1KU5A

Crystal structure of recombinant histone hpha from hyperthermophilic archaeon pyrococcus horikoshii ot3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
66
structure length
66
Chain Sequence
GELPIAPVDRLIRKAGAERVSEQAAKVLAEYLEEYAIEIAKKAVEFARHAGRKTVKVEDIKLAIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HPhA
publication title Structure based hyperthermostability of archaeal histone HPhA from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 22
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1ku5A00
5AV9B 4YM6C 4J8VA 5CP6A 5DNNB 5AV9D 3AZEA 5DNND 4UUZA 3X1UB 1P3FB 3X1UD 3LELC 5B31G 1P3FD 3KXBB 3KUYA 3AZNC 3KXBD 3UTAA 3AV2C 1S32C 4J8XC 3X1TB 1BH8B 3X1TD 4CSRA 5BT1D 3WTPE 5AV6D 1N1JA 2RVQD 5JA4B 4Z66B 4G92B 2FJ7A 4Z66D 5GT3C 3VH6W 3AZKA 4KUDC 5CHLB 3W96C 5B0YC 1P34C 4WZSB 3AZHA 1P3OA 3LJAA 5CPJC 1M19A 4KUDD 1EQZC 3W98B 3WKJC 4WU8A 5CPIA 3AFAA 3W98D 3R45A 1M18A 5B2JB 5KDMB 5AY8D 5B2JD 3MGSB 5GT3B 4NFTA 3MNNB 5AV5A 3MGSD 1JFIB 3MNND 3REJC 1BH9A 5GSUB 3AZMC 4KUDB 3W99A 1HQ3C 3UTAC 3TU4D 5B1LC 3NQJA 3X1VA 4H9NB 2CWEA 3WKJB 2FJ7C 2LY8A 1P3PA 3KWQD 4WU9A 5JRGB 5B0ZC 3W97B 4J8VB 5CP6B 3W97D 5G49A 4J8VD 3AZEB 5CP6D 1P3GA 3VH5W 3AZED 1P3MC 3AN2C 3O62A 4R8PA 1KX3C 3KUYB 3KUYD 3UTAB 3B6FC 5BO0A 3X1SC 1Q9CA 4CSRB 1P3LA 3AFAC 1N1JB 5F99C 2FJ7B 5AV8D 1P3IA 1TZYC 1F66D 5B0ZB 2F8NK 3MVDC 5B1MA 4NE6A 3RELC 2IO5C 3LZ0A 3AZKB 3AZKD 4ZUXC 3C1BC 3AZJA 3AZHB 1P3OB 3LJAB 1M19B 3AZHD 1P3OD 3LJAD 1M19D 2BYMA 2NQBC 4WU8B 5CPIB 3A6NA 3AFAB 5B31A 5CPID 3R45B 5B2IC 1M18B 1M18D 5AV6A 5AV5B 3REKC 5AV5D 5AVBA 1ULYA 1BH9B 2IO5B 5CPKA 3W99B 4NE3A 4YS3A 3W99D 3AZIA 2AROC 3MGPA 3MGQC 4X23C 3AZGA 1A7WA 3NQJB 4J8UD 3X1VB 5BNXA 4HGAB 3X1VD 2JSSA 3WA9A 5FUGA 1R4VA 3VH6A 1P3PB 4WU9B 3VH5T 4WU9D 4KHAA 5G49B 4JJNC 1P3GB 5AY8A 4AWLC 1P3GD 1ID3A 3O62B 4R8PB 5AV9C 1B6WA 5DNNC 4R8PD 5E5AA 3X1UC 5BO0B 1P3FC 4KGCA 3KXBC 4XUJD 1P3LB 1P3LD 1P3KA 4Z2MG 3X1TC 5BT1C 5AV6C 2RVQC 2NZDA 1P3ID 4G92C 4Z66C 5B1MB 3V9RA 5B1MD 3LZ0B 3LZ0D 5B32G 3AZJB 3AZJD 3AYWA 2BYMB 3C1CA 3A6NB 3A6ND 5B31D 3AZFA 1P3BD 5B24A 5AV6B 3W98C 5AVBB 5AV8A 3VH5A 5B2JC 5AVBD 3MGSC 1F66A 3MNNC 5CPKB 4YS3B 5CPKD 4YS3D 3AZIB 5GSUC 3MGPB 3AZID 3AZGB 3MGPD 4ZBJB 3AZGD 5BNXB 3TU4C 3WA9B 3AV1A 5FUGB 3WA9D 5BS7A 2HIOD 1F1EA 4J8WA 1AOIA 1KX5A 5B33A 4XZQA 2PYOD 3KWQC 5AY8B 3LZ1A 1ID3B 5JRGC 1ID3D 4J8VC 3W97C 5CP6C 3AZEC 5E5AB 5E5AD 4KGCB 5AVCA 4KGCD 3KUYC 1KX4A 3B0BA 4YM6D 3TU4B 3AZLA 1P3KB 4J8UA 4DRAA 1P3KD 1WWSA 5BNVA 4QLCD 2NZDB 5AV8C 2NZDD 5B40A 3WTPA 1F66C 3KWQB 3MGRA 5GT0A 4UUZB 3REIA 3AZKC 3AYWB 3AYWD 3C1CB 3C1CD 3AZHC 5GXQA 1P3OC 3LJAC 1M19C 3AZFB 1P3AA 3AZFD 4XUJA 5B24B 5B0YD 2HUEB 5CPIC 5B24D 4WU8C 4WNNA 1M18C 5AV8B 1U35D 2L5AA 1F66B 5AV5C 3UTBD 3W99C 3WAAA 4CAYA 3B0DB 4J8UC 4E44A 5B32A 3X1VC 3AV1B 3AZMD 4HGAC 3AV1D 4H9SA 4J8WB 1AOIB 1KX5B 1AOID 4J8WD 1KX5D 3B0CT 5B33B 4XZQB 1P3BA 5B33D 4XZQD 3UT9A 3LZ1B 1P3PC 4WU9C 2F8NG 3LZ1D 4LD9D 1P3GC 1M1AD 3O62C 2BYKA 4R8PC 5AVCB 1KX4B 1WWIA 5AVCD 1KX4D 3AZLB 4J8UB 3AZLD 4XUJC 5BNVB 1ZLAA 3B6GA 1P3LC 2YFVA 4H9QA 3WTPB 5B40B 2HIOA 5B40D 3WTPD 1P3IC 4Z5TD 3REHA 5B1MC 3MGRB 2PYOA 5GT0B 1BH8A 3LZ0C 3MGRD 5GT0D 3REIB 3REID 2CV5A 3AZJC 5GXQB 5GXQD 4EO5C 5DNMA 1P3AB 4XUJB 4YM6A 1P3AD 3A6NC 5B31C 4WNNB 3LELA 4QLCA 4G91B 3AZNA 1P3IB 5AVBC 3AV2A 1BFMA 1S32A 4J8XA 5CPKC 4YS3C 3WAAB 1TAFA 4CAYB 3AZIC 3WAAD 3MGPC 2YFWA 3AZGC 5B32B 4ZBJC 1JFIA 5B32D 4EO5B 5B31B 1P3BB 3WA9C 4X23D 3UT9B 3W96A 5B0YA 3UT9D 4H9OA 1P34A 2PYOC 4H9RA 5CPJA 1U35A 5AY8C 5C3IB 4H9NA 4H9PA 1ID3C 2BYKB 3UTBA 1EQZA 3WKJA 4Z2MH 5E5AC 4KGCC 1ZLAB 3B6GB 1ZLAD 4DRBA 3REJA 3B6GD 1HTAA 1P3KC 2YFVB 4H9QB 3AZMA 4QLCC 2HIOB 1HQ3A 2NZDC 3REHB 5B1LA 4KHAB 3REHD 2PYOB 3B0CW 2CV5B 4LD9A 2CV5D 1M1AA 2F8NA 4NE5A 3AYWC 5DNMB 5B0ZA 3C1CC 5DNMD 4YM6B 1P3MA 3AZFC 3AN2A 3LELB 4QLCB 5B24C 3LELD 1KX3A 1H3OA 2HUEC 3AZNB 3KSYA 3AZND 3B6FA 3AV2B 3X1SA 1U35C 3V9RB 1S32B 3AV2D 4J8XB 1KU5A 1S32D 3UTBC 4Z5TA 4J8XD 4WV4B 1TAFB 5F99A 2YFWB 1TZYA 5GT3D 3MVDA 3B0DC 3RELA 5GSUD 3AV1C 5BS7C 4ZUXA 3C1BA 4J8WC 5B0YB 1AOIC 1KX5C 3W96B 3W96D 4H9OB 1P34B 5B33C 4XZQC 4H9RB 5CPJB 1P34D 1U35B 5CPJD 3LZ1C 2NQBA 4H9PB 3UTBB 1EQZB 4LD9C 1EQZD 1M1AC 3WKJD 5B2IA 5AVCC 5JRGD 3REKA 3NQUA 1KX4C 3REJB 3AZLC 3REJD 3AZMB 1HQ3B 2AROA 5B1LB 1HQ3D 3UTAD 3MGQA 4X23A 5B1LD 3WTPC 5B40C 4Z5TC 3VH6T 4LD9B 3MGRC 1M1AB 5GT0C 2FJ7D 2F8NB 3REIC 2F8ND 5B0ZD 4JJNA 5GXQC 1P3MB 3AN2B 1P3MD 1P3AC 3AN2D 5AV9A 1KX3B 1H3OB 5DNNA 1KX3D 3X1UA 3B6FB 3X1SB 1P3FA 3B6FD 3X1SD 3KXBA 4Z5TB 4G91C 1B67A 4WU8D 3AFAD 5F99B 5F99D 3X1TA 1TZYB 3WAAC 3MVDB 1TZYD 5JA4A 4Z66A 3MVDD 3RELB 4E45A 2F8NH 5B32C 3RELD 4ZUXB 4H9SC 3C1BB 4ZUXD 3C1BD 1P3BC 3UT9C 2NQBB 2NQBD 5B2IB 5C3IC 5B2ID 1P3PD 3W98A 3REKB 3NQUB 3REKD 5B2JA 5KDMA 3MGSA 5GT3A 3MNNA 3O62D 1ZLAC 3B6GC 2AROB 5GSUA 2AROD 4X23B 3MGQB 3MGQD 2HIOC 4KUDA 4M6BA 3TU4A 3REHC 2CV5C 4JJNB 3KWQA 4JJND 4AWLB 5DNMC 5JRGA 3W97A
chains in the Genus database with same CATH superfamily
5AV9B 4YM6C 2VQRA 2XD5A 5CP6A 5DNNB 5AV9D 4J8VA 3AZEA 3KFUG 5DNND 4UUZA 3X1UB 1P3FB 3X1UD 3LELC 5B31G 1P3FD 3KXBB 3KUYA 3AZNC 3KXBD 3UTAA 2JCHA 3AV2C 2RIQA 1S32C 4J8XC 3X1TB 1BH8B 2Y2QA 3X1TD 4CSRA 5BT1D 3WTPE 5AV6D 1N1JA 2RVQD 5JA4B 4Z66B 4G92B 2FJ7A 4Z66D 5GT3C 3VH6W 3AZKA 4KUDC 5CHLB 3W96C 5B0YC 1P34C 4WZSB 3AZHA 1P3OA 3LJAA 5CPJC 1M19A 4KUDD 1EQZC 3W98B 3WKJC 2Y2HA 4WU8A 5CPIA 3AFAA 3W98D 4WJ3C 3R45A 1M18A 5B2JB 5KDMB 5AY8D 5B2JD 3MGSB 5GT3B 4NFTA 3MNNB 5AV5A 3MGSD 1JFIB 3MNND 3REJC 1BH9A 5GSUB 3AZMC 4KUDB 3W99A 1HQ3C 3UTAC 3TU4D 5B1LC 3NQJA 3X1VA 4H9NB 2CWEA 3WKJB 2FJ7C 2Y2LA 2LY8A 1P3PA 3KWQD 4WU9A 5JRGB 5B0ZC 3W97B 4J8VB 5CP6B 3W97D 5G49A 4J8VD 3AZEB 5CP6D 1P3GA 3VH5W 3IP4C 3AZED 1P3MC 3AN2C 3O62A 4UPKA 4R8PA 1KX3C 3KUYB 3KUYD 3UTAB 3B6FC 5BO0A 3X1SC 1Q9CA 4CSRB 1P3LA 3AFAC 1N1JB 3A1KA 5F99C 2FJ7B 5AV8D 2XD1A 1P3IA 1TZYC 1F66D 5B0ZB 2F8NK 3MVDC 5B1MA 4NE6A 3RELC 2IO5C 3LZ0A 3AZKB 3AZKD 2J8PA 4ZUXC 3C1BC 3AZJA 3EPKA 3H0RC 3AZHB 1P3OB 3LJAB 1M19B 3AZHD 1P3OD 3LJAD 1M19D 2BYMA 2NQBC 4WU8B 5CPIB 3A6NA 3AFAB 5B31A 5CPID 3R45B 5B2IC 1M18B 1M18D 5AV6A 5AV5B 3REKC 5AV5D 5AVBA 1ULYA 1BH9B 2IO5B 5CPKA 3W99B 4NE3A 4YS3A 3W99D 3AZIA 2AROC 3MGPA 3MGQC 4X23C 3AZGA 1A7WA 3NQJB 4J8UD 3X1VB 5BNXA 4HGAB 3X1VD 2JSSA 3WA9A 5FUGA 1R4VA 3VH6A 1P3PB 4WU9B 3VH5T 4WU9D 4KHAA 5G49B 4JJNC 1P3GB 5AY8A 4AWLC 1P3GD 1ID3A 3O62B 4R8PB 5AV9C 1B6WA 5DNNC 4R8PD 5E5AA 3X1UC 5BO0B 1P3FC 4KGCA 3KXBC 4XUJD 1P3LB 2JE5A 1P3LD 1P3KA 4Z2MG 3X1TC 5BT1C 5AV6C 2RVQC 2NZDA 1P3ID 4G92C 4Z66C 1T3UA 5B1MB 3V9RA 5B1MD 3LZ0B 3LZ0D 5B32G 3AZJB 3AZJD 3AYWA 2BYMB 3C1CA 3A6NB 3A1IA 3A6ND 5B31D 3AZFA 1P3BD 5B24A 1W2EA 5AV6B 3W98C 5AVBB 5AV8A 3VH5A 5B2JC 5AVBD 2DF4C 3MGSC 1F66A 3MNNC 5CPKB 4YS3B 5CPKD 4YS3D 3AZIB 5GSUC 3MGPB 3AZID 3AZGB 3MGPD 4ZBJB 3AZGD 5BNXB 3TU4C 3WA9B 3AV1A 5FUGB 3WA9D 5BS7A 2HIOD 1F1EA 4J8WA 1AOIA 1KX5A 5B33A 4XZQA 2PYOD 3KWQC 5AY8B 3LZ1A 1ID3B 5JRGC 1ID3D 2Y2GA 4J8VC 3W97C 5CP6C 3AZEC 3EG5B 5E5AB 5E5AD 4KGCB 5AVCA 4KGCD 3KUYC 3AL0C 1KX4A 3B0BA 4YM6D 3TU4B 3AZLA 1P3KB 4J8UA 4DRAA 1P3KD 1WWSA 5BNVA 4QLCD 2NZDB 5AV8C 2NZDD 5B40A 3WTPA 1F66C 3KWQB 2Y2MA 2Y2KA 3MGRA 5GT0A 4UUZB 3REIA 3AZKC 3AYWB 3AYWD 3C1CB 3C1CD 3AZHC 5GXQA 1P3OC 3LJAC 1M19C 3AZFB 1P3AA 2Y2JA 4XUJA 5B24B 3AZFD 5B0YD 2HUEB 5CPIC 5B24D 4WU8C 4WNNA 1M18C 5AV8B 1U35D 2L5AA 1F66B 5AV5C 3UTBD 3EPJA 3W99C 2FFFB 2ZY4A 3F6TA 3WAAA 4CAYA 2Y2PA 3B0DB 4J8UC 4E44A 5B32A 3X1VC 3AV1B 3AZMD 4HGAC 3AV1D 4H9SA 4J8WB 1AOIB 1KX5B 1AOID 4J8WD 1KX5D 3B0CT 5B33B 4XZQB 1P3BA 5B33D 4XZQD 3UT9A 3LZ1B 1P3PC 4WU9C 2F8NG 3LZ1D 4LD9D 1P3GC 1M1AD 3O62C 3H0MC 2BYKA 4R8PC 5AVCB 4DQYB 1KX4B 1WWIA 5AVCD 1KX4D 3AZLB 4J8UB 3AZLD 4XUJC 5BNVB 1ZLAA 3B6GA 1P3LC 2G5IC 2YFVA 4H9QA 3WTPB 5B40B 2HIOA 5B40D 3WTPD 1P3IC 4Z5TD 3REHA 5B1MC 3MGRB 2PYOA 5GT0B 1BH8A 3LZ0C 3MGRD 5GT0D 3REIB 3REID 2Y2IA 2ZY2A 3AZJC 2CV5A 5GXQB 5GXQD 4EO5C 5DNMA 1P3AB 2ZY5A 4XUJB 4YM6A 1P3AD 3EPHA 3A6NC 5B31C 4WNNB 3LELA 4QLCA 4G91B 3AZNA 1P3IB 5AVBC 3AV2A 1BFMA 1S32A 4J8XA 5CPKC 4YS3C 3WAAB 1TAFA 4CAYB 3AZIC 3WAAD 3MGPC 2YFWA 3AZGC 5B32B 4ZBJC 1JFIA 5B32D 4EO5B 5B31B 1P3BB 3WA9C 4X23D 3UT9B 3W96A 5B0YA 3UT9D 4H9OA 1P34A 2PYOC 4H9RA 5CPJA 1U35A 5AY8C 5C3IB 4H9NA 4H9PA 1ID3C 2BYKB 3UTBA 1EQZA 3WKJA 4Z2MH 5E5AC 4KGCC 3P5JB 1ZLAB 3B6GB 1ZLAD 4DRBA 3REJA 3B6GD 1HTAA 1P3KC 2YFVB 4H9QB 3AZMA 4QLCC 2HIOB 1HQ3A 2NZDC 3REHB 5B1LA 4KHAB 3REHD 2PYOB 3FDDA 3B0CW 2CV5B 4LD9A 2CV5D 1M1AA 2F8NA 4NE5A 3AYWC 5DNMB 5B0ZA 3C1CC 5DNMD 4YM6B 1P3MA 3AZFC 3AN2A 3LELB 4QLCB 5B24C 3LELD 1KX3A 1H3OA 2HUEC 3AZNB 3KSYA 3AZND 3B6FA 3AV2B 3X1SA 1U35C 3V9RB 1S32B 3AV2D 4J8XB 1KU5A 1S32D 3UTBC 4Z5TA 4J8XD 4WV4B 1TAFB 2Y2OA 5F99A 2YFWB 2DQNC 1TZYA 5GT3D 3MVDA 2ZY3A 3B0DC 3RELA 5GSUD 3AV1C 5BS7C 4ZUXA 3C1BA 4J8WC 5B0YB 1AOIC 1KX5C 3W96B 3W96D 4H9OB 1P34B 5B33C 4XZQC 4H9RB 5CPJB 1P34D 1U35B 5CPJD 3LZ1C 2NQBA 4H9PB 3UTBB 1EQZB 2G5HC 4LD9C 1EQZD 1M1AC 3WKJD 5B2IA 2BG1A 2F2AC 5AVCC 5JRGD 3REKA 3NQUA 1KX4C 3REJB 3AZLC 3REJD 3AZMB 1Z2CB 1HQ3B 2AROA 5B1LB 1HQ3D 3UTAD 3MGQA 4X23A 5B1LD 3WTPC 5B40C 2Y2NA 4Z5TC 3VH6T 4LD9B 3MGRC 1M1AB 5GT0C 2FJ7D 2F8NB 3REIC 2F8ND 2W8SA 5B0ZD 4JJNA 5GXQC 1P3MB 3AN2B 1P3MD 3H0LC 1P3AC 3AN2D 5AV9A 1KX3B 1H3OB 5DNNA 1KX3D 3X1UA 3B6FB 3X1SB 1P3FA 3B6FD 3X1SD 3KXBA 4Z5TB 4G91C 1B67A 4WU8D 3AFAD 5F99B 5F99D 3X1TA 1TZYB 3WAAC 3MVDB 1TZYD 5JA4A 4Z66A 2ZM5A 3MVDD 3RELB 4E45A 2F8NH 5B32C 3RELD 4ZUXB 4H9SC 3C1BB 4ZUXD 3C1BD 1P3BC 3UT9C 2NQBB 2NQBD 5B2IB 5C3IC 5B2ID 1P3PD 3W98A 3REKB 3NQUB 3EPLA 3REKD 5B2JA 5KDMA 3MGSA 5GT3A 3MNNA 3O62D 1ZLAC 3B6GC 2AROB 5GSUA 2AROD 4X23B 3MGQB 3MGQD 2HIOC 4KUDA 4M6BA 1PZRA 3TU4A 3REHC 2CV5C 2UWXA 4JJNB 3KWQA 4JJND 4AWLB 5DNMC 5JRGA 3W97A
chains in the Genus database with same CATH topology
5AV9B 4YM6C 2VQRA 2XD5A 5CP6A 5DNNB 5AV9D 4J8VA 3AZEA 3KFUG 5DNND 4UUZA 3X1UB 1P3FB 3X1UD 3LELC 5B31G 1P3FD 3KXBB 3KUYA 3AZNC 3KXBD 3UTAA 2JCHA 3AV2C 2RIQA 1S32C 4J8XC 3X1TB 1BH8B 2Y2QA 3X1TD 4CSRA 5BT1D 3WTPE 5AV6D 1N1JA 2RVQD 5JA4B 4Z66B 4G92B 2FJ7A 4Z66D 5GT3C 3VH6W 3AZKA 4KUDC 5CHLB 3W96C 5B0YC 1P34C 4WZSB 3AZHA 1P3OA 3LJAA 5CPJC 1M19A 4KUDD 1EQZC 3W98B 3WKJC 2Y2HA 4WU8A 5CPIA 3AFAA 3W98D 4WJ3C 3R45A 1M18A 5B2JB 5KDMB 5AY8D 5B2JD 3MGSB 5GT3B 4NFTA 3MNNB 5AV5A 3MGSD 1JFIB 3MNND 3REJC 1BH9A 5GSUB 3AZMC 4KUDB 3W99A 1HQ3C 3UTAC 3TU4D 5B1LC 3NQJA 3X1VA 4H9NB 2CWEA 3WKJB 2FJ7C 2Y2LA 2LY8A 1P3PA 3KWQD 4WU9A 5JRGB 5B0ZC 3W97B 4J8VB 5CP6B 3W97D 5G49A 4J8VD 3AZEB 5CP6D 1P3GA 3VH5W 3IP4C 3AZED 1P3MC 3AN2C 3O62A 4UPKA 4R8PA 1KX3C 3KUYB 3KUYD 3UTAB 3B6FC 5BO0A 3X1SC 1Q9CA 4CSRB 1P3LA 3AFAC 1N1JB 3A1KA 5F99C 2FJ7B 5AV8D 2XD1A 1P3IA 1TZYC 1F66D 5B0ZB 2F8NK 3MVDC 5B1MA 4NE6A 3RELC 2IO5C 3LZ0A 3AZKB 3AZKD 2J8PA 4ZUXC 3C1BC 3AZJA 3EPKA 3H0RC 3AZHB 1P3OB 3LJAB 1M19B 3AZHD 1P3OD 3LJAD 1M19D 2BYMA 2NQBC 4WU8B 5CPIB 3A6NA 3AFAB 5B31A 5CPID 3R45B 5B2IC 1M18B 1M18D 5AV6A 5AV5B 3REKC 5AV5D 5AVBA 1ULYA 1BH9B 2IO5B 5CPKA 3W99B 4NE3A 4YS3A 3W99D 3AZIA 2AROC 3MGPA 3MGQC 4X23C 3AZGA 1A7WA 3NQJB 4J8UD 3X1VB 5BNXA 4HGAB 3X1VD 2JSSA 3WA9A 5FUGA 1R4VA 3VH6A 1P3PB 4WU9B 3VH5T 4WU9D 4KHAA 5G49B 4JJNC 1P3GB 5AY8A 4AWLC 1P3GD 1ID3A 3O62B 4R8PB 5AV9C 1B6WA 5DNNC 4R8PD 5E5AA 3X1UC 5BO0B 1P3FC 4KGCA 3KXBC 4XUJD 1P3LB 2JE5A 1P3LD 1P3KA 4Z2MG 3X1TC 5BT1C 5AV6C 2RVQC 2NZDA 1P3ID 4G92C 4Z66C 1T3UA 5B1MB 3V9RA 5B1MD 3LZ0B 3LZ0D 5B32G 3AZJB 3AZJD 3AYWA 2BYMB 3C1CA 3A6NB 3A1IA 3A6ND 5B31D 3AZFA 1P3BD 5B24A 1W2EA 5AV6B 3W98C 5AVBB 5AV8A 3VH5A 5B2JC 5AVBD 2DF4C 3MGSC 1F66A 3MNNC 5CPKB 4YS3B 5CPKD 4YS3D 3AZIB 5GSUC 3MGPB 3AZID 3AZGB 3MGPD 4ZBJB 3AZGD 5BNXB 3TU4C 3WA9B 3AV1A 5FUGB 3WA9D 5BS7A 2HIOD 1F1EA 4J8WA 1AOIA 1KX5A 5B33A 4XZQA 2PYOD 3KWQC 5AY8B 3LZ1A 1ID3B 5JRGC 1ID3D 2Y2GA 4J8VC 3W97C 5CP6C 3AZEC 3EG5B 5E5AB 5E5AD 4KGCB 5AVCA 4KGCD 3KUYC 3AL0C 1KX4A 3B0BA 4YM6D 3TU4B 3AZLA 1P3KB 4J8UA 4DRAA 1P3KD 1WWSA 5BNVA 4QLCD 2NZDB 5AV8C 2NZDD 5B40A 3WTPA 1F66C 3KWQB 2Y2MA 2Y2KA 3MGRA 5GT0A 4UUZB 3REIA 3AZKC 3AYWB 3AYWD 3C1CB 3C1CD 3AZHC 5GXQA 1P3OC 3LJAC 1M19C 3AZFB 1P3AA 2Y2JA 4XUJA 5B24B 3AZFD 5B0YD 2HUEB 5CPIC 5B24D 4WU8C 4WNNA 1M18C 5AV8B 1U35D 2L5AA 1F66B 5AV5C 3UTBD 3EPJA 3W99C 2FFFB 2ZY4A 3F6TA 3WAAA 4CAYA 2Y2PA 3B0DB 4J8UC 4E44A 5B32A 3X1VC 3AV1B 3AZMD 4HGAC 3AV1D 4H9SA 4J8WB 1AOIB 1KX5B 1AOID 4J8WD 1KX5D 3B0CT 5B33B 4XZQB 1P3BA 5B33D 4XZQD 3UT9A 3LZ1B 1P3PC 4WU9C 2F8NG 3LZ1D 4LD9D 1P3GC 1M1AD 3O62C 3H0MC 2BYKA 4R8PC 5AVCB 4DQYB 1KX4B 1WWIA 5AVCD 1KX4D 3AZLB 4J8UB 3AZLD 4XUJC 5BNVB 1ZLAA 3B6GA 1P3LC 2G5IC 2YFVA 4H9QA 3WTPB 5B40B 2HIOA 5B40D 3WTPD 1P3IC 4Z5TD 3REHA 5B1MC 3MGRB 2PYOA 5GT0B 1BH8A 3LZ0C 3MGRD 5GT0D 3REIB 3REID 2Y2IA 2ZY2A 3AZJC 2CV5A 5GXQB 5GXQD 4EO5C 5DNMA 1P3AB 2ZY5A 4XUJB 4YM6A 1P3AD 3EPHA 3A6NC 5B31C 4WNNB 3LELA 4QLCA 4G91B 3AZNA 1P3IB 5AVBC 3AV2A 1BFMA 1S32A 4J8XA 5CPKC 4YS3C 3WAAB 1TAFA 4CAYB 3AZIC 3WAAD 3MGPC 2YFWA 3AZGC 5B32B 4ZBJC 1JFIA 5B32D 4EO5B 5B31B 1P3BB 3WA9C 4X23D 3UT9B 3W96A 5B0YA 3UT9D 4H9OA 1P34A 2PYOC 4H9RA 5CPJA 1U35A 5AY8C 5C3IB 4H9NA 4H9PA 1ID3C 2BYKB 3UTBA 1EQZA 3WKJA 4Z2MH 5E5AC 4KGCC 3P5JB 1ZLAB 3B6GB 1ZLAD 4DRBA 3REJA 3B6GD 1HTAA 1P3KC 2YFVB 4H9QB 3AZMA 4QLCC 2HIOB 1HQ3A 2NZDC 3REHB 5B1LA 4KHAB 3REHD 2PYOB 3FDDA 3B0CW 2CV5B 4LD9A 2CV5D 1M1AA 2F8NA 4NE5A 3AYWC 5DNMB 5B0ZA 3C1CC 5DNMD 4YM6B 1P3MA 3AZFC 3AN2A 3LELB 4QLCB 5B24C 3LELD 1KX3A 1H3OA 2HUEC 3AZNB 3KSYA 3AZND 3B6FA 3AV2B 3X1SA 1U35C 3V9RB 1S32B 3AV2D 4J8XB 1KU5A 1S32D 3UTBC 4Z5TA 4J8XD 4WV4B 1TAFB 2Y2OA 5F99A 2YFWB 2DQNC 1TZYA 5GT3D 3MVDA 2ZY3A 3B0DC 3RELA 5GSUD 3AV1C 5BS7C 4ZUXA 3C1BA 4J8WC 5B0YB 1AOIC 1KX5C 3W96B 3W96D 4H9OB 1P34B 5B33C 4XZQC 4H9RB 5CPJB 1P34D 1U35B 5CPJD 3LZ1C 2NQBA 4H9PB 3UTBB 1EQZB 2G5HC 4LD9C 1EQZD 1M1AC 3WKJD 5B2IA 2BG1A 2F2AC 5AVCC 5JRGD 3REKA 3NQUA 1KX4C 3REJB 3AZLC 3REJD 3AZMB 1Z2CB 1HQ3B 2AROA 5B1LB 1HQ3D 3UTAD 3MGQA 4X23A 5B1LD 3WTPC 5B40C 2Y2NA 4Z5TC 3VH6T 4LD9B 3MGRC 1M1AB 5GT0C 2FJ7D 2F8NB 3REIC 2F8ND 2W8SA 5B0ZD 4JJNA 5GXQC 1P3MB 3AN2B 1P3MD 3H0LC 1P3AC 3AN2D 5AV9A 1KX3B 1H3OB 5DNNA 1KX3D 3X1UA 3B6FB 3X1SB 1P3FA 3B6FD 3X1SD 3KXBA 4Z5TB 4G91C 1B67A 4WU8D 3AFAD 5F99B 5F99D 3X1TA 1TZYB 3WAAC 3MVDB 1TZYD 5JA4A 4Z66A 2ZM5A 3MVDD 3RELB 4E45A 2F8NH 5B32C 3RELD 4ZUXB 4H9SC 3C1BB 4ZUXD 3C1BD 1P3BC 3UT9C 2NQBB 2NQBD 5B2IB 5C3IC 5B2ID 1P3PD 3W98A 3REKB 3NQUB 3EPLA 3REKD 5B2JA 5KDMA 3MGSA 5GT3A 3MNNA 3O62D 1ZLAC 3B6GC 2AROB 5GSUA 2AROD 4X23B 3MGQB 3MGQD 2HIOC 4KUDA 4M6BA 1PZRA 3TU4A 3REHC 2CV5C 2UWXA 4JJNB 3KWQA 4JJND 4AWLB 5DNMC 5JRGA 3W97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 B;  4YM6 C;  4J8V A;  5CP6 A;  5DNN B;  5AV9 D;  3AZE A;  5DNN D;  4UUZ A;  3X1U B;  1P3F B;  3X1U D;  3LEL C;  5B31 G;  1P3F D;  3KXB B;  3KUY A;  3AZN C;  3KXB D;  3UTA A;  3AV2 C;  1S32 C;  4J8X C;  3X1T B;  1BH8 B;  3X1T D;  4CSR A;  5BT1 D;  3WTP E;  5AV6 D;  1N1J A;  2RVQ D;  5JA4 B;  4Z66 B;  4G92 B;  2FJ7 A;  4Z66 D;  5GT3 C;  3VH6 W;  3AZK A;  4KUD C;  5CHL B;  3W96 C;  5B0Y C;  1P34 C;  4WZS B;  3AZH A;  1P3O A;  3LJA A;  5CPJ C;  1M19 A;  4KUD D;  1EQZ C;  3W98 B;  3WKJ C;  4WU8 A;  5CPI A;  3AFA A;  3W98 D;  3R45 A;  1M18 A;  5B2J B;  5KDM B;  5AY8 D;  5B2J D;  3MGS B;  5GT3 B;  4NFT A;  3MNN B;  5AV5 A;  3MGS D;  1JFI B;  3MNN D;  3REJ C;  1BH9 A;  5GSU B;  3AZM C;  4KUD B;  3W99 A;  1HQ3 C;  3UTA C;  3TU4 D;  5B1L C;  3NQJ A;  3X1V A;  4H9N B;  2CWE A;  3WKJ B;  2FJ7 C;  2LY8 A;  1P3P A;  3KWQ D;  4WU9 A;  5JRG B;  5B0Z C;  3W97 B;  4J8V B;  5CP6 B;  3W97 D;  5G49 A;  4J8V D;  3AZE B;  5CP6 D;  1P3G A;  3VH5 W;  3AZE D;  1P3M C;  3AN2 C;  3O62 A;  4R8P A;  1KX3 C;  3KUY B;  3KUY D;  3UTA B;  3B6F C;  5BO0 A;  3X1S C;  1Q9C A;  4CSR B;  1P3L A;  3AFA C;  1N1J B;  5F99 C;  2FJ7 B;  5AV8 D;  1P3I A;  1TZY C;  1F66 D;  5B0Z B;  2F8N K;  3MVD C;  5B1M A;  4NE6 A;  3REL C;  2IO5 C;  3LZ0 A;  3AZK B;  3AZK D;  4ZUX C;  3C1B C;  3AZJ A;  3AZH B;  1P3O B;  3LJA B;  1M19 B;  3AZH D;  1P3O D;  3LJA D;  1M19 D;  2BYM A;  2NQB C;  4WU8 B;  5CPI B;  3A6N A;  3AFA B;  5B31 A;  5CPI D;  3R45 B;  5B2I C;  1M18 B;  1M18 D;  5AV6 A;  5AV5 B;  3REK C;  5AV5 D;  5AVB A;  1ULY A;  1BH9 B;  2IO5 B;  5CPK A;  3W99 B;  4NE3 A;  4YS3 A;  3W99 D;  3AZI A;  2ARO C;  3MGP A;  3MGQ C;  4X23 C;  3AZG A;  1A7W A;  3NQJ B;  4J8U D;  3X1V B;  5BNX A;  4HGA B;  3X1V D;  2JSS A;  3WA9 A;  5FUG A;  1R4V A;  3VH6 A;  1P3P B;  4WU9 B;  3VH5 T;  4WU9 D;  4KHA A;  5G49 B;  4JJN C;  1P3G B;  5AY8 A;  4AWL C;  1P3G D;  1ID3 A;  3O62 B;  4R8P B;  5AV9 C;  1B6W A;  5DNN C;  4R8P D;  5E5A A;  3X1U C;  5BO0 B;  1P3F C;  4KGC A;  3KXB C;  4XUJ D;  1P3L B;  1P3L D;  1P3K A;  4Z2M G;  3X1T C;  5BT1 C;  5AV6 C;  2RVQ C;  2NZD A;  1P3I D;  4G92 C;  4Z66 C;  5B1M B;  3V9R A;  5B1M D;  3LZ0 B;  3LZ0 D;  5B32 G;  3AZJ B;  3AZJ D;  3AYW A;  2BYM B;  3C1C A;  3A6N B;  3A6N D;  5B31 D;  3AZF A;  1P3B D;  5B24 A;  5AV6 B;  3W98 C;  5AVB B;  5AV8 A;  3VH5 A;  5B2J C;  5AVB D;  3MGS C;  1F66 A;  3MNN C;  5CPK B;  4YS3 B;  5CPK D;  4YS3 D;  3AZI B;  5GSU C;  3MGP B;  3AZI D;  3AZG B;  3MGP D;  4ZBJ B;  3AZG D;  5BNX B;  3TU4 C;  3WA9 B;  3AV1 A;  5FUG B;  3WA9 D;  5BS7 A;  2HIO D;  1F1E A;  4J8W A;  1AOI A;  1KX5 A;  5B33 A;  4XZQ A;  2PYO D;  3KWQ C;  5AY8 B;  3LZ1 A;  1ID3 B;  5JRG C;  1ID3 D;  4J8V C;  3W97 C;  5CP6 C;  3AZE C;  5E5A B;  5E5A D;  4KGC B;  5AVC A;  4KGC D;  3KUY C;  1KX4 A;  3B0B A;  4YM6 D;  3TU4 B;  3AZL A;  1P3K B;  4J8U A;  4DRA A;  1P3K D;  1WWS A;  5BNV A;  4QLC D;  2NZD B;  5AV8 C;  2NZD D;  5B40 A;  3WTP A;  1F66 C;  3KWQ B;  3MGR A;  5GT0 A;  4UUZ B;  3REI A;  3AZK C;  3AYW B;  3AYW D;  3C1C B;  3C1C D;  3AZH C;  5GXQ A;  1P3O C;  3LJA C;  1M19 C;  3AZF B;  1P3A A;  3AZF D;  4XUJ A;  5B24 B;  5B0Y D;  2HUE B;  5CPI C;  5B24 D;  4WU8 C;  4WNN A;  1M18 C;  5AV8 B;  1U35 D;  2L5A A;  1F66 B;  5AV5 C;  3UTB D;  3W99 C;  3WAA A;  4CAY A;  3B0D B;  4J8U C;  4E44 A;  5B32 A;  3X1V C;  3AV1 B;  3AZM D;  4HGA C;  3AV1 D;  4H9S A;  4J8W B;  1AOI B;  1KX5 B;  1AOI D;  4J8W D;  1KX5 D;  3B0C T;  5B33 B;  4XZQ B;  1P3B A;  5B33 D;  4XZQ D;  3UT9 A;  3LZ1 B;  1P3P C;  4WU9 C;  2F8N G;  3LZ1 D;  4LD9 D;  1P3G C;  1M1A D;  3O62 C;  2BYK A;  4R8P C;  5AVC B;  1KX4 B;  1WWI A;  5AVC D;  1KX4 D;  3AZL B;  4J8U B;  3AZL D;  4XUJ C;  5BNV B;  1ZLA A;  3B6G A;  1P3L C;  2YFV A;  4H9Q A;  3WTP B;  5B40 B;  2HIO A;  5B40 D;  3WTP D;  1P3I C;  4Z5T D;  3REH A;  5B1M C;  3MGR B;  2PYO A;  5GT0 B;  1BH8 A;  3LZ0 C;  3MGR D;  5GT0 D;  3REI B;  3REI D;  2CV5 A;  3AZJ C;  5GXQ B;  5GXQ D;  4EO5 C;  5DNM A;  1P3A B;  4XUJ B;  4YM6 A;  1P3A D;  3A6N C;  5B31 C;  4WNN B;  3LEL A;  4QLC A;  4G91 B;  3AZN A;  1P3I B;  5AVB C;  3AV2 A;  1BFM A;  1S32 A;  4J8X A;  5CPK C;  4YS3 C;  3WAA B;  1TAF A;  4CAY B;  3AZI C;  3WAA D;  3MGP C;  2YFW A;  3AZG C;  5B32 B;  4ZBJ C;  1JFI A;  5B32 D;  4EO5 B;  5B31 B;  1P3B B;  3WA9 C;  4X23 D;  3UT9 B;  3W96 A;  5B0Y A;  3UT9 D;  4H9O A;  1P34 A;  2PYO C;  4H9R A;  5CPJ A;  1U35 A;  5AY8 C;  5C3I B;  4H9N A;  4H9P A;  1ID3 C;  2BYK B;  3UTB A;  1EQZ A;  3WKJ A;  4Z2M H;  5E5A C;  4KGC C;  1ZLA B;  3B6G B;  1ZLA D;  4DRB A;  3REJ A;  3B6G D;  1HTA A;  1P3K C;  2YFV B;  4H9Q B;  3AZM A;  4QLC C;  2HIO B;  1HQ3 A;  2NZD C;  3REH B;  5B1L A;  4KHA B;  3REH D;  2PYO B;  3B0C W;  2CV5 B;  4LD9 A;  2CV5 D;  1M1A A;  2F8N A;  4NE5 A;  3AYW C;  5DNM B;  5B0Z A;  3C1C C;  5DNM D;  4YM6 B;  1P3M A;  3AZF C;  3AN2 A;  3LEL B;  4QLC B;  5B24 C;  3LEL D;  1KX3 A;  1H3O A;  2HUE C;  3AZN B;  3KSY A;  3AZN D;  3B6F A;  3AV2 B;  3X1S A;  1U35 C;  3V9R B;  1S32 B;  3AV2 D;  4J8X B;  1KU5 A;  1S32 D;  3UTB C;  4Z5T A;  4J8X D;  4WV4 B;  1TAF B;  5F99 A;  2YFW B;  1TZY A;  5GT3 D;  3MVD A;  3B0D C;  3REL A;  5GSU D;  3AV1 C;  5BS7 C;  4ZUX A;  3C1B A;  4J8W C;  5B0Y B;  1AOI C;  1KX5 C;  3W96 B;  3W96 D;  4H9O B;  1P34 B;  5B33 C;  4XZQ C;  4H9R B;  5CPJ B;  1P34 D;  1U35 B;  5CPJ D;  3LZ1 C;  2NQB A;  4H9P B;  3UTB B;  1EQZ B;  4LD9 C;  1EQZ D;  1M1A C;  3WKJ D;  5B2I A;  5AVC C;  5JRG D;  3REK A;  3NQU A;  1KX4 C;  3REJ B;  3AZL C;  3REJ D;  3AZM B;  1HQ3 B;  2ARO A;  5B1L B;  1HQ3 D;  3UTA D;  3MGQ A;  4X23 A;  5B1L D;  3WTP C;  5B40 C;  4Z5T C;  3VH6 T;  4LD9 B;  3MGR C;  1M1A B;  5GT0 C;  2FJ7 D;  2F8N B;  3REI C;  2F8N D;  5B0Z D;  4JJN A;  5GXQ C;  1P3M B;  3AN2 B;  1P3M D;  1P3A C;  3AN2 D;  5AV9 A;  1KX3 B;  1H3O B;  5DNN A;  1KX3 D;  3X1U A;  3B6F B;  3X1S B;  1P3F A;  3B6F D;  3X1S D;  3KXB A;  4Z5T B;  4G91 C;  1B67 A;  4WU8 D;  3AFA D;  5F99 B;  5F99 D;  3X1T A;  1TZY B;  3WAA C;  3MVD B;  1TZY D;  5JA4 A;  4Z66 A;  3MVD D;  3REL B;  4E45 A;  2F8N H;  5B32 C;  3REL D;  4ZUX B;  4H9S C;  3C1B B;  4ZUX D;  3C1B D;  1P3B C;  3UT9 C;  2NQB B;  2NQB D;  5B2I B;  5C3I C;  5B2I D;  1P3P D;  3W98 A;  3REK B;  3NQU B;  3REK D;  5B2J A;  5KDM A;  3MGS A;  5GT3 A;  3MNN A;  3O62 D;  1ZLA C;  3B6G C;  2ARO B;  5GSU A;  2ARO D;  4X23 B;  3MGQ B;  3MGQ D;  2HIO C;  4KUD A;  4M6B A;  3TU4 A;  3REH C;  2CV5 C;  4JJN B;  3KWQ A;  4JJN D;  4AWL B;  5DNM C;  5JRG A;  3W97 A; 
#chains in the Genus database with same CATH topology
 5AV9 B;  4YM6 C;  2VQR A;  2XD5 A;  5CP6 A;  5DNN B;  5AV9 D;  4J8V A;  3AZE A;  3KFU G;  5DNN D;  4UUZ A;  3X1U B;  1P3F B;  3X1U D;  3LEL C;  5B31 G;  1P3F D;  3KXB B;  3KUY A;  3AZN C;  3KXB D;  3UTA A;  2JCH A;  3AV2 C;  2RIQ A;  1S32 C;  4J8X C;  3X1T B;  1BH8 B;  2Y2Q A;  3X1T D;  4CSR A;  5BT1 D;  3WTP E;  5AV6 D;  1N1J A;  2RVQ D;  5JA4 B;  4Z66 B;  4G92 B;  2FJ7 A;  4Z66 D;  5GT3 C;  3VH6 W;  3AZK A;  4KUD C;  5CHL B;  3W96 C;  5B0Y C;  1P34 C;  4WZS B;  3AZH A;  1P3O A;  3LJA A;  5CPJ C;  1M19 A;  4KUD D;  1EQZ C;  3W98 B;  3WKJ C;  2Y2H A;  4WU8 A;  5CPI A;  3AFA A;  3W98 D;  4WJ3 C;  3R45 A;  1M18 A;  5B2J B;  5KDM B;  5AY8 D;  5B2J D;  3MGS B;  5GT3 B;  4NFT A;  3MNN B;  5AV5 A;  3MGS D;  1JFI B;  3MNN D;  3REJ C;  1BH9 A;  5GSU B;  3AZM C;  4KUD B;  3W99 A;  1HQ3 C;  3UTA C;  3TU4 D;  5B1L C;  3NQJ A;  3X1V A;  4H9N B;  2CWE A;  3WKJ B;  2FJ7 C;  2Y2L A;  2LY8 A;  1P3P A;  3KWQ D;  4WU9 A;  5JRG B;  5B0Z C;  3W97 B;  4J8V B;  5CP6 B;  3W97 D;  5G49 A;  4J8V D;  3AZE B;  5CP6 D;  1P3G A;  3VH5 W;  3IP4 C;  3AZE D;  1P3M C;  3AN2 C;  3O62 A;  4UPK A;  4R8P A;  1KX3 C;  3KUY B;  3KUY D;  3UTA B;  3B6F C;  5BO0 A;  3X1S C;  1Q9C A;  4CSR B;  1P3L A;  3AFA C;  1N1J B;  3A1K A;  5F99 C;  2FJ7 B;  5AV8 D;  2XD1 A;  1P3I A;  1TZY C;  1F66 D;  5B0Z B;  2F8N K;  3MVD C;  5B1M A;  4NE6 A;  3REL C;  2IO5 C;  3LZ0 A;  3AZK B;  3AZK D;  2J8P A;  4ZUX C;  3C1B C;  3AZJ A;  3EPK A;  3H0R C;  3AZH B;  1P3O B;  3LJA B;  1M19 B;  3AZH D;  1P3O D;  3LJA D;  1M19 D;  2BYM A;  2NQB C;  4WU8 B;  5CPI B;  3A6N A;  3AFA B;  5B31 A;  5CPI D;  3R45 B;  5B2I C;  1M18 B;  1M18 D;  5AV6 A;  5AV5 B;  3REK C;  5AV5 D;  5AVB A;  1ULY A;  1BH9 B;  2IO5 B;  5CPK A;  3W99 B;  4NE3 A;  4YS3 A;  3W99 D;  3AZI A;  2ARO C;  3MGP A;  3MGQ C;  4X23 C;  3AZG A;  1A7W A;  3NQJ B;  4J8U D;  3X1V B;  5BNX A;  4HGA B;  3X1V D;  2JSS A;  3WA9 A;  5FUG A;  1R4V A;  3VH6 A;  1P3P B;  4WU9 B;  3VH5 T;  4WU9 D;  4KHA A;  5G49 B;  4JJN C;  1P3G B;  5AY8 A;  4AWL C;  1P3G D;  1ID3 A;  3O62 B;  4R8P B;  5AV9 C;  1B6W A;  5DNN C;  4R8P D;  5E5A A;  3X1U C;  5BO0 B;  1P3F C;  4KGC A;  3KXB C;  4XUJ D;  1P3L B;  2JE5 A;  1P3L D;  1P3K A;  4Z2M G;  3X1T C;  5BT1 C;  5AV6 C;  2RVQ C;  2NZD A;  1P3I D;  4G92 C;  4Z66 C;  1T3U A;  5B1M B;  3V9R A;  5B1M D;  3LZ0 B;  3LZ0 D;  5B32 G;  3AZJ B;  3AZJ D;  3AYW A;  2BYM B;  3C1C A;  3A6N B;  3A1I A;  3A6N D;  5B31 D;  3AZF A;  1P3B D;  5B24 A;  1W2E A;  5AV6 B;  3W98 C;  5AVB B;  5AV8 A;  3VH5 A;  5B2J C;  5AVB D;  2DF4 C;  3MGS C;  1F66 A;  3MNN C;  5CPK B;  4YS3 B;  5CPK D;  4YS3 D;  3AZI B;  5GSU C;  3MGP B;  3AZI D;  3AZG B;  3MGP D;  4ZBJ B;  3AZG D;  5BNX B;  3TU4 C;  3WA9 B;  3AV1 A;  5FUG B;  3WA9 D;  5BS7 A;  2HIO D;  1F1E A;  4J8W A;  1AOI A;  1KX5 A;  5B33 A;  4XZQ A;  2PYO D;  3KWQ C;  5AY8 B;  3LZ1 A;  1ID3 B;  5JRG C;  1ID3 D;  2Y2G A;  4J8V C;  3W97 C;  5CP6 C;  3AZE C;  3EG5 B;  5E5A B;  5E5A D;  4KGC B;  5AVC A;  4KGC D;  3KUY C;  3AL0 C;  1KX4 A;  3B0B A;  4YM6 D;  3TU4 B;  3AZL A;  1P3K B;  4J8U A;  4DRA A;  1P3K D;  1WWS A;  5BNV A;  4QLC D;  2NZD B;  5AV8 C;  2NZD D;  5B40 A;  3WTP A;  1F66 C;  3KWQ B;  2Y2M A;  2Y2K A;  3MGR A;  5GT0 A;  4UUZ B;  3REI A;  3AZK C;  3AYW B;  3AYW D;  3C1C B;  3C1C D;  3AZH C;  5GXQ A;  1P3O C;  3LJA C;  1M19 C;  3AZF B;  1P3A A;  2Y2J A;  4XUJ A;  5B24 B;  3AZF D;  5B0Y D;  2HUE B;  5CPI C;  5B24 D;  4WU8 C;  4WNN A;  1M18 C;  5AV8 B;  1U35 D;  2L5A A;  1F66 B;  5AV5 C;  3UTB D;  3EPJ A;  3W99 C;  2FFF B;  2ZY4 A;  3F6T A;  3WAA A;  4CAY A;  2Y2P A;  3B0D B;  4J8U C;  4E44 A;  5B32 A;  3X1V C;  3AV1 B;  3AZM D;  4HGA C;  3AV1 D;  4H9S A;  4J8W B;  1AOI B;  1KX5 B;  1AOI D;  4J8W D;  1KX5 D;  3B0C T;  5B33 B;  4XZQ B;  1P3B A;  5B33 D;  4XZQ D;  3UT9 A;  3LZ1 B;  1P3P C;  4WU9 C;  2F8N G;  3LZ1 D;  4LD9 D;  1P3G C;  1M1A D;  3O62 C;  3H0M C;  2BYK A;  4R8P C;  5AVC B;  4DQY B;  1KX4 B;  1WWI A;  5AVC D;  1KX4 D;  3AZL B;  4J8U B;  3AZL D;  4XUJ C;  5BNV B;  1ZLA A;  3B6G A;  1P3L C;  2G5I C;  2YFV A;  4H9Q A;  3WTP B;  5B40 B;  2HIO A;  5B40 D;  3WTP D;  1P3I C;  4Z5T D;  3REH A;  5B1M C;  3MGR B;  2PYO A;  5GT0 B;  1BH8 A;  3LZ0 C;  3MGR D;  5GT0 D;  3REI B;  3REI D;  2Y2I A;  2ZY2 A;  3AZJ C;  2CV5 A;  5GXQ B;  5GXQ D;  4EO5 C;  5DNM A;  1P3A B;  2ZY5 A;  4XUJ B;  4YM6 A;  1P3A D;  3EPH A;  3A6N C;  5B31 C;  4WNN B;  3LEL A;  4QLC A;  4G91 B;  3AZN A;  1P3I B;  5AVB C;  3AV2 A;  1BFM A;  1S32 A;  4J8X A;  5CPK C;  4YS3 C;  3WAA B;  1TAF A;  4CAY B;  3AZI C;  3WAA D;  3MGP C;  2YFW A;  3AZG C;  5B32 B;  4ZBJ C;  1JFI A;  5B32 D;  4EO5 B;  5B31 B;  1P3B B;  3WA9 C;  4X23 D;  3UT9 B;  3W96 A;  5B0Y A;  3UT9 D;  4H9O A;  1P34 A;  2PYO C;  4H9R A;  5CPJ A;  1U35 A;  5AY8 C;  5C3I B;  4H9N A;  4H9P A;  1ID3 C;  2BYK B;  3UTB A;  1EQZ A;  3WKJ A;  4Z2M H;  5E5A C;  4KGC C;  3P5J B;  1ZLA B;  3B6G B;  1ZLA D;  4DRB A;  3REJ A;  3B6G D;  1HTA A;  1P3K C;  2YFV B;  4H9Q B;  3AZM A;  4QLC C;  2HIO B;  1HQ3 A;  2NZD C;  3REH B;  5B1L A;  4KHA B;  3REH D;  2PYO B;  3FDD A;  3B0C W;  2CV5 B;  4LD9 A;  2CV5 D;  1M1A A;  2F8N A;  4NE5 A;  3AYW C;  5DNM B;  5B0Z A;  3C1C C;  5DNM D;  4YM6 B;  1P3M A;  3AZF C;  3AN2 A;  3LEL B;  4QLC B;  5B24 C;  3LEL D;  1KX3 A;  1H3O A;  2HUE C;  3AZN B;  3KSY A;  3AZN D;  3B6F A;  3AV2 B;  3X1S A;  1U35 C;  3V9R B;  1S32 B;  3AV2 D;  4J8X B;  1KU5 A;  1S32 D;  3UTB C;  4Z5T A;  4J8X D;  4WV4 B;  1TAF B;  2Y2O A;  5F99 A;  2YFW B;  2DQN C;  1TZY A;  5GT3 D;  3MVD A;  2ZY3 A;  3B0D C;  3REL A;  5GSU D;  3AV1 C;  5BS7 C;  4ZUX A;  3C1B A;  4J8W C;  5B0Y B;  1AOI C;  1KX5 C;  3W96 B;  3W96 D;  4H9O B;  1P34 B;  5B33 C;  4XZQ C;  4H9R B;  5CPJ B;  1P34 D;  1U35 B;  5CPJ D;  3LZ1 C;  2NQB A;  4H9P B;  3UTB B;  1EQZ B;  2G5H C;  4LD9 C;  1EQZ D;  1M1A C;  3WKJ D;  5B2I A;  2BG1 A;  2F2A C;  5AVC C;  5JRG D;  3REK A;  3NQU A;  1KX4 C;  3REJ B;  3AZL C;  3REJ D;  3AZM B;  1Z2C B;  1HQ3 B;  2ARO A;  5B1L B;  1HQ3 D;  3UTA D;  3MGQ A;  4X23 A;  5B1L D;  3WTP C;  5B40 C;  2Y2N A;  4Z5T C;  3VH6 T;  4LD9 B;  3MGR C;  1M1A B;  5GT0 C;  2FJ7 D;  2F8N B;  3REI C;  2F8N D;  2W8S A;  5B0Z D;  4JJN A;  5GXQ C;  1P3M B;  3AN2 B;  1P3M D;  3H0L C;  1P3A C;  3AN2 D;  5AV9 A;  1KX3 B;  1H3O B;  5DNN A;  1KX3 D;  3X1U A;  3B6F B;  3X1S B;  1P3F A;  3B6F D;  3X1S D;  3KXB A;  4Z5T B;  4G91 C;  1B67 A;  4WU8 D;  3AFA D;  5F99 B;  5F99 D;  3X1T A;  1TZY B;  3WAA C;  3MVD B;  1TZY D;  5JA4 A;  4Z66 A;  2ZM5 A;  3MVD D;  3REL B;  4E45 A;  2F8N H;  5B32 C;  3REL D;  4ZUX B;  4H9S C;  3C1B B;  4ZUX D;  3C1B D;  1P3B C;  3UT9 C;  2NQB B;  2NQB D;  5B2I B;  5C3I C;  5B2I D;  1P3P D;  3W98 A;  3REK B;  3NQU B;  3EPL A;  3REK D;  5B2J A;  5KDM A;  3MGS A;  5GT3 A;  3MNN A;  3O62 D;  1ZLA C;  3B6G C;  2ARO B;  5GSU A;  2ARO D;  4X23 B;  3MGQ B;  3MGQ D;  2HIO C;  4KUD A;  4M6B A;  1PZR A;  3TU4 A;  3REH C;  2CV5 C;  2UWX A;  4JJN B;  3KWQ A;  4JJN D;  4AWL B;  5DNM C;  5JRG A;  3W97 A; 
#chains in the Genus database with same CATH homology
 5AV9 B;  4YM6 C;  2VQR A;  2XD5 A;  5CP6 A;  5DNN B;  5AV9 D;  4J8V A;  3AZE A;  3KFU G;  5DNN D;  4UUZ A;  3X1U B;  1P3F B;  3X1U D;  3LEL C;  5B31 G;  1P3F D;  3KXB B;  3KUY A;  3AZN C;  3KXB D;  3UTA A;  2JCH A;  3AV2 C;  2RIQ A;  1S32 C;  4J8X C;  3X1T B;  1BH8 B;  2Y2Q A;  3X1T D;  4CSR A;  5BT1 D;  3WTP E;  5AV6 D;  1N1J A;  2RVQ D;  5JA4 B;  4Z66 B;  4G92 B;  2FJ7 A;  4Z66 D;  5GT3 C;  3VH6 W;  3AZK A;  4KUD C;  5CHL B;  3W96 C;  5B0Y C;  1P34 C;  4WZS B;  3AZH A;  1P3O A;  3LJA A;  5CPJ C;  1M19 A;  4KUD D;  1EQZ C;  3W98 B;  3WKJ C;  2Y2H A;  4WU8 A;  5CPI A;  3AFA A;  3W98 D;  4WJ3 C;  3R45 A;  1M18 A;  5B2J B;  5KDM B;  5AY8 D;  5B2J D;  3MGS B;  5GT3 B;  4NFT A;  3MNN B;  5AV5 A;  3MGS D;  1JFI B;  3MNN D;  3REJ C;  1BH9 A;  5GSU B;  3AZM C;  4KUD B;  3W99 A;  1HQ3 C;  3UTA C;  3TU4 D;  5B1L C;  3NQJ A;  3X1V A;  4H9N B;  2CWE A;  3WKJ B;  2FJ7 C;  2Y2L A;  2LY8 A;  1P3P A;  3KWQ D;  4WU9 A;  5JRG B;  5B0Z C;  3W97 B;  4J8V B;  5CP6 B;  3W97 D;  5G49 A;  4J8V D;  3AZE B;  5CP6 D;  1P3G A;  3VH5 W;  3IP4 C;  3AZE D;  1P3M C;  3AN2 C;  3O62 A;  4UPK A;  4R8P A;  1KX3 C;  3KUY B;  3KUY D;  3UTA B;  3B6F C;  5BO0 A;  3X1S C;  1Q9C A;  4CSR B;  1P3L A;  3AFA C;  1N1J B;  3A1K A;  5F99 C;  2FJ7 B;  5AV8 D;  2XD1 A;  1P3I A;  1TZY C;  1F66 D;  5B0Z B;  2F8N K;  3MVD C;  5B1M A;  4NE6 A;  3REL C;  2IO5 C;  3LZ0 A;  3AZK B;  3AZK D;  2J8P A;  4ZUX C;  3C1B C;  3AZJ A;  3EPK A;  3H0R C;  3AZH B;  1P3O B;  3LJA B;  1M19 B;  3AZH D;  1P3O D;  3LJA D;  1M19 D;  2BYM A;  2NQB C;  4WU8 B;  5CPI B;  3A6N A;  3AFA B;  5B31 A;  5CPI D;  3R45 B;  5B2I C;  1M18 B;  1M18 D;  5AV6 A;  5AV5 B;  3REK C;  5AV5 D;  5AVB A;  1ULY A;  1BH9 B;  2IO5 B;  5CPK A;  3W99 B;  4NE3 A;  4YS3 A;  3W99 D;  3AZI A;  2ARO C;  3MGP A;  3MGQ C;  4X23 C;  3AZG A;  1A7W A;  3NQJ B;  4J8U D;  3X1V B;  5BNX A;  4HGA B;  3X1V D;  2JSS A;  3WA9 A;  5FUG A;  1R4V A;  3VH6 A;  1P3P B;  4WU9 B;  3VH5 T;  4WU9 D;  4KHA A;  5G49 B;  4JJN C;  1P3G B;  5AY8 A;  4AWL C;  1P3G D;  1ID3 A;  3O62 B;  4R8P B;  5AV9 C;  1B6W A;  5DNN C;  4R8P D;  5E5A A;  3X1U C;  5BO0 B;  1P3F C;  4KGC A;  3KXB C;  4XUJ D;  1P3L B;  2JE5 A;  1P3L D;  1P3K A;  4Z2M G;  3X1T C;  5BT1 C;  5AV6 C;  2RVQ C;  2NZD A;  1P3I D;  4G92 C;  4Z66 C;  1T3U A;  5B1M B;  3V9R A;  5B1M D;  3LZ0 B;  3LZ0 D;  5B32 G;  3AZJ B;  3AZJ D;  3AYW A;  2BYM B;  3C1C A;  3A6N B;  3A1I A;  3A6N D;  5B31 D;  3AZF A;  1P3B D;  5B24 A;  1W2E A;  5AV6 B;  3W98 C;  5AVB B;  5AV8 A;  3VH5 A;  5B2J C;  5AVB D;  2DF4 C;  3MGS C;  1F66 A;  3MNN C;  5CPK B;  4YS3 B;  5CPK D;  4YS3 D;  3AZI B;  5GSU C;  3MGP B;  3AZI D;  3AZG B;  3MGP D;  4ZBJ B;  3AZG D;  5BNX B;  3TU4 C;  3WA9 B;  3AV1 A;  5FUG B;  3WA9 D;  5BS7 A;  2HIO D;  1F1E A;  4J8W A;  1AOI A;  1KX5 A;  5B33 A;  4XZQ A;  2PYO D;  3KWQ C;  5AY8 B;  3LZ1 A;  1ID3 B;  5JRG C;  1ID3 D;  2Y2G A;  4J8V C;  3W97 C;  5CP6 C;  3AZE C;  3EG5 B;  5E5A B;  5E5A D;  4KGC B;  5AVC A;  4KGC D;  3KUY C;  3AL0 C;  1KX4 A;  3B0B A;  4YM6 D;  3TU4 B;  3AZL A;  1P3K B;  4J8U A;  4DRA A;  1P3K D;  1WWS A;  5BNV A;  4QLC D;  2NZD B;  5AV8 C;  2NZD D;  5B40 A;  3WTP A;  1F66 C;  3KWQ B;  2Y2M A;  2Y2K A;  3MGR A;  5GT0 A;  4UUZ B;  3REI A;  3AZK C;  3AYW B;  3AYW D;  3C1C B;  3C1C D;  3AZH C;  5GXQ A;  1P3O C;  3LJA C;  1M19 C;  3AZF B;  1P3A A;  2Y2J A;  4XUJ A;  5B24 B;  3AZF D;  5B0Y D;  2HUE B;  5CPI C;  5B24 D;  4WU8 C;  4WNN A;  1M18 C;  5AV8 B;  1U35 D;  2L5A A;  1F66 B;  5AV5 C;  3UTB D;  3EPJ A;  3W99 C;  2FFF B;  2ZY4 A;  3F6T A;  3WAA A;  4CAY A;  2Y2P A;  3B0D B;  4J8U C;  4E44 A;  5B32 A;  3X1V C;  3AV1 B;  3AZM D;  4HGA C;  3AV1 D;  4H9S A;  4J8W B;  1AOI B;  1KX5 B;  1AOI D;  4J8W D;  1KX5 D;  3B0C T;  5B33 B;  4XZQ B;  1P3B A;  5B33 D;  4XZQ D;  3UT9 A;  3LZ1 B;  1P3P C;  4WU9 C;  2F8N G;  3LZ1 D;  4LD9 D;  1P3G C;  1M1A D;  3O62 C;  3H0M C;  2BYK A;  4R8P C;  5AVC B;  4DQY B;  1KX4 B;  1WWI A;  5AVC D;  1KX4 D;  3AZL B;  4J8U B;  3AZL D;  4XUJ C;  5BNV B;  1ZLA A;  3B6G A;  1P3L C;  2G5I C;  2YFV A;  4H9Q A;  3WTP B;  5B40 B;  2HIO A;  5B40 D;  3WTP D;  1P3I C;  4Z5T D;  3REH A;  5B1M C;  3MGR B;  2PYO A;  5GT0 B;  1BH8 A;  3LZ0 C;  3MGR D;  5GT0 D;  3REI B;  3REI D;  2Y2I A;  2ZY2 A;  3AZJ C;  2CV5 A;  5GXQ B;  5GXQ D;  4EO5 C;  5DNM A;  1P3A B;  2ZY5 A;  4XUJ B;  4YM6 A;  1P3A D;  3EPH A;  3A6N C;  5B31 C;  4WNN B;  3LEL A;  4QLC A;  4G91 B;  3AZN A;  1P3I B;  5AVB C;  3AV2 A;  1BFM A;  1S32 A;  4J8X A;  5CPK C;  4YS3 C;  3WAA B;  1TAF A;  4CAY B;  3AZI C;  3WAA D;  3MGP C;  2YFW A;  3AZG C;  5B32 B;  4ZBJ C;  1JFI A;  5B32 D;  4EO5 B;  5B31 B;  1P3B B;  3WA9 C;  4X23 D;  3UT9 B;  3W96 A;  5B0Y A;  3UT9 D;  4H9O A;  1P34 A;  2PYO C;  4H9R A;  5CPJ A;  1U35 A;  5AY8 C;  5C3I B;  4H9N A;  4H9P A;  1ID3 C;  2BYK B;  3UTB A;  1EQZ A;  3WKJ A;  4Z2M H;  5E5A C;  4KGC C;  3P5J B;  1ZLA B;  3B6G B;  1ZLA D;  4DRB A;  3REJ A;  3B6G D;  1HTA A;  1P3K C;  2YFV B;  4H9Q B;  3AZM A;  4QLC C;  2HIO B;  1HQ3 A;  2NZD C;  3REH B;  5B1L A;  4KHA B;  3REH D;  2PYO B;  3FDD A;  3B0C W;  2CV5 B;  4LD9 A;  2CV5 D;  1M1A A;  2F8N A;  4NE5 A;  3AYW C;  5DNM B;  5B0Z A;  3C1C C;  5DNM D;  4YM6 B;  1P3M A;  3AZF C;  3AN2 A;  3LEL B;  4QLC B;  5B24 C;  3LEL D;  1KX3 A;  1H3O A;  2HUE C;  3AZN B;  3KSY A;  3AZN D;  3B6F A;  3AV2 B;  3X1S A;  1U35 C;  3V9R B;  1S32 B;  3AV2 D;  4J8X B;  1KU5 A;  1S32 D;  3UTB C;  4Z5T A;  4J8X D;  4WV4 B;  1TAF B;  2Y2O A;  5F99 A;  2YFW B;  2DQN C;  1TZY A;  5GT3 D;  3MVD A;  2ZY3 A;  3B0D C;  3REL A;  5GSU D;  3AV1 C;  5BS7 C;  4ZUX A;  3C1B A;  4J8W C;  5B0Y B;  1AOI C;  1KX5 C;  3W96 B;  3W96 D;  4H9O B;  1P34 B;  5B33 C;  4XZQ C;  4H9R B;  5CPJ B;  1P34 D;  1U35 B;  5CPJ D;  3LZ1 C;  2NQB A;  4H9P B;  3UTB B;  1EQZ B;  2G5H C;  4LD9 C;  1EQZ D;  1M1A C;  3WKJ D;  5B2I A;  2BG1 A;  2F2A C;  5AVC C;  5JRG D;  3REK A;  3NQU A;  1KX4 C;  3REJ B;  3AZL C;  3REJ D;  3AZM B;  1Z2C B;  1HQ3 B;  2ARO A;  5B1L B;  1HQ3 D;  3UTA D;  3MGQ A;  4X23 A;  5B1L D;  3WTP C;  5B40 C;  2Y2N A;  4Z5T C;  3VH6 T;  4LD9 B;  3MGR C;  1M1A B;  5GT0 C;  2FJ7 D;  2F8N B;  3REI C;  2F8N D;  2W8S A;  5B0Z D;  4JJN A;  5GXQ C;  1P3M B;  3AN2 B;  1P3M D;  3H0L C;  1P3A C;  3AN2 D;  5AV9 A;  1KX3 B;  1H3O B;  5DNN A;  1KX3 D;  3X1U A;  3B6F B;  3X1S B;  1P3F A;  3B6F D;  3X1S D;  3KXB A;  4Z5T B;  4G91 C;  1B67 A;  4WU8 D;  3AFA D;  5F99 B;  5F99 D;  3X1T A;  1TZY B;  3WAA C;  3MVD B;  1TZY D;  5JA4 A;  4Z66 A;  2ZM5 A;  3MVD D;  3REL B;  4E45 A;  2F8N H;  5B32 C;  3REL D;  4ZUX B;  4H9S C;  3C1B B;  4ZUX D;  3C1B D;  1P3B C;  3UT9 C;  2NQB B;  2NQB D;  5B2I B;  5C3I C;  5B2I D;  1P3P D;  3W98 A;  3REK B;  3NQU B;  3EPL A;  3REK D;  5B2J A;  5KDM A;  3MGS A;  5GT3 A;  3MNN A;  3O62 D;  1ZLA C;  3B6G C;  2ARO B;  5GSU A;  2ARO D;  4X23 B;  3MGQ B;  3MGQ D;  2HIO C;  4KUD A;  4M6B A;  1PZR A;  3TU4 A;  3REH C;  2CV5 C;  2UWX A;  4JJN B;  3KWQ A;  4JJN D;  4AWL B;  5DNM C;  5JRG A;  3W97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...