4H9OB

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9oB00
4Z5TD 1P3AA 3UTAC 3MGSC 1M19D 1KX4A 1F66A 3KXBD 5B2IC 3AZIC 1P34A 2NZDD 3C1BC 3W99B 4ZUXC 3B6GD 4M6BA 4AWLC 4R8PD 3X1VA 5B0ZD 4KGCB 5AY8D 3RELB 5BO0A 4JJNA 5CPJA 3W97D 3TU4A 2HIOB 4J8WB 5B40A 5DNMB 1H3OB 3MGPA 5B1MD 4Z5TB 1M19B 3KXBB 1R4VA 3AZFD 5BT1D 3REHD 2NZDB 3KWQA 5B2JA 3B6GB 1F1EA 2CWEA 4WU9A 2CV5C 2FJ7C 4J8VA 1P3IC 4R8PB 1HQ3D 3AZLC 4J8XC 5KDMB 5AY8B 5B33A 1M1AC 3MGSD 5DNNC 1B6WA 1HTAA 5B2ID 3X1UA 1P3AC 1P3GC 1KX4C 1F66C 4KGCA 2HUEB 3LJAD 3C1BD 3W97B 5GXQB 3VH6W 3X1VC 3X1SC 5FUGA 3AZKB 4J8WA 3AFAA 4HGAC 1KX5D 1P3PA 3W96D 5F99B 1HQ3B 3B0CT 4JJNC 1TZYD 4YS3A 4WZSB 3MGRA 3TU4C 2F8NG 3WKJA 5B40C 3MGSB 3AYWA 5B2IB 5JRGA 3C1BB 3LJAB 4ZUXB 4H9QB 3VH6A 4XUJC 5B2JC 3NQJB 3KWQC 4AWLB 2CV5D 1P3ID 5BNXB 3REIA 4Z2MG 3A6NA 3AZGD 3AV1A 4WNNA 5B31A 1M1AD 1P3GD 5E5AC 5B33C 1P3AD 2YFWA 1KX4D 1KX5B 1F66D 1TAFA 5B24A 3X1UC 4H9OB 3W96B 1P34D 3AZKA 1ULYA 1TZYB 3X1VD 2F8NK 4Z66A 5AVCC 3AZJC 4J8UA 3MNNC 4H9PB 3UTAA 3AZEA 2CV5B 1P3IB 3AFAC 3AZIA 1P3PC 5AVBA 1ID3A 4JJND 5CPJD 1P3BA 4J8XB 3TU4D 3AZNA 5BNXA 5B40D 4YS3C 1M1AB 5DNNB 3MGPD 3MGRC 1P3GB 1P3AB 1KX4B 1F66B 3WKJC 3AYWC 2NQBA 1P34B 5JRGC 3UT9A 3KWQD 5B2JD 2L5AA 4WU9D 4J8VD 3WA9C 3X1VB 3REIC 3X1SB 3A6NC 3AV1C 3WTPA 5B33D 5B31C 4HGAB 4XZQC 3X1UD 4KGCD 1N1JA 5BO0B 5B24C 4JJNB 2FJ7A 3TU4B 2F8NA 5B40B 3AZLA 4Z66C 4H9RA 3KWQB 5B2JB 4J8WD 4J8UC 1M18A 3WAAA 5DNNA 3AFAD 4WU9B 3AZEC 1P3PD 4J8VB 2AROA 1ID3C 5AVBC 1P3BC 3REKC 3AZNC 5B33B 3WKJD 3AYWD 3X1UB 4LD9A 3X1SA 5JRGD 5BNVA 2NQBC 3UT9C 1KX3C 4ZBJC 4WV4B 2BYKA 3REID 1AOIA 3B6FA 3A6ND 3AV1D 5FUGB 5GXQD 5B1LA 5B31D 5GT0A 3WTPC 3AFAB 1P3PB 5B24D 1BH8A 4NFTA 3AZKD 3VH5T 4XUJA 4YS3B 1S32A 3MGRB 4KUDA 3WKJB 5F99D 3AYWB 4Z66D 5JRGB 4J8UD 5E5AA 1M18C 3UTAD 3AZED 3WAAC 3O62A 3AN2A 3AZID 1ID3D 5AVBD 3REIB 2AROC 4ZUXD 5GSUA 2RVQC 5BS7A 3A6NB 3AV1B 4WNNB 3AZND 5B31B 4XZQB 4NE6A 2YFWB 5AVCA 1TAFB 5B24B 3AZJA 2JSSA 1P3LA 2NQBD 4LD9C 3UT9D 4EO5C 4H9NA 3MNNA 4CSRA 5AV9A 1JFIA 1AOIC 5CPIA 2PYOC 4Z66B 3WTPE 3B6FC 5B0YA 4J8UB 1P3FA 3KUYC 5B1LC 4DRBA 5GT0C 2YFVA 3UTBC 3UTAB 3AZEB 1Q9CA 3AZIB 1ID3B 5AVBB 1P3BB 3REKB 1WWSA 1B67A 5CPKA 2FJ7D 3AZNB 2F8ND 3AZMC 1S32C 3WA9A 4KUDC 3AZLD 3B0BA 4KHAA 4J8XD 2NQBB 3UT9B 4XZQA 4ZBJB 4UUZB 3WAAD 5DNND 5AV6C 2AROD 5CP6A 3O62C 3AN2C 2RVQD 4QLCA 5GSUC 5BS7C 3WTPB 1P3OA 4LD9D 3X1SD 1N1JB 1P3LC 1EQZA 2FJ7B 2F8NB 5AV9C 1AOID 3REJA 3W99C 3AZLB 3B6FD 3REKA 5CPIC 5B1LD 4H9RB 5GT0D 5B0YC 1M18B 1P3FC 3WAAB 2AROB 4X23C 5G49A 5C3IC 4G92C 4XUJD 5B32G 5AV8A 4UUZA 3LELA 1KX3A 1S32D 5CPKC 4CAYA 4LD9B 3C1CA 5BNVB 2HIOC 4EO5B 5E5AD 2BYKB 3O62D 3AN2D 1AOIB 5CP6C 2PYOB 5GSUD 1ZLAA 3B6FB 3KUYB 5B1LB 4QLCC 5GT0B 3VH5A 3W98A 1P3MA 4R8PC 3VH6T 5B0ZC 5AVCD 3AZJD 1P3LD 1BH8B 1P3OC 3AV2A 4NE5A 5AV5A 4XUJB 3MNND 3LZ0A 4YM6A 3AZMB 5AV9D 1S32B 1EQZC 4KUDB 3MGQA 3B0CW 3W97C 5CPID 3REJC 5B0YD 4YS3D 1P3FD 3MGRD 3B0DC 5E5AB 5B1MC 5AV6B 3O62B 3AN2B 3AZFC 2F8NH 3REHC 5GSUB 5AV8C 5CPKD 3LELC 3WA9D 5JA4A 3X1TA 3MVDA 2PYOA 5AVCB 3AZJB 1P3LB 3KUYA 3C1CC 1P3KA 4H9NB 4XZQD 3MNNB 4CSRB 3UTBA 5AV9B 3R45B 5CP6D 3LJAC 1JFIB 5CPIB 4QLCD 1ZLAC 5B0YB 3NQUA 2BYMB 5GT3A 3AZMA 4DRAA 1P3FB 1BFMA 3W98C 2YFVB 1P3MC 1P3OD 4X23B 4G91C 5C3IB 5B31G 4G92B 5B32A 3AV2C 5AV5C 3LZ0C 5CPKB 5AV6A 1KX5C 1EQZD 4YM6C 2IO5C 3W96C 3WA9B 3REJD 3MGQC 3LZ1A 1U35A 1P3BD 3REKD 1BH9A 4KHAB 1TZYC 4E44A 4WU8A 3AZHA 5CP6B 5AV8D 1KX3D 4QLCB 3LELD 3R45A 5B0ZB 3W99A 1P3OB 3X1TC 3MVDC 3AZGC 3C1CD 1A7WA 2BYMA 3WTPD 1P3KC 1EQZB 4X23A 3RELA 3REJB 1P34C 1ZLAD 3B0DB 3W98D 1P3MD 5B1MB 5GT3C 3AZFB 3REHB 2HIOA 3AV2D 5G49B 5DNMA 1H3OA 5CHLB 5AV5D 5AV8B 5B32C 4Z5TA 3LZ0D 3LELB 1M19A 1M18D 1KX3B 4YM6D 3KXBA 4CAYB 3MGQD 2NZDA 5CPJC 3B6GA 1U35C 3LZ1C 3C1CB 4R8PA 4WU8C 4H9SA 3MGPC 5B0ZA 5AY8A 5KDMA 3AZHC 1ZLAB 4WU9C 4J8VC 3W98B 1P3MB 3W97A 3X1TD 3MVDD 2PYOD 1WWIA 4G91B 5GXQA 3AV2B 3KUYD 1P3KD 5AV5B 3UTBD 3LZ0B 5B1MA 4YM6B 2IO5B 4KGCC 3V9RB 3AZFA 3MGQB 3REHA 3VH5W 3RELC 5GT3D 3AZMD 4KUDD 5F99A 1HQ3A 4E45A 4NE3A 5B32D 4J8WC 5DNMC 3MGSA 5B2IA 4Z5TC 5AV6D 1M19C 3KXBC 3C1BA 3LJAA 4ZUXA 4H9QA 5JA4B 3X1TB 3LZ1D 3MVDB 3AZGB 1U35D 2NZDC 3NQJA 3B6GC 1KU5A 4WU8D 1P3KB 3UTBB 4H9SC 3AZHD 5AY8C 1KX5A 3NQUB 4H9OA 3W96A 5GT3B 3V9RA 2LY8A 2HUEC 3W99D 1TZYA 5GXQC 5B32B 4X23D 5CPJB 3RELD 5BT1C 3AZKC 1U35B 3LZ1B 4H9PA 1BH9B 2CV5A 1P3IA 4WU8B 3MGPB 3KSYA 5F99C 1HQ3C 4J8XA 3AZGA 2HIOD 3AZHB 1M1AA 5DNMD 1P3GA 4Z2MH
chains in the Genus database with same CATH superfamily
4Z5TD 1P3AA 3UTAC 3MGSC 1M19D 1KX4A 1F66A 3KXBD 5B2IC 3AZIC 1P34A 2NZDD 3C1BC 3W99B 4ZUXC 3B6GD 4M6BA 4AWLC 4R8PD 3X1VA 5B0ZD 4KGCB 2XD1A 5AY8D 3RELB 2FFFB 5BO0A 4JJNA 5CPJA 3W97D 3TU4A 2HIOB 4J8WB 5B40A 5DNMB 1H3OB 3MGPA 5B1MD 4Z5TB 1M19B 2ZM5A 3KXBB 1R4VA 3AZFD 5BT1D 3REHD 2NZDB 3KWQA 5B2JA 3B6GB 1F1EA 2CWEA 4WU9A 2CV5C 2FJ7C 4J8VA 1P3IC 2JCHA 4R8PB 1HQ3D 3AZLC 4J8XC 5KDMB 5AY8B 5B33A 1M1AC 3MGSD 5DNNC 1B6WA 1HTAA 5B2ID 3X1UA 1P3AC 1P3GC 1KX4C 1F66C 4KGCA 2HUEB 3LJAD 3C1BD 3W97B 5GXQB 3VH6W 3X1VC 3X1SC 5FUGA 3EPKA 3AZKB 4J8WA 3AFAA 4HGAC 1KX5D 1P3PA 3W96D 5F99B 1HQ3B 3B0CT 4JJNC 1TZYD 4YS3A 4WZSB 3MGRA 3TU4C 2F8NG 3WKJA 5B40C 3MGSB 3AYWA 5B2IB 5JRGA 3C1BB 3LJAB 4ZUXB 4H9QB 3VH6A 2VQRA 4XUJC 5B2JC 3NQJB 3KWQC 4AWLB 2CV5D 1P3ID 5BNXB 3REIA 1W2EA 4Z2MG 3A6NA 3AZGD 3AV1A 4WNNA 5B31A 1M1AD 1P3GD 5E5AC 5B33C 1P3AD 2YFWA 1KX4D 1KX5B 1F66D 1TAFA 5B24A 3X1UC 4H9OB 3W96B 1P34D 3AZKA 1ULYA 1TZYB 3X1VD 2F8NK 4Z66A 5AVCC 3AZJC 4J8UA 3MNNC 4H9PB 3UTAA 3AZEA 2CV5B 1P3IB 3AFAC 2Y2MA 3AZIA 5AVBA 1P3PC 4JJND 5CPJD 1P3BA 1ID3A 4J8XB 3TU4D 3AZNA 5BNXA 5B40D 4YS3C 1M1AB 5DNNB 3MGPD 3MGRC 1P3GB 1P3AB 1KX4B 1F66B 3WKJC 3AYWC 2NQBA 1P34B 5JRGC 3UT9A 3KWQD 5B2JD 2L5AA 4WU9D 4J8VD 2Y2JA 3KFUG 3WA9C 3X1VB 3REIC 3X1SB 3A6NC 3AV1C 2JE5A 3WTPA 5B33D 5B31C 4HGAB 4XZQC 3X1UD 4KGCD 1N1JA 5BO0B 5B24C 4JJNB 2FJ7A 3TU4B 2F8NA 5B40B 3AZLA 4Z66C 4H9RA 3KWQB 5B2JB 4J8WD 4J8UC 1M18A 3WAAA 5DNNA 3AFAD 4WU9B 2UWXA 3AZEC 4J8VB 1P3PD 2AROA 1ID3C 5AVBC 1P3BC 3REKC 2Y2OA 3AZNC 5B33B 3WKJD 3AYWD 3X1UB 4LD9A 3X1SA 5JRGD 5BNVA 2NQBC 3UT9C 1KX3C 4ZBJC 4WV4B 2BYKA 3REID 1AOIA 2DF4C 3B6FA 3A6ND 3AV1D 5FUGB 5GXQD 5B1LA 5B31D 5GT0A 3WTPC 3AFAB 1P3PB 5B24D 1BH8A 4NFTA 3AZKD 3VH5T 4XUJA 4YS3B 1S32A 3MGRB 4KUDA 3WKJB 5F99D 3AYWB 4Z66D 5JRGB 4J8UD 5E5AA 1M18C 3UTAD 3AZED 2G5HC 3WAAC 3EPHA 3O62A 3AN2A 3AZID 1ID3D 5AVBD 3REIB 2AROC 4ZUXD 5GSUA 3A1IA 2RVQC 5BS7A 3A6NB 3AV1B 4WNNB 3AZND 5B31B 3H0MC 4XZQB 4NE6A 2Y2IA 2YFWB 5AVCA 1TAFB 5B24B 3AZJA 2JSSA 1P3LA 2NQBD 4LD9C 3UT9D 4EO5C 4H9NA 3MNNA 4CSRA 5AV9A 1PZRA 1JFIA 1AOIC 5CPIA 2PYOC 4Z66B 3WTPE 3B6FC 5B0YA 4J8UB 1P3FA 3KUYC 5B1LC 4DRBA 5GT0C 2YFVA 3UTBC 3UTAB 3AZEB 1Q9CA 3AZIB 1ID3B 5AVBB 1P3BB 3REKB 2XD5A 1WWSA 1B67A 5CPKA 2FJ7D 3AZNB 2F8ND 3AZMC 1S32C 3WA9A 4KUDC 3AZLD 3B0BA 4KHAA 4J8XD 2NQBB 3UT9B 4XZQA 4ZBJB 4UUZB 3WAAD 5DNND 5AV6C 2AROD 5CP6A 2G5IC 3O62C 3AN2C 2RVQD 4QLCA 5GSUC 5BS7C 3WTPB 3EPLA 1P3OA 4LD9D 3X1SD 1N1JB 1P3LC 3H0LC 1EQZA 2FJ7B 2F8NB 2ZY2A 5AV9C 2W8SA 1AOID 3REJA 3W99C 3AZLB 3B6FD 3REKA 2DQNC 5CPIC 1T3UA 4H9RB 5B1LD 5GT0D 5B0YC 1M18B 1P3FC 3WAAB 3EG5B 2AROB 4X23C 5G49A 5C3IC 4G92C 4XUJD 5B32G 5AV8A 4UUZA 3LELA 1KX3A 1S32D 5CPKC 4CAYA 4LD9B 3C1CA 5BNVB 2HIOC 4EO5B 5E5AD 2BYKB 3O62D 3AN2D 1AOIB 5CP6C 2PYOB 5GSUD 1ZLAA 3B6FB 2ZY3A 3EPJA 3KUYB 5B1LB 4QLCC 5GT0B 3VH5A 3W98A 1P3MA 4R8PC 3VH6T 5B0ZC 5AVCD 3AZJD 2BG1A 1P3LD 1BH8B 1P3OC 3AV2A 3H0RC 4NE5A 5AV5A 4XUJB 3MNND 3LZ0A 4YM6A 3AZMB 5AV9D 1S32B 1EQZC 4KUDB 3MGQA 3B0CW 3W97C 5CPID 3REJC 5B0YD 4YS3D 1P3FD 3MGRD 3B0DC 5E5AB 5B1MC 5AV6B 3O62B 3AN2B 3AZFC 2F8NH 3REHC 5GSUB 3FDDA 5AV8C 5CPKD 3LELC 3WA9D 2Y2KA 5JA4A 3X1TA 3MVDA 2PYOA 3AL0C 5AVCB 3AZJB 1P3LB 3KUYA 3C1CC 1P3KA 4H9NB 4XZQD 3MNNB 3IP4C 4CSRB 3UTBA 5AV9B 3R45B 3A1KA 5CP6D 3LJAC 1JFIB 5CPIB 4QLCD 1ZLAC 5B0YB 3NQUA 2BYMB 5GT3A 3AZMA 4DRAA 1P3FB 1BFMA 3W98C 2YFVB 1P3MC 2Y2PA 1P3OD 4X23B 2ZY5A 4G91C 4WJ3C 5C3IB 5B31G 4G92B 5B32A 3AV2C 5AV5C 3LZ0C 5CPKB 5AV6A 1KX5C 1EQZD 4YM6C 2IO5C 3W96C 3WA9B 3REJD 3MGQC 3LZ1A 1U35A 1P3BD 3REKD 1BH9A 4KHAB 1TZYC 4E44A 2Y2NA 4WU8A 2F2AC 3AZHA 5CP6B 5AV8D 1KX3D 4QLCB 3LELD 3R45A 2J8PA 5B0ZB 3W99A 1P3OB 3X1TC 3MVDC 3AZGC 3C1CD 3F6TA 1A7WA 2BYMA 3WTPD 1P3KC 1EQZB 4X23A 3RELA 3REJB 1P34C 1ZLAD 3B0DB 3W98D 1P3MD 5B1MB 5GT3C 3AZFB 3REHB 2HIOA 3AV2D 5G49B 5DNMA 1H3OA 5CHLB 5AV5D 5AV8B 5B32C 4Z5TA 3LZ0D 3LELB 1M19A 1M18D 1KX3B 4YM6D 3KXBA 4CAYB 3MGQD 2NZDA 5CPJC 3B6GA 1U35C 3LZ1C 3C1CB 4R8PA 4WU8C 4H9SA 3MGPC 5B0ZA 5AY8A 4UPKA 5KDMA 3AZHC 1ZLAB 4WU9C 4J8VC 3W98B 1P3MB 3W97A 3X1TD 3MVDD 2PYOD 1WWIA 4G91B 5GXQA 3AV2B 3KUYD 1P3KD 5AV5B 3UTBD 3LZ0B 5B1MA 4YM6B 2IO5B 4KGCC 3V9RB 3AZFA 2ZY4A 3MGQB 3REHA 3VH5W 3RELC 5GT3D 3AZMD 4KUDD 5F99A 1HQ3A 4E45A 1Z2CB 4NE3A 5B32D 4J8WC 5DNMC 3MGSA 2Y2HA 5B2IA 4Z5TC 5AV6D 2Y2LA 1M19C 2Y2QA 3KXBC 3LJAA 4ZUXA 4H9QA 3C1BA 5JA4B 3X1TB 3LZ1D 3MVDB 3AZGB 1U35D 2NZDC 2Y2GA 3NQJA 3B6GC 1KU5A 4WU8D 4DQYB 3UTBB 1P3KB 4H9SC 3AZHD 5AY8C 1KX5A 3NQUB 4H9OA 3W96A 5GT3B 3V9RA 2LY8A 2HUEC 3W99D 1TZYA 5GXQC 5B32B 3P5JB 4X23D 5CPJB 3RELD 5BT1C 3AZKC 1U35B 3LZ1B 4H9PA 1BH9B 2CV5A 1P3IA 4WU8B 3MGPB 3KSYA 5F99C 1HQ3C 4J8XA 3AZGA 2RIQA 2HIOD 3AZHB 1M1AA 5DNMD 1P3GA 4Z2MH
chains in the Genus database with same CATH topology
4Z5TD 1P3AA 3UTAC 3MGSC 1M19D 1KX4A 1F66A 3KXBD 5B2IC 3AZIC 1P34A 2NZDD 3C1BC 3W99B 4ZUXC 3B6GD 4M6BA 4AWLC 4R8PD 3X1VA 5B0ZD 4KGCB 2XD1A 5AY8D 3RELB 2FFFB 5BO0A 4JJNA 5CPJA 3W97D 3TU4A 2HIOB 4J8WB 5B40A 5DNMB 1H3OB 3MGPA 5B1MD 4Z5TB 1M19B 2ZM5A 3KXBB 1R4VA 3AZFD 5BT1D 3REHD 2NZDB 3KWQA 5B2JA 3B6GB 1F1EA 2CWEA 4WU9A 2CV5C 2FJ7C 4J8VA 1P3IC 2JCHA 4R8PB 1HQ3D 3AZLC 4J8XC 5KDMB 5AY8B 5B33A 1M1AC 3MGSD 5DNNC 1B6WA 1HTAA 5B2ID 3X1UA 1P3AC 1P3GC 1KX4C 1F66C 4KGCA 2HUEB 3LJAD 3C1BD 3W97B 5GXQB 3VH6W 3X1VC 3X1SC 5FUGA 3EPKA 3AZKB 4J8WA 3AFAA 4HGAC 1KX5D 1P3PA 3W96D 5F99B 1HQ3B 3B0CT 4JJNC 1TZYD 4YS3A 4WZSB 3MGRA 3TU4C 2F8NG 3WKJA 5B40C 3MGSB 3AYWA 5B2IB 5JRGA 3C1BB 3LJAB 4ZUXB 4H9QB 3VH6A 2VQRA 4XUJC 5B2JC 3NQJB 3KWQC 4AWLB 2CV5D 1P3ID 5BNXB 3REIA 1W2EA 4Z2MG 3A6NA 3AZGD 3AV1A 4WNNA 5B31A 1M1AD 1P3GD 5E5AC 5B33C 1P3AD 2YFWA 1KX4D 1KX5B 1F66D 1TAFA 5B24A 3X1UC 4H9OB 3W96B 1P34D 3AZKA 1ULYA 1TZYB 3X1VD 2F8NK 4Z66A 5AVCC 3AZJC 4J8UA 3MNNC 4H9PB 3UTAA 3AZEA 2CV5B 1P3IB 3AFAC 2Y2MA 3AZIA 5AVBA 1P3PC 4JJND 5CPJD 1P3BA 1ID3A 4J8XB 3TU4D 3AZNA 5BNXA 5B40D 4YS3C 1M1AB 5DNNB 3MGPD 3MGRC 1P3GB 1P3AB 1KX4B 1F66B 3WKJC 3AYWC 2NQBA 1P34B 5JRGC 3UT9A 3KWQD 5B2JD 2L5AA 4WU9D 4J8VD 2Y2JA 3KFUG 3WA9C 3X1VB 3REIC 3X1SB 3A6NC 3AV1C 2JE5A 3WTPA 5B33D 5B31C 4HGAB 4XZQC 3X1UD 4KGCD 1N1JA 5BO0B 5B24C 4JJNB 2FJ7A 3TU4B 2F8NA 5B40B 3AZLA 4Z66C 4H9RA 3KWQB 5B2JB 4J8WD 4J8UC 1M18A 3WAAA 5DNNA 3AFAD 4WU9B 2UWXA 3AZEC 4J8VB 1P3PD 2AROA 1ID3C 5AVBC 1P3BC 3REKC 2Y2OA 3AZNC 5B33B 3WKJD 3AYWD 3X1UB 4LD9A 3X1SA 5JRGD 5BNVA 2NQBC 3UT9C 1KX3C 4ZBJC 4WV4B 2BYKA 3REID 1AOIA 2DF4C 3B6FA 3A6ND 3AV1D 5FUGB 5GXQD 5B1LA 5B31D 5GT0A 3WTPC 3AFAB 1P3PB 5B24D 1BH8A 4NFTA 3AZKD 3VH5T 4XUJA 4YS3B 1S32A 3MGRB 4KUDA 3WKJB 5F99D 3AYWB 4Z66D 5JRGB 4J8UD 5E5AA 1M18C 3UTAD 3AZED 2G5HC 3WAAC 3EPHA 3O62A 3AN2A 3AZID 1ID3D 5AVBD 3REIB 2AROC 4ZUXD 5GSUA 3A1IA 2RVQC 5BS7A 3A6NB 3AV1B 4WNNB 3AZND 5B31B 3H0MC 4XZQB 4NE6A 2Y2IA 2YFWB 5AVCA 1TAFB 5B24B 3AZJA 2JSSA 1P3LA 2NQBD 4LD9C 3UT9D 4EO5C 4H9NA 3MNNA 4CSRA 5AV9A 1PZRA 1JFIA 1AOIC 5CPIA 2PYOC 4Z66B 3WTPE 3B6FC 5B0YA 4J8UB 1P3FA 3KUYC 5B1LC 4DRBA 5GT0C 2YFVA 3UTBC 3UTAB 3AZEB 1Q9CA 3AZIB 1ID3B 5AVBB 1P3BB 3REKB 2XD5A 1WWSA 1B67A 5CPKA 2FJ7D 3AZNB 2F8ND 3AZMC 1S32C 3WA9A 4KUDC 3AZLD 3B0BA 4KHAA 4J8XD 2NQBB 3UT9B 4XZQA 4ZBJB 4UUZB 3WAAD 5DNND 5AV6C 2AROD 5CP6A 2G5IC 3O62C 3AN2C 2RVQD 4QLCA 5GSUC 5BS7C 3WTPB 3EPLA 1P3OA 4LD9D 3X1SD 1N1JB 1P3LC 3H0LC 1EQZA 2FJ7B 2F8NB 2ZY2A 5AV9C 2W8SA 1AOID 3REJA 3W99C 3AZLB 3B6FD 3REKA 2DQNC 5CPIC 1T3UA 4H9RB 5B1LD 5GT0D 5B0YC 1M18B 1P3FC 3WAAB 3EG5B 2AROB 4X23C 5G49A 5C3IC 4G92C 4XUJD 5B32G 5AV8A 4UUZA 3LELA 1KX3A 1S32D 5CPKC 4CAYA 4LD9B 3C1CA 5BNVB 2HIOC 4EO5B 5E5AD 2BYKB 3O62D 3AN2D 1AOIB 5CP6C 2PYOB 5GSUD 1ZLAA 3B6FB 2ZY3A 3EPJA 3KUYB 5B1LB 4QLCC 5GT0B 3VH5A 3W98A 1P3MA 4R8PC 3VH6T 5B0ZC 5AVCD 3AZJD 2BG1A 1P3LD 1BH8B 1P3OC 3AV2A 3H0RC 4NE5A 5AV5A 4XUJB 3MNND 3LZ0A 4YM6A 3AZMB 5AV9D 1S32B 1EQZC 4KUDB 3MGQA 3B0CW 3W97C 5CPID 3REJC 5B0YD 4YS3D 1P3FD 3MGRD 3B0DC 5E5AB 5B1MC 5AV6B 3O62B 3AN2B 3AZFC 2F8NH 3REHC 5GSUB 3FDDA 5AV8C 5CPKD 3LELC 3WA9D 2Y2KA 5JA4A 3X1TA 3MVDA 2PYOA 3AL0C 5AVCB 3AZJB 1P3LB 3KUYA 3C1CC 1P3KA 4H9NB 4XZQD 3MNNB 3IP4C 4CSRB 3UTBA 5AV9B 3R45B 3A1KA 5CP6D 3LJAC 1JFIB 5CPIB 4QLCD 1ZLAC 5B0YB 3NQUA 2BYMB 5GT3A 3AZMA 4DRAA 1P3FB 1BFMA 3W98C 2YFVB 1P3MC 2Y2PA 1P3OD 4X23B 2ZY5A 4G91C 4WJ3C 5C3IB 5B31G 4G92B 5B32A 3AV2C 5AV5C 3LZ0C 5CPKB 5AV6A 1KX5C 1EQZD 4YM6C 2IO5C 3W96C 3WA9B 3REJD 3MGQC 3LZ1A 1U35A 1P3BD 3REKD 1BH9A 4KHAB 1TZYC 4E44A 2Y2NA 4WU8A 2F2AC 3AZHA 5CP6B 5AV8D 1KX3D 4QLCB 3LELD 3R45A 2J8PA 5B0ZB 3W99A 1P3OB 3X1TC 3MVDC 3AZGC 3C1CD 3F6TA 1A7WA 2BYMA 3WTPD 1P3KC 1EQZB 4X23A 3RELA 3REJB 1P34C 1ZLAD 3B0DB 3W98D 1P3MD 5B1MB 5GT3C 3AZFB 3REHB 2HIOA 3AV2D 5G49B 5DNMA 1H3OA 5CHLB 5AV5D 5AV8B 5B32C 4Z5TA 3LZ0D 3LELB 1M19A 1M18D 1KX3B 4YM6D 3KXBA 4CAYB 3MGQD 2NZDA 5CPJC 3B6GA 1U35C 3LZ1C 3C1CB 4R8PA 4WU8C 4H9SA 3MGPC 5B0ZA 5AY8A 4UPKA 5KDMA 3AZHC 1ZLAB 4WU9C 4J8VC 3W98B 1P3MB 3W97A 3X1TD 3MVDD 2PYOD 1WWIA 4G91B 5GXQA 3AV2B 3KUYD 1P3KD 5AV5B 3UTBD 3LZ0B 5B1MA 4YM6B 2IO5B 4KGCC 3V9RB 3AZFA 2ZY4A 3MGQB 3REHA 3VH5W 3RELC 5GT3D 3AZMD 4KUDD 5F99A 1HQ3A 4E45A 1Z2CB 4NE3A 5B32D 4J8WC 5DNMC 3MGSA 2Y2HA 5B2IA 4Z5TC 5AV6D 2Y2LA 1M19C 2Y2QA 3KXBC 3LJAA 4ZUXA 4H9QA 3C1BA 5JA4B 3X1TB 3LZ1D 3MVDB 3AZGB 1U35D 2NZDC 2Y2GA 3NQJA 3B6GC 1KU5A 4WU8D 4DQYB 3UTBB 1P3KB 4H9SC 3AZHD 5AY8C 1KX5A 3NQUB 4H9OA 3W96A 5GT3B 3V9RA 2LY8A 2HUEC 3W99D 1TZYA 5GXQC 5B32B 3P5JB 4X23D 5CPJB 3RELD 5BT1C 3AZKC 1U35B 3LZ1B 4H9PA 1BH9B 2CV5A 1P3IA 4WU8B 3MGPB 3KSYA 5F99C 1HQ3C 4J8XA 3AZGA 2RIQA 2HIOD 3AZHB 1M1AA 5DNMD 1P3GA 4Z2MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T D;  1P3A A;  3UTA C;  3MGS C;  1M19 D;  1KX4 A;  1F66 A;  3KXB D;  5B2I C;  3AZI C;  1P34 A;  2NZD D;  3C1B C;  3W99 B;  4ZUX C;  3B6G D;  4M6B A;  4AWL C;  4R8P D;  3X1V A;  5B0Z D;  4KGC B;  5AY8 D;  3REL B;  5BO0 A;  4JJN A;  5CPJ A;  3W97 D;  3TU4 A;  2HIO B;  4J8W B;  5B40 A;  5DNM B;  1H3O B;  3MGP A;  5B1M D;  4Z5T B;  1M19 B;  3KXB B;  1R4V A;  3AZF D;  5BT1 D;  3REH D;  2NZD B;  3KWQ A;  5B2J A;  3B6G B;  1F1E A;  2CWE A;  4WU9 A;  2CV5 C;  2FJ7 C;  4J8V A;  1P3I C;  4R8P B;  1HQ3 D;  3AZL C;  4J8X C;  5KDM B;  5AY8 B;  5B33 A;  1M1A C;  3MGS D;  5DNN C;  1B6W A;  1HTA A;  5B2I D;  3X1U A;  1P3A C;  1P3G C;  1KX4 C;  1F66 C;  4KGC A;  2HUE B;  3LJA D;  3C1B D;  3W97 B;  5GXQ B;  3VH6 W;  3X1V C;  3X1S C;  5FUG A;  3AZK B;  4J8W A;  3AFA A;  4HGA C;  1KX5 D;  1P3P A;  3W96 D;  5F99 B;  1HQ3 B;  3B0C T;  4JJN C;  1TZY D;  4YS3 A;  4WZS B;  3MGR A;  3TU4 C;  2F8N G;  3WKJ A;  5B40 C;  3MGS B;  3AYW A;  5B2I B;  5JRG A;  3C1B B;  3LJA B;  4ZUX B;  4H9Q B;  3VH6 A;  4XUJ C;  5B2J C;  3NQJ B;  3KWQ C;  4AWL B;  2CV5 D;  1P3I D;  5BNX B;  3REI A;  4Z2M G;  3A6N A;  3AZG D;  3AV1 A;  4WNN A;  5B31 A;  1M1A D;  1P3G D;  5E5A C;  5B33 C;  1P3A D;  2YFW A;  1KX4 D;  1KX5 B;  1F66 D;  1TAF A;  5B24 A;  3X1U C;  4H9O B;  3W96 B;  1P34 D;  3AZK A;  1ULY A;  1TZY B;  3X1V D;  2F8N K;  4Z66 A;  5AVC C;  3AZJ C;  4J8U A;  3MNN C;  4H9P B;  3UTA A;  3AZE A;  2CV5 B;  1P3I B;  3AFA C;  3AZI A;  1P3P C;  5AVB A;  1ID3 A;  4JJN D;  5CPJ D;  1P3B A;  4J8X B;  3TU4 D;  3AZN A;  5BNX A;  5B40 D;  4YS3 C;  1M1A B;  5DNN B;  3MGP D;  3MGR C;  1P3G B;  1P3A B;  1KX4 B;  1F66 B;  3WKJ C;  3AYW C;  2NQB A;  1P34 B;  5JRG C;  3UT9 A;  3KWQ D;  5B2J D;  2L5A A;  4WU9 D;  4J8V D;  3WA9 C;  3X1V B;  3REI C;  3X1S B;  3A6N C;  3AV1 C;  3WTP A;  5B33 D;  5B31 C;  4HGA B;  4XZQ C;  3X1U D;  4KGC D;  1N1J A;  5BO0 B;  5B24 C;  4JJN B;  2FJ7 A;  3TU4 B;  2F8N A;  5B40 B;  3AZL A;  4Z66 C;  4H9R A;  3KWQ B;  5B2J B;  4J8W D;  4J8U C;  1M18 A;  3WAA A;  5DNN A;  3AFA D;  4WU9 B;  3AZE C;  1P3P D;  4J8V B;  2ARO A;  1ID3 C;  5AVB C;  1P3B C;  3REK C;  3AZN C;  5B33 B;  3WKJ D;  3AYW D;  3X1U B;  4LD9 A;  3X1S A;  5JRG D;  5BNV A;  2NQB C;  3UT9 C;  1KX3 C;  4ZBJ C;  4WV4 B;  2BYK A;  3REI D;  1AOI A;  3B6F A;  3A6N D;  3AV1 D;  5FUG B;  5GXQ D;  5B1L A;  5B31 D;  5GT0 A;  3WTP C;  3AFA B;  1P3P B;  5B24 D;  1BH8 A;  4NFT A;  3AZK D;  3VH5 T;  4XUJ A;  4YS3 B;  1S32 A;  3MGR B;  4KUD A;  3WKJ B;  5F99 D;  3AYW B;  4Z66 D;  5JRG B;  4J8U D;  5E5A A;  1M18 C;  3UTA D;  3AZE D;  3WAA C;  3O62 A;  3AN2 A;  3AZI D;  1ID3 D;  5AVB D;  3REI B;  2ARO C;  4ZUX D;  5GSU A;  2RVQ C;  5BS7 A;  3A6N B;  3AV1 B;  4WNN B;  3AZN D;  5B31 B;  4XZQ B;  4NE6 A;  2YFW B;  5AVC A;  1TAF B;  5B24 B;  3AZJ A;  2JSS A;  1P3L A;  2NQB D;  4LD9 C;  3UT9 D;  4EO5 C;  4H9N A;  3MNN A;  4CSR A;  5AV9 A;  1JFI A;  1AOI C;  5CPI A;  2PYO C;  4Z66 B;  3WTP E;  3B6F C;  5B0Y A;  4J8U B;  1P3F A;  3KUY C;  5B1L C;  4DRB A;  5GT0 C;  2YFV A;  3UTB C;  3UTA B;  3AZE B;  1Q9C A;  3AZI B;  1ID3 B;  5AVB B;  1P3B B;  3REK B;  1WWS A;  1B67 A;  5CPK A;  2FJ7 D;  3AZN B;  2F8N D;  3AZM C;  1S32 C;  3WA9 A;  4KUD C;  3AZL D;  3B0B A;  4KHA A;  4J8X D;  2NQB B;  3UT9 B;  4XZQ A;  4ZBJ B;  4UUZ B;  3WAA D;  5DNN D;  5AV6 C;  2ARO D;  5CP6 A;  3O62 C;  3AN2 C;  2RVQ D;  4QLC A;  5GSU C;  5BS7 C;  3WTP B;  1P3O A;  4LD9 D;  3X1S D;  1N1J B;  1P3L C;  1EQZ A;  2FJ7 B;  2F8N B;  5AV9 C;  1AOI D;  3REJ A;  3W99 C;  3AZL B;  3B6F D;  3REK A;  5CPI C;  5B1L D;  4H9R B;  5GT0 D;  5B0Y C;  1M18 B;  1P3F C;  3WAA B;  2ARO B;  4X23 C;  5G49 A;  5C3I C;  4G92 C;  4XUJ D;  5B32 G;  5AV8 A;  4UUZ A;  3LEL A;  1KX3 A;  1S32 D;  5CPK C;  4CAY A;  4LD9 B;  3C1C A;  5BNV B;  2HIO C;  4EO5 B;  5E5A D;  2BYK B;  3O62 D;  3AN2 D;  1AOI B;  5CP6 C;  2PYO B;  5GSU D;  1ZLA A;  3B6F B;  3KUY B;  5B1L B;  4QLC C;  5GT0 B;  3VH5 A;  3W98 A;  1P3M A;  4R8P C;  3VH6 T;  5B0Z C;  5AVC D;  3AZJ D;  1P3L D;  1BH8 B;  1P3O C;  3AV2 A;  4NE5 A;  5AV5 A;  4XUJ B;  3MNN D;  3LZ0 A;  4YM6 A;  3AZM B;  5AV9 D;  1S32 B;  1EQZ C;  4KUD B;  3MGQ A;  3B0C W;  3W97 C;  5CPI D;  3REJ C;  5B0Y D;  4YS3 D;  1P3F D;  3MGR D;  3B0D C;  5E5A B;  5B1M C;  5AV6 B;  3O62 B;  3AN2 B;  3AZF C;  2F8N H;  3REH C;  5GSU B;  5AV8 C;  5CPK D;  3LEL C;  3WA9 D;  5JA4 A;  3X1T A;  3MVD A;  2PYO A;  5AVC B;  3AZJ B;  1P3L B;  3KUY A;  3C1C C;  1P3K A;  4H9N B;  4XZQ D;  3MNN B;  4CSR B;  3UTB A;  5AV9 B;  3R45 B;  5CP6 D;  3LJA C;  1JFI B;  5CPI B;  4QLC D;  1ZLA C;  5B0Y B;  3NQU A;  2BYM B;  5GT3 A;  3AZM A;  4DRA A;  1P3F B;  1BFM A;  3W98 C;  2YFV B;  1P3M C;  1P3O D;  4X23 B;  4G91 C;  5C3I B;  5B31 G;  4G92 B;  5B32 A;  3AV2 C;  5AV5 C;  3LZ0 C;  5CPK B;  5AV6 A;  1KX5 C;  1EQZ D;  4YM6 C;  2IO5 C;  3W96 C;  3WA9 B;  3REJ D;  3MGQ C;  3LZ1 A;  1U35 A;  1P3B D;  3REK D;  1BH9 A;  4KHA B;  1TZY C;  4E44 A;  4WU8 A;  3AZH A;  5CP6 B;  5AV8 D;  1KX3 D;  4QLC B;  3LEL D;  3R45 A;  5B0Z B;  3W99 A;  1P3O B;  3X1T C;  3MVD C;  3AZG C;  3C1C D;  1A7W A;  2BYM A;  3WTP D;  1P3K C;  1EQZ B;  4X23 A;  3REL A;  3REJ B;  1P34 C;  1ZLA D;  3B0D B;  3W98 D;  1P3M D;  5B1M B;  5GT3 C;  3AZF B;  3REH B;  2HIO A;  3AV2 D;  5G49 B;  5DNM A;  1H3O A;  5CHL B;  5AV5 D;  5AV8 B;  5B32 C;  4Z5T A;  3LZ0 D;  3LEL B;  1M19 A;  1M18 D;  1KX3 B;  4YM6 D;  3KXB A;  4CAY B;  3MGQ D;  2NZD A;  5CPJ C;  3B6G A;  1U35 C;  3LZ1 C;  3C1C B;  4R8P A;  4WU8 C;  4H9S A;  3MGP C;  5B0Z A;  5AY8 A;  5KDM A;  3AZH C;  1ZLA B;  4WU9 C;  4J8V C;  3W98 B;  1P3M B;  3W97 A;  3X1T D;  3MVD D;  2PYO D;  1WWI A;  4G91 B;  5GXQ A;  3AV2 B;  3KUY D;  1P3K D;  5AV5 B;  3UTB D;  3LZ0 B;  5B1M A;  4YM6 B;  2IO5 B;  4KGC C;  3V9R B;  3AZF A;  3MGQ B;  3REH A;  3VH5 W;  3REL C;  5GT3 D;  3AZM D;  4KUD D;  5F99 A;  1HQ3 A;  4E45 A;  4NE3 A;  5B32 D;  4J8W C;  5DNM C;  3MGS A;  5B2I A;  4Z5T C;  5AV6 D;  1M19 C;  3KXB C;  3C1B A;  3LJA A;  4ZUX A;  4H9Q A;  5JA4 B;  3X1T B;  3LZ1 D;  3MVD B;  3AZG B;  1U35 D;  2NZD C;  3NQJ A;  3B6G C;  1KU5 A;  4WU8 D;  1P3K B;  3UTB B;  4H9S C;  3AZH D;  5AY8 C;  1KX5 A;  3NQU B;  4H9O A;  3W96 A;  5GT3 B;  3V9R A;  2LY8 A;  2HUE C;  3W99 D;  1TZY A;  5GXQ C;  5B32 B;  4X23 D;  5CPJ B;  3REL D;  5BT1 C;  3AZK C;  1U35 B;  3LZ1 B;  4H9P A;  1BH9 B;  2CV5 A;  1P3I A;  4WU8 B;  3MGP B;  3KSY A;  5F99 C;  1HQ3 C;  4J8X A;  3AZG A;  2HIO D;  3AZH B;  1M1A A;  5DNM D;  1P3G A;  4Z2M H; 
#chains in the Genus database with same CATH topology
 4Z5T D;  1P3A A;  3UTA C;  3MGS C;  1M19 D;  1KX4 A;  1F66 A;  3KXB D;  5B2I C;  3AZI C;  1P34 A;  2NZD D;  3C1B C;  3W99 B;  4ZUX C;  3B6G D;  4M6B A;  4AWL C;  4R8P D;  3X1V A;  5B0Z D;  4KGC B;  2XD1 A;  5AY8 D;  3REL B;  2FFF B;  5BO0 A;  4JJN A;  5CPJ A;  3W97 D;  3TU4 A;  2HIO B;  4J8W B;  5B40 A;  5DNM B;  1H3O B;  3MGP A;  5B1M D;  4Z5T B;  1M19 B;  2ZM5 A;  3KXB B;  1R4V A;  3AZF D;  5BT1 D;  3REH D;  2NZD B;  3KWQ A;  5B2J A;  3B6G B;  1F1E A;  2CWE A;  4WU9 A;  2CV5 C;  2FJ7 C;  4J8V A;  1P3I C;  2JCH A;  4R8P B;  1HQ3 D;  3AZL C;  4J8X C;  5KDM B;  5AY8 B;  5B33 A;  1M1A C;  3MGS D;  5DNN C;  1B6W A;  1HTA A;  5B2I D;  3X1U A;  1P3A C;  1P3G C;  1KX4 C;  1F66 C;  4KGC A;  2HUE B;  3LJA D;  3C1B D;  3W97 B;  5GXQ B;  3VH6 W;  3X1V C;  3X1S C;  5FUG A;  3EPK A;  3AZK B;  4J8W A;  3AFA A;  4HGA C;  1KX5 D;  1P3P A;  3W96 D;  5F99 B;  1HQ3 B;  3B0C T;  4JJN C;  1TZY D;  4YS3 A;  4WZS B;  3MGR A;  3TU4 C;  2F8N G;  3WKJ A;  5B40 C;  3MGS B;  3AYW A;  5B2I B;  5JRG A;  3C1B B;  3LJA B;  4ZUX B;  4H9Q B;  3VH6 A;  2VQR A;  4XUJ C;  5B2J C;  3NQJ B;  3KWQ C;  4AWL B;  2CV5 D;  1P3I D;  5BNX B;  3REI A;  1W2E A;  4Z2M G;  3A6N A;  3AZG D;  3AV1 A;  4WNN A;  5B31 A;  1M1A D;  1P3G D;  5E5A C;  5B33 C;  1P3A D;  2YFW A;  1KX4 D;  1KX5 B;  1F66 D;  1TAF A;  5B24 A;  3X1U C;  4H9O B;  3W96 B;  1P34 D;  3AZK A;  1ULY A;  1TZY B;  3X1V D;  2F8N K;  4Z66 A;  5AVC C;  3AZJ C;  4J8U A;  3MNN C;  4H9P B;  3UTA A;  3AZE A;  2CV5 B;  1P3I B;  3AFA C;  2Y2M A;  3AZI A;  5AVB A;  1P3P C;  4JJN D;  5CPJ D;  1P3B A;  1ID3 A;  4J8X B;  3TU4 D;  3AZN A;  5BNX A;  5B40 D;  4YS3 C;  1M1A B;  5DNN B;  3MGP D;  3MGR C;  1P3G B;  1P3A B;  1KX4 B;  1F66 B;  3WKJ C;  3AYW C;  2NQB A;  1P34 B;  5JRG C;  3UT9 A;  3KWQ D;  5B2J D;  2L5A A;  4WU9 D;  4J8V D;  2Y2J A;  3KFU G;  3WA9 C;  3X1V B;  3REI C;  3X1S B;  3A6N C;  3AV1 C;  2JE5 A;  3WTP A;  5B33 D;  5B31 C;  4HGA B;  4XZQ C;  3X1U D;  4KGC D;  1N1J A;  5BO0 B;  5B24 C;  4JJN B;  2FJ7 A;  3TU4 B;  2F8N A;  5B40 B;  3AZL A;  4Z66 C;  4H9R A;  3KWQ B;  5B2J B;  4J8W D;  4J8U C;  1M18 A;  3WAA A;  5DNN A;  3AFA D;  4WU9 B;  2UWX A;  3AZE C;  4J8V B;  1P3P D;  2ARO A;  1ID3 C;  5AVB C;  1P3B C;  3REK C;  2Y2O A;  3AZN C;  5B33 B;  3WKJ D;  3AYW D;  3X1U B;  4LD9 A;  3X1S A;  5JRG D;  5BNV A;  2NQB C;  3UT9 C;  1KX3 C;  4ZBJ C;  4WV4 B;  2BYK A;  3REI D;  1AOI A;  2DF4 C;  3B6F A;  3A6N D;  3AV1 D;  5FUG B;  5GXQ D;  5B1L A;  5B31 D;  5GT0 A;  3WTP C;  3AFA B;  1P3P B;  5B24 D;  1BH8 A;  4NFT A;  3AZK D;  3VH5 T;  4XUJ A;  4YS3 B;  1S32 A;  3MGR B;  4KUD A;  3WKJ B;  5F99 D;  3AYW B;  4Z66 D;  5JRG B;  4J8U D;  5E5A A;  1M18 C;  3UTA D;  3AZE D;  2G5H C;  3WAA C;  3EPH A;  3O62 A;  3AN2 A;  3AZI D;  1ID3 D;  5AVB D;  3REI B;  2ARO C;  4ZUX D;  5GSU A;  3A1I A;  2RVQ C;  5BS7 A;  3A6N B;  3AV1 B;  4WNN B;  3AZN D;  5B31 B;  3H0M C;  4XZQ B;  4NE6 A;  2Y2I A;  2YFW B;  5AVC A;  1TAF B;  5B24 B;  3AZJ A;  2JSS A;  1P3L A;  2NQB D;  4LD9 C;  3UT9 D;  4EO5 C;  4H9N A;  3MNN A;  4CSR A;  5AV9 A;  1PZR A;  1JFI A;  1AOI C;  5CPI A;  2PYO C;  4Z66 B;  3WTP E;  3B6F C;  5B0Y A;  4J8U B;  1P3F A;  3KUY C;  5B1L C;  4DRB A;  5GT0 C;  2YFV A;  3UTB C;  3UTA B;  3AZE B;  1Q9C A;  3AZI B;  1ID3 B;  5AVB B;  1P3B B;  3REK B;  2XD5 A;  1WWS A;  1B67 A;  5CPK A;  2FJ7 D;  3AZN B;  2F8N D;  3AZM C;  1S32 C;  3WA9 A;  4KUD C;  3AZL D;  3B0B A;  4KHA A;  4J8X D;  2NQB B;  3UT9 B;  4XZQ A;  4ZBJ B;  4UUZ B;  3WAA D;  5DNN D;  5AV6 C;  2ARO D;  5CP6 A;  2G5I C;  3O62 C;  3AN2 C;  2RVQ D;  4QLC A;  5GSU C;  5BS7 C;  3WTP B;  3EPL A;  1P3O A;  4LD9 D;  3X1S D;  1N1J B;  1P3L C;  3H0L C;  1EQZ A;  2FJ7 B;  2F8N B;  2ZY2 A;  5AV9 C;  2W8S A;  1AOI D;  3REJ A;  3W99 C;  3AZL B;  3B6F D;  3REK A;  2DQN C;  5CPI C;  1T3U A;  4H9R B;  5B1L D;  5GT0 D;  5B0Y C;  1M18 B;  1P3F C;  3WAA B;  3EG5 B;  2ARO B;  4X23 C;  5G49 A;  5C3I C;  4G92 C;  4XUJ D;  5B32 G;  5AV8 A;  4UUZ A;  3LEL A;  1KX3 A;  1S32 D;  5CPK C;  4CAY A;  4LD9 B;  3C1C A;  5BNV B;  2HIO C;  4EO5 B;  5E5A D;  2BYK B;  3O62 D;  3AN2 D;  1AOI B;  5CP6 C;  2PYO B;  5GSU D;  1ZLA A;  3B6F B;  2ZY3 A;  3EPJ A;  3KUY B;  5B1L B;  4QLC C;  5GT0 B;  3VH5 A;  3W98 A;  1P3M A;  4R8P C;  3VH6 T;  5B0Z C;  5AVC D;  3AZJ D;  2BG1 A;  1P3L D;  1BH8 B;  1P3O C;  3AV2 A;  3H0R C;  4NE5 A;  5AV5 A;  4XUJ B;  3MNN D;  3LZ0 A;  4YM6 A;  3AZM B;  5AV9 D;  1S32 B;  1EQZ C;  4KUD B;  3MGQ A;  3B0C W;  3W97 C;  5CPI D;  3REJ C;  5B0Y D;  4YS3 D;  1P3F D;  3MGR D;  3B0D C;  5E5A B;  5B1M C;  5AV6 B;  3O62 B;  3AN2 B;  3AZF C;  2F8N H;  3REH C;  5GSU B;  3FDD A;  5AV8 C;  5CPK D;  3LEL C;  3WA9 D;  2Y2K A;  5JA4 A;  3X1T A;  3MVD A;  2PYO A;  3AL0 C;  5AVC B;  3AZJ B;  1P3L B;  3KUY A;  3C1C C;  1P3K A;  4H9N B;  4XZQ D;  3MNN B;  3IP4 C;  4CSR B;  3UTB A;  5AV9 B;  3R45 B;  3A1K A;  5CP6 D;  3LJA C;  1JFI B;  5CPI B;  4QLC D;  1ZLA C;  5B0Y B;  3NQU A;  2BYM B;  5GT3 A;  3AZM A;  4DRA A;  1P3F B;  1BFM A;  3W98 C;  2YFV B;  1P3M C;  2Y2P A;  1P3O D;  4X23 B;  2ZY5 A;  4G91 C;  4WJ3 C;  5C3I B;  5B31 G;  4G92 B;  5B32 A;  3AV2 C;  5AV5 C;  3LZ0 C;  5CPK B;  5AV6 A;  1KX5 C;  1EQZ D;  4YM6 C;  2IO5 C;  3W96 C;  3WA9 B;  3REJ D;  3MGQ C;  3LZ1 A;  1U35 A;  1P3B D;  3REK D;  1BH9 A;  4KHA B;  1TZY C;  4E44 A;  2Y2N A;  4WU8 A;  2F2A C;  3AZH A;  5CP6 B;  5AV8 D;  1KX3 D;  4QLC B;  3LEL D;  3R45 A;  2J8P A;  5B0Z B;  3W99 A;  1P3O B;  3X1T C;  3MVD C;  3AZG C;  3C1C D;  3F6T A;  1A7W A;  2BYM A;  3WTP D;  1P3K C;  1EQZ B;  4X23 A;  3REL A;  3REJ B;  1P34 C;  1ZLA D;  3B0D B;  3W98 D;  1P3M D;  5B1M B;  5GT3 C;  3AZF B;  3REH B;  2HIO A;  3AV2 D;  5G49 B;  5DNM A;  1H3O A;  5CHL B;  5AV5 D;  5AV8 B;  5B32 C;  4Z5T A;  3LZ0 D;  3LEL B;  1M19 A;  1M18 D;  1KX3 B;  4YM6 D;  3KXB A;  4CAY B;  3MGQ D;  2NZD A;  5CPJ C;  3B6G A;  1U35 C;  3LZ1 C;  3C1C B;  4R8P A;  4WU8 C;  4H9S A;  3MGP C;  5B0Z A;  5AY8 A;  4UPK A;  5KDM A;  3AZH C;  1ZLA B;  4WU9 C;  4J8V C;  3W98 B;  1P3M B;  3W97 A;  3X1T D;  3MVD D;  2PYO D;  1WWI A;  4G91 B;  5GXQ A;  3AV2 B;  3KUY D;  1P3K D;  5AV5 B;  3UTB D;  3LZ0 B;  5B1M A;  4YM6 B;  2IO5 B;  4KGC C;  3V9R B;  3AZF A;  2ZY4 A;  3MGQ B;  3REH A;  3VH5 W;  3REL C;  5GT3 D;  3AZM D;  4KUD D;  5F99 A;  1HQ3 A;  4E45 A;  1Z2C B;  4NE3 A;  5B32 D;  4J8W C;  5DNM C;  3MGS A;  2Y2H A;  5B2I A;  4Z5T C;  5AV6 D;  2Y2L A;  1M19 C;  2Y2Q A;  3KXB C;  3LJA A;  4ZUX A;  4H9Q A;  3C1B A;  5JA4 B;  3X1T B;  3LZ1 D;  3MVD B;  3AZG B;  1U35 D;  2NZD C;  2Y2G A;  3NQJ A;  3B6G C;  1KU5 A;  4WU8 D;  4DQY B;  3UTB B;  1P3K B;  4H9S C;  3AZH D;  5AY8 C;  1KX5 A;  3NQU B;  4H9O A;  3W96 A;  5GT3 B;  3V9R A;  2LY8 A;  2HUE C;  3W99 D;  1TZY A;  5GXQ C;  5B32 B;  3P5J B;  4X23 D;  5CPJ B;  3REL D;  5BT1 C;  3AZK C;  1U35 B;  3LZ1 B;  4H9P A;  1BH9 B;  2CV5 A;  1P3I A;  4WU8 B;  3MGP B;  3KSY A;  5F99 C;  1HQ3 C;  4J8X A;  3AZG A;  2RIQ A;  2HIO D;  3AZH B;  1M1A A;  5DNM D;  1P3G A;  4Z2M H; 
#chains in the Genus database with same CATH homology
 4Z5T D;  1P3A A;  3UTA C;  3MGS C;  1M19 D;  1KX4 A;  1F66 A;  3KXB D;  5B2I C;  3AZI C;  1P34 A;  2NZD D;  3C1B C;  3W99 B;  4ZUX C;  3B6G D;  4M6B A;  4AWL C;  4R8P D;  3X1V A;  5B0Z D;  4KGC B;  2XD1 A;  5AY8 D;  3REL B;  2FFF B;  5BO0 A;  4JJN A;  5CPJ A;  3W97 D;  3TU4 A;  2HIO B;  4J8W B;  5B40 A;  5DNM B;  1H3O B;  3MGP A;  5B1M D;  4Z5T B;  1M19 B;  2ZM5 A;  3KXB B;  1R4V A;  3AZF D;  5BT1 D;  3REH D;  2NZD B;  3KWQ A;  5B2J A;  3B6G B;  1F1E A;  2CWE A;  4WU9 A;  2CV5 C;  2FJ7 C;  4J8V A;  1P3I C;  2JCH A;  4R8P B;  1HQ3 D;  3AZL C;  4J8X C;  5KDM B;  5AY8 B;  5B33 A;  1M1A C;  3MGS D;  5DNN C;  1B6W A;  1HTA A;  5B2I D;  3X1U A;  1P3A C;  1P3G C;  1KX4 C;  1F66 C;  4KGC A;  2HUE B;  3LJA D;  3C1B D;  3W97 B;  5GXQ B;  3VH6 W;  3X1V C;  3X1S C;  5FUG A;  3EPK A;  3AZK B;  4J8W A;  3AFA A;  4HGA C;  1KX5 D;  1P3P A;  3W96 D;  5F99 B;  1HQ3 B;  3B0C T;  4JJN C;  1TZY D;  4YS3 A;  4WZS B;  3MGR A;  3TU4 C;  2F8N G;  3WKJ A;  5B40 C;  3MGS B;  3AYW A;  5B2I B;  5JRG A;  3C1B B;  3LJA B;  4ZUX B;  4H9Q B;  3VH6 A;  2VQR A;  4XUJ C;  5B2J C;  3NQJ B;  3KWQ C;  4AWL B;  2CV5 D;  1P3I D;  5BNX B;  3REI A;  1W2E A;  4Z2M G;  3A6N A;  3AZG D;  3AV1 A;  4WNN A;  5B31 A;  1M1A D;  1P3G D;  5E5A C;  5B33 C;  1P3A D;  2YFW A;  1KX4 D;  1KX5 B;  1F66 D;  1TAF A;  5B24 A;  3X1U C;  4H9O B;  3W96 B;  1P34 D;  3AZK A;  1ULY A;  1TZY B;  3X1V D;  2F8N K;  4Z66 A;  5AVC C;  3AZJ C;  4J8U A;  3MNN C;  4H9P B;  3UTA A;  3AZE A;  2CV5 B;  1P3I B;  3AFA C;  2Y2M A;  3AZI A;  5AVB A;  1P3P C;  4JJN D;  5CPJ D;  1P3B A;  1ID3 A;  4J8X B;  3TU4 D;  3AZN A;  5BNX A;  5B40 D;  4YS3 C;  1M1A B;  5DNN B;  3MGP D;  3MGR C;  1P3G B;  1P3A B;  1KX4 B;  1F66 B;  3WKJ C;  3AYW C;  2NQB A;  1P34 B;  5JRG C;  3UT9 A;  3KWQ D;  5B2J D;  2L5A A;  4WU9 D;  4J8V D;  2Y2J A;  3KFU G;  3WA9 C;  3X1V B;  3REI C;  3X1S B;  3A6N C;  3AV1 C;  2JE5 A;  3WTP A;  5B33 D;  5B31 C;  4HGA B;  4XZQ C;  3X1U D;  4KGC D;  1N1J A;  5BO0 B;  5B24 C;  4JJN B;  2FJ7 A;  3TU4 B;  2F8N A;  5B40 B;  3AZL A;  4Z66 C;  4H9R A;  3KWQ B;  5B2J B;  4J8W D;  4J8U C;  1M18 A;  3WAA A;  5DNN A;  3AFA D;  4WU9 B;  2UWX A;  3AZE C;  4J8V B;  1P3P D;  2ARO A;  1ID3 C;  5AVB C;  1P3B C;  3REK C;  2Y2O A;  3AZN C;  5B33 B;  3WKJ D;  3AYW D;  3X1U B;  4LD9 A;  3X1S A;  5JRG D;  5BNV A;  2NQB C;  3UT9 C;  1KX3 C;  4ZBJ C;  4WV4 B;  2BYK A;  3REI D;  1AOI A;  2DF4 C;  3B6F A;  3A6N D;  3AV1 D;  5FUG B;  5GXQ D;  5B1L A;  5B31 D;  5GT0 A;  3WTP C;  3AFA B;  1P3P B;  5B24 D;  1BH8 A;  4NFT A;  3AZK D;  3VH5 T;  4XUJ A;  4YS3 B;  1S32 A;  3MGR B;  4KUD A;  3WKJ B;  5F99 D;  3AYW B;  4Z66 D;  5JRG B;  4J8U D;  5E5A A;  1M18 C;  3UTA D;  3AZE D;  2G5H C;  3WAA C;  3EPH A;  3O62 A;  3AN2 A;  3AZI D;  1ID3 D;  5AVB D;  3REI B;  2ARO C;  4ZUX D;  5GSU A;  3A1I A;  2RVQ C;  5BS7 A;  3A6N B;  3AV1 B;  4WNN B;  3AZN D;  5B31 B;  3H0M C;  4XZQ B;  4NE6 A;  2Y2I A;  2YFW B;  5AVC A;  1TAF B;  5B24 B;  3AZJ A;  2JSS A;  1P3L A;  2NQB D;  4LD9 C;  3UT9 D;  4EO5 C;  4H9N A;  3MNN A;  4CSR A;  5AV9 A;  1PZR A;  1JFI A;  1AOI C;  5CPI A;  2PYO C;  4Z66 B;  3WTP E;  3B6F C;  5B0Y A;  4J8U B;  1P3F A;  3KUY C;  5B1L C;  4DRB A;  5GT0 C;  2YFV A;  3UTB C;  3UTA B;  3AZE B;  1Q9C A;  3AZI B;  1ID3 B;  5AVB B;  1P3B B;  3REK B;  2XD5 A;  1WWS A;  1B67 A;  5CPK A;  2FJ7 D;  3AZN B;  2F8N D;  3AZM C;  1S32 C;  3WA9 A;  4KUD C;  3AZL D;  3B0B A;  4KHA A;  4J8X D;  2NQB B;  3UT9 B;  4XZQ A;  4ZBJ B;  4UUZ B;  3WAA D;  5DNN D;  5AV6 C;  2ARO D;  5CP6 A;  2G5I C;  3O62 C;  3AN2 C;  2RVQ D;  4QLC A;  5GSU C;  5BS7 C;  3WTP B;  3EPL A;  1P3O A;  4LD9 D;  3X1S D;  1N1J B;  1P3L C;  3H0L C;  1EQZ A;  2FJ7 B;  2F8N B;  2ZY2 A;  5AV9 C;  2W8S A;  1AOI D;  3REJ A;  3W99 C;  3AZL B;  3B6F D;  3REK A;  2DQN C;  5CPI C;  1T3U A;  4H9R B;  5B1L D;  5GT0 D;  5B0Y C;  1M18 B;  1P3F C;  3WAA B;  3EG5 B;  2ARO B;  4X23 C;  5G49 A;  5C3I C;  4G92 C;  4XUJ D;  5B32 G;  5AV8 A;  4UUZ A;  3LEL A;  1KX3 A;  1S32 D;  5CPK C;  4CAY A;  4LD9 B;  3C1C A;  5BNV B;  2HIO C;  4EO5 B;  5E5A D;  2BYK B;  3O62 D;  3AN2 D;  1AOI B;  5CP6 C;  2PYO B;  5GSU D;  1ZLA A;  3B6F B;  2ZY3 A;  3EPJ A;  3KUY B;  5B1L B;  4QLC C;  5GT0 B;  3VH5 A;  3W98 A;  1P3M A;  4R8P C;  3VH6 T;  5B0Z C;  5AVC D;  3AZJ D;  2BG1 A;  1P3L D;  1BH8 B;  1P3O C;  3AV2 A;  3H0R C;  4NE5 A;  5AV5 A;  4XUJ B;  3MNN D;  3LZ0 A;  4YM6 A;  3AZM B;  5AV9 D;  1S32 B;  1EQZ C;  4KUD B;  3MGQ A;  3B0C W;  3W97 C;  5CPI D;  3REJ C;  5B0Y D;  4YS3 D;  1P3F D;  3MGR D;  3B0D C;  5E5A B;  5B1M C;  5AV6 B;  3O62 B;  3AN2 B;  3AZF C;  2F8N H;  3REH C;  5GSU B;  3FDD A;  5AV8 C;  5CPK D;  3LEL C;  3WA9 D;  2Y2K A;  5JA4 A;  3X1T A;  3MVD A;  2PYO A;  3AL0 C;  5AVC B;  3AZJ B;  1P3L B;  3KUY A;  3C1C C;  1P3K A;  4H9N B;  4XZQ D;  3MNN B;  3IP4 C;  4CSR B;  3UTB A;  5AV9 B;  3R45 B;  3A1K A;  5CP6 D;  3LJA C;  1JFI B;  5CPI B;  4QLC D;  1ZLA C;  5B0Y B;  3NQU A;  2BYM B;  5GT3 A;  3AZM A;  4DRA A;  1P3F B;  1BFM A;  3W98 C;  2YFV B;  1P3M C;  2Y2P A;  1P3O D;  4X23 B;  2ZY5 A;  4G91 C;  4WJ3 C;  5C3I B;  5B31 G;  4G92 B;  5B32 A;  3AV2 C;  5AV5 C;  3LZ0 C;  5CPK B;  5AV6 A;  1KX5 C;  1EQZ D;  4YM6 C;  2IO5 C;  3W96 C;  3WA9 B;  3REJ D;  3MGQ C;  3LZ1 A;  1U35 A;  1P3B D;  3REK D;  1BH9 A;  4KHA B;  1TZY C;  4E44 A;  2Y2N A;  4WU8 A;  2F2A C;  3AZH A;  5CP6 B;  5AV8 D;  1KX3 D;  4QLC B;  3LEL D;  3R45 A;  2J8P A;  5B0Z B;  3W99 A;  1P3O B;  3X1T C;  3MVD C;  3AZG C;  3C1C D;  3F6T A;  1A7W A;  2BYM A;  3WTP D;  1P3K C;  1EQZ B;  4X23 A;  3REL A;  3REJ B;  1P34 C;  1ZLA D;  3B0D B;  3W98 D;  1P3M D;  5B1M B;  5GT3 C;  3AZF B;  3REH B;  2HIO A;  3AV2 D;  5G49 B;  5DNM A;  1H3O A;  5CHL B;  5AV5 D;  5AV8 B;  5B32 C;  4Z5T A;  3LZ0 D;  3LEL B;  1M19 A;  1M18 D;  1KX3 B;  4YM6 D;  3KXB A;  4CAY B;  3MGQ D;  2NZD A;  5CPJ C;  3B6G A;  1U35 C;  3LZ1 C;  3C1C B;  4R8P A;  4WU8 C;  4H9S A;  3MGP C;  5B0Z A;  5AY8 A;  4UPK A;  5KDM A;  3AZH C;  1ZLA B;  4WU9 C;  4J8V C;  3W98 B;  1P3M B;  3W97 A;  3X1T D;  3MVD D;  2PYO D;  1WWI A;  4G91 B;  5GXQ A;  3AV2 B;  3KUY D;  1P3K D;  5AV5 B;  3UTB D;  3LZ0 B;  5B1M A;  4YM6 B;  2IO5 B;  4KGC C;  3V9R B;  3AZF A;  2ZY4 A;  3MGQ B;  3REH A;  3VH5 W;  3REL C;  5GT3 D;  3AZM D;  4KUD D;  5F99 A;  1HQ3 A;  4E45 A;  1Z2C B;  4NE3 A;  5B32 D;  4J8W C;  5DNM C;  3MGS A;  2Y2H A;  5B2I A;  4Z5T C;  5AV6 D;  2Y2L A;  1M19 C;  2Y2Q A;  3KXB C;  3LJA A;  4ZUX A;  4H9Q A;  3C1B A;  5JA4 B;  3X1T B;  3LZ1 D;  3MVD B;  3AZG B;  1U35 D;  2NZD C;  2Y2G A;  3NQJ A;  3B6G C;  1KU5 A;  4WU8 D;  4DQY B;  3UTB B;  1P3K B;  4H9S C;  3AZH D;  5AY8 C;  1KX5 A;  3NQU B;  4H9O A;  3W96 A;  5GT3 B;  3V9R A;  2LY8 A;  2HUE C;  3W99 D;  1TZY A;  5GXQ C;  5B32 B;  3P5J B;  4X23 D;  5CPJ B;  3REL D;  5BT1 C;  3AZK C;  1U35 B;  3LZ1 B;  4H9P A;  1BH9 B;  2CV5 A;  1P3I A;  4WU8 B;  3MGP B;  3KSY A;  5F99 C;  1HQ3 C;  4J8X A;  3AZG A;  2RIQ A;  2HIO D;  3AZH B;  1M1A A;  5DNM D;  1P3G A;  4Z2M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...