4H9OB

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9oB00
5GSUC 3MGQD 5B0ZD 2NZDB 3AZKC 3REIC 5CP6A 2HIOD 5CPKB 4H9SA 3AYWD 5B2JA 4QLCC 3B6FC 4KGCC 4Z5TA 1ID3A 4NFTA 3WAAD 5AVBC 1HQ3B 2CV5B 1F66D 3LELD 1P3AA 3MNNC 3O62C 3UTAD 1P34D 5AY8A 5F99A 2YFWB 4UUZB 5BT1C 3B0BA 1M1AB 1AOIA 3KXBB 4R8PA 5JRGA 3B6FB 4KGCB 4KHAA 4WV4B 5AV5A 4H9PA 5GXQA 3LZ1C 3AZNB 3REKC 1EQZA 1KX4B 4ZUXC 4XZQC 5B31C 2NQBB 1KX3A 1U35A 1P3OB 5AV8D 3AZFD 3MGRB 1P3GA 3TU4B 3C1BC 4J8XA 3V9RA 5DNMA 1TZYC 3REJA 3B6GC 3X1UC 5E5AC 4WNNB 3AZEA 5AV9B 5GSUA 5CPIC 5B2IB 3AZKA 5B1MC 3X1SC 3REIA 2F8ND 5B24A 4Z66A 2BYMB 5B1LC 5JA4A 3W98B 4JJNC 3C1CD 4QLCA 3X1UB 2FJ7B 4NE6A 1B6WA 3W99B 5AVBA 5B0YC 5CP6D 3MVDB 3O62A 5GT0D 3X1TB 5B2JD 4CSRB 4G92C 4Z5TD 1ID3D 1ZLAA 5DNNC 5B0ZB 3VH6W 3LJAD 4YS3C 4WU9D 2HIOB 5KDMA 3LZ1A 3AFAA 3AYWB 4J8WB 3REKA 3KSYA 4ZUXA 4XZQA 5AY8D 4G91B 5F99D 5B40A 3KWQB 3AN2A 4R8PD 5JRGD 5BO0B 2L5AA 3C1BA 5AV5D 2PYOA 4XUJA 1TZYA 3B6GA 1P3BC 1F66B 5GXQD 5E5AA 3LELB 3AZLB 1P3PC 3A6NB 3MGSC 1P34B 4H9RA 1M18A 4WU8C 5CPIA 1P3LC 1KX3D 5B1MA 1P3GD 5B1LA 3AZID 4J8XD 5DNMD 3REJD 3X1VA 3WTPC 3AZED 5AV8B 5BNXB 3AZKD 4WU8B 5B0YA 1TAFA 5B24D 3REID 4J8UC 4Z66D 3NQJB 3WKJC 2YFVA 1JFIA 3UTBC 2AROB 5AV6B 3AZJB 4H9NB 5DNNA 4LD9C 4X23C 2F8NB 4YS3A 4KUDB 1BFMA 1S32D 3MGPB 5BNVA 2NZDC 3REHD 3WTPE 3UTBB 5CPKC 1ZLAD 1BH9A 2BYKB 5CP6B 1P3BA 3LZ1D 3LZ0D 3AFAD 2F8NG 5GT0B 3REKD 1HQ3C 5CPJA 4ZUXD 2CV5C 4J8VC 3W97B 5B40D 1P3IA 4YM6B 3AN2D 3LJAB 3AZHA 3AV1D 4WU9B 3C1BD 2PYOD 4XUJD 1TZYD 1M1AC 3KXBC 3AZMA 1KX5B 5E5AD 1WWSA 3WTPA 1M18D 5B33B 3KUYB 5CPID 1P3KC 4J8VB 3AZNC 5JRGB 5B1MD 1KX4C 4KHAB 3AZGB 5B32A 3WKJA 5B1LD 2NQBC 5GXQB 3X1VD 1P3OC 4HGAB 1P3FD 3MGRC 3W96B 3TU4C 1P3MA 4LD9A 3UT9B 4X23A 1KX3B 3WA9B 5B0YD 5AV9C 1P3KB 3AZIB 5DNMB 5B2IC 2NZDA 5GT3C 4EO5C 5CPKA 5DNND 3W98C 4YS3D 2FJ7C 1M19C 3W99C 2CV5A 5AVCB 3MVDC 5GT3B 3RELC 4EO5B 3X1TC 2YFWA 4UUZA 1S32B 3KXBA 1P3BD 1BH8B 4Z2MH 5B0ZC 3B6FA 4KGCA 1EQZD 3REHB 5CPJD 1M19B 2HIOC 4DRBA 1ZLAB 3AYWC 3AZNA 4J8WC 1P3ID 3B0DB 4E45A 1KX4A 3AZHD 5G49B 3RELB 4G91C 1H3OB 3KWQC 2NQBA 3MNNA 3LZ0B 1P3OA 3AZMD 3AV2B 3MGQB 3WTPD 1F66C 3LELC 4WNNA 3AN2B 3AZLC 3A6NC 3UTAC 1P34C 3AV1B 5AV9A 5B32D 3WKJD 1P3AD 5B31A 5B2IA 1A7WA 2BYMA 2HUEB 1AOID 3WAAB 1P3MD 1M18B 4LD9D 4X23D 3B0CT 3X1UA 3UTAB 3W99A 1Q9CA 5AV8C 1P3FB 2NZDD 4H9QB 1KU5A 3NQUB 5FUGB 3X1SA 1U35D 3MVDA 5CPKD 2AROC 4H9OB 5C3IB 5AV6C 3AZJC 4CSRA 4JJNA 3B0CW 5B0ZA 1N1JB 4AWLB 4KUDC 5GSUD 3AZFB 3MGPC 4J8WA 1HTAA 3KWQA 3KXBD 4QLCD 3B6FD 4KGCD 5BO0A 5CP6C 4CAYB 1F66A 5AVBD 4H9SC 3AZLA 3A6NA 3AZND 5GT0C 3W97C 1KX4D 5B2JC 3C1CB 2NQBD 3MNND 3O62D 4YM6C 1P3OD 3LJAC 1EQZB 4ZBJC 5BT1D 4WU9C 1KX5C 1P3IB 3AZHB 5AY8C 1P3PA 5AV9D 3MGSA 5B33C 3KUYC 5AV8A 4XZQD 3AZMB 5B31D 5B2JB 5BNXA 5JRGC 5B2ID 4WU8A 4Z5TB 1ID3B 3AZGC 1P3LA 4NE5A 5GXQC 4ZBJB 4HGAC 2AROA 3W96C 3B6GD 5AV6A 3AZJA 3X1UD 4H9NA 5B32B 1P3AB 3UT9C 1KX3C 3W99D 5AY8B 5F99B 2F8NA 4KUDA 3WA9C 1AOIB 3R45A 3AZIC 4R8PB 5DNMC 3X1SD 3MGPA 3MVDD 3REJC 1P3MB 4J8UA 5AV5B 4H9PB 3UTBA 4JJND 2BYKA 5B32G 5B24C 4Z66C 1U35B 1P3GB 4J8WD 5GT0A 3W97A 4J8XB 2IO5B 3V9RB 5AVCC 3REJB 3KWQD 4YM6A 3LJAA 3AZEB 4WU9A 5GSUB 1S32C 1KX5A 3AZKB 3REIB 5B24B 4Z66B 3AZLD 3A6ND 3REHC 2JSSA 1HQ3A 5JA4B 5B33A 3KUYA 4J8VA 1ZLAC 4QLCB 3B0DC 3VH6A 3AZGA 5AVBB 3LZ0C 3AFAC 3W96A 1M1AA 3AV2C 2RVQC 3MGQC 1B67A 1P3PD 5B40C 3UT9A 3O62B 3MNNB 3MGSD 1F1EA 3AN2C 3WA9A 3AV1C 4WU8D 1P3KA 1P3LD 3AZIA 2PYOC 4XUJC 4Z2MG 4DRAA 2AROD 5KDMB 3LZ1B 2HUEC 3WAAC 5AV6D 3AFAB 3AZJD 3MGRA 3REKB 1M18C 3TU4A 4ZUXB 4XZQB 3VH5A 5B31B 4WZSB 5B40B 4KUDD 3X1VC 3MGPD 1P3FC 3C1BB 4J8UD 2PYOB 4XUJB 1TZYB 5AVCA 3B6GB 3VH6T 5E5AB 5GT3A 3UTBD 4H9RB 5C3IC 5CPIB 1S32A 3W98A 5B31G 3X1SB 5B1MB 1BH8A 2FJ7A 4AWLC 5B1LB 3REHA 1M19A 3W97D 3X1VB 3AZFC 4JJNB 2F8NK 4YM6D 5G49A 3RELA 1H3OA 3LZ0A 1KX5D 3X1TA 1TAFB 5B0YB 3AV2A 3MGQA 3VH5T 2YFVB 1JFIB 1HQ3D 5B33D 3KUYD 2HIOA 4J8VD 2CV5D 4G92B 3AV1A 3AYWA 3AZGD 5DNNB 3C1CC 1ULYA 4YS3B 5BS7C 1EQZC 3W96D 5CPJC 1M1AD 3WAAA 5BNVB 3UT9D 1P3IC 3VH5W 3AZHC 3LELA 3WA9D 1P3KD 3UTAA 1BH9B 1P34A 3AZMC 1P3FA 4H9QA 4Z5TC 1ID3C 1P3BB 3NQUA 5FUGA 1P3PB 3MGRD 3MGSB 5CPJB 3TU4D 4H9OA 1P3LB 5B32C 1P3AC 1N1JA 5F99C 5CHLB 5AVCD 1AOIC 3AZFA 1P3MC 4R8PC 5GT3D 4NE3A 5AV5C 3WTPB 3NQJA 1WWIA 3R45B 3W98D 4J8UB 1R4VA 2FJ7D 3WKJB 1M19D 4CAYA 2LY8A 1U35C 2F8NH 1P3GC 4E44A 4J8XC 2IO5C 2CWEA 4LD9B 3RELD 4X23B 3C1CA 3AZEC 3X1TD 5BS7A 4M6BA 3AV2D 2RVQD
chains in the Genus database with same CATH superfamily
5GSUC 3MGQD 5B0ZD 2NZDB 3AZKC 3REIC 5CP6A 2HIOD 5CPKB 4H9SA 3AYWD 5B2JA 4QLCC 3B6FC 4KGCC 4Z5TA 1ID3A 4NFTA 3WAAD 5AVBC 1HQ3B 2CV5B 1F66D 3LELD 2Y2QA 1P3AA 3MNNC 3O62C 3EPJA 3UTAD 2BG1A 5AY8A 5F99A 1P34D 2YFWB 4UUZB 5BT1C 3B0BA 1M1AB 1AOIA 3KXBB 4R8PA 5JRGA 3B6FB 4KGCB 4KHAA 4WV4B 5AV5A 4H9PA 5GXQA 3LZ1C 3AZNB 3REKC 1EQZA 1KX4B 4ZUXC 4XZQC 5B31C 3H0MC 2NQBB 1KX3A 1U35A 1P3OB 5AV8D 3AZFD 3MGRB 1P3GA 3TU4B 3C1BC 4J8XA 3V9RA 5DNMA 1TZYC 3REJA 3B6GC 3X1UC 5E5AC 4WNNB 3AZEA 5AV9B 5GSUA 5CPIC 5B2IB 3AZKA 5B1MC 3X1SC 3REIA 2F8ND 5B24A 4Z66A 2BYMB 5B1LC 5JA4A 3W98B 4JJNC 3C1CD 2Y2JA 4QLCA 3FDDA 3X1UB 2FJ7B 4NE6A 1B6WA 3W99B 5AVBA 5B0YC 5CP6D 3MVDB 2G5IC 3F6TA 3O62A 5GT0D 3X1TB 5B2JD 4CSRB 4G92C 4Z5TD 1W2EA 1ID3D 1ZLAA 5DNNC 5B0ZB 3VH6W 3LJAD 4YS3C 4WU9D 2HIOB 5KDMA 3LZ1A 3AFAA 1PZRA 3AYWB 3A1KA 4J8WB 3REKA 3KSYA 4ZUXA 4XZQA 5AY8D 4G91B 5F99D 5B40A 3KWQB 3AN2A 4R8PD 5JRGD 5BO0B 2L5AA 3C1BA 5AV5D 2PYOA 4XUJA 1TZYA 3B6GA 1P3BC 1F66B 5GXQD 5E5AA 3LELB 3AZLB 1P3PC 3A6NB 3MGSC 1P34B 2XD1A 4H9RA 1M18A 4WU8C 5CPIA 1P3LC 1KX3D 5B1MA 1P3GD 5B1LA 3AZID 4J8XD 5DNMD 3REJD 3X1VA 3WTPC 3AZED 5AV8B 5BNXB 2RIQA 3AZKD 1TAFA 5B0YA 4WU8B 5B24D 3REID 4J8UC 2Y2NA 4Z66D 3NQJB 3WKJC 2YFVA 1JFIA 3UTBC 2AROB 5AV6B 3AZJB 3EPLA 4H9NB 5DNNA 4LD9C 4X23C 2F8NB 4YS3A 4KUDB 2VQRA 1BFMA 2JE5A 1Z2CB 1S32D 3MGPB 2Y2MA 5BNVA 2NZDC 3REHD 3WTPE 3UTBB 5CPKC 1ZLAD 1BH9A 2BYKB 5CP6B 1P3BA 3LZ1D 3LZ0D 3AFAD 2F8NG 5GT0B 3REKD 1HQ3C 5CPJA 4ZUXD 2CV5C 4J8VC 3W97B 5B40D 1P3IA 3AL0C 4YM6B 3AN2D 3LJAB 3AZHA 3AV1D 4WU9B 3H0RC 3C1BD 2PYOD 4XUJD 1TZYD 1M1AC 3KXBC 2Y2IA 3AZMA 1KX5B 5E5AD 1WWSA 3WTPA 1M18D 5B33B 3KUYB 5CPID 1P3KC 4J8VB 3AZNC 5JRGB 5B1MD 1KX4C 4KHAB 3AZGB 5B32A 3WKJA 5B1LD 2NQBC 5GXQB 3X1VD 3P5JB 1P3OC 4HGAB 1P3FD 3MGRC 3W96B 3TU4C 1P3MA 4LD9A 3UT9B 4X23A 1KX3B 3WA9B 5B0YD 2XD5A 5AV9C 3AZIB 1P3KB 5DNMB 5B2IC 2NZDA 5GT3C 4EO5C 5CPKA 5DNND 3W98C 4YS3D 2FJ7C 1M19C 3W99C 2CV5A 2Y2LA 5AVCB 3MVDC 5GT3B 3RELC 4EO5B 3X1TC 2YFWA 4UUZA 2ZY2A 1S32B 3KXBA 1P3BD 1BH8B 4Z2MH 5B0ZC 3B6FA 4KGCA 1EQZD 3REHB 5CPJD 1M19B 2HIOC 4DRBA 1ZLAB 3IP4C 3AZNA 4J8WC 3AYWC 3B0DB 4E45A 1P3ID 1KX4A 3AZHD 5G49B 3RELB 4G91C 1H3OB 3KWQC 2NQBA 3MNNA 3LZ0B 3EPKA 3AZMD 1P3OA 3AV2B 3MGQB 3WTPD 2ZM5A 1F66C 3LELC 4WNNA 3AN2B 3AZLC 4WJ3C 3A6NC 3UTAC 1P34C 3AV1B 5AV9A 5B32D 3WKJD 1P3AD 5B31A 5B2IA 1A7WA 2BYMA 3A1IA 2HUEB 1AOID 3WAAB 1P3MD 1M18B 4LD9D 4X23D 3B0CT 3X1UA 3UTAB 3W99A 1Q9CA 5AV8C 1P3FB 2NZDD 4H9QB 1KU5A 3NQUB 5FUGB 3X1SA 1U35D 3MVDA 2F2AC 5CPKD 2AROC 4H9OB 5C3IB 5AV6C 3AZJC 4CSRA 4JJNA 3B0CW 5B0ZA 1N1JB 4AWLB 4KUDC 2G5HC 5GSUD 3AZFB 3MGPC 4J8WA 1HTAA 2FFFB 3KWQA 3KXBD 4QLCD 3B6FD 4KGCD 5BO0A 3EPHA 5CP6C 4CAYB 1F66A 5AVBD 4DQYB 4H9SC 3AZLA 3A6NA 3AZND 5GT0C 2UWXA 3W97C 1KX4D 5B2JC 3C1CB 2NQBD 3MNND 3O62D 4YM6C 1P3OD 3LJAC 1EQZB 4ZBJC 5BT1D 4WU9C 1KX5C 3KFUG 1P3IB 3AZHB 5AY8C 1P3PA 5AV9D 3MGSA 5B33C 3KUYC 5AV8A 4XZQD 3AZMB 5B31D 5B2JB 5BNXA 5JRGC 5B2ID 4WU8A 4Z5TB 1ID3B 3AZGC 1P3LA 4NE5A 5GXQC 4ZBJB 4HGAC 2AROA 3W96C 3B6GD 5AV6A 3AZJA 3X1UD 4H9NA 5B32B 1P3AB 3UT9C 1KX3C 3W99D 5AY8B 5F99B 2F8NA 4KUDA 3WA9C 1AOIB 3R45A 3AZIC 5DNMC 4R8PB 3X1SD 3MGPA 3MVDD 3REJC 1P3MB 2ZY3A 4J8UA 5AV5B 4H9PB 3UTBA 2Y2GA 4JJND 2BYKA 5B32G 5B24C 4Z66C 1U35B 1T3UA 1P3GB 4J8WD 5GT0A 3W97A 4J8XB 2IO5B 3V9RB 5AVCC 3REJB 2Y2PA 3KWQD 2JCHA 4YM6A 3LJAA 3AZEB 4WU9A 2Y2OA 5GSUB 1S32C 1KX5A 3AZKB 3REIB 5B24B 4Z66B 3AZLD 3A6ND 3REHC 2JSSA 1HQ3A 5JA4B 5B33A 3KUYA 4J8VA 1ZLAC 4QLCB 3B0DC 3VH6A 4UPKA 3AZGA 5AVBB 3LZ0C 3AFAC 3W96A 1M1AA 2Y2HA 3AV2C 2RVQC 3MGQC 1B67A 1P3PD 5B40C 3UT9A 3O62B 3MNNB 3MGSD 1F1EA 3AN2C 3WA9A 3AV1C 4WU8D 1P3KA 1P3LD 3AZIA 2ZY5A 2PYOC 4XUJC 4Z2MG 4DRAA 2AROD 5KDMB 3LZ1B 2HUEC 3WAAC 5AV6D 3AFAB 3AZJD 3MGRA 3REKB 1M18C 3TU4A 4ZUXB 4XZQB 3VH5A 5B31B 4WZSB 3H0LC 5B40B 4KUDD 3X1VC 3MGPD 1P3FC 3C1BB 4J8UD 2PYOB 4XUJB 1TZYB 5AVCA 3B6GB 3VH6T 5E5AB 5GT3A 3UTBD 4H9RB 5C3IC 2DF4C 5CPIB 1S32A 3W98A 5B31G 3X1SB 5B1MB 1BH8A 2FJ7A 4AWLC 5B1LB 3REHA 1M19A 3W97D 3X1VB 3AZFC 4JJNB 2F8NK 4YM6D 5G49A 3RELA 1H3OA 3LZ0A 1KX5D 3X1TA 1TAFB 5B0YB 2ZY4A 3AV2A 3MGQA 3VH5T 2YFVB 1JFIB 1HQ3D 5B33D 3KUYD 2HIOA 4J8VD 2CV5D 4G92B 3AV1A 3AYWA 3AZGD 5DNNB 3C1CC 1ULYA 4YS3B 5BS7C 1EQZC 3W96D 5CPJC 1M1AD 3WAAA 5BNVB 3UT9D 1P3IC 3VH5W 3AZHC 3LELA 3WA9D 1P3KD 3UTAA 1BH9B 1P34A 3AZMC 1P3FA 3EG5B 4H9QA 4Z5TC 1ID3C 1P3BB 3NQUA 5FUGA 1P3PB 3MGRD 3MGSB 5CPJB 3TU4D 4H9OA 1P3LB 5B32C 1P3AC 1N1JA 5F99C 5CHLB 2W8SA 5AVCD 1AOIC 3AZFA 1P3MC 4R8PC 5GT3D 4NE3A 5AV5C 2DQNC 3WTPB 3NQJA 1WWIA 3R45B 3W98D 2Y2KA 2J8PA 4J8UB 1R4VA 2FJ7D 3WKJB 1M19D 4CAYA 2LY8A 1U35C 2F8NH 1P3GC 4E44A 4J8XC 2IO5C 2CWEA 4LD9B 3RELD 4X23B 3C1CA 3AZEC 3X1TD 5BS7A 4M6BA 3AV2D 2RVQD
chains in the Genus database with same CATH topology
5GSUC 3MGQD 5B0ZD 2NZDB 3AZKC 3REIC 5CP6A 2HIOD 5CPKB 4H9SA 3AYWD 5B2JA 4QLCC 3B6FC 4KGCC 4Z5TA 1ID3A 4NFTA 3WAAD 5AVBC 1HQ3B 2CV5B 1F66D 3LELD 2Y2QA 1P3AA 3MNNC 3O62C 3EPJA 3UTAD 2BG1A 5AY8A 5F99A 1P34D 2YFWB 4UUZB 5BT1C 3B0BA 1M1AB 1AOIA 3KXBB 4R8PA 5JRGA 3B6FB 4KGCB 4KHAA 4WV4B 5AV5A 4H9PA 5GXQA 3LZ1C 3AZNB 3REKC 1EQZA 1KX4B 4ZUXC 4XZQC 5B31C 3H0MC 2NQBB 1KX3A 1U35A 1P3OB 5AV8D 3AZFD 3MGRB 1P3GA 3TU4B 3C1BC 4J8XA 3V9RA 5DNMA 1TZYC 3REJA 3B6GC 3X1UC 5E5AC 4WNNB 3AZEA 5AV9B 5GSUA 5CPIC 5B2IB 3AZKA 5B1MC 3X1SC 3REIA 2F8ND 5B24A 4Z66A 2BYMB 5B1LC 5JA4A 3W98B 4JJNC 3C1CD 2Y2JA 4QLCA 3FDDA 3X1UB 2FJ7B 4NE6A 1B6WA 3W99B 5AVBA 5B0YC 5CP6D 3MVDB 2G5IC 3F6TA 3O62A 5GT0D 3X1TB 5B2JD 4CSRB 4G92C 4Z5TD 1W2EA 1ID3D 1ZLAA 5DNNC 5B0ZB 3VH6W 3LJAD 4YS3C 4WU9D 2HIOB 5KDMA 3LZ1A 3AFAA 1PZRA 3AYWB 3A1KA 4J8WB 3REKA 3KSYA 4ZUXA 4XZQA 5AY8D 4G91B 5F99D 5B40A 3KWQB 3AN2A 4R8PD 5JRGD 5BO0B 2L5AA 3C1BA 5AV5D 2PYOA 4XUJA 1TZYA 3B6GA 1P3BC 1F66B 5GXQD 5E5AA 3LELB 3AZLB 1P3PC 3A6NB 3MGSC 1P34B 2XD1A 4H9RA 1M18A 4WU8C 5CPIA 1P3LC 1KX3D 5B1MA 1P3GD 5B1LA 3AZID 4J8XD 5DNMD 3REJD 3X1VA 3WTPC 3AZED 5AV8B 5BNXB 2RIQA 3AZKD 1TAFA 5B0YA 4WU8B 5B24D 3REID 4J8UC 2Y2NA 4Z66D 3NQJB 3WKJC 2YFVA 1JFIA 3UTBC 2AROB 5AV6B 3AZJB 3EPLA 4H9NB 5DNNA 4LD9C 4X23C 2F8NB 4YS3A 4KUDB 2VQRA 1BFMA 2JE5A 1Z2CB 1S32D 3MGPB 2Y2MA 5BNVA 2NZDC 3REHD 3WTPE 3UTBB 5CPKC 1ZLAD 1BH9A 2BYKB 5CP6B 1P3BA 3LZ1D 3LZ0D 3AFAD 2F8NG 5GT0B 3REKD 1HQ3C 5CPJA 4ZUXD 2CV5C 4J8VC 3W97B 5B40D 1P3IA 3AL0C 4YM6B 3AN2D 3LJAB 3AZHA 3AV1D 4WU9B 3H0RC 3C1BD 2PYOD 4XUJD 1TZYD 1M1AC 3KXBC 2Y2IA 3AZMA 1KX5B 5E5AD 1WWSA 3WTPA 1M18D 5B33B 3KUYB 5CPID 1P3KC 4J8VB 3AZNC 5JRGB 5B1MD 1KX4C 4KHAB 3AZGB 5B32A 3WKJA 5B1LD 2NQBC 5GXQB 3X1VD 3P5JB 1P3OC 4HGAB 1P3FD 3MGRC 3W96B 3TU4C 1P3MA 4LD9A 3UT9B 4X23A 1KX3B 3WA9B 5B0YD 2XD5A 5AV9C 3AZIB 1P3KB 5DNMB 5B2IC 2NZDA 5GT3C 4EO5C 5CPKA 5DNND 3W98C 4YS3D 2FJ7C 1M19C 3W99C 2CV5A 2Y2LA 5AVCB 3MVDC 5GT3B 3RELC 4EO5B 3X1TC 2YFWA 4UUZA 2ZY2A 1S32B 3KXBA 1P3BD 1BH8B 4Z2MH 5B0ZC 3B6FA 4KGCA 1EQZD 3REHB 5CPJD 1M19B 2HIOC 4DRBA 1ZLAB 3IP4C 3AZNA 4J8WC 3AYWC 3B0DB 4E45A 1P3ID 1KX4A 3AZHD 5G49B 3RELB 4G91C 1H3OB 3KWQC 2NQBA 3MNNA 3LZ0B 3EPKA 3AZMD 1P3OA 3AV2B 3MGQB 3WTPD 2ZM5A 1F66C 3LELC 4WNNA 3AN2B 3AZLC 4WJ3C 3A6NC 3UTAC 1P34C 3AV1B 5AV9A 5B32D 3WKJD 1P3AD 5B31A 5B2IA 1A7WA 2BYMA 3A1IA 2HUEB 1AOID 3WAAB 1P3MD 1M18B 4LD9D 4X23D 3B0CT 3X1UA 3UTAB 3W99A 1Q9CA 5AV8C 1P3FB 2NZDD 4H9QB 1KU5A 3NQUB 5FUGB 3X1SA 1U35D 3MVDA 2F2AC 5CPKD 2AROC 4H9OB 5C3IB 5AV6C 3AZJC 4CSRA 4JJNA 3B0CW 5B0ZA 1N1JB 4AWLB 4KUDC 2G5HC 5GSUD 3AZFB 3MGPC 4J8WA 1HTAA 2FFFB 3KWQA 3KXBD 4QLCD 3B6FD 4KGCD 5BO0A 3EPHA 5CP6C 4CAYB 1F66A 5AVBD 4DQYB 4H9SC 3AZLA 3A6NA 3AZND 5GT0C 2UWXA 3W97C 1KX4D 5B2JC 3C1CB 2NQBD 3MNND 3O62D 4YM6C 1P3OD 3LJAC 1EQZB 4ZBJC 5BT1D 4WU9C 1KX5C 3KFUG 1P3IB 3AZHB 5AY8C 1P3PA 5AV9D 3MGSA 5B33C 3KUYC 5AV8A 4XZQD 3AZMB 5B31D 5B2JB 5BNXA 5JRGC 5B2ID 4WU8A 4Z5TB 1ID3B 3AZGC 1P3LA 4NE5A 5GXQC 4ZBJB 4HGAC 2AROA 3W96C 3B6GD 5AV6A 3AZJA 3X1UD 4H9NA 5B32B 1P3AB 3UT9C 1KX3C 3W99D 5AY8B 5F99B 2F8NA 4KUDA 3WA9C 1AOIB 3R45A 3AZIC 5DNMC 4R8PB 3X1SD 3MGPA 3MVDD 3REJC 1P3MB 2ZY3A 4J8UA 5AV5B 4H9PB 3UTBA 2Y2GA 4JJND 2BYKA 5B32G 5B24C 4Z66C 1U35B 1T3UA 1P3GB 4J8WD 5GT0A 3W97A 4J8XB 2IO5B 3V9RB 5AVCC 3REJB 2Y2PA 3KWQD 2JCHA 4YM6A 3LJAA 3AZEB 4WU9A 2Y2OA 5GSUB 1S32C 1KX5A 3AZKB 3REIB 5B24B 4Z66B 3AZLD 3A6ND 3REHC 2JSSA 1HQ3A 5JA4B 5B33A 3KUYA 4J8VA 1ZLAC 4QLCB 3B0DC 3VH6A 4UPKA 3AZGA 5AVBB 3LZ0C 3AFAC 3W96A 1M1AA 2Y2HA 3AV2C 2RVQC 3MGQC 1B67A 1P3PD 5B40C 3UT9A 3O62B 3MNNB 3MGSD 1F1EA 3AN2C 3WA9A 3AV1C 4WU8D 1P3KA 1P3LD 3AZIA 2ZY5A 2PYOC 4XUJC 4Z2MG 4DRAA 2AROD 5KDMB 3LZ1B 2HUEC 3WAAC 5AV6D 3AFAB 3AZJD 3MGRA 3REKB 1M18C 3TU4A 4ZUXB 4XZQB 3VH5A 5B31B 4WZSB 3H0LC 5B40B 4KUDD 3X1VC 3MGPD 1P3FC 3C1BB 4J8UD 2PYOB 4XUJB 1TZYB 5AVCA 3B6GB 3VH6T 5E5AB 5GT3A 3UTBD 4H9RB 5C3IC 2DF4C 5CPIB 1S32A 3W98A 5B31G 3X1SB 5B1MB 1BH8A 2FJ7A 4AWLC 5B1LB 3REHA 1M19A 3W97D 3X1VB 3AZFC 4JJNB 2F8NK 4YM6D 5G49A 3RELA 1H3OA 3LZ0A 1KX5D 3X1TA 1TAFB 5B0YB 2ZY4A 3AV2A 3MGQA 3VH5T 2YFVB 1JFIB 1HQ3D 5B33D 3KUYD 2HIOA 4J8VD 2CV5D 4G92B 3AV1A 3AYWA 3AZGD 5DNNB 3C1CC 1ULYA 4YS3B 5BS7C 1EQZC 3W96D 5CPJC 1M1AD 3WAAA 5BNVB 3UT9D 1P3IC 3VH5W 3AZHC 3LELA 3WA9D 1P3KD 3UTAA 1BH9B 1P34A 3AZMC 1P3FA 3EG5B 4H9QA 4Z5TC 1ID3C 1P3BB 3NQUA 5FUGA 1P3PB 3MGRD 3MGSB 5CPJB 3TU4D 4H9OA 1P3LB 5B32C 1P3AC 1N1JA 5F99C 5CHLB 2W8SA 5AVCD 1AOIC 3AZFA 1P3MC 4R8PC 5GT3D 4NE3A 5AV5C 2DQNC 3WTPB 3NQJA 1WWIA 3R45B 3W98D 2Y2KA 2J8PA 4J8UB 1R4VA 2FJ7D 3WKJB 1M19D 4CAYA 2LY8A 1U35C 2F8NH 1P3GC 4E44A 4J8XC 2IO5C 2CWEA 4LD9B 3RELD 4X23B 3C1CA 3AZEC 3X1TD 5BS7A 4M6BA 3AV2D 2RVQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSU C;  3MGQ D;  5B0Z D;  2NZD B;  3AZK C;  3REI C;  5CP6 A;  2HIO D;  5CPK B;  4H9S A;  3AYW D;  5B2J A;  4QLC C;  3B6F C;  4KGC C;  4Z5T A;  1ID3 A;  4NFT A;  3WAA D;  5AVB C;  1HQ3 B;  2CV5 B;  1F66 D;  3LEL D;  1P3A A;  3MNN C;  3O62 C;  3UTA D;  1P34 D;  5AY8 A;  5F99 A;  2YFW B;  4UUZ B;  5BT1 C;  3B0B A;  1M1A B;  1AOI A;  3KXB B;  4R8P A;  5JRG A;  3B6F B;  4KGC B;  4KHA A;  4WV4 B;  5AV5 A;  4H9P A;  5GXQ A;  3LZ1 C;  3AZN B;  3REK C;  1EQZ A;  1KX4 B;  4ZUX C;  4XZQ C;  5B31 C;  2NQB B;  1KX3 A;  1U35 A;  1P3O B;  5AV8 D;  3AZF D;  3MGR B;  1P3G A;  3TU4 B;  3C1B C;  4J8X A;  3V9R A;  5DNM A;  1TZY C;  3REJ A;  3B6G C;  3X1U C;  5E5A C;  4WNN B;  3AZE A;  5AV9 B;  5GSU A;  5CPI C;  5B2I B;  3AZK A;  5B1M C;  3X1S C;  3REI A;  2F8N D;  5B24 A;  4Z66 A;  2BYM B;  5B1L C;  5JA4 A;  3W98 B;  4JJN C;  3C1C D;  4QLC A;  3X1U B;  2FJ7 B;  4NE6 A;  1B6W A;  3W99 B;  5AVB A;  5B0Y C;  5CP6 D;  3MVD B;  3O62 A;  5GT0 D;  3X1T B;  5B2J D;  4CSR B;  4G92 C;  4Z5T D;  1ID3 D;  1ZLA A;  5DNN C;  5B0Z B;  3VH6 W;  3LJA D;  4YS3 C;  4WU9 D;  2HIO B;  5KDM A;  3LZ1 A;  3AFA A;  3AYW B;  4J8W B;  3REK A;  3KSY A;  4ZUX A;  4XZQ A;  5AY8 D;  4G91 B;  5F99 D;  5B40 A;  3KWQ B;  3AN2 A;  4R8P D;  5JRG D;  5BO0 B;  2L5A A;  3C1B A;  5AV5 D;  2PYO A;  4XUJ A;  1TZY A;  3B6G A;  1P3B C;  1F66 B;  5GXQ D;  5E5A A;  3LEL B;  3AZL B;  1P3P C;  3A6N B;  3MGS C;  1P34 B;  4H9R A;  1M18 A;  4WU8 C;  5CPI A;  1P3L C;  1KX3 D;  5B1M A;  1P3G D;  5B1L A;  3AZI D;  4J8X D;  5DNM D;  3REJ D;  3X1V A;  3WTP C;  3AZE D;  5AV8 B;  5BNX B;  3AZK D;  4WU8 B;  5B0Y A;  1TAF A;  5B24 D;  3REI D;  4J8U C;  4Z66 D;  3NQJ B;  3WKJ C;  2YFV A;  1JFI A;  3UTB C;  2ARO B;  5AV6 B;  3AZJ B;  4H9N B;  5DNN A;  4LD9 C;  4X23 C;  2F8N B;  4YS3 A;  4KUD B;  1BFM A;  1S32 D;  3MGP B;  5BNV A;  2NZD C;  3REH D;  3WTP E;  3UTB B;  5CPK C;  1ZLA D;  1BH9 A;  2BYK B;  5CP6 B;  1P3B A;  3LZ1 D;  3LZ0 D;  3AFA D;  2F8N G;  5GT0 B;  3REK D;  1HQ3 C;  5CPJ A;  4ZUX D;  2CV5 C;  4J8V C;  3W97 B;  5B40 D;  1P3I A;  4YM6 B;  3AN2 D;  3LJA B;  3AZH A;  3AV1 D;  4WU9 B;  3C1B D;  2PYO D;  4XUJ D;  1TZY D;  1M1A C;  3KXB C;  3AZM A;  1KX5 B;  5E5A D;  1WWS A;  3WTP A;  1M18 D;  5B33 B;  3KUY B;  5CPI D;  1P3K C;  4J8V B;  3AZN C;  5JRG B;  5B1M D;  1KX4 C;  4KHA B;  3AZG B;  5B32 A;  3WKJ A;  5B1L D;  2NQB C;  5GXQ B;  3X1V D;  1P3O C;  4HGA B;  1P3F D;  3MGR C;  3W96 B;  3TU4 C;  1P3M A;  4LD9 A;  3UT9 B;  4X23 A;  1KX3 B;  3WA9 B;  5B0Y D;  5AV9 C;  1P3K B;  3AZI B;  5DNM B;  5B2I C;  2NZD A;  5GT3 C;  4EO5 C;  5CPK A;  5DNN D;  3W98 C;  4YS3 D;  2FJ7 C;  1M19 C;  3W99 C;  2CV5 A;  5AVC B;  3MVD C;  5GT3 B;  3REL C;  4EO5 B;  3X1T C;  2YFW A;  4UUZ A;  1S32 B;  3KXB A;  1P3B D;  1BH8 B;  4Z2M H;  5B0Z C;  3B6F A;  4KGC A;  1EQZ D;  3REH B;  5CPJ D;  1M19 B;  2HIO C;  4DRB A;  1ZLA B;  3AYW C;  3AZN A;  4J8W C;  1P3I D;  3B0D B;  4E45 A;  1KX4 A;  3AZH D;  5G49 B;  3REL B;  4G91 C;  1H3O B;  3KWQ C;  2NQB A;  3MNN A;  3LZ0 B;  1P3O A;  3AZM D;  3AV2 B;  3MGQ B;  3WTP D;  1F66 C;  3LEL C;  4WNN A;  3AN2 B;  3AZL C;  3A6N C;  3UTA C;  1P34 C;  3AV1 B;  5AV9 A;  5B32 D;  3WKJ D;  1P3A D;  5B31 A;  5B2I A;  1A7W A;  2BYM A;  2HUE B;  1AOI D;  3WAA B;  1P3M D;  1M18 B;  4LD9 D;  4X23 D;  3B0C T;  3X1U A;  3UTA B;  3W99 A;  1Q9C A;  5AV8 C;  1P3F B;  2NZD D;  4H9Q B;  1KU5 A;  3NQU B;  5FUG B;  3X1S A;  1U35 D;  3MVD A;  5CPK D;  2ARO C;  4H9O B;  5C3I B;  5AV6 C;  3AZJ C;  4CSR A;  4JJN A;  3B0C W;  5B0Z A;  1N1J B;  4AWL B;  4KUD C;  5GSU D;  3AZF B;  3MGP C;  4J8W A;  1HTA A;  3KWQ A;  3KXB D;  4QLC D;  3B6F D;  4KGC D;  5BO0 A;  5CP6 C;  4CAY B;  1F66 A;  5AVB D;  4H9S C;  3AZL A;  3A6N A;  3AZN D;  5GT0 C;  3W97 C;  1KX4 D;  5B2J C;  3C1C B;  2NQB D;  3MNN D;  3O62 D;  4YM6 C;  1P3O D;  3LJA C;  1EQZ B;  4ZBJ C;  5BT1 D;  4WU9 C;  1KX5 C;  1P3I B;  3AZH B;  5AY8 C;  1P3P A;  5AV9 D;  3MGS A;  5B33 C;  3KUY C;  5AV8 A;  4XZQ D;  3AZM B;  5B31 D;  5B2J B;  5BNX A;  5JRG C;  5B2I D;  4WU8 A;  4Z5T B;  1ID3 B;  3AZG C;  1P3L A;  4NE5 A;  5GXQ C;  4ZBJ B;  4HGA C;  2ARO A;  3W96 C;  3B6G D;  5AV6 A;  3AZJ A;  3X1U D;  4H9N A;  5B32 B;  1P3A B;  3UT9 C;  1KX3 C;  3W99 D;  5AY8 B;  5F99 B;  2F8N A;  4KUD A;  3WA9 C;  1AOI B;  3R45 A;  3AZI C;  4R8P B;  5DNM C;  3X1S D;  3MGP A;  3MVD D;  3REJ C;  1P3M B;  4J8U A;  5AV5 B;  4H9P B;  3UTB A;  4JJN D;  2BYK A;  5B32 G;  5B24 C;  4Z66 C;  1U35 B;  1P3G B;  4J8W D;  5GT0 A;  3W97 A;  4J8X B;  2IO5 B;  3V9R B;  5AVC C;  3REJ B;  3KWQ D;  4YM6 A;  3LJA A;  3AZE B;  4WU9 A;  5GSU B;  1S32 C;  1KX5 A;  3AZK B;  3REI B;  5B24 B;  4Z66 B;  3AZL D;  3A6N D;  3REH C;  2JSS A;  1HQ3 A;  5JA4 B;  5B33 A;  3KUY A;  4J8V A;  1ZLA C;  4QLC B;  3B0D C;  3VH6 A;  3AZG A;  5AVB B;  3LZ0 C;  3AFA C;  3W96 A;  1M1A A;  3AV2 C;  2RVQ C;  3MGQ C;  1B67 A;  1P3P D;  5B40 C;  3UT9 A;  3O62 B;  3MNN B;  3MGS D;  1F1E A;  3AN2 C;  3WA9 A;  3AV1 C;  4WU8 D;  1P3K A;  1P3L D;  3AZI A;  2PYO C;  4XUJ C;  4Z2M G;  4DRA A;  2ARO D;  5KDM B;  3LZ1 B;  2HUE C;  3WAA C;  5AV6 D;  3AFA B;  3AZJ D;  3MGR A;  3REK B;  1M18 C;  3TU4 A;  4ZUX B;  4XZQ B;  3VH5 A;  5B31 B;  4WZS B;  5B40 B;  4KUD D;  3X1V C;  3MGP D;  1P3F C;  3C1B B;  4J8U D;  2PYO B;  4XUJ B;  1TZY B;  5AVC A;  3B6G B;  3VH6 T;  5E5A B;  5GT3 A;  3UTB D;  4H9R B;  5C3I C;  5CPI B;  1S32 A;  3W98 A;  5B31 G;  3X1S B;  5B1M B;  1BH8 A;  2FJ7 A;  4AWL C;  5B1L B;  3REH A;  1M19 A;  3W97 D;  3X1V B;  3AZF C;  4JJN B;  2F8N K;  4YM6 D;  5G49 A;  3REL A;  1H3O A;  3LZ0 A;  1KX5 D;  3X1T A;  1TAF B;  5B0Y B;  3AV2 A;  3MGQ A;  3VH5 T;  2YFV B;  1JFI B;  1HQ3 D;  5B33 D;  3KUY D;  2HIO A;  4J8V D;  2CV5 D;  4G92 B;  3AV1 A;  3AYW A;  3AZG D;  5DNN B;  3C1C C;  1ULY A;  4YS3 B;  5BS7 C;  1EQZ C;  3W96 D;  5CPJ C;  1M1A D;  3WAA A;  5BNV B;  3UT9 D;  1P3I C;  3VH5 W;  3AZH C;  3LEL A;  3WA9 D;  1P3K D;  3UTA A;  1BH9 B;  1P34 A;  3AZM C;  1P3F A;  4H9Q A;  4Z5T C;  1ID3 C;  1P3B B;  3NQU A;  5FUG A;  1P3P B;  3MGR D;  3MGS B;  5CPJ B;  3TU4 D;  4H9O A;  1P3L B;  5B32 C;  1P3A C;  1N1J A;  5F99 C;  5CHL B;  5AVC D;  1AOI C;  3AZF A;  1P3M C;  4R8P C;  5GT3 D;  4NE3 A;  5AV5 C;  3WTP B;  3NQJ A;  1WWI A;  3R45 B;  3W98 D;  4J8U B;  1R4V A;  2FJ7 D;  3WKJ B;  1M19 D;  4CAY A;  2LY8 A;  1U35 C;  2F8N H;  1P3G C;  4E44 A;  4J8X C;  2IO5 C;  2CWE A;  4LD9 B;  3REL D;  4X23 B;  3C1C A;  3AZE C;  3X1T D;  5BS7 A;  4M6B A;  3AV2 D;  2RVQ D; 
#chains in the Genus database with same CATH topology
 5GSU C;  3MGQ D;  5B0Z D;  2NZD B;  3AZK C;  3REI C;  5CP6 A;  2HIO D;  5CPK B;  4H9S A;  3AYW D;  5B2J A;  4QLC C;  3B6F C;  4KGC C;  4Z5T A;  1ID3 A;  4NFT A;  3WAA D;  5AVB C;  1HQ3 B;  2CV5 B;  1F66 D;  3LEL D;  2Y2Q A;  1P3A A;  3MNN C;  3O62 C;  3EPJ A;  3UTA D;  2BG1 A;  5AY8 A;  5F99 A;  1P34 D;  2YFW B;  4UUZ B;  5BT1 C;  3B0B A;  1M1A B;  1AOI A;  3KXB B;  4R8P A;  5JRG A;  3B6F B;  4KGC B;  4KHA A;  4WV4 B;  5AV5 A;  4H9P A;  5GXQ A;  3LZ1 C;  3AZN B;  3REK C;  1EQZ A;  1KX4 B;  4ZUX C;  4XZQ C;  5B31 C;  3H0M C;  2NQB B;  1KX3 A;  1U35 A;  1P3O B;  5AV8 D;  3AZF D;  3MGR B;  1P3G A;  3TU4 B;  3C1B C;  4J8X A;  3V9R A;  5DNM A;  1TZY C;  3REJ A;  3B6G C;  3X1U C;  5E5A C;  4WNN B;  3AZE A;  5AV9 B;  5GSU A;  5CPI C;  5B2I B;  3AZK A;  5B1M C;  3X1S C;  3REI A;  2F8N D;  5B24 A;  4Z66 A;  2BYM B;  5B1L C;  5JA4 A;  3W98 B;  4JJN C;  3C1C D;  2Y2J A;  4QLC A;  3FDD A;  3X1U B;  2FJ7 B;  4NE6 A;  1B6W A;  3W99 B;  5AVB A;  5B0Y C;  5CP6 D;  3MVD B;  2G5I C;  3F6T A;  3O62 A;  5GT0 D;  3X1T B;  5B2J D;  4CSR B;  4G92 C;  4Z5T D;  1W2E A;  1ID3 D;  1ZLA A;  5DNN C;  5B0Z B;  3VH6 W;  3LJA D;  4YS3 C;  4WU9 D;  2HIO B;  5KDM A;  3LZ1 A;  3AFA A;  1PZR A;  3AYW B;  3A1K A;  4J8W B;  3REK A;  3KSY A;  4ZUX A;  4XZQ A;  5AY8 D;  4G91 B;  5F99 D;  5B40 A;  3KWQ B;  3AN2 A;  4R8P D;  5JRG D;  5BO0 B;  2L5A A;  3C1B A;  5AV5 D;  2PYO A;  4XUJ A;  1TZY A;  3B6G A;  1P3B C;  1F66 B;  5GXQ D;  5E5A A;  3LEL B;  3AZL B;  1P3P C;  3A6N B;  3MGS C;  1P34 B;  2XD1 A;  4H9R A;  1M18 A;  4WU8 C;  5CPI A;  1P3L C;  1KX3 D;  5B1M A;  1P3G D;  5B1L A;  3AZI D;  4J8X D;  5DNM D;  3REJ D;  3X1V A;  3WTP C;  3AZE D;  5AV8 B;  5BNX B;  2RIQ A;  3AZK D;  1TAF A;  5B0Y A;  4WU8 B;  5B24 D;  3REI D;  4J8U C;  2Y2N A;  4Z66 D;  3NQJ B;  3WKJ C;  2YFV A;  1JFI A;  3UTB C;  2ARO B;  5AV6 B;  3AZJ B;  3EPL A;  4H9N B;  5DNN A;  4LD9 C;  4X23 C;  2F8N B;  4YS3 A;  4KUD B;  2VQR A;  1BFM A;  2JE5 A;  1Z2C B;  1S32 D;  3MGP B;  2Y2M A;  5BNV A;  2NZD C;  3REH D;  3WTP E;  3UTB B;  5CPK C;  1ZLA D;  1BH9 A;  2BYK B;  5CP6 B;  1P3B A;  3LZ1 D;  3LZ0 D;  3AFA D;  2F8N G;  5GT0 B;  3REK D;  1HQ3 C;  5CPJ A;  4ZUX D;  2CV5 C;  4J8V C;  3W97 B;  5B40 D;  1P3I A;  3AL0 C;  4YM6 B;  3AN2 D;  3LJA B;  3AZH A;  3AV1 D;  4WU9 B;  3H0R C;  3C1B D;  2PYO D;  4XUJ D;  1TZY D;  1M1A C;  3KXB C;  2Y2I A;  3AZM A;  1KX5 B;  5E5A D;  1WWS A;  3WTP A;  1M18 D;  5B33 B;  3KUY B;  5CPI D;  1P3K C;  4J8V B;  3AZN C;  5JRG B;  5B1M D;  1KX4 C;  4KHA B;  3AZG B;  5B32 A;  3WKJ A;  5B1L D;  2NQB C;  5GXQ B;  3X1V D;  3P5J B;  1P3O C;  4HGA B;  1P3F D;  3MGR C;  3W96 B;  3TU4 C;  1P3M A;  4LD9 A;  3UT9 B;  4X23 A;  1KX3 B;  3WA9 B;  5B0Y D;  2XD5 A;  5AV9 C;  3AZI B;  1P3K B;  5DNM B;  5B2I C;  2NZD A;  5GT3 C;  4EO5 C;  5CPK A;  5DNN D;  3W98 C;  4YS3 D;  2FJ7 C;  1M19 C;  3W99 C;  2CV5 A;  2Y2L A;  5AVC B;  3MVD C;  5GT3 B;  3REL C;  4EO5 B;  3X1T C;  2YFW A;  4UUZ A;  2ZY2 A;  1S32 B;  3KXB A;  1P3B D;  1BH8 B;  4Z2M H;  5B0Z C;  3B6F A;  4KGC A;  1EQZ D;  3REH B;  5CPJ D;  1M19 B;  2HIO C;  4DRB A;  1ZLA B;  3IP4 C;  3AZN A;  4J8W C;  3AYW C;  3B0D B;  4E45 A;  1P3I D;  1KX4 A;  3AZH D;  5G49 B;  3REL B;  4G91 C;  1H3O B;  3KWQ C;  2NQB A;  3MNN A;  3LZ0 B;  3EPK A;  3AZM D;  1P3O A;  3AV2 B;  3MGQ B;  3WTP D;  2ZM5 A;  1F66 C;  3LEL C;  4WNN A;  3AN2 B;  3AZL C;  4WJ3 C;  3A6N C;  3UTA C;  1P34 C;  3AV1 B;  5AV9 A;  5B32 D;  3WKJ D;  1P3A D;  5B31 A;  5B2I A;  1A7W A;  2BYM A;  3A1I A;  2HUE B;  1AOI D;  3WAA B;  1P3M D;  1M18 B;  4LD9 D;  4X23 D;  3B0C T;  3X1U A;  3UTA B;  3W99 A;  1Q9C A;  5AV8 C;  1P3F B;  2NZD D;  4H9Q B;  1KU5 A;  3NQU B;  5FUG B;  3X1S A;  1U35 D;  3MVD A;  2F2A C;  5CPK D;  2ARO C;  4H9O B;  5C3I B;  5AV6 C;  3AZJ C;  4CSR A;  4JJN A;  3B0C W;  5B0Z A;  1N1J B;  4AWL B;  4KUD C;  2G5H C;  5GSU D;  3AZF B;  3MGP C;  4J8W A;  1HTA A;  2FFF B;  3KWQ A;  3KXB D;  4QLC D;  3B6F D;  4KGC D;  5BO0 A;  3EPH A;  5CP6 C;  4CAY B;  1F66 A;  5AVB D;  4DQY B;  4H9S C;  3AZL A;  3A6N A;  3AZN D;  5GT0 C;  2UWX A;  3W97 C;  1KX4 D;  5B2J C;  3C1C B;  2NQB D;  3MNN D;  3O62 D;  4YM6 C;  1P3O D;  3LJA C;  1EQZ B;  4ZBJ C;  5BT1 D;  4WU9 C;  1KX5 C;  3KFU G;  1P3I B;  3AZH B;  5AY8 C;  1P3P A;  5AV9 D;  3MGS A;  5B33 C;  3KUY C;  5AV8 A;  4XZQ D;  3AZM B;  5B31 D;  5B2J B;  5BNX A;  5JRG C;  5B2I D;  4WU8 A;  4Z5T B;  1ID3 B;  3AZG C;  1P3L A;  4NE5 A;  5GXQ C;  4ZBJ B;  4HGA C;  2ARO A;  3W96 C;  3B6G D;  5AV6 A;  3AZJ A;  3X1U D;  4H9N A;  5B32 B;  1P3A B;  3UT9 C;  1KX3 C;  3W99 D;  5AY8 B;  5F99 B;  2F8N A;  4KUD A;  3WA9 C;  1AOI B;  3R45 A;  3AZI C;  5DNM C;  4R8P B;  3X1S D;  3MGP A;  3MVD D;  3REJ C;  1P3M B;  2ZY3 A;  4J8U A;  5AV5 B;  4H9P B;  3UTB A;  2Y2G A;  4JJN D;  2BYK A;  5B32 G;  5B24 C;  4Z66 C;  1U35 B;  1T3U A;  1P3G B;  4J8W D;  5GT0 A;  3W97 A;  4J8X B;  2IO5 B;  3V9R B;  5AVC C;  3REJ B;  2Y2P A;  3KWQ D;  2JCH A;  4YM6 A;  3LJA A;  3AZE B;  4WU9 A;  2Y2O A;  5GSU B;  1S32 C;  1KX5 A;  3AZK B;  3REI B;  5B24 B;  4Z66 B;  3AZL D;  3A6N D;  3REH C;  2JSS A;  1HQ3 A;  5JA4 B;  5B33 A;  3KUY A;  4J8V A;  1ZLA C;  4QLC B;  3B0D C;  3VH6 A;  4UPK A;  3AZG A;  5AVB B;  3LZ0 C;  3AFA C;  3W96 A;  1M1A A;  2Y2H A;  3AV2 C;  2RVQ C;  3MGQ C;  1B67 A;  1P3P D;  5B40 C;  3UT9 A;  3O62 B;  3MNN B;  3MGS D;  1F1E A;  3AN2 C;  3WA9 A;  3AV1 C;  4WU8 D;  1P3K A;  1P3L D;  3AZI A;  2ZY5 A;  2PYO C;  4XUJ C;  4Z2M G;  4DRA A;  2ARO D;  5KDM B;  3LZ1 B;  2HUE C;  3WAA C;  5AV6 D;  3AFA B;  3AZJ D;  3MGR A;  3REK B;  1M18 C;  3TU4 A;  4ZUX B;  4XZQ B;  3VH5 A;  5B31 B;  4WZS B;  3H0L C;  5B40 B;  4KUD D;  3X1V C;  3MGP D;  1P3F C;  3C1B B;  4J8U D;  2PYO B;  4XUJ B;  1TZY B;  5AVC A;  3B6G B;  3VH6 T;  5E5A B;  5GT3 A;  3UTB D;  4H9R B;  5C3I C;  2DF4 C;  5CPI B;  1S32 A;  3W98 A;  5B31 G;  3X1S B;  5B1M B;  1BH8 A;  2FJ7 A;  4AWL C;  5B1L B;  3REH A;  1M19 A;  3W97 D;  3X1V B;  3AZF C;  4JJN B;  2F8N K;  4YM6 D;  5G49 A;  3REL A;  1H3O A;  3LZ0 A;  1KX5 D;  3X1T A;  1TAF B;  5B0Y B;  2ZY4 A;  3AV2 A;  3MGQ A;  3VH5 T;  2YFV B;  1JFI B;  1HQ3 D;  5B33 D;  3KUY D;  2HIO A;  4J8V D;  2CV5 D;  4G92 B;  3AV1 A;  3AYW A;  3AZG D;  5DNN B;  3C1C C;  1ULY A;  4YS3 B;  5BS7 C;  1EQZ C;  3W96 D;  5CPJ C;  1M1A D;  3WAA A;  5BNV B;  3UT9 D;  1P3I C;  3VH5 W;  3AZH C;  3LEL A;  3WA9 D;  1P3K D;  3UTA A;  1BH9 B;  1P34 A;  3AZM C;  1P3F A;  3EG5 B;  4H9Q A;  4Z5T C;  1ID3 C;  1P3B B;  3NQU A;  5FUG A;  1P3P B;  3MGR D;  3MGS B;  5CPJ B;  3TU4 D;  4H9O A;  1P3L B;  5B32 C;  1P3A C;  1N1J A;  5F99 C;  5CHL B;  2W8S A;  5AVC D;  1AOI C;  3AZF A;  1P3M C;  4R8P C;  5GT3 D;  4NE3 A;  5AV5 C;  2DQN C;  3WTP B;  3NQJ A;  1WWI A;  3R45 B;  3W98 D;  2Y2K A;  2J8P A;  4J8U B;  1R4V A;  2FJ7 D;  3WKJ B;  1M19 D;  4CAY A;  2LY8 A;  1U35 C;  2F8N H;  1P3G C;  4E44 A;  4J8X C;  2IO5 C;  2CWE A;  4LD9 B;  3REL D;  4X23 B;  3C1C A;  3AZE C;  3X1T D;  5BS7 A;  4M6B A;  3AV2 D;  2RVQ D; 
#chains in the Genus database with same CATH homology
 5GSU C;  3MGQ D;  5B0Z D;  2NZD B;  3AZK C;  3REI C;  5CP6 A;  2HIO D;  5CPK B;  4H9S A;  3AYW D;  5B2J A;  4QLC C;  3B6F C;  4KGC C;  4Z5T A;  1ID3 A;  4NFT A;  3WAA D;  5AVB C;  1HQ3 B;  2CV5 B;  1F66 D;  3LEL D;  2Y2Q A;  1P3A A;  3MNN C;  3O62 C;  3EPJ A;  3UTA D;  2BG1 A;  5AY8 A;  5F99 A;  1P34 D;  2YFW B;  4UUZ B;  5BT1 C;  3B0B A;  1M1A B;  1AOI A;  3KXB B;  4R8P A;  5JRG A;  3B6F B;  4KGC B;  4KHA A;  4WV4 B;  5AV5 A;  4H9P A;  5GXQ A;  3LZ1 C;  3AZN B;  3REK C;  1EQZ A;  1KX4 B;  4ZUX C;  4XZQ C;  5B31 C;  3H0M C;  2NQB B;  1KX3 A;  1U35 A;  1P3O B;  5AV8 D;  3AZF D;  3MGR B;  1P3G A;  3TU4 B;  3C1B C;  4J8X A;  3V9R A;  5DNM A;  1TZY C;  3REJ A;  3B6G C;  3X1U C;  5E5A C;  4WNN B;  3AZE A;  5AV9 B;  5GSU A;  5CPI C;  5B2I B;  3AZK A;  5B1M C;  3X1S C;  3REI A;  2F8N D;  5B24 A;  4Z66 A;  2BYM B;  5B1L C;  5JA4 A;  3W98 B;  4JJN C;  3C1C D;  2Y2J A;  4QLC A;  3FDD A;  3X1U B;  2FJ7 B;  4NE6 A;  1B6W A;  3W99 B;  5AVB A;  5B0Y C;  5CP6 D;  3MVD B;  2G5I C;  3F6T A;  3O62 A;  5GT0 D;  3X1T B;  5B2J D;  4CSR B;  4G92 C;  4Z5T D;  1W2E A;  1ID3 D;  1ZLA A;  5DNN C;  5B0Z B;  3VH6 W;  3LJA D;  4YS3 C;  4WU9 D;  2HIO B;  5KDM A;  3LZ1 A;  3AFA A;  1PZR A;  3AYW B;  3A1K A;  4J8W B;  3REK A;  3KSY A;  4ZUX A;  4XZQ A;  5AY8 D;  4G91 B;  5F99 D;  5B40 A;  3KWQ B;  3AN2 A;  4R8P D;  5JRG D;  5BO0 B;  2L5A A;  3C1B A;  5AV5 D;  2PYO A;  4XUJ A;  1TZY A;  3B6G A;  1P3B C;  1F66 B;  5GXQ D;  5E5A A;  3LEL B;  3AZL B;  1P3P C;  3A6N B;  3MGS C;  1P34 B;  2XD1 A;  4H9R A;  1M18 A;  4WU8 C;  5CPI A;  1P3L C;  1KX3 D;  5B1M A;  1P3G D;  5B1L A;  3AZI D;  4J8X D;  5DNM D;  3REJ D;  3X1V A;  3WTP C;  3AZE D;  5AV8 B;  5BNX B;  2RIQ A;  3AZK D;  1TAF A;  5B0Y A;  4WU8 B;  5B24 D;  3REI D;  4J8U C;  2Y2N A;  4Z66 D;  3NQJ B;  3WKJ C;  2YFV A;  1JFI A;  3UTB C;  2ARO B;  5AV6 B;  3AZJ B;  3EPL A;  4H9N B;  5DNN A;  4LD9 C;  4X23 C;  2F8N B;  4YS3 A;  4KUD B;  2VQR A;  1BFM A;  2JE5 A;  1Z2C B;  1S32 D;  3MGP B;  2Y2M A;  5BNV A;  2NZD C;  3REH D;  3WTP E;  3UTB B;  5CPK C;  1ZLA D;  1BH9 A;  2BYK B;  5CP6 B;  1P3B A;  3LZ1 D;  3LZ0 D;  3AFA D;  2F8N G;  5GT0 B;  3REK D;  1HQ3 C;  5CPJ A;  4ZUX D;  2CV5 C;  4J8V C;  3W97 B;  5B40 D;  1P3I A;  3AL0 C;  4YM6 B;  3AN2 D;  3LJA B;  3AZH A;  3AV1 D;  4WU9 B;  3H0R C;  3C1B D;  2PYO D;  4XUJ D;  1TZY D;  1M1A C;  3KXB C;  2Y2I A;  3AZM A;  1KX5 B;  5E5A D;  1WWS A;  3WTP A;  1M18 D;  5B33 B;  3KUY B;  5CPI D;  1P3K C;  4J8V B;  3AZN C;  5JRG B;  5B1M D;  1KX4 C;  4KHA B;  3AZG B;  5B32 A;  3WKJ A;  5B1L D;  2NQB C;  5GXQ B;  3X1V D;  3P5J B;  1P3O C;  4HGA B;  1P3F D;  3MGR C;  3W96 B;  3TU4 C;  1P3M A;  4LD9 A;  3UT9 B;  4X23 A;  1KX3 B;  3WA9 B;  5B0Y D;  2XD5 A;  5AV9 C;  3AZI B;  1P3K B;  5DNM B;  5B2I C;  2NZD A;  5GT3 C;  4EO5 C;  5CPK A;  5DNN D;  3W98 C;  4YS3 D;  2FJ7 C;  1M19 C;  3W99 C;  2CV5 A;  2Y2L A;  5AVC B;  3MVD C;  5GT3 B;  3REL C;  4EO5 B;  3X1T C;  2YFW A;  4UUZ A;  2ZY2 A;  1S32 B;  3KXB A;  1P3B D;  1BH8 B;  4Z2M H;  5B0Z C;  3B6F A;  4KGC A;  1EQZ D;  3REH B;  5CPJ D;  1M19 B;  2HIO C;  4DRB A;  1ZLA B;  3IP4 C;  3AZN A;  4J8W C;  3AYW C;  3B0D B;  4E45 A;  1P3I D;  1KX4 A;  3AZH D;  5G49 B;  3REL B;  4G91 C;  1H3O B;  3KWQ C;  2NQB A;  3MNN A;  3LZ0 B;  3EPK A;  3AZM D;  1P3O A;  3AV2 B;  3MGQ B;  3WTP D;  2ZM5 A;  1F66 C;  3LEL C;  4WNN A;  3AN2 B;  3AZL C;  4WJ3 C;  3A6N C;  3UTA C;  1P34 C;  3AV1 B;  5AV9 A;  5B32 D;  3WKJ D;  1P3A D;  5B31 A;  5B2I A;  1A7W A;  2BYM A;  3A1I A;  2HUE B;  1AOI D;  3WAA B;  1P3M D;  1M18 B;  4LD9 D;  4X23 D;  3B0C T;  3X1U A;  3UTA B;  3W99 A;  1Q9C A;  5AV8 C;  1P3F B;  2NZD D;  4H9Q B;  1KU5 A;  3NQU B;  5FUG B;  3X1S A;  1U35 D;  3MVD A;  2F2A C;  5CPK D;  2ARO C;  4H9O B;  5C3I B;  5AV6 C;  3AZJ C;  4CSR A;  4JJN A;  3B0C W;  5B0Z A;  1N1J B;  4AWL B;  4KUD C;  2G5H C;  5GSU D;  3AZF B;  3MGP C;  4J8W A;  1HTA A;  2FFF B;  3KWQ A;  3KXB D;  4QLC D;  3B6F D;  4KGC D;  5BO0 A;  3EPH A;  5CP6 C;  4CAY B;  1F66 A;  5AVB D;  4DQY B;  4H9S C;  3AZL A;  3A6N A;  3AZN D;  5GT0 C;  2UWX A;  3W97 C;  1KX4 D;  5B2J C;  3C1C B;  2NQB D;  3MNN D;  3O62 D;  4YM6 C;  1P3O D;  3LJA C;  1EQZ B;  4ZBJ C;  5BT1 D;  4WU9 C;  1KX5 C;  3KFU G;  1P3I B;  3AZH B;  5AY8 C;  1P3P A;  5AV9 D;  3MGS A;  5B33 C;  3KUY C;  5AV8 A;  4XZQ D;  3AZM B;  5B31 D;  5B2J B;  5BNX A;  5JRG C;  5B2I D;  4WU8 A;  4Z5T B;  1ID3 B;  3AZG C;  1P3L A;  4NE5 A;  5GXQ C;  4ZBJ B;  4HGA C;  2ARO A;  3W96 C;  3B6G D;  5AV6 A;  3AZJ A;  3X1U D;  4H9N A;  5B32 B;  1P3A B;  3UT9 C;  1KX3 C;  3W99 D;  5AY8 B;  5F99 B;  2F8N A;  4KUD A;  3WA9 C;  1AOI B;  3R45 A;  3AZI C;  5DNM C;  4R8P B;  3X1S D;  3MGP A;  3MVD D;  3REJ C;  1P3M B;  2ZY3 A;  4J8U A;  5AV5 B;  4H9P B;  3UTB A;  2Y2G A;  4JJN D;  2BYK A;  5B32 G;  5B24 C;  4Z66 C;  1U35 B;  1T3U A;  1P3G B;  4J8W D;  5GT0 A;  3W97 A;  4J8X B;  2IO5 B;  3V9R B;  5AVC C;  3REJ B;  2Y2P A;  3KWQ D;  2JCH A;  4YM6 A;  3LJA A;  3AZE B;  4WU9 A;  2Y2O A;  5GSU B;  1S32 C;  1KX5 A;  3AZK B;  3REI B;  5B24 B;  4Z66 B;  3AZL D;  3A6N D;  3REH C;  2JSS A;  1HQ3 A;  5JA4 B;  5B33 A;  3KUY A;  4J8V A;  1ZLA C;  4QLC B;  3B0D C;  3VH6 A;  4UPK A;  3AZG A;  5AVB B;  3LZ0 C;  3AFA C;  3W96 A;  1M1A A;  2Y2H A;  3AV2 C;  2RVQ C;  3MGQ C;  1B67 A;  1P3P D;  5B40 C;  3UT9 A;  3O62 B;  3MNN B;  3MGS D;  1F1E A;  3AN2 C;  3WA9 A;  3AV1 C;  4WU8 D;  1P3K A;  1P3L D;  3AZI A;  2ZY5 A;  2PYO C;  4XUJ C;  4Z2M G;  4DRA A;  2ARO D;  5KDM B;  3LZ1 B;  2HUE C;  3WAA C;  5AV6 D;  3AFA B;  3AZJ D;  3MGR A;  3REK B;  1M18 C;  3TU4 A;  4ZUX B;  4XZQ B;  3VH5 A;  5B31 B;  4WZS B;  3H0L C;  5B40 B;  4KUD D;  3X1V C;  3MGP D;  1P3F C;  3C1B B;  4J8U D;  2PYO B;  4XUJ B;  1TZY B;  5AVC A;  3B6G B;  3VH6 T;  5E5A B;  5GT3 A;  3UTB D;  4H9R B;  5C3I C;  2DF4 C;  5CPI B;  1S32 A;  3W98 A;  5B31 G;  3X1S B;  5B1M B;  1BH8 A;  2FJ7 A;  4AWL C;  5B1L B;  3REH A;  1M19 A;  3W97 D;  3X1V B;  3AZF C;  4JJN B;  2F8N K;  4YM6 D;  5G49 A;  3REL A;  1H3O A;  3LZ0 A;  1KX5 D;  3X1T A;  1TAF B;  5B0Y B;  2ZY4 A;  3AV2 A;  3MGQ A;  3VH5 T;  2YFV B;  1JFI B;  1HQ3 D;  5B33 D;  3KUY D;  2HIO A;  4J8V D;  2CV5 D;  4G92 B;  3AV1 A;  3AYW A;  3AZG D;  5DNN B;  3C1C C;  1ULY A;  4YS3 B;  5BS7 C;  1EQZ C;  3W96 D;  5CPJ C;  1M1A D;  3WAA A;  5BNV B;  3UT9 D;  1P3I C;  3VH5 W;  3AZH C;  3LEL A;  3WA9 D;  1P3K D;  3UTA A;  1BH9 B;  1P34 A;  3AZM C;  1P3F A;  3EG5 B;  4H9Q A;  4Z5T C;  1ID3 C;  1P3B B;  3NQU A;  5FUG A;  1P3P B;  3MGR D;  3MGS B;  5CPJ B;  3TU4 D;  4H9O A;  1P3L B;  5B32 C;  1P3A C;  1N1J A;  5F99 C;  5CHL B;  2W8S A;  5AVC D;  1AOI C;  3AZF A;  1P3M C;  4R8P C;  5GT3 D;  4NE3 A;  5AV5 C;  2DQN C;  3WTP B;  3NQJ A;  1WWI A;  3R45 B;  3W98 D;  2Y2K A;  2J8P A;  4J8U B;  1R4V A;  2FJ7 D;  3WKJ B;  1M19 D;  4CAY A;  2LY8 A;  1U35 C;  2F8N H;  1P3G C;  4E44 A;  4J8X C;  2IO5 C;  2CWE A;  4LD9 B;  3REL D;  4X23 B;  3C1C A;  3AZE C;  3X1T D;  5BS7 A;  4M6B A;  3AV2 D;  2RVQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...