4H9OB

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9oB00
2AROB 5GT0D 3W97D 1N1JB 5G49A 3AZEC 5AV9C 3KWQD 3NQUB 1KX3C 4WNNA 1P3FB 5B0YC 3MGPD 4UUZB 3AZMD 3AN2C 1P3BC 3AZLC 4KHAA 4QLCA 4J8VB 3W98A 5AVCD 1ZLAB 5B1MD 4Z5TC 5B1LA 2BYMA 4H9PB 5B33D 4H9PA 4M6BA 3UTAB 4LD9B 4J8XA 1Q9CA 3MNNC 3AV1A 3W98B 2NZDD 4X23C 4H9RA 1M1AB 3REIC 5B33B 3B6GC 3WKJD 4XUJB 3MVDB 5CPJB 3KXBC 1N1JA 3MNNA 3AV1C 5C3IB 3W96B 5CPIC 3X1UB 4AWLC 1P34D 3AZHB 2FJ7A 1ID3D 5DNNB 3W97B 5JA4A 5AV9B 3LZ1B 3W99B 2BYKB 5AVBA 1P3BA 3AZHD 1P34B 5AV8B 1M19B 1ZLAC 1AOIC 4H9QB 4X23D 4H9SC 4ZUXB 3A6NC 2FJ7C 5E5AC 4J8UC 3B6FC 2F8NG 3AV2C 4R8PB 2NZDC 4J8WC 3AZFC 3AFAC 5AY8C 4JJNC 3W98C 4Z2MH 3MGQB 5AV6D 5B24C 4G92C 4ZUXA 5B33A 5AVCC 4H9QA 4G91B 1KX3A 4X23A 3AZJB 3RELB 3AZEA 4J8XC 2NQBA 3AV1B 5AV6B 1P3GB 3X1SB 3X1VC 3MGSD 4YM6A 1P3BD 3LELB 3MGPA 3AZMA 5BNVA 5AV5C 5GT3B 3VH5T 1P3FD 3O62C 5GT3A 5BS7C 2NQBB 3LZ1C 3RELA 1TZYC 3X1SA 4XZQC 3WTPD 4YS3B 5BT1D 1ULYA 3LJAD 5B40B 5F99B 3REJA 4NE6A 1M19C 1P3KC 1KX3B 5B2JC 4HGAB 4XUJA 3LZ1D 3WKJA 3WAAC 3X1TD 1S32B 5B1MA 3WA9D 3KUYB 4R8PC 5B0ZD 4QLCD 4J8XD 3AFAB 3AYWB 1KX5A 4WV4B 4DRAA 3W96D 3AZKC 5CPJD 2F8NA 3B0DC 1P3LD 2BYKA 5AVBB 1B67A 1HQ3B 5F99D 4LD9A 1M1AC 3AV2D 2RVQD 5GSUD 3X1VB 3LZ0B 3VH6W 2NQBD 3AZFD 1P3OD 5KDMA 3LJAC 5BT1C 1EQZB 5B1LB 5C3IC 1KU5A 3W97A 2PYOC 4H9OA 5AV6A 4AWLB 1P3PA 5GSUC 3MGSB 1M18C 1ZLAD 1R4VA 5B32A 5AV5D 3REHB 3O62D 2YFWB 5G49B 4H9RB 1M1AA 1EQZD 3VH5W 5FUGA 5GT0B 1BH9A 3AZKA 3VH6T 3AZGA 5AVBD 3AZGC 1WWSA 1F66B 3A6NB 4NFTA 1B6WA 4CAYA 2L5AA 3TU4C 1M19D 4WU9B 5FUGB 3AYWD 5AV8D 5BO0B 3WKJC 4J8WD 2FJ7D 2CV5A 3A6ND 1HQ3A 1HQ3C 1P3KA 3KXBB 1F66D 5B0ZB 3AZNB 3VH6A 1KX4A 3W99D 3MNND 5B32B 3MGRC 3TU4D 1KX5B 3RELC 5CPKA 5B31C 4EO5C 3B0BA 5JRGD 3C1BB 1P3PB 5B2ID 3WTPB 4YS3D 5AV5B 2AROC 2YFVA 3AZID 1KX4B 3AZLD 3UT9B 5B2IC 5BO0A 1H3OA 5B1LD 1TZYB 1U35A 4XZQB 4YS3C 1P3BB 4ZUXC 1TZYA 5AVCA 3W98D 5AY8D 4JJND 1M18A 3KSYA 2HIOA 4J8VC 3AV2B 5DNMA 1P3IA 2PYOA 5AY8A 4JJNA 1M18D 3AZGB 1F66C 4WU8D 1U35D 1P3LB 4J8UA 3REID 3B6FA 5GT0A 4G92B 5B1MB 3X1UA 4J8VD 3UTBA 3C1BA 2CWEA 1P3GA 2RVQC 3MNNB 1P3AB 3AZND 5B33C 3X1SC 3KWQB 3MGRB 3MGQA 4Z66B 5AVBC 5B24A 4WU9D 1KX5C 2CV5B 2AROD 3UTAA 1F1EA 5GXQD 4R8PA 3REKC 3AN2D 3LJAB 3MGPC 3AZMC 5CPID 5DNNC 3A6NA 3X1VA 2CV5D 5CP6D 4YM6B 5B31D 4E44A 2PYOB 5B2JA 3X1TC 3WAAD 1M19A 4Z66D 1AOIA 3MGRD 5B2JD 3AZJA 3C1CD 1ID3B 4XZQA 3B6GA 3LELD 1S32C 5AV8C 3KUYC 3AFAA 4H9NB 3REHA 3MVDD 3C1CA 3AZJD 3AYWC 4KGCC 2IO5B 5CPKB 5E5AA 4Z66A 1M1AD 2NZDB 4H9SA 4KGCA 3AZFB 5CPIA 1HTAA 3LZ0D 5AY8B 4JJNB 5GXQC 4KUDD 3KXBA 1P3AC 3UTBD 2HIOB 5KDMB 4QLCC 3UT9D 1BFMA 1JFIB 5B0YA 3AZJC 3AZIB 5AV9A 3AZNC 4E45A 1P3MA 3AV2A 3REKB 5DNNA 3LELC 3LELA 3MGPB 3AZMB 5JRGB 3C1BD 3KUYD 3WA9B 3C1CC 1H3OB 4Z5TA 3REHC 3X1TB 1P3OC 3AZEB 3KUYA 4WU8A 5DNND 3AN2B 2YFVB 5DNMD 1P3ID 3REKD 1P3AA 2YFWA 5B0ZA 2HUEC 5GXQA 4Z5TB 3X1TA 3UTBC 4XUJD 1P3MC 3REKA 1P3AD 4KUDA 3AZNA 1F66A 3UTAC 4KUDB 3X1SD 4KGCD 5DNMC 5BNVB 5AV8A 1P3IC 2HIOC 4J8VA 1P3GD 3REIB 1U35B 3REIA 3B0DB 5CPKD 3MVDC 1P3FA 1BH8A 3REHD 1TAFA 3V9RB 4EO5B 3C1BC 3X1UC 4Z66C 4XZQD 3WTPC 3AZHC 1TZYD 3AYWA 3B0CT 5B1LC 3C1CB 4H9OB 4ZUXD 1P3OB 3UT9C 5GSUB 3MGSC 3X1VD 3AZLA 1TAFB 3V9RA 1S32A 4ZBJB 3REJB 3AN2A 3LZ0A 1P34C 4CSRB 5CHLB 1P3PD 5B2IA 2LY8A 1AOIB 1ID3C 5BNXB 2F8NK 5B0YB 5B24D 4WU9A 2F8NB 3TU4A 5GT0C 3AFAD 1P3MB 3KXBD 4J8WB 3B6GD 1S32D 3X1UD 5CPKC 3B0CW 3MGQC 1JFIA 2F8ND 5B24B 4J8UD 3B6FD 3MGRA 5E5AD 1AOID 4UUZA 1U35C 3WKJB 4G91C 3W96A 3NQUA 4WU8B 3AZGD 2CV5C 2HIOD 1P3GC 5B32C 3WA9A 4LD9D 2AROA 3UTAD 5CPJC 1P3LA 3AZIC 1P3PC 3WTPE 5B31G 3O62B 1EQZA 3R45B 5B31A 5CP6A 1BH8B 5JRGC 3AV1D 4YS3A 3WA9C 1KX4C 3RELD 5F99C 5B40C 5B2IB 4NE3A 5B2JB 5JA4B 3MGQD 4KGCB 3WAAB 3W99A 2IO5C 2PYOD 5CP6B 4YM6D 5GSUA 4WZSB 2HUEB 1A7WA 1HQ3D 5GXQB 2FJ7B 1P3LC 5E5AB 4X23B 4J8UB 3B6FB 4Z5TD 3KWQA 5B1MC 3B6GB 4XUJC 5DNMB 1P3IB 1WWIA 1P3MD 5F99A 5B32G 5B40A 3AZKD 3W96C 3NQJB 5AV9D 3LZ0C 3KWQC 3AZED 5JRGA 3VH5A 5B0YD 1KX3D 3UT9A 5BS7A 2BYMB 5AV6C 1EQZC 3R45A 3W97C 3O62A 3AZIA 3LJAA 3REJD 3W99C 1M18B 1BH9B 1P3KD 3WTPA 3NQJA 4DRBA 4YM6C 5BNXA 4CSRA 2NQBC 5GT3D 3MVDA 1P3FC 4ZBJC 3REJC 2JSSA 3UTBB 4WNNB 3AZLB 1KX4D 5CP6C 3MGSA 1P3KB 4Z2MG 4HGAC 4J8WA 4H9NA 4KUDC 5CPJA 4CAYB 3WAAA 3TU4B 5AVCB 1KX5D 4WU9C 1ID3A 5B32D 4LD9C 1ZLAA 1P34A 4J8XB 3AZKB 5B0ZC 4R8PD 4KHAB 4QLCB 3LZ1A 4NE5A 4WU8C 5B31B 5GT3C 1P3OA 3AZFA 5CPIB 2F8NH 2NZDA 5AV5A 5B40D 3AZHA
chains in the Genus database with same CATH superfamily
2AROB 2Y2OA 1W2EA 5GT0D 3W97D 1N1JB 5G49A 3AZEC 5AV9C 3KWQD 3NQUB 3H0MC 1KX3C 4WNNA 1P3FB 5B0YC 3MGPD 4UUZB 3AZMD 3AN2C 1P3BC 3AZLC 4KHAA 4QLCA 4J8VB 2Y2NA 3W98A 5AVCD 1ZLAB 5B1MD 4Z5TC 5B1LA 2BYMA 4H9PB 5B33D 4H9PA 4M6BA 3UTAB 4LD9B 4J8XA 1Q9CA 3MNNC 3AV1A 3W98B 2NZDD 4X23C 4H9RA 1M1AB 3REIC 2G5HC 5B33B 3B6GC 3WKJD 4XUJB 3MVDB 5CPJB 3KXBC 1N1JA 4WJ3C 3MNNA 3AV1C 5C3IB 3W96B 5CPIC 3X1UB 4AWLC 1P34D 2J8PA 3AZHB 2FJ7A 1ID3D 5DNNB 3W97B 5JA4A 3H0LC 5AV9B 3LZ1B 3W99B 2BYKB 5AVBA 1P3BA 3AZHD 1P34B 5AV8B 1M19B 1ZLAC 1AOIC 3IP4C 4H9QB 4X23D 4H9SC 1Z2CB 4ZUXB 3A6NC 2FJ7C 5E5AC 4J8UC 3B6FC 2ZY2A 3AV2C 4R8PB 2F8NG 2NZDC 2Y2GA 4J8WC 3AZFC 3AFAC 5AY8C 4JJNC 3W98C 4Z2MH 3MGQB 5AV6D 5B24C 4G92C 4ZUXA 5B33A 5AVCC 4H9QA 4G91B 1KX3A 4X23A 3AZJB 3RELB 3AZEA 4J8XC 2NQBA 3AV1B 5AV6B 1P3GB 3X1SB 3X1VC 3MGSD 4YM6A 1P3BD 3LELB 3MGPA 3AZMA 5BNVA 5AV5C 2DQNC 5GT3B 3VH5T 1P3FD 3O62C 5GT3A 5BS7C 2NQBB 3LZ1C 3RELA 1TZYC 3X1SA 4XZQC 3WTPD 4YS3B 5BT1D 1ULYA 3LJAD 5B40B 5F99B 3EPLA 3REJA 2W8SA 4NE6A 1M19C 1P3KC 2BG1A 1KX3B 5B2JC 4HGAB 4XUJA 3LZ1D 3WKJA 3WAAC 3X1TD 1S32B 5B1MA 3WA9D 3KUYB 4R8PC 5B0ZD 4QLCD 4J8XD 3AFAB 3EG5B 3AYWB 3F6TA 1KX5A 4WV4B 4DRAA 3W96D 3AZKC 5CPJD 2F8NA 3B0DC 1P3LD 2BYKA 5AVBB 1B67A 1HQ3B 5F99D 4LD9A 1M1AC 3AV2D 2RVQD 5GSUD 3X1VB 3LZ0B 3VH6W 2NQBD 3AZFD 1P3OD 5KDMA 3LJAC 5BT1C 1EQZB 5B1LB 5C3IC 1KU5A 3W97A 2PYOC 4H9OA 5AV6A 4AWLB 1P3PA 3EPJA 5GSUC 3MGSB 1M18C 1ZLAD 1R4VA 5B32A 5AV5D 3REHB 3O62D 2YFWB 5G49B 4H9RB 1M1AA 1EQZD 3VH5W 5FUGA 5GT0B 1BH9A 3AZKA 2RIQA 3P5JB 3VH6T 3AZGA 5AVBD 3AZGC 1WWSA 1F66B 3A6NB 4NFTA 1B6WA 4CAYA 2L5AA 3TU4C 1M19D 4WU9B 5FUGB 3AYWD 5AV8D 5BO0B 3WKJC 4J8WD 2FJ7D 2CV5A 3A6ND 1HQ3A 1HQ3C 1P3KA 3KXBB 1F66D 5B0ZB 3AZNB 3A1KA 3VH6A 1KX4A 3W99D 3MNND 5B32B 3MGRC 3FDDA 3TU4D 1KX5B 3RELC 5CPKA 5B31C 4EO5C 3B0BA 5JRGD 3C1BB 1P3PB 5B2ID 3WTPB 4YS3D 5AV5B 2AROC 2YFVA 2Y2QA 3AZID 1KX4B 3AZLD 2ZY3A 3UT9B 5B2IC 5BO0A 1H3OA 5B1LD 1TZYB 1U35A 2DF4C 4YS3C 4XZQB 1P3BB 4ZUXC 1TZYA 5AVCA 3W98D 5AY8D 4JJND 1M18A 2HIOA 3KSYA 4J8VC 3AV2B 5DNMA 1P3IA 2PYOA 5AY8A 4JJNA 1M18D 3AZGB 1F66C 4WU8D 1U35D 1P3LB 4J8UA 3REID 3B6FA 5GT0A 4G92B 5B1MB 3X1UA 3A1IA 4J8VD 3UTBA 3C1BA 2CWEA 2Y2JA 1P3GA 2RVQC 3MNNB 1P3AB 3AZND 5B33C 3X1SC 3KWQB 3MGRB 3MGQA 4Z66B 5AVBC 5B24A 4WU9D 1KX5C 2CV5B 2AROD 3UTAA 1F1EA 5GXQD 4R8PA 2Y2HA 3REKC 3AN2D 3LJAB 3MGPC 3AZMC 5CPID 5DNNC 3A6NA 3X1VA 2CV5D 5CP6D 4YM6B 5B31D 4E44A 2PYOB 5B2JA 3X1TC 3WAAD 1M19A 4Z66D 1AOIA 3MGRD 5B2JD 3AZJA 3C1CD 1ID3B 4XZQA 3B6GA 3LELD 2Y2PA 1S32C 5AV8C 3KUYC 2XD1A 4H9NB 3AFAA 3REHA 3MVDD 3C1CA 3AZJD 3AYWC 4KGCC 2IO5B 5CPKB 5E5AA 4Z66A 3H0RC 1M1AD 2NZDB 4H9SA 4KGCA 3AZFB 5CPIA 1HTAA 3LZ0D 5AY8B 4JJNB 5GXQC 4KUDD 3KXBA 1P3AC 3UTBD 2HIOB 5KDMB 4QLCC 3UT9D 1BFMA 1JFIB 5B0YA 2Y2LA 3AZJC 3AZIB 5AV9A 3AZNC 4E45A 1P3MA 3AV2A 3REKB 5DNNA 3LELC 3LELA 3MGPB 3AZMB 5JRGB 3C1BD 3KUYD 3WA9B 3C1CC 1H3OB 4Z5TA 3REHC 3X1TB 1P3OC 2JCHA 3AZEB 3KUYA 4WU8A 4UPKA 5DNND 3AN2B 2YFVB 5DNMD 1P3ID 3REKD 1P3AA 2YFWA 5B0ZA 2ZY5A 2HUEC 5GXQA 4Z5TB 3X1TA 3UTBC 4XUJD 1P3MC 3REKA 1P3AD 4KUDA 2F2AC 3AZNA 1F66A 3UTAC 4KUDB 3X1SD 4KGCD 5DNMC 5BNVB 5AV8A 1P3IC 2HIOC 4J8VA 2VQRA 1P3GD 3REIB 1U35B 3REIA 3B0DB 5CPKD 3MVDC 1P3FA 1BH8A 4DQYB 3REHD 1TAFA 3V9RB 4EO5B 3C1BC 3X1UC 4Z66C 4XZQD 3WTPC 3AZHC 1TZYD 2ZM5A 3AYWA 3B0CT 5B1LC 2XD5A 3C1CB 2UWXA 4H9OB 4ZUXD 1P3OB 3UT9C 5GSUB 3MGSC 3X1VD 3AZLA 1TAFB 3V9RA 1S32A 4ZBJB 3REJB 3AN2A 3LZ0A 1P34C 3EPHA 4CSRB 5CHLB 1P3PD 5B2IA 2LY8A 1AOIB 1ID3C 5BNXB 2F8NK 5B0YB 5B24D 4WU9A 2F8NB 2JE5A 3TU4A 5GT0C 3AFAD 1T3UA 1P3MB 3KXBD 4J8WB 3B6GD 1S32D 3X1UD 5CPKC 3B0CW 3MGQC 1JFIA 2F8ND 5B24B 3AL0C 4J8UD 3B6FD 3MGRA 5E5AD 1AOID 4UUZA 1U35C 3WKJB 4G91C 3W96A 3NQUA 4WU8B 3AZGD 2CV5C 2HIOD 1P3GC 5B32C 3WA9A 4LD9D 2AROA 3UTAD 5CPJC 1P3LA 3AZIC 1P3PC 3WTPE 5B31G 3O62B 2Y2MA 1EQZA 3R45B 5B31A 5CP6A 2G5IC 1BH8B 5JRGC 3AV1D 4YS3A 3WA9C 1KX4C 3RELD 5F99C 5B40C 5B2IB 4NE3A 5B2JB 5JA4B 3MGQD 4KGCB 3WAAB 3W99A 2IO5C 3EPKA 2PYOD 5CP6B 4YM6D 5GSUA 4WZSB 2HUEB 1A7WA 1HQ3D 5GXQB 2FJ7B 1P3LC 5E5AB 4X23B 4J8UB 3B6FB 4Z5TD 3KWQA 5B1MC 3B6GB 4XUJC 5DNMB 1P3IB 1WWIA 1P3MD 5F99A 5B32G 5B40A 3AZKD 3W96C 3NQJB 5AV9D 3LZ0C 3KWQC 3AZED 5JRGA 3VH5A 2FFFB 5B0YD 1KX3D 3UT9A 5BS7A 2BYMB 5AV6C 1EQZC 3R45A 3W97C 3O62A 3AZIA 3LJAA 3REJD 3W99C 1M18B 1BH9B 1P3KD 3WTPA 3NQJA 4DRBA 4YM6C 5BNXA 4CSRA 2NQBC 5GT3D 1PZRA 3MVDA 1P3FC 2Y2KA 4ZBJC 3REJC 2JSSA 3UTBB 2Y2IA 4WNNB 3AZLB 1KX4D 5CP6C 3MGSA 1P3KB 4Z2MG 4HGAC 4J8WA 4H9NA 4KUDC 5CPJA 4CAYB 3WAAA 3TU4B 5AVCB 1KX5D 4WU9C 2ZY4A 3KFUG 1ID3A 5B32D 4LD9C 1ZLAA 1P34A 4J8XB 3AZKB 5B0ZC 4R8PD 4KHAB 4QLCB 3LZ1A 4NE5A 4WU8C 5B31B 5GT3C 1P3OA 3AZFA 5CPIB 2F8NH 2NZDA 5AV5A 5B40D 3AZHA
chains in the Genus database with same CATH topology
2AROB 2Y2OA 1W2EA 5GT0D 3W97D 1N1JB 5G49A 3AZEC 5AV9C 3KWQD 3NQUB 3H0MC 1KX3C 4WNNA 1P3FB 5B0YC 3MGPD 4UUZB 3AZMD 3AN2C 1P3BC 3AZLC 4KHAA 4QLCA 4J8VB 2Y2NA 3W98A 5AVCD 1ZLAB 5B1MD 4Z5TC 5B1LA 2BYMA 4H9PB 5B33D 4H9PA 4M6BA 3UTAB 4LD9B 4J8XA 1Q9CA 3MNNC 3AV1A 3W98B 2NZDD 4X23C 4H9RA 1M1AB 3REIC 2G5HC 5B33B 3B6GC 3WKJD 4XUJB 3MVDB 5CPJB 3KXBC 1N1JA 4WJ3C 3MNNA 3AV1C 5C3IB 3W96B 5CPIC 3X1UB 4AWLC 1P34D 2J8PA 3AZHB 2FJ7A 1ID3D 5DNNB 3W97B 5JA4A 3H0LC 5AV9B 3LZ1B 3W99B 2BYKB 5AVBA 1P3BA 3AZHD 1P34B 5AV8B 1M19B 1ZLAC 1AOIC 3IP4C 4H9QB 4X23D 4H9SC 1Z2CB 4ZUXB 3A6NC 2FJ7C 5E5AC 4J8UC 3B6FC 2ZY2A 3AV2C 4R8PB 2F8NG 2NZDC 2Y2GA 4J8WC 3AZFC 3AFAC 5AY8C 4JJNC 3W98C 4Z2MH 3MGQB 5AV6D 5B24C 4G92C 4ZUXA 5B33A 5AVCC 4H9QA 4G91B 1KX3A 4X23A 3AZJB 3RELB 3AZEA 4J8XC 2NQBA 3AV1B 5AV6B 1P3GB 3X1SB 3X1VC 3MGSD 4YM6A 1P3BD 3LELB 3MGPA 3AZMA 5BNVA 5AV5C 2DQNC 5GT3B 3VH5T 1P3FD 3O62C 5GT3A 5BS7C 2NQBB 3LZ1C 3RELA 1TZYC 3X1SA 4XZQC 3WTPD 4YS3B 5BT1D 1ULYA 3LJAD 5B40B 5F99B 3EPLA 3REJA 2W8SA 4NE6A 1M19C 1P3KC 2BG1A 1KX3B 5B2JC 4HGAB 4XUJA 3LZ1D 3WKJA 3WAAC 3X1TD 1S32B 5B1MA 3WA9D 3KUYB 4R8PC 5B0ZD 4QLCD 4J8XD 3AFAB 3EG5B 3AYWB 3F6TA 1KX5A 4WV4B 4DRAA 3W96D 3AZKC 5CPJD 2F8NA 3B0DC 1P3LD 2BYKA 5AVBB 1B67A 1HQ3B 5F99D 4LD9A 1M1AC 3AV2D 2RVQD 5GSUD 3X1VB 3LZ0B 3VH6W 2NQBD 3AZFD 1P3OD 5KDMA 3LJAC 5BT1C 1EQZB 5B1LB 5C3IC 1KU5A 3W97A 2PYOC 4H9OA 5AV6A 4AWLB 1P3PA 3EPJA 5GSUC 3MGSB 1M18C 1ZLAD 1R4VA 5B32A 5AV5D 3REHB 3O62D 2YFWB 5G49B 4H9RB 1M1AA 1EQZD 3VH5W 5FUGA 5GT0B 1BH9A 3AZKA 2RIQA 3P5JB 3VH6T 3AZGA 5AVBD 3AZGC 1WWSA 1F66B 3A6NB 4NFTA 1B6WA 4CAYA 2L5AA 3TU4C 1M19D 4WU9B 5FUGB 3AYWD 5AV8D 5BO0B 3WKJC 4J8WD 2FJ7D 2CV5A 3A6ND 1HQ3A 1HQ3C 1P3KA 3KXBB 1F66D 5B0ZB 3AZNB 3A1KA 3VH6A 1KX4A 3W99D 3MNND 5B32B 3MGRC 3FDDA 3TU4D 1KX5B 3RELC 5CPKA 5B31C 4EO5C 3B0BA 5JRGD 3C1BB 1P3PB 5B2ID 3WTPB 4YS3D 5AV5B 2AROC 2YFVA 2Y2QA 3AZID 1KX4B 3AZLD 2ZY3A 3UT9B 5B2IC 5BO0A 1H3OA 5B1LD 1TZYB 1U35A 2DF4C 4YS3C 4XZQB 1P3BB 4ZUXC 1TZYA 5AVCA 3W98D 5AY8D 4JJND 1M18A 2HIOA 3KSYA 4J8VC 3AV2B 5DNMA 1P3IA 2PYOA 5AY8A 4JJNA 1M18D 3AZGB 1F66C 4WU8D 1U35D 1P3LB 4J8UA 3REID 3B6FA 5GT0A 4G92B 5B1MB 3X1UA 3A1IA 4J8VD 3UTBA 3C1BA 2CWEA 2Y2JA 1P3GA 2RVQC 3MNNB 1P3AB 3AZND 5B33C 3X1SC 3KWQB 3MGRB 3MGQA 4Z66B 5AVBC 5B24A 4WU9D 1KX5C 2CV5B 2AROD 3UTAA 1F1EA 5GXQD 4R8PA 2Y2HA 3REKC 3AN2D 3LJAB 3MGPC 3AZMC 5CPID 5DNNC 3A6NA 3X1VA 2CV5D 5CP6D 4YM6B 5B31D 4E44A 2PYOB 5B2JA 3X1TC 3WAAD 1M19A 4Z66D 1AOIA 3MGRD 5B2JD 3AZJA 3C1CD 1ID3B 4XZQA 3B6GA 3LELD 2Y2PA 1S32C 5AV8C 3KUYC 2XD1A 4H9NB 3AFAA 3REHA 3MVDD 3C1CA 3AZJD 3AYWC 4KGCC 2IO5B 5CPKB 5E5AA 4Z66A 3H0RC 1M1AD 2NZDB 4H9SA 4KGCA 3AZFB 5CPIA 1HTAA 3LZ0D 5AY8B 4JJNB 5GXQC 4KUDD 3KXBA 1P3AC 3UTBD 2HIOB 5KDMB 4QLCC 3UT9D 1BFMA 1JFIB 5B0YA 2Y2LA 3AZJC 3AZIB 5AV9A 3AZNC 4E45A 1P3MA 3AV2A 3REKB 5DNNA 3LELC 3LELA 3MGPB 3AZMB 5JRGB 3C1BD 3KUYD 3WA9B 3C1CC 1H3OB 4Z5TA 3REHC 3X1TB 1P3OC 2JCHA 3AZEB 3KUYA 4WU8A 4UPKA 5DNND 3AN2B 2YFVB 5DNMD 1P3ID 3REKD 1P3AA 2YFWA 5B0ZA 2ZY5A 2HUEC 5GXQA 4Z5TB 3X1TA 3UTBC 4XUJD 1P3MC 3REKA 1P3AD 4KUDA 2F2AC 3AZNA 1F66A 3UTAC 4KUDB 3X1SD 4KGCD 5DNMC 5BNVB 5AV8A 1P3IC 2HIOC 4J8VA 2VQRA 1P3GD 3REIB 1U35B 3REIA 3B0DB 5CPKD 3MVDC 1P3FA 1BH8A 4DQYB 3REHD 1TAFA 3V9RB 4EO5B 3C1BC 3X1UC 4Z66C 4XZQD 3WTPC 3AZHC 1TZYD 2ZM5A 3AYWA 3B0CT 5B1LC 2XD5A 3C1CB 2UWXA 4H9OB 4ZUXD 1P3OB 3UT9C 5GSUB 3MGSC 3X1VD 3AZLA 1TAFB 3V9RA 1S32A 4ZBJB 3REJB 3AN2A 3LZ0A 1P34C 3EPHA 4CSRB 5CHLB 1P3PD 5B2IA 2LY8A 1AOIB 1ID3C 5BNXB 2F8NK 5B0YB 5B24D 4WU9A 2F8NB 2JE5A 3TU4A 5GT0C 3AFAD 1T3UA 1P3MB 3KXBD 4J8WB 3B6GD 1S32D 3X1UD 5CPKC 3B0CW 3MGQC 1JFIA 2F8ND 5B24B 3AL0C 4J8UD 3B6FD 3MGRA 5E5AD 1AOID 4UUZA 1U35C 3WKJB 4G91C 3W96A 3NQUA 4WU8B 3AZGD 2CV5C 2HIOD 1P3GC 5B32C 3WA9A 4LD9D 2AROA 3UTAD 5CPJC 1P3LA 3AZIC 1P3PC 3WTPE 5B31G 3O62B 2Y2MA 1EQZA 3R45B 5B31A 5CP6A 2G5IC 1BH8B 5JRGC 3AV1D 4YS3A 3WA9C 1KX4C 3RELD 5F99C 5B40C 5B2IB 4NE3A 5B2JB 5JA4B 3MGQD 4KGCB 3WAAB 3W99A 2IO5C 3EPKA 2PYOD 5CP6B 4YM6D 5GSUA 4WZSB 2HUEB 1A7WA 1HQ3D 5GXQB 2FJ7B 1P3LC 5E5AB 4X23B 4J8UB 3B6FB 4Z5TD 3KWQA 5B1MC 3B6GB 4XUJC 5DNMB 1P3IB 1WWIA 1P3MD 5F99A 5B32G 5B40A 3AZKD 3W96C 3NQJB 5AV9D 3LZ0C 3KWQC 3AZED 5JRGA 3VH5A 2FFFB 5B0YD 1KX3D 3UT9A 5BS7A 2BYMB 5AV6C 1EQZC 3R45A 3W97C 3O62A 3AZIA 3LJAA 3REJD 3W99C 1M18B 1BH9B 1P3KD 3WTPA 3NQJA 4DRBA 4YM6C 5BNXA 4CSRA 2NQBC 5GT3D 1PZRA 3MVDA 1P3FC 2Y2KA 4ZBJC 3REJC 2JSSA 3UTBB 2Y2IA 4WNNB 3AZLB 1KX4D 5CP6C 3MGSA 1P3KB 4Z2MG 4HGAC 4J8WA 4H9NA 4KUDC 5CPJA 4CAYB 3WAAA 3TU4B 5AVCB 1KX5D 4WU9C 2ZY4A 3KFUG 1ID3A 5B32D 4LD9C 1ZLAA 1P34A 4J8XB 3AZKB 5B0ZC 4R8PD 4KHAB 4QLCB 3LZ1A 4NE5A 4WU8C 5B31B 5GT3C 1P3OA 3AZFA 5CPIB 2F8NH 2NZDA 5AV5A 5B40D 3AZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO B;  5GT0 D;  3W97 D;  1N1J B;  5G49 A;  3AZE C;  5AV9 C;  3KWQ D;  3NQU B;  1KX3 C;  4WNN A;  1P3F B;  5B0Y C;  3MGP D;  4UUZ B;  3AZM D;  3AN2 C;  1P3B C;  3AZL C;  4KHA A;  4QLC A;  4J8V B;  3W98 A;  5AVC D;  1ZLA B;  5B1M D;  4Z5T C;  5B1L A;  2BYM A;  4H9P B;  5B33 D;  4H9P A;  4M6B A;  3UTA B;  4LD9 B;  4J8X A;  1Q9C A;  3MNN C;  3AV1 A;  3W98 B;  2NZD D;  4X23 C;  4H9R A;  1M1A B;  3REI C;  5B33 B;  3B6G C;  3WKJ D;  4XUJ B;  3MVD B;  5CPJ B;  3KXB C;  1N1J A;  3MNN A;  3AV1 C;  5C3I B;  3W96 B;  5CPI C;  3X1U B;  4AWL C;  1P34 D;  3AZH B;  2FJ7 A;  1ID3 D;  5DNN B;  3W97 B;  5JA4 A;  5AV9 B;  3LZ1 B;  3W99 B;  2BYK B;  5AVB A;  1P3B A;  3AZH D;  1P34 B;  5AV8 B;  1M19 B;  1ZLA C;  1AOI C;  4H9Q B;  4X23 D;  4H9S C;  4ZUX B;  3A6N C;  2FJ7 C;  5E5A C;  4J8U C;  3B6F C;  2F8N G;  3AV2 C;  4R8P B;  2NZD C;  4J8W C;  3AZF C;  3AFA C;  5AY8 C;  4JJN C;  3W98 C;  4Z2M H;  3MGQ B;  5AV6 D;  5B24 C;  4G92 C;  4ZUX A;  5B33 A;  5AVC C;  4H9Q A;  4G91 B;  1KX3 A;  4X23 A;  3AZJ B;  3REL B;  3AZE A;  4J8X C;  2NQB A;  3AV1 B;  5AV6 B;  1P3G B;  3X1S B;  3X1V C;  3MGS D;  4YM6 A;  1P3B D;  3LEL B;  3MGP A;  3AZM A;  5BNV A;  5AV5 C;  5GT3 B;  3VH5 T;  1P3F D;  3O62 C;  5GT3 A;  5BS7 C;  2NQB B;  3LZ1 C;  3REL A;  1TZY C;  3X1S A;  4XZQ C;  3WTP D;  4YS3 B;  5BT1 D;  1ULY A;  3LJA D;  5B40 B;  5F99 B;  3REJ A;  4NE6 A;  1M19 C;  1P3K C;  1KX3 B;  5B2J C;  4HGA B;  4XUJ A;  3LZ1 D;  3WKJ A;  3WAA C;  3X1T D;  1S32 B;  5B1M A;  3WA9 D;  3KUY B;  4R8P C;  5B0Z D;  4QLC D;  4J8X D;  3AFA B;  3AYW B;  1KX5 A;  4WV4 B;  4DRA A;  3W96 D;  3AZK C;  5CPJ D;  2F8N A;  3B0D C;  1P3L D;  2BYK A;  5AVB B;  1B67 A;  1HQ3 B;  5F99 D;  4LD9 A;  1M1A C;  3AV2 D;  2RVQ D;  5GSU D;  3X1V B;  3LZ0 B;  3VH6 W;  2NQB D;  3AZF D;  1P3O D;  5KDM A;  3LJA C;  5BT1 C;  1EQZ B;  5B1L B;  5C3I C;  1KU5 A;  3W97 A;  2PYO C;  4H9O A;  5AV6 A;  4AWL B;  1P3P A;  5GSU C;  3MGS B;  1M18 C;  1ZLA D;  1R4V A;  5B32 A;  5AV5 D;  3REH B;  3O62 D;  2YFW B;  5G49 B;  4H9R B;  1M1A A;  1EQZ D;  3VH5 W;  5FUG A;  5GT0 B;  1BH9 A;  3AZK A;  3VH6 T;  3AZG A;  5AVB D;  3AZG C;  1WWS A;  1F66 B;  3A6N B;  4NFT A;  1B6W A;  4CAY A;  2L5A A;  3TU4 C;  1M19 D;  4WU9 B;  5FUG B;  3AYW D;  5AV8 D;  5BO0 B;  3WKJ C;  4J8W D;  2FJ7 D;  2CV5 A;  3A6N D;  1HQ3 A;  1HQ3 C;  1P3K A;  3KXB B;  1F66 D;  5B0Z B;  3AZN B;  3VH6 A;  1KX4 A;  3W99 D;  3MNN D;  5B32 B;  3MGR C;  3TU4 D;  1KX5 B;  3REL C;  5CPK A;  5B31 C;  4EO5 C;  3B0B A;  5JRG D;  3C1B B;  1P3P B;  5B2I D;  3WTP B;  4YS3 D;  5AV5 B;  2ARO C;  2YFV A;  3AZI D;  1KX4 B;  3AZL D;  3UT9 B;  5B2I C;  5BO0 A;  1H3O A;  5B1L D;  1TZY B;  1U35 A;  4XZQ B;  4YS3 C;  1P3B B;  4ZUX C;  1TZY A;  5AVC A;  3W98 D;  5AY8 D;  4JJN D;  1M18 A;  3KSY A;  2HIO A;  4J8V C;  3AV2 B;  5DNM A;  1P3I A;  2PYO A;  5AY8 A;  4JJN A;  1M18 D;  3AZG B;  1F66 C;  4WU8 D;  1U35 D;  1P3L B;  4J8U A;  3REI D;  3B6F A;  5GT0 A;  4G92 B;  5B1M B;  3X1U A;  4J8V D;  3UTB A;  3C1B A;  2CWE A;  1P3G A;  2RVQ C;  3MNN B;  1P3A B;  3AZN D;  5B33 C;  3X1S C;  3KWQ B;  3MGR B;  3MGQ A;  4Z66 B;  5AVB C;  5B24 A;  4WU9 D;  1KX5 C;  2CV5 B;  2ARO D;  3UTA A;  1F1E A;  5GXQ D;  4R8P A;  3REK C;  3AN2 D;  3LJA B;  3MGP C;  3AZM C;  5CPI D;  5DNN C;  3A6N A;  3X1V A;  2CV5 D;  5CP6 D;  4YM6 B;  5B31 D;  4E44 A;  2PYO B;  5B2J A;  3X1T C;  3WAA D;  1M19 A;  4Z66 D;  1AOI A;  3MGR D;  5B2J D;  3AZJ A;  3C1C D;  1ID3 B;  4XZQ A;  3B6G A;  3LEL D;  1S32 C;  5AV8 C;  3KUY C;  3AFA A;  4H9N B;  3REH A;  3MVD D;  3C1C A;  3AZJ D;  3AYW C;  4KGC C;  2IO5 B;  5CPK B;  5E5A A;  4Z66 A;  1M1A D;  2NZD B;  4H9S A;  4KGC A;  3AZF B;  5CPI A;  1HTA A;  3LZ0 D;  5AY8 B;  4JJN B;  5GXQ C;  4KUD D;  3KXB A;  1P3A C;  3UTB D;  2HIO B;  5KDM B;  4QLC C;  3UT9 D;  1BFM A;  1JFI B;  5B0Y A;  3AZJ C;  3AZI B;  5AV9 A;  3AZN C;  4E45 A;  1P3M A;  3AV2 A;  3REK B;  5DNN A;  3LEL C;  3LEL A;  3MGP B;  3AZM B;  5JRG B;  3C1B D;  3KUY D;  3WA9 B;  3C1C C;  1H3O B;  4Z5T A;  3REH C;  3X1T B;  1P3O C;  3AZE B;  3KUY A;  4WU8 A;  5DNN D;  3AN2 B;  2YFV B;  5DNM D;  1P3I D;  3REK D;  1P3A A;  2YFW A;  5B0Z A;  2HUE C;  5GXQ A;  4Z5T B;  3X1T A;  3UTB C;  4XUJ D;  1P3M C;  3REK A;  1P3A D;  4KUD A;  3AZN A;  1F66 A;  3UTA C;  4KUD B;  3X1S D;  4KGC D;  5DNM C;  5BNV B;  5AV8 A;  1P3I C;  2HIO C;  4J8V A;  1P3G D;  3REI B;  1U35 B;  3REI A;  3B0D B;  5CPK D;  3MVD C;  1P3F A;  1BH8 A;  3REH D;  1TAF A;  3V9R B;  4EO5 B;  3C1B C;  3X1U C;  4Z66 C;  4XZQ D;  3WTP C;  3AZH C;  1TZY D;  3AYW A;  3B0C T;  5B1L C;  3C1C B;  4H9O B;  4ZUX D;  1P3O B;  3UT9 C;  5GSU B;  3MGS C;  3X1V D;  3AZL A;  1TAF B;  3V9R A;  1S32 A;  4ZBJ B;  3REJ B;  3AN2 A;  3LZ0 A;  1P34 C;  4CSR B;  5CHL B;  1P3P D;  5B2I A;  2LY8 A;  1AOI B;  1ID3 C;  5BNX B;  2F8N K;  5B0Y B;  5B24 D;  4WU9 A;  2F8N B;  3TU4 A;  5GT0 C;  3AFA D;  1P3M B;  3KXB D;  4J8W B;  3B6G D;  1S32 D;  3X1U D;  5CPK C;  3B0C W;  3MGQ C;  1JFI A;  2F8N D;  5B24 B;  4J8U D;  3B6F D;  3MGR A;  5E5A D;  1AOI D;  4UUZ A;  1U35 C;  3WKJ B;  4G91 C;  3W96 A;  3NQU A;  4WU8 B;  3AZG D;  2CV5 C;  2HIO D;  1P3G C;  5B32 C;  3WA9 A;  4LD9 D;  2ARO A;  3UTA D;  5CPJ C;  1P3L A;  3AZI C;  1P3P C;  3WTP E;  5B31 G;  3O62 B;  1EQZ A;  3R45 B;  5B31 A;  5CP6 A;  1BH8 B;  5JRG C;  3AV1 D;  4YS3 A;  3WA9 C;  1KX4 C;  3REL D;  5F99 C;  5B40 C;  5B2I B;  4NE3 A;  5B2J B;  5JA4 B;  3MGQ D;  4KGC B;  3WAA B;  3W99 A;  2IO5 C;  2PYO D;  5CP6 B;  4YM6 D;  5GSU A;  4WZS B;  2HUE B;  1A7W A;  1HQ3 D;  5GXQ B;  2FJ7 B;  1P3L C;  5E5A B;  4X23 B;  4J8U B;  3B6F B;  4Z5T D;  3KWQ A;  5B1M C;  3B6G B;  4XUJ C;  5DNM B;  1P3I B;  1WWI A;  1P3M D;  5F99 A;  5B32 G;  5B40 A;  3AZK D;  3W96 C;  3NQJ B;  5AV9 D;  3LZ0 C;  3KWQ C;  3AZE D;  5JRG A;  3VH5 A;  5B0Y D;  1KX3 D;  3UT9 A;  5BS7 A;  2BYM B;  5AV6 C;  1EQZ C;  3R45 A;  3W97 C;  3O62 A;  3AZI A;  3LJA A;  3REJ D;  3W99 C;  1M18 B;  1BH9 B;  1P3K D;  3WTP A;  3NQJ A;  4DRB A;  4YM6 C;  5BNX A;  4CSR A;  2NQB C;  5GT3 D;  3MVD A;  1P3F C;  4ZBJ C;  3REJ C;  2JSS A;  3UTB B;  4WNN B;  3AZL B;  1KX4 D;  5CP6 C;  3MGS A;  1P3K B;  4Z2M G;  4HGA C;  4J8W A;  4H9N A;  4KUD C;  5CPJ A;  4CAY B;  3WAA A;  3TU4 B;  5AVC B;  1KX5 D;  4WU9 C;  1ID3 A;  5B32 D;  4LD9 C;  1ZLA A;  1P34 A;  4J8X B;  3AZK B;  5B0Z C;  4R8P D;  4KHA B;  4QLC B;  3LZ1 A;  4NE5 A;  4WU8 C;  5B31 B;  5GT3 C;  1P3O A;  3AZF A;  5CPI B;  2F8N H;  2NZD A;  5AV5 A;  5B40 D;  3AZH A; 
#chains in the Genus database with same CATH topology
 2ARO B;  2Y2O A;  1W2E A;  5GT0 D;  3W97 D;  1N1J B;  5G49 A;  3AZE C;  5AV9 C;  3KWQ D;  3NQU B;  3H0M C;  1KX3 C;  4WNN A;  1P3F B;  5B0Y C;  3MGP D;  4UUZ B;  3AZM D;  3AN2 C;  1P3B C;  3AZL C;  4KHA A;  4QLC A;  4J8V B;  2Y2N A;  3W98 A;  5AVC D;  1ZLA B;  5B1M D;  4Z5T C;  5B1L A;  2BYM A;  4H9P B;  5B33 D;  4H9P A;  4M6B A;  3UTA B;  4LD9 B;  4J8X A;  1Q9C A;  3MNN C;  3AV1 A;  3W98 B;  2NZD D;  4X23 C;  4H9R A;  1M1A B;  3REI C;  2G5H C;  5B33 B;  3B6G C;  3WKJ D;  4XUJ B;  3MVD B;  5CPJ B;  3KXB C;  1N1J A;  4WJ3 C;  3MNN A;  3AV1 C;  5C3I B;  3W96 B;  5CPI C;  3X1U B;  4AWL C;  1P34 D;  2J8P A;  3AZH B;  2FJ7 A;  1ID3 D;  5DNN B;  3W97 B;  5JA4 A;  3H0L C;  5AV9 B;  3LZ1 B;  3W99 B;  2BYK B;  5AVB A;  1P3B A;  3AZH D;  1P34 B;  5AV8 B;  1M19 B;  1ZLA C;  1AOI C;  3IP4 C;  4H9Q B;  4X23 D;  4H9S C;  1Z2C B;  4ZUX B;  3A6N C;  2FJ7 C;  5E5A C;  4J8U C;  3B6F C;  2ZY2 A;  3AV2 C;  4R8P B;  2F8N G;  2NZD C;  2Y2G A;  4J8W C;  3AZF C;  3AFA C;  5AY8 C;  4JJN C;  3W98 C;  4Z2M H;  3MGQ B;  5AV6 D;  5B24 C;  4G92 C;  4ZUX A;  5B33 A;  5AVC C;  4H9Q A;  4G91 B;  1KX3 A;  4X23 A;  3AZJ B;  3REL B;  3AZE A;  4J8X C;  2NQB A;  3AV1 B;  5AV6 B;  1P3G B;  3X1S B;  3X1V C;  3MGS D;  4YM6 A;  1P3B D;  3LEL B;  3MGP A;  3AZM A;  5BNV A;  5AV5 C;  2DQN C;  5GT3 B;  3VH5 T;  1P3F D;  3O62 C;  5GT3 A;  5BS7 C;  2NQB B;  3LZ1 C;  3REL A;  1TZY C;  3X1S A;  4XZQ C;  3WTP D;  4YS3 B;  5BT1 D;  1ULY A;  3LJA D;  5B40 B;  5F99 B;  3EPL A;  3REJ A;  2W8S A;  4NE6 A;  1M19 C;  1P3K C;  2BG1 A;  1KX3 B;  5B2J C;  4HGA B;  4XUJ A;  3LZ1 D;  3WKJ A;  3WAA C;  3X1T D;  1S32 B;  5B1M A;  3WA9 D;  3KUY B;  4R8P C;  5B0Z D;  4QLC D;  4J8X D;  3AFA B;  3EG5 B;  3AYW B;  3F6T A;  1KX5 A;  4WV4 B;  4DRA A;  3W96 D;  3AZK C;  5CPJ D;  2F8N A;  3B0D C;  1P3L D;  2BYK A;  5AVB B;  1B67 A;  1HQ3 B;  5F99 D;  4LD9 A;  1M1A C;  3AV2 D;  2RVQ D;  5GSU D;  3X1V B;  3LZ0 B;  3VH6 W;  2NQB D;  3AZF D;  1P3O D;  5KDM A;  3LJA C;  5BT1 C;  1EQZ B;  5B1L B;  5C3I C;  1KU5 A;  3W97 A;  2PYO C;  4H9O A;  5AV6 A;  4AWL B;  1P3P A;  3EPJ A;  5GSU C;  3MGS B;  1M18 C;  1ZLA D;  1R4V A;  5B32 A;  5AV5 D;  3REH B;  3O62 D;  2YFW B;  5G49 B;  4H9R B;  1M1A A;  1EQZ D;  3VH5 W;  5FUG A;  5GT0 B;  1BH9 A;  3AZK A;  2RIQ A;  3P5J B;  3VH6 T;  3AZG A;  5AVB D;  3AZG C;  1WWS A;  1F66 B;  3A6N B;  4NFT A;  1B6W A;  4CAY A;  2L5A A;  3TU4 C;  1M19 D;  4WU9 B;  5FUG B;  3AYW D;  5AV8 D;  5BO0 B;  3WKJ C;  4J8W D;  2FJ7 D;  2CV5 A;  3A6N D;  1HQ3 A;  1HQ3 C;  1P3K A;  3KXB B;  1F66 D;  5B0Z B;  3AZN B;  3A1K A;  3VH6 A;  1KX4 A;  3W99 D;  3MNN D;  5B32 B;  3MGR C;  3FDD A;  3TU4 D;  1KX5 B;  3REL C;  5CPK A;  5B31 C;  4EO5 C;  3B0B A;  5JRG D;  3C1B B;  1P3P B;  5B2I D;  3WTP B;  4YS3 D;  5AV5 B;  2ARO C;  2YFV A;  2Y2Q A;  3AZI D;  1KX4 B;  3AZL D;  2ZY3 A;  3UT9 B;  5B2I C;  5BO0 A;  1H3O A;  5B1L D;  1TZY B;  1U35 A;  2DF4 C;  4YS3 C;  4XZQ B;  1P3B B;  4ZUX C;  1TZY A;  5AVC A;  3W98 D;  5AY8 D;  4JJN D;  1M18 A;  2HIO A;  3KSY A;  4J8V C;  3AV2 B;  5DNM A;  1P3I A;  2PYO A;  5AY8 A;  4JJN A;  1M18 D;  3AZG B;  1F66 C;  4WU8 D;  1U35 D;  1P3L B;  4J8U A;  3REI D;  3B6F A;  5GT0 A;  4G92 B;  5B1M B;  3X1U A;  3A1I A;  4J8V D;  3UTB A;  3C1B A;  2CWE A;  2Y2J A;  1P3G A;  2RVQ C;  3MNN B;  1P3A B;  3AZN D;  5B33 C;  3X1S C;  3KWQ B;  3MGR B;  3MGQ A;  4Z66 B;  5AVB C;  5B24 A;  4WU9 D;  1KX5 C;  2CV5 B;  2ARO D;  3UTA A;  1F1E A;  5GXQ D;  4R8P A;  2Y2H A;  3REK C;  3AN2 D;  3LJA B;  3MGP C;  3AZM C;  5CPI D;  5DNN C;  3A6N A;  3X1V A;  2CV5 D;  5CP6 D;  4YM6 B;  5B31 D;  4E44 A;  2PYO B;  5B2J A;  3X1T C;  3WAA D;  1M19 A;  4Z66 D;  1AOI A;  3MGR D;  5B2J D;  3AZJ A;  3C1C D;  1ID3 B;  4XZQ A;  3B6G A;  3LEL D;  2Y2P A;  1S32 C;  5AV8 C;  3KUY C;  2XD1 A;  4H9N B;  3AFA A;  3REH A;  3MVD D;  3C1C A;  3AZJ D;  3AYW C;  4KGC C;  2IO5 B;  5CPK B;  5E5A A;  4Z66 A;  3H0R C;  1M1A D;  2NZD B;  4H9S A;  4KGC A;  3AZF B;  5CPI A;  1HTA A;  3LZ0 D;  5AY8 B;  4JJN B;  5GXQ C;  4KUD D;  3KXB A;  1P3A C;  3UTB D;  2HIO B;  5KDM B;  4QLC C;  3UT9 D;  1BFM A;  1JFI B;  5B0Y A;  2Y2L A;  3AZJ C;  3AZI B;  5AV9 A;  3AZN C;  4E45 A;  1P3M A;  3AV2 A;  3REK B;  5DNN A;  3LEL C;  3LEL A;  3MGP B;  3AZM B;  5JRG B;  3C1B D;  3KUY D;  3WA9 B;  3C1C C;  1H3O B;  4Z5T A;  3REH C;  3X1T B;  1P3O C;  2JCH A;  3AZE B;  3KUY A;  4WU8 A;  4UPK A;  5DNN D;  3AN2 B;  2YFV B;  5DNM D;  1P3I D;  3REK D;  1P3A A;  2YFW A;  5B0Z A;  2ZY5 A;  2HUE C;  5GXQ A;  4Z5T B;  3X1T A;  3UTB C;  4XUJ D;  1P3M C;  3REK A;  1P3A D;  4KUD A;  2F2A C;  3AZN A;  1F66 A;  3UTA C;  4KUD B;  3X1S D;  4KGC D;  5DNM C;  5BNV B;  5AV8 A;  1P3I C;  2HIO C;  4J8V A;  2VQR A;  1P3G D;  3REI B;  1U35 B;  3REI A;  3B0D B;  5CPK D;  3MVD C;  1P3F A;  1BH8 A;  4DQY B;  3REH D;  1TAF A;  3V9R B;  4EO5 B;  3C1B C;  3X1U C;  4Z66 C;  4XZQ D;  3WTP C;  3AZH C;  1TZY D;  2ZM5 A;  3AYW A;  3B0C T;  5B1L C;  2XD5 A;  3C1C B;  2UWX A;  4H9O B;  4ZUX D;  1P3O B;  3UT9 C;  5GSU B;  3MGS C;  3X1V D;  3AZL A;  1TAF B;  3V9R A;  1S32 A;  4ZBJ B;  3REJ B;  3AN2 A;  3LZ0 A;  1P34 C;  3EPH A;  4CSR B;  5CHL B;  1P3P D;  5B2I A;  2LY8 A;  1AOI B;  1ID3 C;  5BNX B;  2F8N K;  5B0Y B;  5B24 D;  4WU9 A;  2F8N B;  2JE5 A;  3TU4 A;  5GT0 C;  3AFA D;  1T3U A;  1P3M B;  3KXB D;  4J8W B;  3B6G D;  1S32 D;  3X1U D;  5CPK C;  3B0C W;  3MGQ C;  1JFI A;  2F8N D;  5B24 B;  3AL0 C;  4J8U D;  3B6F D;  3MGR A;  5E5A D;  1AOI D;  4UUZ A;  1U35 C;  3WKJ B;  4G91 C;  3W96 A;  3NQU A;  4WU8 B;  3AZG D;  2CV5 C;  2HIO D;  1P3G C;  5B32 C;  3WA9 A;  4LD9 D;  2ARO A;  3UTA D;  5CPJ C;  1P3L A;  3AZI C;  1P3P C;  3WTP E;  5B31 G;  3O62 B;  2Y2M A;  1EQZ A;  3R45 B;  5B31 A;  5CP6 A;  2G5I C;  1BH8 B;  5JRG C;  3AV1 D;  4YS3 A;  3WA9 C;  1KX4 C;  3REL D;  5F99 C;  5B40 C;  5B2I B;  4NE3 A;  5B2J B;  5JA4 B;  3MGQ D;  4KGC B;  3WAA B;  3W99 A;  2IO5 C;  3EPK A;  2PYO D;  5CP6 B;  4YM6 D;  5GSU A;  4WZS B;  2HUE B;  1A7W A;  1HQ3 D;  5GXQ B;  2FJ7 B;  1P3L C;  5E5A B;  4X23 B;  4J8U B;  3B6F B;  4Z5T D;  3KWQ A;  5B1M C;  3B6G B;  4XUJ C;  5DNM B;  1P3I B;  1WWI A;  1P3M D;  5F99 A;  5B32 G;  5B40 A;  3AZK D;  3W96 C;  3NQJ B;  5AV9 D;  3LZ0 C;  3KWQ C;  3AZE D;  5JRG A;  3VH5 A;  2FFF B;  5B0Y D;  1KX3 D;  3UT9 A;  5BS7 A;  2BYM B;  5AV6 C;  1EQZ C;  3R45 A;  3W97 C;  3O62 A;  3AZI A;  3LJA A;  3REJ D;  3W99 C;  1M18 B;  1BH9 B;  1P3K D;  3WTP A;  3NQJ A;  4DRB A;  4YM6 C;  5BNX A;  4CSR A;  2NQB C;  5GT3 D;  1PZR A;  3MVD A;  1P3F C;  2Y2K A;  4ZBJ C;  3REJ C;  2JSS A;  3UTB B;  2Y2I A;  4WNN B;  3AZL B;  1KX4 D;  5CP6 C;  3MGS A;  1P3K B;  4Z2M G;  4HGA C;  4J8W A;  4H9N A;  4KUD C;  5CPJ A;  4CAY B;  3WAA A;  3TU4 B;  5AVC B;  1KX5 D;  4WU9 C;  2ZY4 A;  3KFU G;  1ID3 A;  5B32 D;  4LD9 C;  1ZLA A;  1P34 A;  4J8X B;  3AZK B;  5B0Z C;  4R8P D;  4KHA B;  4QLC B;  3LZ1 A;  4NE5 A;  4WU8 C;  5B31 B;  5GT3 C;  1P3O A;  3AZF A;  5CPI B;  2F8N H;  2NZD A;  5AV5 A;  5B40 D;  3AZH A; 
#chains in the Genus database with same CATH homology
 2ARO B;  2Y2O A;  1W2E A;  5GT0 D;  3W97 D;  1N1J B;  5G49 A;  3AZE C;  5AV9 C;  3KWQ D;  3NQU B;  3H0M C;  1KX3 C;  4WNN A;  1P3F B;  5B0Y C;  3MGP D;  4UUZ B;  3AZM D;  3AN2 C;  1P3B C;  3AZL C;  4KHA A;  4QLC A;  4J8V B;  2Y2N A;  3W98 A;  5AVC D;  1ZLA B;  5B1M D;  4Z5T C;  5B1L A;  2BYM A;  4H9P B;  5B33 D;  4H9P A;  4M6B A;  3UTA B;  4LD9 B;  4J8X A;  1Q9C A;  3MNN C;  3AV1 A;  3W98 B;  2NZD D;  4X23 C;  4H9R A;  1M1A B;  3REI C;  2G5H C;  5B33 B;  3B6G C;  3WKJ D;  4XUJ B;  3MVD B;  5CPJ B;  3KXB C;  1N1J A;  4WJ3 C;  3MNN A;  3AV1 C;  5C3I B;  3W96 B;  5CPI C;  3X1U B;  4AWL C;  1P34 D;  2J8P A;  3AZH B;  2FJ7 A;  1ID3 D;  5DNN B;  3W97 B;  5JA4 A;  3H0L C;  5AV9 B;  3LZ1 B;  3W99 B;  2BYK B;  5AVB A;  1P3B A;  3AZH D;  1P34 B;  5AV8 B;  1M19 B;  1ZLA C;  1AOI C;  3IP4 C;  4H9Q B;  4X23 D;  4H9S C;  1Z2C B;  4ZUX B;  3A6N C;  2FJ7 C;  5E5A C;  4J8U C;  3B6F C;  2ZY2 A;  3AV2 C;  4R8P B;  2F8N G;  2NZD C;  2Y2G A;  4J8W C;  3AZF C;  3AFA C;  5AY8 C;  4JJN C;  3W98 C;  4Z2M H;  3MGQ B;  5AV6 D;  5B24 C;  4G92 C;  4ZUX A;  5B33 A;  5AVC C;  4H9Q A;  4G91 B;  1KX3 A;  4X23 A;  3AZJ B;  3REL B;  3AZE A;  4J8X C;  2NQB A;  3AV1 B;  5AV6 B;  1P3G B;  3X1S B;  3X1V C;  3MGS D;  4YM6 A;  1P3B D;  3LEL B;  3MGP A;  3AZM A;  5BNV A;  5AV5 C;  2DQN C;  5GT3 B;  3VH5 T;  1P3F D;  3O62 C;  5GT3 A;  5BS7 C;  2NQB B;  3LZ1 C;  3REL A;  1TZY C;  3X1S A;  4XZQ C;  3WTP D;  4YS3 B;  5BT1 D;  1ULY A;  3LJA D;  5B40 B;  5F99 B;  3EPL A;  3REJ A;  2W8S A;  4NE6 A;  1M19 C;  1P3K C;  2BG1 A;  1KX3 B;  5B2J C;  4HGA B;  4XUJ A;  3LZ1 D;  3WKJ A;  3WAA C;  3X1T D;  1S32 B;  5B1M A;  3WA9 D;  3KUY B;  4R8P C;  5B0Z D;  4QLC D;  4J8X D;  3AFA B;  3EG5 B;  3AYW B;  3F6T A;  1KX5 A;  4WV4 B;  4DRA A;  3W96 D;  3AZK C;  5CPJ D;  2F8N A;  3B0D C;  1P3L D;  2BYK A;  5AVB B;  1B67 A;  1HQ3 B;  5F99 D;  4LD9 A;  1M1A C;  3AV2 D;  2RVQ D;  5GSU D;  3X1V B;  3LZ0 B;  3VH6 W;  2NQB D;  3AZF D;  1P3O D;  5KDM A;  3LJA C;  5BT1 C;  1EQZ B;  5B1L B;  5C3I C;  1KU5 A;  3W97 A;  2PYO C;  4H9O A;  5AV6 A;  4AWL B;  1P3P A;  3EPJ A;  5GSU C;  3MGS B;  1M18 C;  1ZLA D;  1R4V A;  5B32 A;  5AV5 D;  3REH B;  3O62 D;  2YFW B;  5G49 B;  4H9R B;  1M1A A;  1EQZ D;  3VH5 W;  5FUG A;  5GT0 B;  1BH9 A;  3AZK A;  2RIQ A;  3P5J B;  3VH6 T;  3AZG A;  5AVB D;  3AZG C;  1WWS A;  1F66 B;  3A6N B;  4NFT A;  1B6W A;  4CAY A;  2L5A A;  3TU4 C;  1M19 D;  4WU9 B;  5FUG B;  3AYW D;  5AV8 D;  5BO0 B;  3WKJ C;  4J8W D;  2FJ7 D;  2CV5 A;  3A6N D;  1HQ3 A;  1HQ3 C;  1P3K A;  3KXB B;  1F66 D;  5B0Z B;  3AZN B;  3A1K A;  3VH6 A;  1KX4 A;  3W99 D;  3MNN D;  5B32 B;  3MGR C;  3FDD A;  3TU4 D;  1KX5 B;  3REL C;  5CPK A;  5B31 C;  4EO5 C;  3B0B A;  5JRG D;  3C1B B;  1P3P B;  5B2I D;  3WTP B;  4YS3 D;  5AV5 B;  2ARO C;  2YFV A;  2Y2Q A;  3AZI D;  1KX4 B;  3AZL D;  2ZY3 A;  3UT9 B;  5B2I C;  5BO0 A;  1H3O A;  5B1L D;  1TZY B;  1U35 A;  2DF4 C;  4YS3 C;  4XZQ B;  1P3B B;  4ZUX C;  1TZY A;  5AVC A;  3W98 D;  5AY8 D;  4JJN D;  1M18 A;  2HIO A;  3KSY A;  4J8V C;  3AV2 B;  5DNM A;  1P3I A;  2PYO A;  5AY8 A;  4JJN A;  1M18 D;  3AZG B;  1F66 C;  4WU8 D;  1U35 D;  1P3L B;  4J8U A;  3REI D;  3B6F A;  5GT0 A;  4G92 B;  5B1M B;  3X1U A;  3A1I A;  4J8V D;  3UTB A;  3C1B A;  2CWE A;  2Y2J A;  1P3G A;  2RVQ C;  3MNN B;  1P3A B;  3AZN D;  5B33 C;  3X1S C;  3KWQ B;  3MGR B;  3MGQ A;  4Z66 B;  5AVB C;  5B24 A;  4WU9 D;  1KX5 C;  2CV5 B;  2ARO D;  3UTA A;  1F1E A;  5GXQ D;  4R8P A;  2Y2H A;  3REK C;  3AN2 D;  3LJA B;  3MGP C;  3AZM C;  5CPI D;  5DNN C;  3A6N A;  3X1V A;  2CV5 D;  5CP6 D;  4YM6 B;  5B31 D;  4E44 A;  2PYO B;  5B2J A;  3X1T C;  3WAA D;  1M19 A;  4Z66 D;  1AOI A;  3MGR D;  5B2J D;  3AZJ A;  3C1C D;  1ID3 B;  4XZQ A;  3B6G A;  3LEL D;  2Y2P A;  1S32 C;  5AV8 C;  3KUY C;  2XD1 A;  4H9N B;  3AFA A;  3REH A;  3MVD D;  3C1C A;  3AZJ D;  3AYW C;  4KGC C;  2IO5 B;  5CPK B;  5E5A A;  4Z66 A;  3H0R C;  1M1A D;  2NZD B;  4H9S A;  4KGC A;  3AZF B;  5CPI A;  1HTA A;  3LZ0 D;  5AY8 B;  4JJN B;  5GXQ C;  4KUD D;  3KXB A;  1P3A C;  3UTB D;  2HIO B;  5KDM B;  4QLC C;  3UT9 D;  1BFM A;  1JFI B;  5B0Y A;  2Y2L A;  3AZJ C;  3AZI B;  5AV9 A;  3AZN C;  4E45 A;  1P3M A;  3AV2 A;  3REK B;  5DNN A;  3LEL C;  3LEL A;  3MGP B;  3AZM B;  5JRG B;  3C1B D;  3KUY D;  3WA9 B;  3C1C C;  1H3O B;  4Z5T A;  3REH C;  3X1T B;  1P3O C;  2JCH A;  3AZE B;  3KUY A;  4WU8 A;  4UPK A;  5DNN D;  3AN2 B;  2YFV B;  5DNM D;  1P3I D;  3REK D;  1P3A A;  2YFW A;  5B0Z A;  2ZY5 A;  2HUE C;  5GXQ A;  4Z5T B;  3X1T A;  3UTB C;  4XUJ D;  1P3M C;  3REK A;  1P3A D;  4KUD A;  2F2A C;  3AZN A;  1F66 A;  3UTA C;  4KUD B;  3X1S D;  4KGC D;  5DNM C;  5BNV B;  5AV8 A;  1P3I C;  2HIO C;  4J8V A;  2VQR A;  1P3G D;  3REI B;  1U35 B;  3REI A;  3B0D B;  5CPK D;  3MVD C;  1P3F A;  1BH8 A;  4DQY B;  3REH D;  1TAF A;  3V9R B;  4EO5 B;  3C1B C;  3X1U C;  4Z66 C;  4XZQ D;  3WTP C;  3AZH C;  1TZY D;  2ZM5 A;  3AYW A;  3B0C T;  5B1L C;  2XD5 A;  3C1C B;  2UWX A;  4H9O B;  4ZUX D;  1P3O B;  3UT9 C;  5GSU B;  3MGS C;  3X1V D;  3AZL A;  1TAF B;  3V9R A;  1S32 A;  4ZBJ B;  3REJ B;  3AN2 A;  3LZ0 A;  1P34 C;  3EPH A;  4CSR B;  5CHL B;  1P3P D;  5B2I A;  2LY8 A;  1AOI B;  1ID3 C;  5BNX B;  2F8N K;  5B0Y B;  5B24 D;  4WU9 A;  2F8N B;  2JE5 A;  3TU4 A;  5GT0 C;  3AFA D;  1T3U A;  1P3M B;  3KXB D;  4J8W B;  3B6G D;  1S32 D;  3X1U D;  5CPK C;  3B0C W;  3MGQ C;  1JFI A;  2F8N D;  5B24 B;  3AL0 C;  4J8U D;  3B6F D;  3MGR A;  5E5A D;  1AOI D;  4UUZ A;  1U35 C;  3WKJ B;  4G91 C;  3W96 A;  3NQU A;  4WU8 B;  3AZG D;  2CV5 C;  2HIO D;  1P3G C;  5B32 C;  3WA9 A;  4LD9 D;  2ARO A;  3UTA D;  5CPJ C;  1P3L A;  3AZI C;  1P3P C;  3WTP E;  5B31 G;  3O62 B;  2Y2M A;  1EQZ A;  3R45 B;  5B31 A;  5CP6 A;  2G5I C;  1BH8 B;  5JRG C;  3AV1 D;  4YS3 A;  3WA9 C;  1KX4 C;  3REL D;  5F99 C;  5B40 C;  5B2I B;  4NE3 A;  5B2J B;  5JA4 B;  3MGQ D;  4KGC B;  3WAA B;  3W99 A;  2IO5 C;  3EPK A;  2PYO D;  5CP6 B;  4YM6 D;  5GSU A;  4WZS B;  2HUE B;  1A7W A;  1HQ3 D;  5GXQ B;  2FJ7 B;  1P3L C;  5E5A B;  4X23 B;  4J8U B;  3B6F B;  4Z5T D;  3KWQ A;  5B1M C;  3B6G B;  4XUJ C;  5DNM B;  1P3I B;  1WWI A;  1P3M D;  5F99 A;  5B32 G;  5B40 A;  3AZK D;  3W96 C;  3NQJ B;  5AV9 D;  3LZ0 C;  3KWQ C;  3AZE D;  5JRG A;  3VH5 A;  2FFF B;  5B0Y D;  1KX3 D;  3UT9 A;  5BS7 A;  2BYM B;  5AV6 C;  1EQZ C;  3R45 A;  3W97 C;  3O62 A;  3AZI A;  3LJA A;  3REJ D;  3W99 C;  1M18 B;  1BH9 B;  1P3K D;  3WTP A;  3NQJ A;  4DRB A;  4YM6 C;  5BNX A;  4CSR A;  2NQB C;  5GT3 D;  1PZR A;  3MVD A;  1P3F C;  2Y2K A;  4ZBJ C;  3REJ C;  2JSS A;  3UTB B;  2Y2I A;  4WNN B;  3AZL B;  1KX4 D;  5CP6 C;  3MGS A;  1P3K B;  4Z2M G;  4HGA C;  4J8W A;  4H9N A;  4KUD C;  5CPJ A;  4CAY B;  3WAA A;  3TU4 B;  5AVC B;  1KX5 D;  4WU9 C;  2ZY4 A;  3KFU G;  1ID3 A;  5B32 D;  4LD9 C;  1ZLA A;  1P34 A;  4J8X B;  3AZK B;  5B0Z C;  4R8P D;  4KHA B;  4QLC B;  3LZ1 A;  4NE5 A;  4WU8 C;  5B31 B;  5GT3 C;  1P3O A;  3AZF A;  5CPI B;  2F8N H;  2NZD A;  5AV5 A;  5B40 D;  3AZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...