4H9OB

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9oB00
2AROA 3X1VB 5B33B 5B24A 3X1VD 1TAFA 5B33D 3LZ0B 1KX5C 1TZYA 4LD9C 3REJC 3NQJB 5B1LC 3X1TC 1P3BA 3LZ0D 3REIA 4J8VB 2PYOB 5BT1C 5C3IB 2YFWA 4EO5B 4J8VD 3AZLC 3C1CA 5B32A 5AV8A 2PYOD 1BH8B 1P3FB 3AZIB 4WV4B 1P34A 3WKJB 3AZGA 1P3FD 3AZID 1U35C 1EQZC 1R4VA 4J8UA 2AROC 1P3AB 3WKJD 1HQ3B 1P3PA 5B40A 1P3AD 1AOIA 1HQ3D 4ZBJC 1P3LB 2BYKA 5CPJC 3AZJC 4R8PB 3W96A 1P3LD 3REIC 4R8PD 2HIOB 4H9QA 1A7WA 3NQUA 4XZQA 5AV8C 4ZUXB 3C1CC 3AZNA 5GXQB 2HIOD 5E5AC 3REKB 1F1EA 5GT3A 1P34C 4ZUXD 3AZGC 5GXQD 3REKD 1P3OA 1P3MA 3C1BA 5B40C 4CAYB 1AOIC 3V9RA 4QLCB 5FUGB 2HUEC 5AVBB 4E44A 4QLCD 3X1VA 5B33A 5AVBD 4XZQC 3LZ0A 2NZDB 3AZNC 3NQJA 5GT3C 2NZDD 3AZFB 4J8VA 2PYOA 5JRGB 3AZMA 1P3MC 4H9PB 1P3KB 3MGQC 3AZFD 5JRGD 4X23B 1P3FA 3W98B 1P3KD 4J8XB 3AV2D 3WKJA 4X23D 3W98D 3AZEB 1P3AA 5AV9B 1HQ3A 3X1VC 5DNMB 3AZED 4YS3D 5AV9D 5B0YB 5AV6C 3LZ0C 3KUYB 1P3LA 5DNMD 4R8PA 3KSYA 5B0YD 3AYWB 5CP6B 5B1MB 4J8VC 2PYOC 3UT9C 3AZMC 3AYWD 5C3IC 2HIOA 5CP6D 5B1MD 4EO5C 4DRAA 5B2JB 4ZUXA 4UUZB 1P3FC 3W97B 5GXQA 3LJAB 3MGSB 3UTBC 5B2JD 2IO5B 1B6WA 3W97D 3LJAD 3MGSD 2RVQD 3AZKC 5B0ZC 1S32B 1HQ3C 1Q9CA 5AV5C 3B0DB 4CAYA 1S32D 4QLCA 4G92B 5FUGA 3KXBB 5GSUB 5AVBA 3LELB 1ZLAB 3MVDB 4Z5TB 3KXBD 2FJ7B 3O62B 5B32G 3LELD 3X1SC 1ZLAD 3MVDD 4Z5TD 4ZUXC 2FJ7D 2NZDA 3O62D 4J8WB 2CV5B 3AZFA 4XUJC 4J8WD 2LY8A 5JRGA 2CV5D 2F8NB 4H9PA 1P3KA 3WTPC 2F8ND 1P3IB 1KX3B 3W98A 4G91B 3AN2B 4QLCC 4J8XA 1P3ID 1KX3D 3UTAC 3AN2D 3AZEA 5AV9A 1F66B 2NQBC 5DNMA 5B0YA 1F66D 3KUYA 2NZDC 3LZ1B 4KHAB 2JSSA 3AFAB 3AYWA 5CP6A 5B24C 5B1MA 3LZ1D 3AFAD 3B6FB 1P3KC 1M18B 1TZYC 5B2JA 4UUZA 3B6FD 3W98C 3W97A 5AVCB 1P3BC 3LJAA 3MGSA 3AV1B 1M18D 4J8XC 1H3OB 3R45B 1WWSA 5AVCD 2CWEA 3AV1D 1S32A 1P3GB 5AV9C 5B32C 5DNNB 1ID3B 5DNMC 5KDMB 1P3GD 5B0YC 5DNND 3KUYC 1ID3D 5CPKB 1BFMA 4HGAB 3X1UB 3KXBA 3A6NB 4J8UC 3RELB 1P3PC 5GSUA 3AYWC 5GT0B 3LELA 4M6BA 5CP6C 5AY8B 5CPKD 1ZLAA 3MVDA 4WZSB 3X1UD 4Z5TA 3A6ND 3RELD 2FJ7A 1N1JB 5BS7A 2YFVB 5GT0D 3O62A 5AY8D 3VH5A 5B2JC 3W96C 1M1AB 4J8WA 3MGSC 4H9NB 1M1AD 2F8NA 5CPIB 3B0DC 1P3IA 1KX3A 5CPID 3AN2A 2L5AA 2F8NH 1HTAA 1KU5A 3KXBC 1P3OC 3C1BC 5B1LB 3X1TB 5GSUC 3AV2B 4WU9B 1ZLAC 3MVDC 1F66A 1BH8A 4Z5TC 3AZIA 2FJ7C 5B1LD 3X1TD 5BS7C 3O62C 4Z2MH 3KWQB 4WU9D 3WA9B 1BH9B 5BT1D 3LZ1A 4KHAA 4J8WC 4YS3B 3AFAA 3KWQD 3AZLD 3WA9D 5B33C 3VH6T 3B6FA 1M18A 1KX3C 4G91C 5AVCA 3AN2C 4ZBJB 5BNVB 3AV1A 1H3OA 5CPJB 3AZJB 4YM6B 3R45A 4KGCB 3VH6W 5CPJD 1P3GA 3AZJD 4YM6D 1F66C 5DNNA 1ID3A 3AZIC 3MGRB 4KGCD 3REKA 5KDMA 3REID 3REHB 3WKJC 3MGRD 5CPKA 5B2IB 5E5AB 3X1UA 3A6NA 3AFAC 3REHD 3RELA 1P3AC 5GT0A 5AY8A 5B2ID 3WAAB 5E5AD 1N1JA 3B6FC 2YFVA 1P3LC 5JA4B 1M18C 3WAAD 4R8PC 3MNNB 1M1AA 5AVCC 3MGPB 3MNND 1M19B 4H9NA 5B31B 4H9SA 2HIOC 3MGPD 5CPIA 2F8NK 1M19D 1ID3C 5B31D 5GXQC 4NE5A 3REKC 5CHLB 4HGAC 5BO0B 3X1UC 4Z66B 1ULYA 5B1LA 3X1TA 3AV2A 5AY8C 3AZND 4WU9A 4X23A 4Z66D 3MGQB 3KWQA 3WA9A 1BH9A 5AVBC 4YS3A 3MGQD 4KUDB 4H9SC 5F99B 4KUDD 4WU8B 4JJNB 5F99D 5BNVA 4WU8D 5AV6B 3AZFC 4NFTA 4JJND 5CPJA 3AZJA 5JRGC 4YM6A 4KGCA 5AV6D 3AV2C 4WU9C 5B31G 4X23C 3MGRA 3UT9B 3AZMB 3KWQC 3REHA 3WA9C 3UT9D 3AZMD 5B2IA 3B6GB 3AZEC 5E5AA 4YS3C 3UTBB 2F8NG 3WAAA 3B6GD 4WNNB 4AWLB 3AZKB 5B0ZB 3UTBD 5JA4A 4H9OB 5AV5B 3MNNA 4Z2MG 3AZKD 5B0ZD 3AZHB 3MGPA 5B1MC 5AV5D 1M19A 4YM6C 1KX4B 3AZHD 5B31A 4KGCC 3TU4B 4NE6A 1JFIB 1KX4D 3W97C 3MGRC 3LJAC 2CV5A 3TU4D 2RVQC 3REHC 3X1SB 2IO5C 5BNXB 3W99B 5B2IC 3B0CT 5BO0A 1S32C 4Z66A 3X1SD 3VH6A 4H9RB 3W99D 3WAAC 4XUJB 1KX5B 1WWIA 3MGQA 3WTPB 4G92C 4XUJD 5G49B 3MNNC 3REJB 4LD9B 1KX5D 3LELC 3WTPD 3MGPC 3B0CW 4KUDA 3REJD 1M19C 4LD9D 3UTAB 2BYMB 5B31C 4CSRB 5F99A 3AZLB 4WU8A 3UTAD 2NQBB 4JJNA 2CV5C 5AV6A 2NQBD 1U35B 1EQZB 2AROB 4Z66C 1U35D 5B24B 1P3IC 1EQZD 2AROD 3UT9A 4E45A 1TAFB 5B24D 1TZYB 1P3BB 3VH5T 3B6GA 3REIB 3UTBA 1TZYD 4KUDC 3WTPE 1P3BD 4WNNA 3AZKA 2YFWB 5B0ZA 5F99C 4J8XD 3C1CB 5AV8B 5B32B 4WU8C 4H9OA 3LZ1C 4JJNC 5AV5A 4DRBA 1P34B 3C1CD 5B32D 5AV8D 3AZGB 3AZHA 3VH5W 4J8UB 1P34D 1KX4A 3AZGD 1P3PB 3TU4A 3KUYD 5B40B 4J8UD 1JFIA 1AOIB 1P3PD 3AV1C 2BYKB 5B40D 3X1SA 2HUEB 1AOID 5BNXA 3W99A 3W96B 3B6GC 1P3GC 4H9RA 5DNNC 3W96D 4XUJA 4AWLC 4H9QB 3B0BA 3NQUB 4XZQB 1KX5A 3WTPA 5CPKC 3AZNB 5G49A 1B67A 3A6NC 3REJA 3RELC 5GT3B 4LD9A 4XZQD 4NE3A 5GT0C 3AZHC 5GT3D 3UTAA 1P3OB 2BYMA 1P3MB 3C1BB 1KX4C 4CSRA 3TU4C 3AZLA 1P3OD 1P3MD 1M1AC 3C1BD 2NQBA 3V9RB 5GSUD 1U35A 3W99C 1EQZA 5CPIC
chains in the Genus database with same CATH superfamily
2AROA 3X1VB 5B33B 5B24A 2Y2MA 3X1VD 1TAFA 5B33D 3LZ0B 1KX5C 1TZYA 4LD9C 3REJC 3NQJB 5B1LC 3X1TC 1P3BA 3LZ0D 3REIA 4J8VB 2PYOB 5BT1C 5C3IB 2YFWA 4EO5B 4J8VD 3AZLC 3C1CA 5B32A 5AV8A 2PYOD 1BH8B 1P3FB 3AZIB 4WV4B 1P34A 3WKJB 2UWXA 3AZGA 1P3FD 3AZID 1U35C 1EQZC 1R4VA 4J8UA 2AROC 1P3AB 3WKJD 1HQ3B 1P3PA 5B40A 1P3AD 1AOIA 1HQ3D 4ZBJC 1P3LB 2BYKA 5CPJC 3AZJC 4R8PB 3P5JB 3W96A 1P3LD 3REIC 4R8PD 2G5IC 2HIOB 4H9QA 1A7WA 2RIQA 3NQUA 3A1IA 4XZQA 2ZY5A 4ZUXB 5AV8C 3C1CC 3AZNA 5GXQB 2HIOD 5E5AC 3REKB 1F1EA 5GT3A 1P34C 4ZUXD 3AZGC 5GXQD 3REKD 1P3OA 1P3MA 3C1BA 5B40C 2ZY3A 4CAYB 1AOIC 3V9RA 4QLCB 5FUGB 2HUEC 5AVBB 4E44A 4QLCD 3FDDA 3X1VA 3EPLA 5B33A 5AVBD 4XZQC 3LZ0A 2NZDB 3AZNC 3NQJA 5GT3C 2NZDD 3AZFB 3F6TA 4J8VA 2PYOA 5JRGB 3AZMA 1P3MC 4H9PB 1P3KB 3MGQC 3AZFD 5JRGD 4UPKA 4X23B 1P3FA 3W98B 1P3KD 4J8XB 3AV2D 3WKJA 4X23D 3W98D 3AZEB 1P3AA 5AV9B 1HQ3A 3X1VC 3IP4C 5DNMB 3AZED 4YS3D 5AV9D 5B0YB 5AV6C 3LZ0C 3KUYB 1P3LA 5DNMD 4R8PA 3KSYA 5B0YD 3AYWB 5CP6B 5B1MB 2ZY2A 4J8VC 2PYOC 4WJ3C 3UT9C 3AZMC 3AYWD 5C3IC 2HIOA 5CP6D 5B1MD 4EO5C 4DRAA 2XD5A 5B2JB 4ZUXA 4UUZB 1P3FC 3W97B 5GXQA 3LJAB 3MGSB 3UTBC 5B2JD 2IO5B 1B6WA 3W97D 3LJAD 3MGSD 2RVQD 3AZKC 5B0ZC 1S32B 1HQ3C 1Q9CA 5AV5C 3B0DB 3KFUG 4CAYA 1S32D 4QLCA 4G92B 5FUGA 3KXBB 5GSUB 5AVBA 2Y2IA 3LELB 1ZLAB 3MVDB 4Z5TB 3KXBD 2FJ7B 3O62B 5B32G 3LELD 3X1SC 1ZLAD 3MVDD 4Z5TD 4ZUXC 2FJ7D 2NZDA 3O62D 4J8WB 2CV5B 1W2EA 3AZFA 4XUJC 4J8WD 2LY8A 5JRGA 2CV5D 2F8NB 4DQYB 4H9PA 1P3KA 3WTPC 2JE5A 2F8ND 1P3IB 1KX3B 3W98A 4G91B 3AN2B 4QLCC 4J8XA 1P3ID 1KX3D 3UTAC 3AN2D 3AZEA 5AV9A 1F66B 2ZY4A 2NQBC 5DNMA 5B0YA 1F66D 3KUYA 2NZDC 3LZ1B 4KHAB 2JSSA 3AFAB 3AYWA 5CP6A 5B24C 5B1MA 3LZ1D 3AFAD 3B6FB 1P3KC 1M18B 1TZYC 5B2JA 4UUZA 3B6FD 3W98C 3W97A 5AVCB 1P3BC 3LJAA 3MGSA 3AV1B 1M18D 4J8XC 1H3OB 3R45B 1WWSA 5AVCD 2CWEA 3AV1D 1S32A 1P3GB 5AV9C 2W8SA 5B32C 5DNNB 1ID3B 5DNMC 5KDMB 2FFFB 1P3GD 5B0YC 5DNND 3H0MC 3KUYC 5CPKB 1ID3D 1BFMA 4HGAB 3X1UB 3KXBA 3A6NB 4J8UC 3RELB 1P3PC 5GSUA 2Y2JA 5GT0B 3AYWC 3LELA 4M6BA 5CP6C 5AY8B 5CPKD 1ZLAA 3MVDA 4WZSB 3X1UD 4Z5TA 3A6ND 3RELD 2FJ7A 1N1JB 5BS7A 2YFVB 5GT0D 3O62A 5AY8D 3VH5A 5B2JC 3W96C 1M1AB 4J8WA 3MGSC 3A1KA 2J8PA 4H9NB 1M1AD 2F8NA 5CPIB 3B0DC 1P3IA 1KX3A 5CPID 3AN2A 2F2AC 2L5AA 2F8NH 1HTAA 1KU5A 3KXBC 1P3OC 3C1BC 5B1LB 3X1TB 5GSUC 3AV2B 4WU9B 1ZLAC 3MVDC 1F66A 1BH8A 4Z5TC 3AZIA 2FJ7C 5B1LD 3X1TD 5BS7C 3O62C 4Z2MH 3KWQB 4WU9D 3WA9B 1BH9B 5BT1D 3LZ1A 4KHAA 3AL0C 4J8WC 4YS3B 3AFAA 3KWQD 3AZLD 3WA9D 5B33C 3VH6T 3EPHA 2VQRA 3B6FA 1M18A 1KX3C 2Y2GA 4G91C 5AVCA 3AN2C 4ZBJB 5BNVB 2Y2PA 3AV1A 1H3OA 5CPJB 3AZJB 4YM6B 3R45A 4KGCB 3VH6W 5CPJD 1P3GA 3AZJD 4YM6D 1F66C 5DNNA 1ID3A 3AZIC 3MGRB 4KGCD 3REKA 5KDMA 3REID 3REHB 3WKJC 3MGRD 5CPKA 5B2IB 5E5AB 3X1UA 3A6NA 3AFAC 3REHD 3RELA 1P3AC 3EPJA 5GT0A 5AY8A 5B2ID 3WAAB 5E5AD 1N1JA 3B6FC 2YFVA 1P3LC 5JA4B 1M18C 3WAAD 4R8PC 3MNNB 1M1AA 5AVCC 3MGPB 3MNND 1M19B 4H9NA 5B31B 4H9SA 2HIOC 3MGPD 5CPIA 2F8NK 1M19D 2Y2KA 1ID3C 5B31D 5GXQC 4NE5A 3REKC 2Y2NA 5CHLB 4HGAC 5BO0B 3X1UC 4Z66B 1ULYA 5B1LA 1T3UA 3X1TA 1Z2CB 3AV2A 5AY8C 3AZND 4WU9A 4X23A 4Z66D 3MGQB 3KWQA 3WA9A 1BH9A 5AVBC 4YS3A 3MGQD 4KUDB 2BG1A 4H9SC 5F99B 4KUDD 4WU8B 4JJNB 5F99D 5BNVA 4WU8D 5AV6B 3AZFC 4NFTA 4JJND 5CPJA 3AZJA 5JRGC 4YM6A 4KGCA 5AV6D 2Y2HA 2DF4C 3AV2C 4WU9C 5B31G 4X23C 3MGRA 3UT9B 3AZMB 2XD1A 3KWQC 3REHA 3EPKA 3WA9C 3UT9D 3AZMD 5B2IA 3B6GB 3AZEC 2G5HC 5E5AA 4YS3C 3UTBB 2F8NG 3WAAA 3B6GD 4WNNB 4AWLB 3AZKB 5B0ZB 3UTBD 5JA4A 4H9OB 5AV5B 3MNNA 4Z2MG 3AZKD 5B0ZD 3AZHB 3MGPA 3H0LC 5B1MC 5AV5D 1M19A 4YM6C 1KX4B 3AZHD 5B31A 4KGCC 3TU4B 4NE6A 1JFIB 1KX4D 3W97C 3MGRC 3LJAC 2CV5A 3TU4D 2RVQC 3REHC 3X1SB 2IO5C 5BNXB 3W99B 5B2IC 3B0CT 5BO0A 1S32C 4Z66A 3X1SD 3VH6A 4H9RB 3W99D 3WAAC 4XUJB 1KX5B 1WWIA 3MGQA 3WTPB 4G92C 4XUJD 5G49B 3MNNC 3REJB 4LD9B 1KX5D 3LELC 3WTPD 3MGPC 3B0CW 4KUDA 3REJD 1M19C 4LD9D 3UTAB 2BYMB 5B31C 4CSRB 5F99A 3AZLB 4WU8A 3UTAD 2NQBB 4JJNA 2JCHA 2CV5C 5AV6A 2NQBD 1U35B 1EQZB 2AROB 4Z66C 2Y2OA 1U35D 5B24B 1P3IC 1EQZD 2AROD 3UT9A 4E45A 1TAFB 5B24D 2ZM5A 1TZYB 1P3BB 3VH5T 2DQNC 3B6GA 3REIB 3UTBA 1TZYD 4KUDC 3WTPE 3H0RC 1P3BD 4WNNA 3AZKA 2YFWB 5B0ZA 5F99C 4J8XD 3C1CB 5AV8B 5B32B 4WU8C 4H9OA 3LZ1C 4JJNC 5AV5A 4DRBA 1P34B 3C1CD 5B32D 5AV8D 3AZGB 3AZHA 3VH5W 4J8UB 1P34D 1KX4A 3AZGD 1P3PB 3TU4A 3KUYD 5B40B 4J8UD 1JFIA 1AOIB 1P3PD 3AV1C 2BYKB 5B40D 3X1SA 2HUEB 1AOID 5BNXA 3W99A 3W96B 3B6GC 1P3GC 4H9RA 5DNNC 3W96D 4XUJA 4AWLC 4H9QB 3B0BA 3NQUB 4XZQB 1KX5A 3WTPA 5CPKC 3AZNB 5G49A 1B67A 3A6NC 3REJA 3RELC 5GT3B 4LD9A 1PZRA 4XZQD 4NE3A 5GT0C 3AZHC 3EG5B 5GT3D 3UTAA 1P3OB 2BYMA 1P3MB 3C1BB 1KX4C 4CSRA 3TU4C 3AZLA 2Y2LA 1P3OD 1P3MD 1M1AC 3C1BD 2NQBA 3V9RB 5GSUD 2Y2QA 1U35A 3W99C 1EQZA 5CPIC
chains in the Genus database with same CATH topology
2AROA 3X1VB 5B33B 5B24A 2Y2MA 3X1VD 1TAFA 5B33D 3LZ0B 1KX5C 1TZYA 4LD9C 3REJC 3NQJB 5B1LC 3X1TC 1P3BA 3LZ0D 3REIA 4J8VB 2PYOB 5BT1C 5C3IB 2YFWA 4EO5B 4J8VD 3AZLC 3C1CA 5B32A 5AV8A 2PYOD 1BH8B 1P3FB 3AZIB 4WV4B 1P34A 3WKJB 2UWXA 3AZGA 1P3FD 3AZID 1U35C 1EQZC 1R4VA 4J8UA 2AROC 1P3AB 3WKJD 1HQ3B 1P3PA 5B40A 1P3AD 1AOIA 1HQ3D 4ZBJC 1P3LB 2BYKA 5CPJC 3AZJC 4R8PB 3P5JB 3W96A 1P3LD 3REIC 4R8PD 2G5IC 2HIOB 4H9QA 1A7WA 2RIQA 3NQUA 3A1IA 4XZQA 2ZY5A 4ZUXB 5AV8C 3C1CC 3AZNA 5GXQB 2HIOD 5E5AC 3REKB 1F1EA 5GT3A 1P34C 4ZUXD 3AZGC 5GXQD 3REKD 1P3OA 1P3MA 3C1BA 5B40C 2ZY3A 4CAYB 1AOIC 3V9RA 4QLCB 5FUGB 2HUEC 5AVBB 4E44A 4QLCD 3FDDA 3X1VA 3EPLA 5B33A 5AVBD 4XZQC 3LZ0A 2NZDB 3AZNC 3NQJA 5GT3C 2NZDD 3AZFB 3F6TA 4J8VA 2PYOA 5JRGB 3AZMA 1P3MC 4H9PB 1P3KB 3MGQC 3AZFD 5JRGD 4UPKA 4X23B 1P3FA 3W98B 1P3KD 4J8XB 3AV2D 3WKJA 4X23D 3W98D 3AZEB 1P3AA 5AV9B 1HQ3A 3X1VC 3IP4C 5DNMB 3AZED 4YS3D 5AV9D 5B0YB 5AV6C 3LZ0C 3KUYB 1P3LA 5DNMD 4R8PA 3KSYA 5B0YD 3AYWB 5CP6B 5B1MB 2ZY2A 4J8VC 2PYOC 4WJ3C 3UT9C 3AZMC 3AYWD 5C3IC 2HIOA 5CP6D 5B1MD 4EO5C 4DRAA 2XD5A 5B2JB 4ZUXA 4UUZB 1P3FC 3W97B 5GXQA 3LJAB 3MGSB 3UTBC 5B2JD 2IO5B 1B6WA 3W97D 3LJAD 3MGSD 2RVQD 3AZKC 5B0ZC 1S32B 1HQ3C 1Q9CA 5AV5C 3B0DB 3KFUG 4CAYA 1S32D 4QLCA 4G92B 5FUGA 3KXBB 5GSUB 5AVBA 2Y2IA 3LELB 1ZLAB 3MVDB 4Z5TB 3KXBD 2FJ7B 3O62B 5B32G 3LELD 3X1SC 1ZLAD 3MVDD 4Z5TD 4ZUXC 2FJ7D 2NZDA 3O62D 4J8WB 2CV5B 1W2EA 3AZFA 4XUJC 4J8WD 2LY8A 5JRGA 2CV5D 2F8NB 4DQYB 4H9PA 1P3KA 3WTPC 2JE5A 2F8ND 1P3IB 1KX3B 3W98A 4G91B 3AN2B 4QLCC 4J8XA 1P3ID 1KX3D 3UTAC 3AN2D 3AZEA 5AV9A 1F66B 2ZY4A 2NQBC 5DNMA 5B0YA 1F66D 3KUYA 2NZDC 3LZ1B 4KHAB 2JSSA 3AFAB 3AYWA 5CP6A 5B24C 5B1MA 3LZ1D 3AFAD 3B6FB 1P3KC 1M18B 1TZYC 5B2JA 4UUZA 3B6FD 3W98C 3W97A 5AVCB 1P3BC 3LJAA 3MGSA 3AV1B 1M18D 4J8XC 1H3OB 3R45B 1WWSA 5AVCD 2CWEA 3AV1D 1S32A 1P3GB 5AV9C 2W8SA 5B32C 5DNNB 1ID3B 5DNMC 5KDMB 2FFFB 1P3GD 5B0YC 5DNND 3H0MC 3KUYC 5CPKB 1ID3D 1BFMA 4HGAB 3X1UB 3KXBA 3A6NB 4J8UC 3RELB 1P3PC 5GSUA 2Y2JA 5GT0B 3AYWC 3LELA 4M6BA 5CP6C 5AY8B 5CPKD 1ZLAA 3MVDA 4WZSB 3X1UD 4Z5TA 3A6ND 3RELD 2FJ7A 1N1JB 5BS7A 2YFVB 5GT0D 3O62A 5AY8D 3VH5A 5B2JC 3W96C 1M1AB 4J8WA 3MGSC 3A1KA 2J8PA 4H9NB 1M1AD 2F8NA 5CPIB 3B0DC 1P3IA 1KX3A 5CPID 3AN2A 2F2AC 2L5AA 2F8NH 1HTAA 1KU5A 3KXBC 1P3OC 3C1BC 5B1LB 3X1TB 5GSUC 3AV2B 4WU9B 1ZLAC 3MVDC 1F66A 1BH8A 4Z5TC 3AZIA 2FJ7C 5B1LD 3X1TD 5BS7C 3O62C 4Z2MH 3KWQB 4WU9D 3WA9B 1BH9B 5BT1D 3LZ1A 4KHAA 3AL0C 4J8WC 4YS3B 3AFAA 3KWQD 3AZLD 3WA9D 5B33C 3VH6T 3EPHA 2VQRA 3B6FA 1M18A 1KX3C 2Y2GA 4G91C 5AVCA 3AN2C 4ZBJB 5BNVB 2Y2PA 3AV1A 1H3OA 5CPJB 3AZJB 4YM6B 3R45A 4KGCB 3VH6W 5CPJD 1P3GA 3AZJD 4YM6D 1F66C 5DNNA 1ID3A 3AZIC 3MGRB 4KGCD 3REKA 5KDMA 3REID 3REHB 3WKJC 3MGRD 5CPKA 5B2IB 5E5AB 3X1UA 3A6NA 3AFAC 3REHD 3RELA 1P3AC 3EPJA 5GT0A 5AY8A 5B2ID 3WAAB 5E5AD 1N1JA 3B6FC 2YFVA 1P3LC 5JA4B 1M18C 3WAAD 4R8PC 3MNNB 1M1AA 5AVCC 3MGPB 3MNND 1M19B 4H9NA 5B31B 4H9SA 2HIOC 3MGPD 5CPIA 2F8NK 1M19D 2Y2KA 1ID3C 5B31D 5GXQC 4NE5A 3REKC 2Y2NA 5CHLB 4HGAC 5BO0B 3X1UC 4Z66B 1ULYA 5B1LA 1T3UA 3X1TA 1Z2CB 3AV2A 5AY8C 3AZND 4WU9A 4X23A 4Z66D 3MGQB 3KWQA 3WA9A 1BH9A 5AVBC 4YS3A 3MGQD 4KUDB 2BG1A 4H9SC 5F99B 4KUDD 4WU8B 4JJNB 5F99D 5BNVA 4WU8D 5AV6B 3AZFC 4NFTA 4JJND 5CPJA 3AZJA 5JRGC 4YM6A 4KGCA 5AV6D 2Y2HA 2DF4C 3AV2C 4WU9C 5B31G 4X23C 3MGRA 3UT9B 3AZMB 2XD1A 3KWQC 3REHA 3EPKA 3WA9C 3UT9D 3AZMD 5B2IA 3B6GB 3AZEC 2G5HC 5E5AA 4YS3C 3UTBB 2F8NG 3WAAA 3B6GD 4WNNB 4AWLB 3AZKB 5B0ZB 3UTBD 5JA4A 4H9OB 5AV5B 3MNNA 4Z2MG 3AZKD 5B0ZD 3AZHB 3MGPA 3H0LC 5B1MC 5AV5D 1M19A 4YM6C 1KX4B 3AZHD 5B31A 4KGCC 3TU4B 4NE6A 1JFIB 1KX4D 3W97C 3MGRC 3LJAC 2CV5A 3TU4D 2RVQC 3REHC 3X1SB 2IO5C 5BNXB 3W99B 5B2IC 3B0CT 5BO0A 1S32C 4Z66A 3X1SD 3VH6A 4H9RB 3W99D 3WAAC 4XUJB 1KX5B 1WWIA 3MGQA 3WTPB 4G92C 4XUJD 5G49B 3MNNC 3REJB 4LD9B 1KX5D 3LELC 3WTPD 3MGPC 3B0CW 4KUDA 3REJD 1M19C 4LD9D 3UTAB 2BYMB 5B31C 4CSRB 5F99A 3AZLB 4WU8A 3UTAD 2NQBB 4JJNA 2JCHA 2CV5C 5AV6A 2NQBD 1U35B 1EQZB 2AROB 4Z66C 2Y2OA 1U35D 5B24B 1P3IC 1EQZD 2AROD 3UT9A 4E45A 1TAFB 5B24D 2ZM5A 1TZYB 1P3BB 3VH5T 2DQNC 3B6GA 3REIB 3UTBA 1TZYD 4KUDC 3WTPE 3H0RC 1P3BD 4WNNA 3AZKA 2YFWB 5B0ZA 5F99C 4J8XD 3C1CB 5AV8B 5B32B 4WU8C 4H9OA 3LZ1C 4JJNC 5AV5A 4DRBA 1P34B 3C1CD 5B32D 5AV8D 3AZGB 3AZHA 3VH5W 4J8UB 1P34D 1KX4A 3AZGD 1P3PB 3TU4A 3KUYD 5B40B 4J8UD 1JFIA 1AOIB 1P3PD 3AV1C 2BYKB 5B40D 3X1SA 2HUEB 1AOID 5BNXA 3W99A 3W96B 3B6GC 1P3GC 4H9RA 5DNNC 3W96D 4XUJA 4AWLC 4H9QB 3B0BA 3NQUB 4XZQB 1KX5A 3WTPA 5CPKC 3AZNB 5G49A 1B67A 3A6NC 3REJA 3RELC 5GT3B 4LD9A 1PZRA 4XZQD 4NE3A 5GT0C 3AZHC 3EG5B 5GT3D 3UTAA 1P3OB 2BYMA 1P3MB 3C1BB 1KX4C 4CSRA 3TU4C 3AZLA 2Y2LA 1P3OD 1P3MD 1M1AC 3C1BD 2NQBA 3V9RB 5GSUD 2Y2QA 1U35A 3W99C 1EQZA 5CPIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO A;  3X1V B;  5B33 B;  5B24 A;  3X1V D;  1TAF A;  5B33 D;  3LZ0 B;  1KX5 C;  1TZY A;  4LD9 C;  3REJ C;  3NQJ B;  5B1L C;  3X1T C;  1P3B A;  3LZ0 D;  3REI A;  4J8V B;  2PYO B;  5BT1 C;  5C3I B;  2YFW A;  4EO5 B;  4J8V D;  3AZL C;  3C1C A;  5B32 A;  5AV8 A;  2PYO D;  1BH8 B;  1P3F B;  3AZI B;  4WV4 B;  1P34 A;  3WKJ B;  3AZG A;  1P3F D;  3AZI D;  1U35 C;  1EQZ C;  1R4V A;  4J8U A;  2ARO C;  1P3A B;  3WKJ D;  1HQ3 B;  1P3P A;  5B40 A;  1P3A D;  1AOI A;  1HQ3 D;  4ZBJ C;  1P3L B;  2BYK A;  5CPJ C;  3AZJ C;  4R8P B;  3W96 A;  1P3L D;  3REI C;  4R8P D;  2HIO B;  4H9Q A;  1A7W A;  3NQU A;  4XZQ A;  5AV8 C;  4ZUX B;  3C1C C;  3AZN A;  5GXQ B;  2HIO D;  5E5A C;  3REK B;  1F1E A;  5GT3 A;  1P34 C;  4ZUX D;  3AZG C;  5GXQ D;  3REK D;  1P3O A;  1P3M A;  3C1B A;  5B40 C;  4CAY B;  1AOI C;  3V9R A;  4QLC B;  5FUG B;  2HUE C;  5AVB B;  4E44 A;  4QLC D;  3X1V A;  5B33 A;  5AVB D;  4XZQ C;  3LZ0 A;  2NZD B;  3AZN C;  3NQJ A;  5GT3 C;  2NZD D;  3AZF B;  4J8V A;  2PYO A;  5JRG B;  3AZM A;  1P3M C;  4H9P B;  1P3K B;  3MGQ C;  3AZF D;  5JRG D;  4X23 B;  1P3F A;  3W98 B;  1P3K D;  4J8X B;  3AV2 D;  3WKJ A;  4X23 D;  3W98 D;  3AZE B;  1P3A A;  5AV9 B;  1HQ3 A;  3X1V C;  5DNM B;  3AZE D;  4YS3 D;  5AV9 D;  5B0Y B;  5AV6 C;  3LZ0 C;  3KUY B;  1P3L A;  5DNM D;  4R8P A;  3KSY A;  5B0Y D;  3AYW B;  5CP6 B;  5B1M B;  4J8V C;  2PYO C;  3UT9 C;  3AZM C;  3AYW D;  5C3I C;  2HIO A;  5CP6 D;  5B1M D;  4EO5 C;  4DRA A;  5B2J B;  4ZUX A;  4UUZ B;  1P3F C;  3W97 B;  5GXQ A;  3LJA B;  3MGS B;  3UTB C;  5B2J D;  2IO5 B;  1B6W A;  3W97 D;  3LJA D;  3MGS D;  2RVQ D;  3AZK C;  5B0Z C;  1S32 B;  1HQ3 C;  1Q9C A;  5AV5 C;  3B0D B;  4CAY A;  1S32 D;  4QLC A;  4G92 B;  5FUG A;  3KXB B;  5GSU B;  5AVB A;  3LEL B;  1ZLA B;  3MVD B;  4Z5T B;  3KXB D;  2FJ7 B;  3O62 B;  5B32 G;  3LEL D;  3X1S C;  1ZLA D;  3MVD D;  4Z5T D;  4ZUX C;  2FJ7 D;  2NZD A;  3O62 D;  4J8W B;  2CV5 B;  3AZF A;  4XUJ C;  4J8W D;  2LY8 A;  5JRG A;  2CV5 D;  2F8N B;  4H9P A;  1P3K A;  3WTP C;  2F8N D;  1P3I B;  1KX3 B;  3W98 A;  4G91 B;  3AN2 B;  4QLC C;  4J8X A;  1P3I D;  1KX3 D;  3UTA C;  3AN2 D;  3AZE A;  5AV9 A;  1F66 B;  2NQB C;  5DNM A;  5B0Y A;  1F66 D;  3KUY A;  2NZD C;  3LZ1 B;  4KHA B;  2JSS A;  3AFA B;  3AYW A;  5CP6 A;  5B24 C;  5B1M A;  3LZ1 D;  3AFA D;  3B6F B;  1P3K C;  1M18 B;  1TZY C;  5B2J A;  4UUZ A;  3B6F D;  3W98 C;  3W97 A;  5AVC B;  1P3B C;  3LJA A;  3MGS A;  3AV1 B;  1M18 D;  4J8X C;  1H3O B;  3R45 B;  1WWS A;  5AVC D;  2CWE A;  3AV1 D;  1S32 A;  1P3G B;  5AV9 C;  5B32 C;  5DNN B;  1ID3 B;  5DNM C;  5KDM B;  1P3G D;  5B0Y C;  5DNN D;  3KUY C;  1ID3 D;  5CPK B;  1BFM A;  4HGA B;  3X1U B;  3KXB A;  3A6N B;  4J8U C;  3REL B;  1P3P C;  5GSU A;  3AYW C;  5GT0 B;  3LEL A;  4M6B A;  5CP6 C;  5AY8 B;  5CPK D;  1ZLA A;  3MVD A;  4WZS B;  3X1U D;  4Z5T A;  3A6N D;  3REL D;  2FJ7 A;  1N1J B;  5BS7 A;  2YFV B;  5GT0 D;  3O62 A;  5AY8 D;  3VH5 A;  5B2J C;  3W96 C;  1M1A B;  4J8W A;  3MGS C;  4H9N B;  1M1A D;  2F8N A;  5CPI B;  3B0D C;  1P3I A;  1KX3 A;  5CPI D;  3AN2 A;  2L5A A;  2F8N H;  1HTA A;  1KU5 A;  3KXB C;  1P3O C;  3C1B C;  5B1L B;  3X1T B;  5GSU C;  3AV2 B;  4WU9 B;  1ZLA C;  3MVD C;  1F66 A;  1BH8 A;  4Z5T C;  3AZI A;  2FJ7 C;  5B1L D;  3X1T D;  5BS7 C;  3O62 C;  4Z2M H;  3KWQ B;  4WU9 D;  3WA9 B;  1BH9 B;  5BT1 D;  3LZ1 A;  4KHA A;  4J8W C;  4YS3 B;  3AFA A;  3KWQ D;  3AZL D;  3WA9 D;  5B33 C;  3VH6 T;  3B6F A;  1M18 A;  1KX3 C;  4G91 C;  5AVC A;  3AN2 C;  4ZBJ B;  5BNV B;  3AV1 A;  1H3O A;  5CPJ B;  3AZJ B;  4YM6 B;  3R45 A;  4KGC B;  3VH6 W;  5CPJ D;  1P3G A;  3AZJ D;  4YM6 D;  1F66 C;  5DNN A;  1ID3 A;  3AZI C;  3MGR B;  4KGC D;  3REK A;  5KDM A;  3REI D;  3REH B;  3WKJ C;  3MGR D;  5CPK A;  5B2I B;  5E5A B;  3X1U A;  3A6N A;  3AFA C;  3REH D;  3REL A;  1P3A C;  5GT0 A;  5AY8 A;  5B2I D;  3WAA B;  5E5A D;  1N1J A;  3B6F C;  2YFV A;  1P3L C;  5JA4 B;  1M18 C;  3WAA D;  4R8P C;  3MNN B;  1M1A A;  5AVC C;  3MGP B;  3MNN D;  1M19 B;  4H9N A;  5B31 B;  4H9S A;  2HIO C;  3MGP D;  5CPI A;  2F8N K;  1M19 D;  1ID3 C;  5B31 D;  5GXQ C;  4NE5 A;  3REK C;  5CHL B;  4HGA C;  5BO0 B;  3X1U C;  4Z66 B;  1ULY A;  5B1L A;  3X1T A;  3AV2 A;  5AY8 C;  3AZN D;  4WU9 A;  4X23 A;  4Z66 D;  3MGQ B;  3KWQ A;  3WA9 A;  1BH9 A;  5AVB C;  4YS3 A;  3MGQ D;  4KUD B;  4H9S C;  5F99 B;  4KUD D;  4WU8 B;  4JJN B;  5F99 D;  5BNV A;  4WU8 D;  5AV6 B;  3AZF C;  4NFT A;  4JJN D;  5CPJ A;  3AZJ A;  5JRG C;  4YM6 A;  4KGC A;  5AV6 D;  3AV2 C;  4WU9 C;  5B31 G;  4X23 C;  3MGR A;  3UT9 B;  3AZM B;  3KWQ C;  3REH A;  3WA9 C;  3UT9 D;  3AZM D;  5B2I A;  3B6G B;  3AZE C;  5E5A A;  4YS3 C;  3UTB B;  2F8N G;  3WAA A;  3B6G D;  4WNN B;  4AWL B;  3AZK B;  5B0Z B;  3UTB D;  5JA4 A;  4H9O B;  5AV5 B;  3MNN A;  4Z2M G;  3AZK D;  5B0Z D;  3AZH B;  3MGP A;  5B1M C;  5AV5 D;  1M19 A;  4YM6 C;  1KX4 B;  3AZH D;  5B31 A;  4KGC C;  3TU4 B;  4NE6 A;  1JFI B;  1KX4 D;  3W97 C;  3MGR C;  3LJA C;  2CV5 A;  3TU4 D;  2RVQ C;  3REH C;  3X1S B;  2IO5 C;  5BNX B;  3W99 B;  5B2I C;  3B0C T;  5BO0 A;  1S32 C;  4Z66 A;  3X1S D;  3VH6 A;  4H9R B;  3W99 D;  3WAA C;  4XUJ B;  1KX5 B;  1WWI A;  3MGQ A;  3WTP B;  4G92 C;  4XUJ D;  5G49 B;  3MNN C;  3REJ B;  4LD9 B;  1KX5 D;  3LEL C;  3WTP D;  3MGP C;  3B0C W;  4KUD A;  3REJ D;  1M19 C;  4LD9 D;  3UTA B;  2BYM B;  5B31 C;  4CSR B;  5F99 A;  3AZL B;  4WU8 A;  3UTA D;  2NQB B;  4JJN A;  2CV5 C;  5AV6 A;  2NQB D;  1U35 B;  1EQZ B;  2ARO B;  4Z66 C;  1U35 D;  5B24 B;  1P3I C;  1EQZ D;  2ARO D;  3UT9 A;  4E45 A;  1TAF B;  5B24 D;  1TZY B;  1P3B B;  3VH5 T;  3B6G A;  3REI B;  3UTB A;  1TZY D;  4KUD C;  3WTP E;  1P3B D;  4WNN A;  3AZK A;  2YFW B;  5B0Z A;  5F99 C;  4J8X D;  3C1C B;  5AV8 B;  5B32 B;  4WU8 C;  4H9O A;  3LZ1 C;  4JJN C;  5AV5 A;  4DRB A;  1P34 B;  3C1C D;  5B32 D;  5AV8 D;  3AZG B;  3AZH A;  3VH5 W;  4J8U B;  1P34 D;  1KX4 A;  3AZG D;  1P3P B;  3TU4 A;  3KUY D;  5B40 B;  4J8U D;  1JFI A;  1AOI B;  1P3P D;  3AV1 C;  2BYK B;  5B40 D;  3X1S A;  2HUE B;  1AOI D;  5BNX A;  3W99 A;  3W96 B;  3B6G C;  1P3G C;  4H9R A;  5DNN C;  3W96 D;  4XUJ A;  4AWL C;  4H9Q B;  3B0B A;  3NQU B;  4XZQ B;  1KX5 A;  3WTP A;  5CPK C;  3AZN B;  5G49 A;  1B67 A;  3A6N C;  3REJ A;  3REL C;  5GT3 B;  4LD9 A;  4XZQ D;  4NE3 A;  5GT0 C;  3AZH C;  5GT3 D;  3UTA A;  1P3O B;  2BYM A;  1P3M B;  3C1B B;  1KX4 C;  4CSR A;  3TU4 C;  3AZL A;  1P3O D;  1P3M D;  1M1A C;  3C1B D;  2NQB A;  3V9R B;  5GSU D;  1U35 A;  3W99 C;  1EQZ A;  5CPI C; 
#chains in the Genus database with same CATH topology
 2ARO A;  3X1V B;  5B33 B;  5B24 A;  2Y2M A;  3X1V D;  1TAF A;  5B33 D;  3LZ0 B;  1KX5 C;  1TZY A;  4LD9 C;  3REJ C;  3NQJ B;  5B1L C;  3X1T C;  1P3B A;  3LZ0 D;  3REI A;  4J8V B;  2PYO B;  5BT1 C;  5C3I B;  2YFW A;  4EO5 B;  4J8V D;  3AZL C;  3C1C A;  5B32 A;  5AV8 A;  2PYO D;  1BH8 B;  1P3F B;  3AZI B;  4WV4 B;  1P34 A;  3WKJ B;  2UWX A;  3AZG A;  1P3F D;  3AZI D;  1U35 C;  1EQZ C;  1R4V A;  4J8U A;  2ARO C;  1P3A B;  3WKJ D;  1HQ3 B;  1P3P A;  5B40 A;  1P3A D;  1AOI A;  1HQ3 D;  4ZBJ C;  1P3L B;  2BYK A;  5CPJ C;  3AZJ C;  4R8P B;  3P5J B;  3W96 A;  1P3L D;  3REI C;  4R8P D;  2G5I C;  2HIO B;  4H9Q A;  1A7W A;  2RIQ A;  3NQU A;  3A1I A;  4XZQ A;  2ZY5 A;  4ZUX B;  5AV8 C;  3C1C C;  3AZN A;  5GXQ B;  2HIO D;  5E5A C;  3REK B;  1F1E A;  5GT3 A;  1P34 C;  4ZUX D;  3AZG C;  5GXQ D;  3REK D;  1P3O A;  1P3M A;  3C1B A;  5B40 C;  2ZY3 A;  4CAY B;  1AOI C;  3V9R A;  4QLC B;  5FUG B;  2HUE C;  5AVB B;  4E44 A;  4QLC D;  3FDD A;  3X1V A;  3EPL A;  5B33 A;  5AVB D;  4XZQ C;  3LZ0 A;  2NZD B;  3AZN C;  3NQJ A;  5GT3 C;  2NZD D;  3AZF B;  3F6T A;  4J8V A;  2PYO A;  5JRG B;  3AZM A;  1P3M C;  4H9P B;  1P3K B;  3MGQ C;  3AZF D;  5JRG D;  4UPK A;  4X23 B;  1P3F A;  3W98 B;  1P3K D;  4J8X B;  3AV2 D;  3WKJ A;  4X23 D;  3W98 D;  3AZE B;  1P3A A;  5AV9 B;  1HQ3 A;  3X1V C;  3IP4 C;  5DNM B;  3AZE D;  4YS3 D;  5AV9 D;  5B0Y B;  5AV6 C;  3LZ0 C;  3KUY B;  1P3L A;  5DNM D;  4R8P A;  3KSY A;  5B0Y D;  3AYW B;  5CP6 B;  5B1M B;  2ZY2 A;  4J8V C;  2PYO C;  4WJ3 C;  3UT9 C;  3AZM C;  3AYW D;  5C3I C;  2HIO A;  5CP6 D;  5B1M D;  4EO5 C;  4DRA A;  2XD5 A;  5B2J B;  4ZUX A;  4UUZ B;  1P3F C;  3W97 B;  5GXQ A;  3LJA B;  3MGS B;  3UTB C;  5B2J D;  2IO5 B;  1B6W A;  3W97 D;  3LJA D;  3MGS D;  2RVQ D;  3AZK C;  5B0Z C;  1S32 B;  1HQ3 C;  1Q9C A;  5AV5 C;  3B0D B;  3KFU G;  4CAY A;  1S32 D;  4QLC A;  4G92 B;  5FUG A;  3KXB B;  5GSU B;  5AVB A;  2Y2I A;  3LEL B;  1ZLA B;  3MVD B;  4Z5T B;  3KXB D;  2FJ7 B;  3O62 B;  5B32 G;  3LEL D;  3X1S C;  1ZLA D;  3MVD D;  4Z5T D;  4ZUX C;  2FJ7 D;  2NZD A;  3O62 D;  4J8W B;  2CV5 B;  1W2E A;  3AZF A;  4XUJ C;  4J8W D;  2LY8 A;  5JRG A;  2CV5 D;  2F8N B;  4DQY B;  4H9P A;  1P3K A;  3WTP C;  2JE5 A;  2F8N D;  1P3I B;  1KX3 B;  3W98 A;  4G91 B;  3AN2 B;  4QLC C;  4J8X A;  1P3I D;  1KX3 D;  3UTA C;  3AN2 D;  3AZE A;  5AV9 A;  1F66 B;  2ZY4 A;  2NQB C;  5DNM A;  5B0Y A;  1F66 D;  3KUY A;  2NZD C;  3LZ1 B;  4KHA B;  2JSS A;  3AFA B;  3AYW A;  5CP6 A;  5B24 C;  5B1M A;  3LZ1 D;  3AFA D;  3B6F B;  1P3K C;  1M18 B;  1TZY C;  5B2J A;  4UUZ A;  3B6F D;  3W98 C;  3W97 A;  5AVC B;  1P3B C;  3LJA A;  3MGS A;  3AV1 B;  1M18 D;  4J8X C;  1H3O B;  3R45 B;  1WWS A;  5AVC D;  2CWE A;  3AV1 D;  1S32 A;  1P3G B;  5AV9 C;  2W8S A;  5B32 C;  5DNN B;  1ID3 B;  5DNM C;  5KDM B;  2FFF B;  1P3G D;  5B0Y C;  5DNN D;  3H0M C;  3KUY C;  5CPK B;  1ID3 D;  1BFM A;  4HGA B;  3X1U B;  3KXB A;  3A6N B;  4J8U C;  3REL B;  1P3P C;  5GSU A;  2Y2J A;  5GT0 B;  3AYW C;  3LEL A;  4M6B A;  5CP6 C;  5AY8 B;  5CPK D;  1ZLA A;  3MVD A;  4WZS B;  3X1U D;  4Z5T A;  3A6N D;  3REL D;  2FJ7 A;  1N1J B;  5BS7 A;  2YFV B;  5GT0 D;  3O62 A;  5AY8 D;  3VH5 A;  5B2J C;  3W96 C;  1M1A B;  4J8W A;  3MGS C;  3A1K A;  2J8P A;  4H9N B;  1M1A D;  2F8N A;  5CPI B;  3B0D C;  1P3I A;  1KX3 A;  5CPI D;  3AN2 A;  2F2A C;  2L5A A;  2F8N H;  1HTA A;  1KU5 A;  3KXB C;  1P3O C;  3C1B C;  5B1L B;  3X1T B;  5GSU C;  3AV2 B;  4WU9 B;  1ZLA C;  3MVD C;  1F66 A;  1BH8 A;  4Z5T C;  3AZI A;  2FJ7 C;  5B1L D;  3X1T D;  5BS7 C;  3O62 C;  4Z2M H;  3KWQ B;  4WU9 D;  3WA9 B;  1BH9 B;  5BT1 D;  3LZ1 A;  4KHA A;  3AL0 C;  4J8W C;  4YS3 B;  3AFA A;  3KWQ D;  3AZL D;  3WA9 D;  5B33 C;  3VH6 T;  3EPH A;  2VQR A;  3B6F A;  1M18 A;  1KX3 C;  2Y2G A;  4G91 C;  5AVC A;  3AN2 C;  4ZBJ B;  5BNV B;  2Y2P A;  3AV1 A;  1H3O A;  5CPJ B;  3AZJ B;  4YM6 B;  3R45 A;  4KGC B;  3VH6 W;  5CPJ D;  1P3G A;  3AZJ D;  4YM6 D;  1F66 C;  5DNN A;  1ID3 A;  3AZI C;  3MGR B;  4KGC D;  3REK A;  5KDM A;  3REI D;  3REH B;  3WKJ C;  3MGR D;  5CPK A;  5B2I B;  5E5A B;  3X1U A;  3A6N A;  3AFA C;  3REH D;  3REL A;  1P3A C;  3EPJ A;  5GT0 A;  5AY8 A;  5B2I D;  3WAA B;  5E5A D;  1N1J A;  3B6F C;  2YFV A;  1P3L C;  5JA4 B;  1M18 C;  3WAA D;  4R8P C;  3MNN B;  1M1A A;  5AVC C;  3MGP B;  3MNN D;  1M19 B;  4H9N A;  5B31 B;  4H9S A;  2HIO C;  3MGP D;  5CPI A;  2F8N K;  1M19 D;  2Y2K A;  1ID3 C;  5B31 D;  5GXQ C;  4NE5 A;  3REK C;  2Y2N A;  5CHL B;  4HGA C;  5BO0 B;  3X1U C;  4Z66 B;  1ULY A;  5B1L A;  1T3U A;  3X1T A;  1Z2C B;  3AV2 A;  5AY8 C;  3AZN D;  4WU9 A;  4X23 A;  4Z66 D;  3MGQ B;  3KWQ A;  3WA9 A;  1BH9 A;  5AVB C;  4YS3 A;  3MGQ D;  4KUD B;  2BG1 A;  4H9S C;  5F99 B;  4KUD D;  4WU8 B;  4JJN B;  5F99 D;  5BNV A;  4WU8 D;  5AV6 B;  3AZF C;  4NFT A;  4JJN D;  5CPJ A;  3AZJ A;  5JRG C;  4YM6 A;  4KGC A;  5AV6 D;  2Y2H A;  2DF4 C;  3AV2 C;  4WU9 C;  5B31 G;  4X23 C;  3MGR A;  3UT9 B;  3AZM B;  2XD1 A;  3KWQ C;  3REH A;  3EPK A;  3WA9 C;  3UT9 D;  3AZM D;  5B2I A;  3B6G B;  3AZE C;  2G5H C;  5E5A A;  4YS3 C;  3UTB B;  2F8N G;  3WAA A;  3B6G D;  4WNN B;  4AWL B;  3AZK B;  5B0Z B;  3UTB D;  5JA4 A;  4H9O B;  5AV5 B;  3MNN A;  4Z2M G;  3AZK D;  5B0Z D;  3AZH B;  3MGP A;  3H0L C;  5B1M C;  5AV5 D;  1M19 A;  4YM6 C;  1KX4 B;  3AZH D;  5B31 A;  4KGC C;  3TU4 B;  4NE6 A;  1JFI B;  1KX4 D;  3W97 C;  3MGR C;  3LJA C;  2CV5 A;  3TU4 D;  2RVQ C;  3REH C;  3X1S B;  2IO5 C;  5BNX B;  3W99 B;  5B2I C;  3B0C T;  5BO0 A;  1S32 C;  4Z66 A;  3X1S D;  3VH6 A;  4H9R B;  3W99 D;  3WAA C;  4XUJ B;  1KX5 B;  1WWI A;  3MGQ A;  3WTP B;  4G92 C;  4XUJ D;  5G49 B;  3MNN C;  3REJ B;  4LD9 B;  1KX5 D;  3LEL C;  3WTP D;  3MGP C;  3B0C W;  4KUD A;  3REJ D;  1M19 C;  4LD9 D;  3UTA B;  2BYM B;  5B31 C;  4CSR B;  5F99 A;  3AZL B;  4WU8 A;  3UTA D;  2NQB B;  4JJN A;  2JCH A;  2CV5 C;  5AV6 A;  2NQB D;  1U35 B;  1EQZ B;  2ARO B;  4Z66 C;  2Y2O A;  1U35 D;  5B24 B;  1P3I C;  1EQZ D;  2ARO D;  3UT9 A;  4E45 A;  1TAF B;  5B24 D;  2ZM5 A;  1TZY B;  1P3B B;  3VH5 T;  2DQN C;  3B6G A;  3REI B;  3UTB A;  1TZY D;  4KUD C;  3WTP E;  3H0R C;  1P3B D;  4WNN A;  3AZK A;  2YFW B;  5B0Z A;  5F99 C;  4J8X D;  3C1C B;  5AV8 B;  5B32 B;  4WU8 C;  4H9O A;  3LZ1 C;  4JJN C;  5AV5 A;  4DRB A;  1P34 B;  3C1C D;  5B32 D;  5AV8 D;  3AZG B;  3AZH A;  3VH5 W;  4J8U B;  1P34 D;  1KX4 A;  3AZG D;  1P3P B;  3TU4 A;  3KUY D;  5B40 B;  4J8U D;  1JFI A;  1AOI B;  1P3P D;  3AV1 C;  2BYK B;  5B40 D;  3X1S A;  2HUE B;  1AOI D;  5BNX A;  3W99 A;  3W96 B;  3B6G C;  1P3G C;  4H9R A;  5DNN C;  3W96 D;  4XUJ A;  4AWL C;  4H9Q B;  3B0B A;  3NQU B;  4XZQ B;  1KX5 A;  3WTP A;  5CPK C;  3AZN B;  5G49 A;  1B67 A;  3A6N C;  3REJ A;  3REL C;  5GT3 B;  4LD9 A;  1PZR A;  4XZQ D;  4NE3 A;  5GT0 C;  3AZH C;  3EG5 B;  5GT3 D;  3UTA A;  1P3O B;  2BYM A;  1P3M B;  3C1B B;  1KX4 C;  4CSR A;  3TU4 C;  3AZL A;  2Y2L A;  1P3O D;  1P3M D;  1M1A C;  3C1B D;  2NQB A;  3V9R B;  5GSU D;  2Y2Q A;  1U35 A;  3W99 C;  1EQZ A;  5CPI C; 
#chains in the Genus database with same CATH homology
 2ARO A;  3X1V B;  5B33 B;  5B24 A;  2Y2M A;  3X1V D;  1TAF A;  5B33 D;  3LZ0 B;  1KX5 C;  1TZY A;  4LD9 C;  3REJ C;  3NQJ B;  5B1L C;  3X1T C;  1P3B A;  3LZ0 D;  3REI A;  4J8V B;  2PYO B;  5BT1 C;  5C3I B;  2YFW A;  4EO5 B;  4J8V D;  3AZL C;  3C1C A;  5B32 A;  5AV8 A;  2PYO D;  1BH8 B;  1P3F B;  3AZI B;  4WV4 B;  1P34 A;  3WKJ B;  2UWX A;  3AZG A;  1P3F D;  3AZI D;  1U35 C;  1EQZ C;  1R4V A;  4J8U A;  2ARO C;  1P3A B;  3WKJ D;  1HQ3 B;  1P3P A;  5B40 A;  1P3A D;  1AOI A;  1HQ3 D;  4ZBJ C;  1P3L B;  2BYK A;  5CPJ C;  3AZJ C;  4R8P B;  3P5J B;  3W96 A;  1P3L D;  3REI C;  4R8P D;  2G5I C;  2HIO B;  4H9Q A;  1A7W A;  2RIQ A;  3NQU A;  3A1I A;  4XZQ A;  2ZY5 A;  4ZUX B;  5AV8 C;  3C1C C;  3AZN A;  5GXQ B;  2HIO D;  5E5A C;  3REK B;  1F1E A;  5GT3 A;  1P34 C;  4ZUX D;  3AZG C;  5GXQ D;  3REK D;  1P3O A;  1P3M A;  3C1B A;  5B40 C;  2ZY3 A;  4CAY B;  1AOI C;  3V9R A;  4QLC B;  5FUG B;  2HUE C;  5AVB B;  4E44 A;  4QLC D;  3FDD A;  3X1V A;  3EPL A;  5B33 A;  5AVB D;  4XZQ C;  3LZ0 A;  2NZD B;  3AZN C;  3NQJ A;  5GT3 C;  2NZD D;  3AZF B;  3F6T A;  4J8V A;  2PYO A;  5JRG B;  3AZM A;  1P3M C;  4H9P B;  1P3K B;  3MGQ C;  3AZF D;  5JRG D;  4UPK A;  4X23 B;  1P3F A;  3W98 B;  1P3K D;  4J8X B;  3AV2 D;  3WKJ A;  4X23 D;  3W98 D;  3AZE B;  1P3A A;  5AV9 B;  1HQ3 A;  3X1V C;  3IP4 C;  5DNM B;  3AZE D;  4YS3 D;  5AV9 D;  5B0Y B;  5AV6 C;  3LZ0 C;  3KUY B;  1P3L A;  5DNM D;  4R8P A;  3KSY A;  5B0Y D;  3AYW B;  5CP6 B;  5B1M B;  2ZY2 A;  4J8V C;  2PYO C;  4WJ3 C;  3UT9 C;  3AZM C;  3AYW D;  5C3I C;  2HIO A;  5CP6 D;  5B1M D;  4EO5 C;  4DRA A;  2XD5 A;  5B2J B;  4ZUX A;  4UUZ B;  1P3F C;  3W97 B;  5GXQ A;  3LJA B;  3MGS B;  3UTB C;  5B2J D;  2IO5 B;  1B6W A;  3W97 D;  3LJA D;  3MGS D;  2RVQ D;  3AZK C;  5B0Z C;  1S32 B;  1HQ3 C;  1Q9C A;  5AV5 C;  3B0D B;  3KFU G;  4CAY A;  1S32 D;  4QLC A;  4G92 B;  5FUG A;  3KXB B;  5GSU B;  5AVB A;  2Y2I A;  3LEL B;  1ZLA B;  3MVD B;  4Z5T B;  3KXB D;  2FJ7 B;  3O62 B;  5B32 G;  3LEL D;  3X1S C;  1ZLA D;  3MVD D;  4Z5T D;  4ZUX C;  2FJ7 D;  2NZD A;  3O62 D;  4J8W B;  2CV5 B;  1W2E A;  3AZF A;  4XUJ C;  4J8W D;  2LY8 A;  5JRG A;  2CV5 D;  2F8N B;  4DQY B;  4H9P A;  1P3K A;  3WTP C;  2JE5 A;  2F8N D;  1P3I B;  1KX3 B;  3W98 A;  4G91 B;  3AN2 B;  4QLC C;  4J8X A;  1P3I D;  1KX3 D;  3UTA C;  3AN2 D;  3AZE A;  5AV9 A;  1F66 B;  2ZY4 A;  2NQB C;  5DNM A;  5B0Y A;  1F66 D;  3KUY A;  2NZD C;  3LZ1 B;  4KHA B;  2JSS A;  3AFA B;  3AYW A;  5CP6 A;  5B24 C;  5B1M A;  3LZ1 D;  3AFA D;  3B6F B;  1P3K C;  1M18 B;  1TZY C;  5B2J A;  4UUZ A;  3B6F D;  3W98 C;  3W97 A;  5AVC B;  1P3B C;  3LJA A;  3MGS A;  3AV1 B;  1M18 D;  4J8X C;  1H3O B;  3R45 B;  1WWS A;  5AVC D;  2CWE A;  3AV1 D;  1S32 A;  1P3G B;  5AV9 C;  2W8S A;  5B32 C;  5DNN B;  1ID3 B;  5DNM C;  5KDM B;  2FFF B;  1P3G D;  5B0Y C;  5DNN D;  3H0M C;  3KUY C;  5CPK B;  1ID3 D;  1BFM A;  4HGA B;  3X1U B;  3KXB A;  3A6N B;  4J8U C;  3REL B;  1P3P C;  5GSU A;  2Y2J A;  5GT0 B;  3AYW C;  3LEL A;  4M6B A;  5CP6 C;  5AY8 B;  5CPK D;  1ZLA A;  3MVD A;  4WZS B;  3X1U D;  4Z5T A;  3A6N D;  3REL D;  2FJ7 A;  1N1J B;  5BS7 A;  2YFV B;  5GT0 D;  3O62 A;  5AY8 D;  3VH5 A;  5B2J C;  3W96 C;  1M1A B;  4J8W A;  3MGS C;  3A1K A;  2J8P A;  4H9N B;  1M1A D;  2F8N A;  5CPI B;  3B0D C;  1P3I A;  1KX3 A;  5CPI D;  3AN2 A;  2F2A C;  2L5A A;  2F8N H;  1HTA A;  1KU5 A;  3KXB C;  1P3O C;  3C1B C;  5B1L B;  3X1T B;  5GSU C;  3AV2 B;  4WU9 B;  1ZLA C;  3MVD C;  1F66 A;  1BH8 A;  4Z5T C;  3AZI A;  2FJ7 C;  5B1L D;  3X1T D;  5BS7 C;  3O62 C;  4Z2M H;  3KWQ B;  4WU9 D;  3WA9 B;  1BH9 B;  5BT1 D;  3LZ1 A;  4KHA A;  3AL0 C;  4J8W C;  4YS3 B;  3AFA A;  3KWQ D;  3AZL D;  3WA9 D;  5B33 C;  3VH6 T;  3EPH A;  2VQR A;  3B6F A;  1M18 A;  1KX3 C;  2Y2G A;  4G91 C;  5AVC A;  3AN2 C;  4ZBJ B;  5BNV B;  2Y2P A;  3AV1 A;  1H3O A;  5CPJ B;  3AZJ B;  4YM6 B;  3R45 A;  4KGC B;  3VH6 W;  5CPJ D;  1P3G A;  3AZJ D;  4YM6 D;  1F66 C;  5DNN A;  1ID3 A;  3AZI C;  3MGR B;  4KGC D;  3REK A;  5KDM A;  3REI D;  3REH B;  3WKJ C;  3MGR D;  5CPK A;  5B2I B;  5E5A B;  3X1U A;  3A6N A;  3AFA C;  3REH D;  3REL A;  1P3A C;  3EPJ A;  5GT0 A;  5AY8 A;  5B2I D;  3WAA B;  5E5A D;  1N1J A;  3B6F C;  2YFV A;  1P3L C;  5JA4 B;  1M18 C;  3WAA D;  4R8P C;  3MNN B;  1M1A A;  5AVC C;  3MGP B;  3MNN D;  1M19 B;  4H9N A;  5B31 B;  4H9S A;  2HIO C;  3MGP D;  5CPI A;  2F8N K;  1M19 D;  2Y2K A;  1ID3 C;  5B31 D;  5GXQ C;  4NE5 A;  3REK C;  2Y2N A;  5CHL B;  4HGA C;  5BO0 B;  3X1U C;  4Z66 B;  1ULY A;  5B1L A;  1T3U A;  3X1T A;  1Z2C B;  3AV2 A;  5AY8 C;  3AZN D;  4WU9 A;  4X23 A;  4Z66 D;  3MGQ B;  3KWQ A;  3WA9 A;  1BH9 A;  5AVB C;  4YS3 A;  3MGQ D;  4KUD B;  2BG1 A;  4H9S C;  5F99 B;  4KUD D;  4WU8 B;  4JJN B;  5F99 D;  5BNV A;  4WU8 D;  5AV6 B;  3AZF C;  4NFT A;  4JJN D;  5CPJ A;  3AZJ A;  5JRG C;  4YM6 A;  4KGC A;  5AV6 D;  2Y2H A;  2DF4 C;  3AV2 C;  4WU9 C;  5B31 G;  4X23 C;  3MGR A;  3UT9 B;  3AZM B;  2XD1 A;  3KWQ C;  3REH A;  3EPK A;  3WA9 C;  3UT9 D;  3AZM D;  5B2I A;  3B6G B;  3AZE C;  2G5H C;  5E5A A;  4YS3 C;  3UTB B;  2F8N G;  3WAA A;  3B6G D;  4WNN B;  4AWL B;  3AZK B;  5B0Z B;  3UTB D;  5JA4 A;  4H9O B;  5AV5 B;  3MNN A;  4Z2M G;  3AZK D;  5B0Z D;  3AZH B;  3MGP A;  3H0L C;  5B1M C;  5AV5 D;  1M19 A;  4YM6 C;  1KX4 B;  3AZH D;  5B31 A;  4KGC C;  3TU4 B;  4NE6 A;  1JFI B;  1KX4 D;  3W97 C;  3MGR C;  3LJA C;  2CV5 A;  3TU4 D;  2RVQ C;  3REH C;  3X1S B;  2IO5 C;  5BNX B;  3W99 B;  5B2I C;  3B0C T;  5BO0 A;  1S32 C;  4Z66 A;  3X1S D;  3VH6 A;  4H9R B;  3W99 D;  3WAA C;  4XUJ B;  1KX5 B;  1WWI A;  3MGQ A;  3WTP B;  4G92 C;  4XUJ D;  5G49 B;  3MNN C;  3REJ B;  4LD9 B;  1KX5 D;  3LEL C;  3WTP D;  3MGP C;  3B0C W;  4KUD A;  3REJ D;  1M19 C;  4LD9 D;  3UTA B;  2BYM B;  5B31 C;  4CSR B;  5F99 A;  3AZL B;  4WU8 A;  3UTA D;  2NQB B;  4JJN A;  2JCH A;  2CV5 C;  5AV6 A;  2NQB D;  1U35 B;  1EQZ B;  2ARO B;  4Z66 C;  2Y2O A;  1U35 D;  5B24 B;  1P3I C;  1EQZ D;  2ARO D;  3UT9 A;  4E45 A;  1TAF B;  5B24 D;  2ZM5 A;  1TZY B;  1P3B B;  3VH5 T;  2DQN C;  3B6G A;  3REI B;  3UTB A;  1TZY D;  4KUD C;  3WTP E;  3H0R C;  1P3B D;  4WNN A;  3AZK A;  2YFW B;  5B0Z A;  5F99 C;  4J8X D;  3C1C B;  5AV8 B;  5B32 B;  4WU8 C;  4H9O A;  3LZ1 C;  4JJN C;  5AV5 A;  4DRB A;  1P34 B;  3C1C D;  5B32 D;  5AV8 D;  3AZG B;  3AZH A;  3VH5 W;  4J8U B;  1P34 D;  1KX4 A;  3AZG D;  1P3P B;  3TU4 A;  3KUY D;  5B40 B;  4J8U D;  1JFI A;  1AOI B;  1P3P D;  3AV1 C;  2BYK B;  5B40 D;  3X1S A;  2HUE B;  1AOI D;  5BNX A;  3W99 A;  3W96 B;  3B6G C;  1P3G C;  4H9R A;  5DNN C;  3W96 D;  4XUJ A;  4AWL C;  4H9Q B;  3B0B A;  3NQU B;  4XZQ B;  1KX5 A;  3WTP A;  5CPK C;  3AZN B;  5G49 A;  1B67 A;  3A6N C;  3REJ A;  3REL C;  5GT3 B;  4LD9 A;  1PZR A;  4XZQ D;  4NE3 A;  5GT0 C;  3AZH C;  3EG5 B;  5GT3 D;  3UTA A;  1P3O B;  2BYM A;  1P3M B;  3C1B B;  1KX4 C;  4CSR A;  3TU4 C;  3AZL A;  2Y2L A;  1P3O D;  1P3M D;  1M1A C;  3C1B D;  2NQB A;  3V9R B;  5GSU D;  2Y2Q A;  1U35 A;  3W99 C;  1EQZ A;  5CPI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...