;  3KFU G;  3O62 D;  5B24 B;  4WU9 D;  5E5A D;  3REI D;  1M1A B;  3W98 D;  3H0L C;  5B31 D;  3REK D;  1P3K A;  4KUD C;  4H9O A;  5DNM B;  5BO0 B;  4WV4 B;  5CP6 C;  4XZQ A;  4YM6 B;  3VH6 T;  5B32 G;  5B40 B;  1P3K B;  3KXB C;  3AFA D;  4H9O B;  1P3B A;  2ZY3 A;  4ZUX B;  4AWL C;  3C1C C;  3AZI C;  3WA9 A;  4KUD D;  1TZY C;  3AYW C;  3VH5 A;  1KX3 C;  5CP6 D;  1P3B B;  4J8U A;  4XUJ A;  1P3G A;  3WAA A;  4Z66 C;  2LY8 A;  2UWX A;  3B0D C;  3WA9 B;  5F99 A;  4H9S C;  3MGS B;  4NFT A;  3KXB D;  1EQZ A;  5AY8 A;  3C1C D;  1P3G B;  4XUJ B;  3AZI D;  3C1B B;  3WAA B;  2DF4 C;  5AV9 C;  1ID3 C;  1TZY D;  3AYW D; 
#chains in the Genus database with same CATH homology
 5F99 B;  3X1S C;  4KGC C;  1KX3 D;  3REI A;  2W8S A;  5E5A A;  1P3A B;  1EQZ B;  2CWE A;  3REJ C;  2Y2G A;  5B31 A;  5AY8 B;  3AN2 C;  4Z66 D;  2NQB C;  4QLC A;  3AZH A;  3REH C;  3KUY C;  3AZE C;  1M19 B;  5KDM A;  2YFV A;  5AV9 D;  1ID3 D;  2Y2H A;  3X1S D;  4KGC D;  4QLC B;  4E45 A;  3REJ D;  3AZH B;  3AN2 D;  1HQ3 A;  5KDM B;  3TU4 C;  2F2A C;  2YFV B;  1B6W A;  2NQB D;  3MNN B;  2F8N G;  3H0M C;  5CPI C;  3REH D;  1U35 C;  3VH6 A;  3AZE D;  4WNN A;  3KXB A;  1HQ3 B;  4G91 C;  5GT3 C;  5AVB A;  1AOI B;  2ZY5 A;  3C1C A;  4J8V C;  3LZ0 C;  5CPJ C;  3AZL A;  2BG1 A;  5GXQ C;  3AYW A;  3TU4 D;  2F8N D;  3KXB B;  1KX3 A;  5AVB B;  5CPI D;  5AV5 B;  4Z66 A;  1WWI A;  1U35 D;  3AZL B;  4H9S A;  4DRB A;  5BS7 A;  3X1U C;  4J8W A;  5GT3 D;  5CPK A;  1HTA A;  1H3O B;  5JA4 A;  3LZ0 D;  2G5I C;  2Y2J A;  5CPJ D;  3MGP A;  4YS3 C;  5AV9 A;  5GXQ D;  1P3F C;  3UT9 A;  3AL0 C;  4J8W B;  3EPL A;  2Y2Q A;  5CPK B;  2J8P A;  5JA4 B;  3MVD B;  3MGP B;  3AZM C;  1B67 A;  5AV9 B;  3X1U D;  4J8X C;  5B1L C;  3LEL C;  3UT9 B;  3AZN C;  4ZBJ C;  3AZF C;  2IO5 C;  4DQY B;  3KUY A;  3AZE A;  1Q9C A;  4KHA B;  4YS3 D;  1P3L C;  2F8N K;  1P3F D;  5AV8 C;  3B0B A;  5B0Z B;  3WTP C;  4JJN C;  5B1M B;  1P3I C;  3KUY B;  5AV6 C;  3TU4 A;  3AZM D;  3AZK C;  2F8N H;  4J8X D;  4Z2M H;  5B1L D;  3LEL D;  3AZN D;  5BT1 C;  5CPI A;  3AZF D;  5GSU C;  1U35 A;  3KWQ A;  2CV5 B;  1P3L D;  3R45 A;  5AV8 D;  3W99 C;  4NE5 A;  3WTP D;  4J8V A;  1F66 B;  2Y2M A;  3W96 C;  4Z5T B;  4JJN D;  3AZG C;  3LZ1 B;  1P3I D;  2PYO A;  5GXQ A;  3KWQ B;  5AV6 D;  4H9P A;  4EO5 B;  3LJA C;  3R45 B;  3AZK D;  2FJ7 A;  2VQR A;  4M6B A;  5B33 B;  3REL A;  5BT1 D;  4J8V B;  5GSU D;  2JSS A;  5B32 C;  5GXQ B;  2PYO B;  5JRG A;  4H9P B;  2FFF B;  2L5A A;  3W99 D;  1ZLA A;  2FJ7 B;  3REL B;  3P5J B;  3W97 A;  3WKJ A;  3W96 D;  3AZG D;  3UTB C;  1KX4 C;  2ZY2 A;  1P3F A;  4XZQ B;  3LJA D;  1KX5 C;  5JRG B;  5GT0 C;  3X1V C;  3AV2 C;  1ZLA B;  3A1I A;  3W97 B;  3WKJ B;  3AZM A;  5B2I C;  4CSR A;  5B32 D;  5AVC C;  3A6N C;  4J8X A;  3AZN A;  3AZF A;  4G92 B;  4WZS B;  4HGA B;  3UTB D;  5B2J C;  1P3L A;  1KX4 D;  3AZM B;  3MGQ A;  4J8U B;  5AV8 A;  1KX5 D;  3WTP A;  5GT0 D;  1T3U A;  3AV2 D;  3AZN B;  3X1V D;  4JJN A;  3AZF B;  1P3I A;  3O62 A;  1N1J A;  4WU9 A;  3W98 A;  5B2I D;  1M18 C;  1KU5 A;  5AVC D;  3A6N D;  1P3L B;  3REK A;  3MGQ B;  3AZK A;  3WTP B;  5GSU A;  2HUE B;  3V9R A;  2ZM5 A;  3B6F C;  5B2J D;  1N1J B;  3O62 B;  5E5A B;  3REI B;  4WU9 B;  3W98 B;  5B31 B;  3REK B;  3W99 A;  2HIO C;  4WU8 C;  3AFA A;  3B6G C;  1S32 C;  3MGR C;  3V9R B;  4LD9 C;  3AV1 C;  1M18 D;  4KUD A;  3AFA B;  5CP6 A;  2NZD C;  2BYM A;  4X23 C;  5B32 A;  3B6F D;  1P34 C;  1W2E A;  4KUD B;  2HIO D;  4WU8 D;  3IP4 C;  3B6G D;  1S32 D;  3FDD A;  3MGR D;  3UTB A;  1P3O C;  5CP6 B;  2BYM B;  3X1T C;  3AZI A;  5B32 B;  3AV1 D;  4LD9 D;  5GT0 A;  3X1V A;  1TZY A;  4WNN B;  4UUZ A;  3VH5 W;  4NE3 A;  2NZD D;  5B2I A;  4X23 D;  3UTB B;  4AWL B;  3C1C B;  1P34 D;  1P3P C;  3AZI B;  5DNN C;  5GT0 B;  1TZY B;  3AYW B;  4R8P C;  2Y2N A;  4UUZ B;  1P3M C;  1KX3 B;  1P3O D;  5B2J A;  5B24 C;  3X1T D;  4Z66 B;  5C3I C;  2YFW A;  3EPH A;  1ID3 A;  3B0D B;  5DNM C;  3X1S A;  4KGC A;  1M18 A;  3REJ A;  3AN2 A;  1P3P D;  2JE5 A;  1TAF A;  2YFW B;  5DNN D;  5B40 C;  1P3K C;  2NQB A;  1ID3 B;  4NE6 A;  4R8P D;  3X1S B;  1P3M D;  4KGC B;  3B6F A;  3REH A;  4ZUX C;  5FUG A;  5B24 D;  3REJ B;  1M1A D;  2JCH A;  3NQU A;  3AN2 B;  2HIO A;  4WU8 A;  1TAF B;  5DNM D;  2NQB B;  3EPJ A;  1P3B C;  4LD9 A;  3REH B;  1PZR A;  5FUG B;  3AZE B;  2F8N A;  5B40 D;  3WA9 C;  1P3K D;  1ULY A;  3MGS C;  3VH5 T;  4ZUX D;  4LD9 B;  1P3G C;  2DQN C;  4CAY A;  3WAA C;  3VH6 W;  3C1B C;  3KSY A;  3TU4 B;  2F8N B;  5GT3 A;  5F99 C;  3X1T A;  1P3B D;  3LZ0 A;  5CPJ A;  1P3A C;  1EQZ C;  5CPI B;  5AY8 C;  1U35 B;  2XD1 A;  4CAY B;  3WA9 D;  4G91 B;  3MGS D;  5GT3 B;  2BYK A;  4WJ3 C;  3X1T B;  3LZ0 B;  5CPJ B;  1P3G D;  4XUJ D;  5DNN A;  3C1B D;  1M19 C;  3WAA D;  3X1U A;  5B31 G;  5BNX A;  4R8P A;  5F99 D;  3AZJ C;  4QLC C;  2BYK B;  1EQZ D;  1P3A D;  3AZH C;  5AY8 D;  4YS3 A;  3X1U B;  3MNN C;  5BNX B;  4R8P B;  1BH8 A;  5C3I B;  5B40 A;  4YS3 B;  1M19 D;  1P3F B;  1HQ3 C;  5B1L A;  3LEL A;  4ZUX A;  3AZJ D;  1AOI C;  4QLC D;  1JFI A;  2ARO C;  1F1E A;  3AZH D;  1BH8 B;  4CSR B;  4J8X B;  5G49 A;  3MNN D;  5B1L B;  3LEL B;  4ZBJ B;  5AVB C;  2IO5 B;  5AV5 C;  1JFI B;  3NQJ A;  5AV6 A;  3WTP E;  3AZL C;  2RIQ A;  3MGS A;  1HQ3 D;  5AV8 B;  5G49 B;  3F6T A;  1AOI D;  5CHL B;  4JJN B;  1P3I B;  2ARO D;  3C1B A;  3NQJ B;  5AV6 B;  4E44 A;  5BS7 C;  3AZK B;  2Y2O A;  4J8W C;  1P3A A;  3W96 A;  3AZG A;  5AVB D;  3EPK A;  5CPK C;  5GSU B;  5AV5 D;  3MGP C;  3MVD C;  3LJA A;  3AZL D;  3UTA C;  2Y2K A;  2Y2P A;  3W99 B;  3UT9 C;  3W96 B;  3AZG B;  1M19 A;  3LJA B;  5BNV A;  3AZJ A;  5B0Z C;  4J8W D;  5B1M C;  5CPK D;  1KX4 A;  3MGP D;  3MVD D;  1KX5 A;  3MNN A;  4H9Q A;  3AV2 A;  3UTA D;  5BNV B;  3UT9 D;  3AZJ B;  3B0C W;  1KX4 B;  5AVC A;  3A6N A;  2Y2I A;  2CV5 C;  1A7W A;  1KX5 B;  2XD5 A;  4H9Q B;  3AV2 B;  5B0Y C;  3X1V B;  1AOI A;  5B0Z D;  4Z2M G;  1F66 C;  2ARO A;  4Z5T C;  5B1M D;  3LZ1 C;  1BFM A;  3KUY D;  2Y2L A;  5B2I B;  3KWQ C;  1M1A C;  5AVC B;  3A6N B;  4EO5 C;  1R4V A;  5B33 C;  5AV5 A;  2ARO B;  5B2J B;  2PYO C;  4YM6 C;  2CV5 D;  2FJ7 C;  5B0Y D;  3REL C;  1H3O A;  4H9R A;  1F66 D;  4Z5T D;  3LZ1 D;  2RVQ C;  1M18 B;  1BH9 A;  4XZQ C;  3KWQ D;  3A1K A;  5JRG C;  5B33 D;  3B6G A;  1WWS A;  1S32 A;  1ZLA C;  3MGR A;  4H9R B;  3MVD A;  4J8V D;  3W97 C;  3WKJ C;  3AV1 A;  3B6F B;  2PYO D;  4YM6 D;  1BH9 B;  1Z2C B;  3UTA A;  3H0R C;  3NQU B;  2HIO B;  4WU8 B;  2FJ7 D;  3REL D;  3B6G B;  2NZD A;  3B0C T;  1S32 B;  4G92 C;  4X23 A;  3MGR B;  4KHA A;  4HGA C;  2RVQ D;  1P34 A;  2ZY4 A;  4XZQ D;  3AV1 B;  4J8U C;  4XUJ C;  3UTA B;  2G5H C;  5JRG D;  5B0Z A;  1ZLA D;  5B1M A;  1P3O A;  2NZD B;  4X23 B;  3W97 D;  3WKJ D;  1P34 B;  4H9N A;  3MGQ C;  4UPK A;  2HUE C;  1P3O B;  2CV5 A;  3O62 C;  3REI C;  4WU9 C;  5E5A C;  1P3P A;  3W98 C;  4J8U D;  4H9N B;  5B31 C;  3REK C;  5B0Y A;  1F66 A;  1P3M A;  4Z5T A;  3LZ1 A;  1M1A A;  5B24 A;  1P3P B;  4DRA A;  3MGQ D;  5B33 A;  5DNN B;  5DNM A;  5B0Y B;  3EG5 B;  5BO0 A;  3AFA C;  1P3M B;  4YM6 A;  3KFU G;  3O62 D;  5B24 B;  4WU9 D;  5E5A D;  3REI D;  1M1A B;  3W98 D;  3H0L C;  5B31 D;  3REK D;  1P3K A;  4KUD C;  4H9O A;  5DNM B;  5BO0 B;  4WV4 B;  5CP6 C;  4XZQ A;  4YM6 B;  3VH6 T;  5B32 G;  5B40 B;  1P3K B;  3KXB C;  3AFA D;  4H9O B;  1P3B A;  2ZY3 A;  4ZUX B;  4AWL C;  3C1C C;  3AZI C;  3WA9 A;  4KUD D;  1TZY C;  3AYW C;  3VH5 A;  1KX3 C;  5CP6 D;  1P3B B;  4J8U A;  4XUJ A;  1P3G A;  3WAA A;  4Z66 C;  2LY8 A;  2UWX A;  3B0D C;  3WA9 B;  5F99 A;  4H9S C;  3MGS B;  4NFT A;  3KXB D;  1EQZ A;  5AY8 A;  3C1C D;  1P3G B;  4XUJ B;  3AZI D;  3C1B B;  3WAA B;  2DF4 C;  5AV9 C;  1ID3 C;  1TZY D;  3AYW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...