3LJAC

Using soft x-rays for a detailed picture of divalent metal binding in the nucleosome
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Using soft X-rays for a detailed picture of divalent metal binding in the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ljaC00
3KWQA 4DRBA 3W98D 3AZNA 3B6GB 5DNMB 3W98A 2PYOD 1ZLAC 1M18A 5JA4A 2PYOA 3AV1A 1TAFB 1P3LC 2HIOB 3X1SD 4XUJC 5AV6D 3AZMB 3X1SA 1BH9B 5AV6A 1P3AC 5F99C 5B31C 5CPJD 5B1MB 5AVCB 4Z5TC 3VH6W 5B2IC 3REJB 3W97B 5BT1D 1TZYC 3REKD 5AV9D 1EQZB 2BYKA 1HQ3C 4J8WA 1KX5B 2F8NB 5C3IB 3KWQB 1ZLAA 3WKJC 4H9QA 5B32G 1P3LA 3AV2C 3W98B 3WAAB 4XUJA 1P3AD 5F99D 5B31D 5JA4B 2PYOB 1P3AA 5B31A 3UTAC 5CP6C 4Z5TD 4YS3C 3AZLA 2FJ7C 5AVBC 5B2ID 3X1SB 4J8UD 4Z5TA 5AV6B 4XZQC 2YFWB 5B2IA 1TZYD 3LJAC 5CPJB 1HQ3D 1TZYA 3AZHB 3AZEB 3AN2D 1HQ3A 1HTAA 1JFIB 1P3PC 3WKJD 1M19C 3B6FD 3WKJA 2NZDD 3AFAC 3REKB 5AV9B 3AV2A 3UTAD 4HGAC 3VH5T 4YS3D 1ID3C 2F8NK 2FJ7D 5KDMA 3UTAA 5AVBD 5CP6A 3KXBD 2FJ7A 5B0ZD 5AVBA 3X1VB 1P3AB 4XZQA 5B31B 5F99B 3LJAA 1P3PD 5AV8D 1F66C 5B2IB 4J8UB 1P3PA 1M19D 2CV5C 1TZYB 3AFAD 1M19A 3AN2B 1ID3D 1H3OA 1S32C 1ID3A 3B6FB 2NZDB 1AOID 4Z2MG 3WTPE 3UTAB 4YS3B 1F66D 4E45A 3KXBB 1F66A 5B0ZB 4H9NB 1P3MC 2CV5A 4ZBJB 2NQBC 1U35C 5CPKC 3LZ0C 1P3PB 5AV8B 4ZUXD 1S32D 5GT3B 1S32A 3AFAB 2F8NG 3A6NC 1H3OB 4HGAB 1ID3B 5JRGB 5DNNC 3REIC 4WNNA 3MGRC 1KX4C 4LD9D 3X1UB 4Z66A 1AOIB 1P3MD 4WU8C 5B24C 5CPIB 4H9PB 4WU9C 1P3MA 2NQBA 1U35A 1F66B 5CPKA 3LZ0A 3AZND 3WA9A 5AY8B 3MGSB 1BH8B 2BYMA 5B33C 1B6WA 1M18D 4J8WC 3A6ND 3AV1D 3A6NA 3REID 4ZUXB 3MGRD 3RELC 4M6BA 5DNNA 3REIA 5GSUC 3MGRA 1M1AC 1KX4A 4KUDC 2L5AA 4WU8A 3AZLC 3KUYC 5B24A 3LELB 3MNNC 4WU9A 4LD9B 4Z2MH 5B33D 3VH6A 4J8VB 1P3MB 2IO5C 4J8WD 1A7WA 5B33A 1ZLAD 4H9OA 4EO5C 1R4VA 5FUGA 4X23C 1P3LD 4XUJD 3AZNB 5BS7C 3RELA 2JSSA 1M1AD 4CAYA 4KGCC 4KUDD 5GSUA 1M18B 3A6NB 1M1AA 3AV1B 4KUDA 4G91C 3AZLD 3R45A 4YM6C 3KUYD 4WV4B 3MNND 3REIB 3KUYA 2F8NH 3MNNA 5B0YC 4JJNC 1N1JA 4QLCC 5B32C 3MGPC 4X23D 3UT9C 4X23A 3AV2D 2BYKB 3VH5W 5B33B 4H9OB 5BS7A 4J8WB 4KGCA 4R8PC 1ZLAB 4H9QB 5CP6D 3WAAC 3C1CC 1P3LB 5E5AC 4YM6A 3MGQC 4XUJB 1P3IC 4XZQD 3LJAD 1M1AB 4KUDB 4JJND 3REHC 1P3FC 5B0YA 4QLCD 5B32D 4JJNA 3AZLB 3MGPD 3KUYB 4QLCA 4Z5TB 5B32A 3MNNB 3MGPA 5GT0C 3UT9A 4UUZA 4R8PD 1HQ3B 4KHAA 4EO5B 4R8PA 3C1CD 4X23B 5BNXA 3X1TC 5E5AD 3MGQD 3WKJB 1P3ID 3C1CA 3WAAA 5E5AA 4G92C 3AV2B 1P3BC 3MGQA 1P3IA 3REHD 4WZSB 1P3FD 4G91B 3REHA 5KDMB 1P3FA 5CP6B 3W96C 3AZIC 5BNVA 2FJ7B 5AVBB 3B0CW 4Z66C 4XZQB 4CSRA 1P3GC 5GT0D 3KSYA 2CV5D 3LJAB 4JJNB 3B6GC 5GT0A 4QLCB 1P34A 1B67A 3MGPB 3X1TD 3WA9C 3TU4C 4UUZB 1P3KC 3X1TA 1M19B 2YFVA 3AZMC 1P3BA 2HUEC 4R8PB 5AVCC 3W96D 3AZID 5E5AB 3MGQB 4Z66D 4J8XC 3W96A 3AZIA 1P3GD 3REJC 3W97C 3NQUA 1P3FB 1P3GA 2NQBD 3W99C 1U35D 5BNVB 5CPKD 3B6GA 3LZ0D 1KX5C 3WA9D 4CSRB 3TU4D 1P3KD 5GT0B 3TU4A 2CV5B 1P3KA 3AZGC 3AZMA 1BH9A 5AVCD 3AZKC 3X1TB 5DNND 4J8XD 3NQJA 5AVCA 1S32B 1KX4D 3B0DC 4NFTA 4G92B 4J8XA 4WU8D 3REJA 3W97A 5B24D 5CPJC 3W99D 3B0BA 5AV5C 3AZHC 4WU9D 3AZEC 4WNNB 5B2JC 2F8ND 3W99A 3AZIB 5B31G 1KX5A 4Z66B 3NQUB 2F8NA 1P3GB 5B40C 5BT1C 2CWEA 5G49A 3REKC 2AROC 5AV9C 3MVDC 3AZGD 2RVQC 2NQBB 1U35B 5CPKB 3C1BC 3AZGA 3LZ0B 3AZKD 3WA9B 3RELD 3TU4B 1P3KB 3AZKA 2BYMB 4NE6A 5GSUD 3X1VC 2HUEB 2YFWA 5AV5D 3AZHD 3AZED 3NQJB 5B2JD 5CPJA 5AV5A 3AZHA 5DNNB 3AZEA 3MGRB 1KU5A 4J8XB 5B2JA 1KX4B 4J8UC 3AYWC 1JFIA 5B40D 4WU8B 2AROD 5B40A 3VH6T 3MVDD 1BFMA 5B24B 1Q9CA 2RVQD 3W99B 4H9RA 3C1BD 3REKA 2AROA 5AV9A 3MVDA 3AN2C 4WU9B 3UTBC 1F1EA 3C1BA 5G49B 4KGCD 3B6FC 3X1VD 2NZDC 3AZGB 2LY8A 5FUGB 3X1VA 3VH5A 5F99A 4YM6D 3AZKB 3O62C 4AWLC 3RELB 4CAYB 3AYWD 3B0DB 3KXBC 3V9RA 5GSUB 5B0YD 5B0ZC 4J8UA 3AYWA 1WWSA 3R45B 5AV5B 4ZBJC 5B2JB 3UTBD 5AV8C 3UT9D 3AN2A 3AZJC 3UTBA 5B40B 5GT3C 1N1JB 4NE3A 4H9RB 1P34C 2AROB 2IO5B 3MVDB 3LZ1C 1P3OC 3B6FA 2NZDA 1ULYA 3C1BB 4E44A 5BO0A 3WAAD 5JRGC 3O62D 4YS3A 3AZFC 3O62A 4KGCB 3X1UC 5GXQC 3KXBA 1AOIC 5B0ZA 5CPIC 4H9NA 5B1LC 4YM6B 3V9RB 1KX3C 3WTPC 3AZJD 3AYWB 5AY8C 5GT3D 5AV8A 5B0YB 3MGSC 3AZJA 1P34D 5GT3A 3LZ1D 1P3OD 5DNMC 3AFAA 5B32B 3LZ1A 1P3OA 5JRGD 3UTBB 4ZUXC 3UT9B 2HIOC 3AZFD 5JRGA 1P3BD 3X1UD 5GXQD 3AZFA 4KHAB 3X1UA 5BO0B 5GXQA 5CPID 5B1LD 4H9SC 5BNXB 1AOIA 5B1MC 1WWIA 3C1CB 5CPIA 5B1LA 4H9PA 3WTPD 3O62B 3LELC 4AWLB 1KX3D 1P3IB 5AY8D 4LD9C 1KX3A 3WTPA 3MGSD 3REHB 5AY8A 4J8VC 1EQZC 5DNMD 3B6GD 3B0CT 4DRAA 1BH8A 3MGSA 5DNMA 5C3IC 3KWQC 2HIOD 3AZJB 3AZNC 1TAFA 4ZUXA 3AZMD 2HIOA 3W98C 1P34B 3LZ1B 4NE5A 1P3OB 1M18C 2PYOC 3AV1C 5B1MD 4H9SA 3LELD 2YFVB 3X1SC 5B1MA 3AZFB 5AV6C 3LELA 1P3BB 3REJD 3W97D 5GXQB 4J8VD 1EQZD 4LD9A 5CHLB 5B1LB 4J8VA 1EQZA 1KX5D 3KWQD 3W96B 1KX3B 3WTPB
chains in the Genus database with same CATH superfamily
3KWQA 4DRBA 3W98D 2G5HC 3AZNA 3B6GB 5DNMB 3W98A 2PYOD 1ZLAC 1M18A 5JA4A 2PYOA 3AV1A 3AL0C 1TAFB 1P3LC 2HIOB 3X1SD 4XUJC 5AV6D 3EPKA 3AZMB 3X1SA 1BH9B 5AV6A 1P3AC 5F99C 5B31C 5CPJD 3A1IA 3P5JB 5B1MB 5AVCB 4Z5TC 1PZRA 3VH6W 5B2IC 2G5IC 3REJB 3W97B 5BT1D 1TZYC 3REKD 5AV9D 1EQZB 2BYKA 1HQ3C 4J8WA 1KX5B 2F8NB 5C3IB 3KWQB 1ZLAA 3WKJC 4H9QA 5B32G 1P3LA 3AV2C 3W98B 3WAAB 4XUJA 1P3AD 5F99D 5B31D 5JA4B 2PYOB 2ZY4A 1P3AA 5B31A 3UTAC 5CP6C 4Z5TD 2Y2MA 4YS3C 3AZLA 2FJ7C 5AVBC 5B2ID 3X1SB 4J8UD 4Z5TA 5AV6B 4XZQC 2YFWB 5B2IA 1TZYD 2Y2NA 3LJAC 5CPJB 1HQ3D 1TZYA 3AZHB 3AZEB 3AN2D 1HQ3A 1HTAA 1JFIB 1P3PC 3WKJD 1M19C 3B6FD 3WKJA 2NZDD 3AFAC 3REKB 5AV9B 3AV2A 3UTAD 2ZY2A 4HGAC 3VH5T 4YS3D 1ID3C 2F8NK 2FJ7D 5KDMA 3UTAA 5AVBD 5CP6A 3KXBD 2FJ7A 5B0ZD 5AVBA 3X1VB 1P3AB 4XZQA 5B31B 5F99B 2W8SA 3LJAA 2JCHA 1P3PD 5AV8D 1F66C 5B2IB 4J8UB 4WJ3C 1P3PA 1M19D 2CV5C 1TZYB 3AFAD 1M19A 3AN2B 1ID3D 1H3OA 1S32C 1ID3A 1Z2CB 3B6FB 2NZDB 1AOID 4Z2MG 3WTPE 3UTAB 4YS3B 1F66D 4E45A 2Y2LA 3KXBB 1F66A 5B0ZB 4H9NB 1P3MC 2CV5A 4ZBJB 2NQBC 2DQNC 1U35C 5CPKC 3LZ0C 1P3PB 5AV8B 4ZUXD 1S32D 5GT3B 1S32A 3AFAB 2F8NG 3A6NC 3EPJA 1H3OB 4HGAB 1ID3B 5JRGB 5DNNC 3REIC 4WNNA 1W2EA 3MGRC 1KX4C 4LD9D 3X1UB 4Z66A 1AOIB 1P3MD 4WU8C 2ZY5A 5B24C 5CPIB 4H9PB 4WU9C 1P3MA 2NQBA 1U35A 1F66B 5CPKA 2BG1A 3LZ0A 3AZND 3WA9A 5AY8B 2Y2PA 3MGSB 1BH8B 2BYMA 5B33C 1B6WA 1M18D 4J8WC 3A6ND 3AV1D 3A6NA 3REID 4ZUXB 2ZM5A 3MGRD 3RELC 4M6BA 5DNNA 3REIA 5GSUC 3MGRA 1M1AC 1KX4A 4KUDC 2L5AA 4WU8A 3AZLC 3KUYC 5B24A 3LELB 3MNNC 4WU9A 4LD9B 4Z2MH 5B33D 3VH6A 4J8VB 1P3MB 2IO5C 4J8WD 1A7WA 5B33A 1ZLAD 4H9OA 4EO5C 1R4VA 2UWXA 5FUGA 4X23C 1P3LD 4XUJD 3AZNB 5BS7C 2FFFB 2JSSA 3RELA 4CAYA 1M1AD 4KGCC 4KUDD 5GSUA 1M18B 3A6NB 1M1AA 3AV1B 4KUDA 4G91C 3AZLD 3R45A 4YM6C 3KUYD 4WV4B 3MNND 3REIB 3KUYA 2F8NH 3MNNA 5B0YC 2RIQA 4JJNC 1N1JA 4QLCC 5B32C 3MGPC 4X23D 3UT9C 4X23A 3AV2D 2BYKB 3VH5W 5B33B 4H9OB 5BS7A 4J8WB 4KGCA 4R8PC 1ZLAB 3FDDA 4H9QB 5CP6D 3WAAC 3C1CC 1P3LB 5E5AC 4YM6A 3MGQC 4XUJB 1P3IC 4XZQD 3LJAD 1M1AB 4KUDB 4JJND 3REHC 1P3FC 5B0YA 4QLCD 5B32D 4JJNA 3AZLB 3MGPD 3KUYB 4QLCA 4Z5TB 5B32A 3MNNB 3MGPA 2JE5A 5GT0C 3UT9A 4UUZA 4R8PD 1HQ3B 4KHAA 4EO5B 4R8PA 3C1CD 4X23B 5BNXA 3X1TC 5E5AD 3MGQD 3WKJB 1P3ID 3C1CA 3WAAA 5E5AA 4G92C 3AV2B 1P3BC 3MGQA 1P3IA 3REHD 4WZSB 1P3FD 4G91B 3REHA 5KDMB 1P3FA 5CP6B 3W96C 2DF4C 5BNVA 3AZIC 2FJ7B 5AVBB 3B0CW 2XD1A 4Z66C 1T3UA 4CSRA 4XZQB 1P3GC 5GT0D 3KSYA 2CV5D 3EPHA 3LJAB 4JJNB 3B6GC 5GT0A 4QLCB 1P34A 1B67A 2VQRA 3MGPB 3X1TD 3WA9C 3TU4C 4UUZB 1P3KC 3X1TA 1M19B 2YFVA 3AZMC 1P3BA 2HUEC 4R8PB 5AVCC 3W96D 3AZID 3IP4C 5E5AB 3MGQB 4Z66D 4J8XC 3W96A 3AZIA 1P3GD 3REJC 3W97C 3NQUA 1P3FB 1P3GA 2Y2IA 2NQBD 3W99C 1U35D 5BNVB 5CPKD 3B6GA 3LZ0D 1KX5C 3WA9D 4CSRB 3TU4D 1P3KD 5GT0B 3TU4A 2CV5B 1P3KA 3AZGC 4UPKA 3AZMA 1BH9A 5AVCD 3AZKC 3X1TB 5DNND 4J8XD 3NQJA 5AVCA 1S32B 1KX4D 3B0DC 4NFTA 4G92B 4J8XA 2F2AC 4WU8D 3REJA 3W97A 5B24D 5CPJC 3W99D 3B0BA 5AV5C 3AZHC 4WU9D 3AZEC 4WNNB 5B2JC 2F8ND 3W99A 3AZIB 5B31G 1KX5A 4Z66B 3NQUB 2F8NA 1P3GB 5B40C 5BT1C 2CWEA 5G49A 3REKC 2AROC 5AV9C 3MVDC 3AZGD 2RVQC 2NQBB 1U35B 5CPKB 3C1BC 3AZGA 3LZ0B 3AZKD 3WA9B 3RELD 3TU4B 1P3KB 3AZKA 2BYMB 3F6TA 4NE6A 5GSUD 3H0RC 3X1VC 2HUEB 3H0LC 2YFWA 5AV5D 3AZHD 3AZED 3NQJB 5B2JD 5CPJA 5AV5A 3AZHA 5DNNB 3AZEA 3MGRB 1KU5A 4J8XB 5B2JA 1KX4B 4J8UC 3AYWC 1JFIA 5B40D 2J8PA 2AROD 4WU8B 5B40A 3VH6T 3MVDD 1BFMA 5B24B 1Q9CA 2RVQD 3W99B 4H9RA 3C1BD 3REKA 2AROA 5AV9A 3MVDA 3AN2C 4WU9B 3UTBC 1F1EA 3C1BA 5G49B 4KGCD 3B6FC 3X1VD 2NZDC 3AZGB 2LY8A 5FUGB 3X1VA 3VH5A 5F99A 4YM6D 3AZKB 3O62C 4AWLC 3RELB 4CAYB 3AYWD 3B0DB 3KXBC 3V9RA 5GSUB 5B0YD 5B0ZC 4J8UA 3AYWA 1WWSA 3R45B 3A1KA 4ZBJC 5AV5B 5B2JB 3UTBD 5AV8C 3UT9D 3AN2A 3AZJC 2ZY3A 3UTBA 5B40B 5GT3C 3EPLA 1N1JB 4NE3A 4H9RB 1P34C 2AROB 2IO5B 3MVDB 3LZ1C 2XD5A 1P3OC 3B6FA 2NZDA 1ULYA 3C1BB 4E44A 5BO0A 3WAAD 5JRGC 3O62D 4YS3A 3AZFC 3O62A 4KGCB 3X1UC 5GXQC 3KXBA 1AOIC 5B0ZA 5CPIC 4H9NA 5B1LC 4YM6B 3V9RB 1KX3C 3WTPC 3AZJD 3AYWB 2Y2GA 5AY8C 5GT3D 5AV8A 5B0YB 2Y2KA 3MGSC 3AZJA 1P34D 5GT3A 3LZ1D 1P3OD 5DNMC 3AFAA 5B32B 4DQYB 3LZ1A 1P3OA 5JRGD 3UTBB 4ZUXC 3UT9B 2HIOC 3EG5B 3AZFD 3H0MC 5JRGA 1P3BD 3X1UD 5GXQD 3AZFA 4KHAB 3X1UA 5BO0B 5GXQA 5CPID 5B1LD 4H9SC 5BNXB 1AOIA 5B1MC 1WWIA 3C1CB 5CPIA 5B1LA 4H9PA 3WTPD 3O62B 3LELC 4AWLB 1KX3D 1P3IB 5AY8D 4LD9C 1KX3A 3WTPA 3MGSD 3REHB 5AY8A 4J8VC 1EQZC 5DNMD 2Y2JA 3B6GD 3B0CT 4DRAA 1BH8A 3MGSA 5DNMA 5C3IC 3KWQC 3KFUG 2HIOD 3AZJB 3AZNC 1TAFA 4ZUXA 3AZMD 2HIOA 3W98C 2Y2HA 1P34B 3LZ1B 4NE5A 1P3OB 1M18C 2PYOC 3AV1C 5B1MD 4H9SA 2Y2QA 3LELD 2YFVB 2Y2OA 3X1SC 5B1MA 3AZFB 5AV6C 3LELA 1P3BB 3REJD 3W97D 5GXQB 4J8VD 1EQZD 4LD9A 5CHLB 5B1LB 4J8VA 1EQZA 1KX5D 3KWQD 3W96B 1KX3B 3WTPB
chains in the Genus database with same CATH topology
3KWQA 4DRBA 3W98D 2G5HC 3AZNA 3B6GB 5DNMB 3W98A 2PYOD 1ZLAC 1M18A 5JA4A 2PYOA 3AV1A 3AL0C 1TAFB 1P3LC 2HIOB 3X1SD 4XUJC 5AV6D 3EPKA 3AZMB 3X1SA 1BH9B 5AV6A 1P3AC 5F99C 5B31C 5CPJD 3A1IA 3P5JB 5B1MB 5AVCB 4Z5TC 1PZRA 3VH6W 5B2IC 2G5IC 3REJB 3W97B 5BT1D 1TZYC 3REKD 5AV9D 1EQZB 2BYKA 1HQ3C 4J8WA 1KX5B 2F8NB 5C3IB 3KWQB 1ZLAA 3WKJC 4H9QA 5B32G 1P3LA 3AV2C 3W98B 3WAAB 4XUJA 1P3AD 5F99D 5B31D 5JA4B 2PYOB 2ZY4A 1P3AA 5B31A 3UTAC 5CP6C 4Z5TD 2Y2MA 4YS3C 3AZLA 2FJ7C 5AVBC 5B2ID 3X1SB 4J8UD 4Z5TA 5AV6B 4XZQC 2YFWB 5B2IA 1TZYD 2Y2NA 3LJAC 5CPJB 1HQ3D 1TZYA 3AZHB 3AZEB 3AN2D 1HQ3A 1HTAA 1JFIB 1P3PC 3WKJD 1M19C 3B6FD 3WKJA 2NZDD 3AFAC 3REKB 5AV9B 3AV2A 3UTAD 2ZY2A 4HGAC 3VH5T 4YS3D 1ID3C 2F8NK 2FJ7D 5KDMA 3UTAA 5AVBD 5CP6A 3KXBD 2FJ7A 5B0ZD 5AVBA 3X1VB 1P3AB 4XZQA 5B31B 5F99B 2W8SA 3LJAA 2JCHA 1P3PD 5AV8D 1F66C 5B2IB 4J8UB 4WJ3C 1P3PA 1M19D 2CV5C 1TZYB 3AFAD 1M19A 3AN2B 1ID3D 1H3OA 1S32C 1ID3A 1Z2CB 3B6FB 2NZDB 1AOID 4Z2MG 3WTPE 3UTAB 4YS3B 1F66D 4E45A 2Y2LA 3KXBB 1F66A 5B0ZB 4H9NB 1P3MC 2CV5A 4ZBJB 2NQBC 2DQNC 1U35C 5CPKC 3LZ0C 1P3PB 5AV8B 4ZUXD 1S32D 5GT3B 1S32A 3AFAB 2F8NG 3A6NC 3EPJA 1H3OB 4HGAB 1ID3B 5JRGB 5DNNC 3REIC 4WNNA 1W2EA 3MGRC 1KX4C 4LD9D 3X1UB 4Z66A 1AOIB 1P3MD 4WU8C 2ZY5A 5B24C 5CPIB 4H9PB 4WU9C 1P3MA 2NQBA 1U35A 1F66B 5CPKA 2BG1A 3LZ0A 3AZND 3WA9A 5AY8B 2Y2PA 3MGSB 1BH8B 2BYMA 5B33C 1B6WA 1M18D 4J8WC 3A6ND 3AV1D 3A6NA 3REID 4ZUXB 2ZM5A 3MGRD 3RELC 4M6BA 5DNNA 3REIA 5GSUC 3MGRA 1M1AC 1KX4A 4KUDC 2L5AA 4WU8A 3AZLC 3KUYC 5B24A 3LELB 3MNNC 4WU9A 4LD9B 4Z2MH 5B33D 3VH6A 4J8VB 1P3MB 2IO5C 4J8WD 1A7WA 5B33A 1ZLAD 4H9OA 4EO5C 1R4VA 2UWXA 5FUGA 4X23C 1P3LD 4XUJD 3AZNB 5BS7C 2FFFB 2JSSA 3RELA 4CAYA 1M1AD 4KGCC 4KUDD 5GSUA 1M18B 3A6NB 1M1AA 3AV1B 4KUDA 4G91C 3AZLD 3R45A 4YM6C 3KUYD 4WV4B 3MNND 3REIB 3KUYA 2F8NH 3MNNA 5B0YC 2RIQA 4JJNC 1N1JA 4QLCC 5B32C 3MGPC 4X23D 3UT9C 4X23A 3AV2D 2BYKB 3VH5W 5B33B 4H9OB 5BS7A 4J8WB 4KGCA 4R8PC 1ZLAB 3FDDA 4H9QB 5CP6D 3WAAC 3C1CC 1P3LB 5E5AC 4YM6A 3MGQC 4XUJB 1P3IC 4XZQD 3LJAD 1M1AB 4KUDB 4JJND 3REHC 1P3FC 5B0YA 4QLCD 5B32D 4JJNA 3AZLB 3MGPD 3KUYB 4QLCA 4Z5TB 5B32A 3MNNB 3MGPA 2JE5A 5GT0C 3UT9A 4UUZA 4R8PD 1HQ3B 4KHAA 4EO5B 4R8PA 3C1CD 4X23B 5BNXA 3X1TC 5E5AD 3MGQD 3WKJB 1P3ID 3C1CA 3WAAA 5E5AA 4G92C 3AV2B 1P3BC 3MGQA 1P3IA 3REHD 4WZSB 1P3FD 4G91B 3REHA 5KDMB 1P3FA 5CP6B 3W96C 2DF4C 5BNVA 3AZIC 2FJ7B 5AVBB 3B0CW 2XD1A 4Z66C 1T3UA 4CSRA 4XZQB 1P3GC 5GT0D 3KSYA 2CV5D 3EPHA 3LJAB 4JJNB 3B6GC 5GT0A 4QLCB 1P34A 1B67A 2VQRA 3MGPB 3X1TD 3WA9C 3TU4C 4UUZB 1P3KC 3X1TA 1M19B 2YFVA 3AZMC 1P3BA 2HUEC 4R8PB 5AVCC 3W96D 3AZID 3IP4C 5E5AB 3MGQB 4Z66D 4J8XC 3W96A 3AZIA 1P3GD 3REJC 3W97C 3NQUA 1P3FB 1P3GA 2Y2IA 2NQBD 3W99C 1U35D 5BNVB 5CPKD 3B6GA 3LZ0D 1KX5C 3WA9D 4CSRB 3TU4D 1P3KD 5GT0B 3TU4A 2CV5B 1P3KA 3AZGC 4UPKA 3AZMA 1BH9A 5AVCD 3AZKC 3X1TB 5DNND 4J8XD 3NQJA 5AVCA 1S32B 1KX4D 3B0DC 4NFTA 4G92B 4J8XA 2F2AC 4WU8D 3REJA 3W97A 5B24D 5CPJC 3W99D 3B0BA 5AV5C 3AZHC 4WU9D 3AZEC 4WNNB 5B2JC 2F8ND 3W99A 3AZIB 5B31G 1KX5A 4Z66B 3NQUB 2F8NA 1P3GB 5B40C 5BT1C 2CWEA 5G49A 3REKC 2AROC 5AV9C 3MVDC 3AZGD 2RVQC 2NQBB 1U35B 5CPKB 3C1BC 3AZGA 3LZ0B 3AZKD 3WA9B 3RELD 3TU4B 1P3KB 3AZKA 2BYMB 3F6TA 4NE6A 5GSUD 3H0RC 3X1VC 2HUEB 3H0LC 2YFWA 5AV5D 3AZHD 3AZED 3NQJB 5B2JD 5CPJA 5AV5A 3AZHA 5DNNB 3AZEA 3MGRB 1KU5A 4J8XB 5B2JA 1KX4B 4J8UC 3AYWC 1JFIA 5B40D 2J8PA 2AROD 4WU8B 5B40A 3VH6T 3MVDD 1BFMA 5B24B 1Q9CA 2RVQD 3W99B 4H9RA 3C1BD 3REKA 2AROA 5AV9A 3MVDA 3AN2C 4WU9B 3UTBC 1F1EA 3C1BA 5G49B 4KGCD 3B6FC 3X1VD 2NZDC 3AZGB 2LY8A 5FUGB 3X1VA 3VH5A 5F99A 4YM6D 3AZKB 3O62C 4AWLC 3RELB 4CAYB 3AYWD 3B0DB 3KXBC 3V9RA 5GSUB 5B0YD 5B0ZC 4J8UA 3AYWA 1WWSA 3R45B 3A1KA 4ZBJC 5AV5B 5B2JB 3UTBD 5AV8C 3UT9D 3AN2A 3AZJC 2ZY3A 3UTBA 5B40B 5GT3C 3EPLA 1N1JB 4NE3A 4H9RB 1P34C 2AROB 2IO5B 3MVDB 3LZ1C 2XD5A 1P3OC 3B6FA 2NZDA 1ULYA 3C1BB 4E44A 5BO0A 3WAAD 5JRGC 3O62D 4YS3A 3AZFC 3O62A 4KGCB 3X1UC 5GXQC 3KXBA 1AOIC 5B0ZA 5CPIC 4H9NA 5B1LC 4YM6B 3V9RB 1KX3C 3WTPC 3AZJD 3AYWB 2Y2GA 5AY8C 5GT3D 5AV8A 5B0YB 2Y2KA 3MGSC 3AZJA 1P34D 5GT3A 3LZ1D 1P3OD 5DNMC 3AFAA 5B32B 4DQYB 3LZ1A 1P3OA 5JRGD 3UTBB 4ZUXC 3UT9B 2HIOC 3EG5B 3AZFD 3H0MC 5JRGA 1P3BD 3X1UD 5GXQD 3AZFA 4KHAB 3X1UA 5BO0B 5GXQA 5CPID 5B1LD 4H9SC 5BNXB 1AOIA 5B1MC 1WWIA 3C1CB 5CPIA 5B1LA 4H9PA 3WTPD 3O62B 3LELC 4AWLB 1KX3D 1P3IB 5AY8D 4LD9C 1KX3A 3WTPA 3MGSD 3REHB 5AY8A 4J8VC 1EQZC 5DNMD 2Y2JA 3B6GD 3B0CT 4DRAA 1BH8A 3MGSA 5DNMA 5C3IC 3KWQC 3KFUG 2HIOD 3AZJB 3AZNC 1TAFA 4ZUXA 3AZMD 2HIOA 3W98C 2Y2HA 1P34B 3LZ1B 4NE5A 1P3OB 1M18C 2PYOC 3AV1C 5B1MD 4H9SA 2Y2QA 3LELD 2YFVB 2Y2OA 3X1SC 5B1MA 3AZFB 5AV6C 3LELA 1P3BB 3REJD 3W97D 5GXQB 4J8VD 1EQZD 4LD9A 5CHLB 5B1LB 4J8VA 1EQZA 1KX5D 3KWQD 3W96B 1KX3B 3WTPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWQ A;  4DRB A;  3W98 D;  3AZN A;  3B6G B;  5DNM B;  3W98 A;  2PYO D;  1ZLA C;  1M18 A;  5JA4 A;  2PYO A;  3AV1 A;  1TAF B;  1P3L C;  2HIO B;  3X1S D;  4XUJ C;  5AV6 D;  3AZM B;  3X1S A;  1BH9 B;  5AV6 A;  1P3A C;  5F99 C;  5B31 C;  5CPJ D;  5B1M B;  5AVC B;  4Z5T C;  3VH6 W;  5B2I C;  3REJ B;  3W97 B;  5BT1 D;  1TZY C;  3REK D;  5AV9 D;  1EQZ B;  2BYK A;  1HQ3 C;  4J8W A;  1KX5 B;  2F8N B;  5C3I B;  3KWQ B;  1ZLA A;  3WKJ C;  4H9Q A;  5B32 G;  1P3L A;  3AV2 C;  3W98 B;  3WAA B;  4XUJ A;  1P3A D;  5F99 D;  5B31 D;  5JA4 B;  2PYO B;  1P3A A;  5B31 A;  3UTA C;  5CP6 C;  4Z5T D;  4YS3 C;  3AZL A;  2FJ7 C;  5AVB C;  5B2I D;  3X1S B;  4J8U D;  4Z5T A;  5AV6 B;  4XZQ C;  2YFW B;  5B2I A;  1TZY D;  3LJA C;  5CPJ B;  1HQ3 D;  1TZY A;  3AZH B;  3AZE B;  3AN2 D;  1HQ3 A;  1HTA A;  1JFI B;  1P3P C;  3WKJ D;  1M19 C;  3B6F D;  3WKJ A;  2NZD D;  3AFA C;  3REK B;  5AV9 B;  3AV2 A;  3UTA D;  4HGA C;  3VH5 T;  4YS3 D;  1ID3 C;  2F8N K;  2FJ7 D;  5KDM A;  3UTA A;  5AVB D;  5CP6 A;  3KXB D;  2FJ7 A;  5B0Z D;  5AVB A;  3X1V B;  1P3A B;  4XZQ A;  5B31 B;  5F99 B;  3LJA A;  1P3P D;  5AV8 D;  1F66 C;  5B2I B;  4J8U B;  1P3P A;  1M19 D;  2CV5 C;  1TZY B;  3AFA D;  1M19 A;  3AN2 B;  1ID3 D;  1H3O A;  1S32 C;  1ID3 A;  3B6F B;  2NZD B;  1AOI D;  4Z2M G;  3WTP E;  3UTA B;  4YS3 B;  1F66 D;  4E45 A;  3KXB B;  1F66 A;  5B0Z B;  4H9N B;  1P3M C;  2CV5 A;  4ZBJ B;  2NQB C;  1U35 C;  5CPK C;  3LZ0 C;  1P3P B;  5AV8 B;  4ZUX D;  1S32 D;  5GT3 B;  1S32 A;  3AFA B;  2F8N G;  3A6N C;  1H3O B;  4HGA B;  1ID3 B;  5JRG B;  5DNN C;  3REI C;  4WNN A;  3MGR C;  1KX4 C;  4LD9 D;  3X1U B;  4Z66 A;  1AOI B;  1P3M D;  4WU8 C;  5B24 C;  5CPI B;  4H9P B;  4WU9 C;  1P3M A;  2NQB A;  1U35 A;  1F66 B;  5CPK A;  3LZ0 A;  3AZN D;  3WA9 A;  5AY8 B;  3MGS B;  1BH8 B;  2BYM A;  5B33 C;  1B6W A;  1M18 D;  4J8W C;  3A6N D;  3AV1 D;  3A6N A;  3REI D;  4ZUX B;  3MGR D;  3REL C;  4M6B A;  5DNN A;  3REI A;  5GSU C;  3MGR A;  1M1A C;  1KX4 A;  4KUD C;  2L5A A;  4WU8 A;  3AZL C;  3KUY C;  5B24 A;  3LEL B;  3MNN C;  4WU9 A;  4LD9 B;  4Z2M H;  5B33 D;  3VH6 A;  4J8V B;  1P3M B;  2IO5 C;  4J8W D;  1A7W A;  5B33 A;  1ZLA D;  4H9O A;  4EO5 C;  1R4V A;  5FUG A;  4X23 C;  1P3L D;  4XUJ D;  3AZN B;  5BS7 C;  3REL A;  2JSS A;  1M1A D;  4CAY A;  4KGC C;  4KUD D;  5GSU A;  1M18 B;  3A6N B;  1M1A A;  3AV1 B;  4KUD A;  4G91 C;  3AZL D;  3R45 A;  4YM6 C;  3KUY D;  4WV4 B;  3MNN D;  3REI B;  3KUY A;  2F8N H;  3MNN A;  5B0Y C;  4JJN C;  1N1J A;  4QLC C;  5B32 C;  3MGP C;  4X23 D;  3UT9 C;  4X23 A;  3AV2 D;  2BYK B;  3VH5 W;  5B33 B;  4H9O B;  5BS7 A;  4J8W B;  4KGC A;  4R8P C;  1ZLA B;  4H9Q B;  5CP6 D;  3WAA C;  3C1C C;  1P3L B;  5E5A C;  4YM6 A;  3MGQ C;  4XUJ B;  1P3I C;  4XZQ D;  3LJA D;  1M1A B;  4KUD B;  4JJN D;  3REH C;  1P3F C;  5B0Y A;  4QLC D;  5B32 D;  4JJN A;  3AZL B;  3MGP D;  3KUY B;  4QLC A;  4Z5T B;  5B32 A;  3MNN B;  3MGP A;  5GT0 C;  3UT9 A;  4UUZ A;  4R8P D;  1HQ3 B;  4KHA A;  4EO5 B;  4R8P A;  3C1C D;  4X23 B;  5BNX A;  3X1T C;  5E5A D;  3MGQ D;  3WKJ B;  1P3I D;  3C1C A;  3WAA A;  5E5A A;  4G92 C;  3AV2 B;  1P3B C;  3MGQ A;  1P3I A;  3REH D;  4WZS B;  1P3F D;  4G91 B;  3REH A;  5KDM B;  1P3F A;  5CP6 B;  3W96 C;  3AZI C;  5BNV A;  2FJ7 B;  5AVB B;  3B0C W;  4Z66 C;  4XZQ B;  4CSR A;  1P3G C;  5GT0 D;  3KSY A;  2CV5 D;  3LJA B;  4JJN B;  3B6G C;  5GT0 A;  4QLC B;  1P34 A;  1B67 A;  3MGP B;  3X1T D;  3WA9 C;  3TU4 C;  4UUZ B;  1P3K C;  3X1T A;  1M19 B;  2YFV A;  3AZM C;  1P3B A;  2HUE C;  4R8P B;  5AVC C;  3W96 D;  3AZI D;  5E5A B;  3MGQ B;  4Z66 D;  4J8X C;  3W96 A;  3AZI A;  1P3G D;  3REJ C;  3W97 C;  3NQU A;  1P3F B;  1P3G A;  2NQB D;  3W99 C;  1U35 D;  5BNV B;  5CPK D;  3B6G A;  3LZ0 D;  1KX5 C;  3WA9 D;  4CSR B;  3TU4 D;  1P3K D;  5GT0 B;  3TU4 A;  2CV5 B;  1P3K A;  3AZG C;  3AZM A;  1BH9 A;  5AVC D;  3AZK C;  3X1T B;  5DNN D;  4J8X D;  3NQJ A;  5AVC A;  1S32 B;  1KX4 D;  3B0D C;  4NFT A;  4G92 B;  4J8X A;  4WU8 D;  3REJ A;  3W97 A;  5B24 D;  5CPJ C;  3W99 D;  3B0B A;  5AV5 C;  3AZH C;  4WU9 D;  3AZE C;  4WNN B;  5B2J C;  2F8N D;  3W99 A;  3AZI B;  5B31 G;  1KX5 A;  4Z66 B;  3NQU B;  2F8N A;  1P3G B;  5B40 C;  5BT1 C;  2CWE A;  5G49 A;  3REK C;  2ARO C;  5AV9 C;  3MVD C;  3AZG D;  2RVQ C;  2NQB B;  1U35 B;  5CPK B;  3C1B C;  3AZG A;  3LZ0 B;  3AZK D;  3WA9 B;  3REL D;  3TU4 B;  1P3K B;  3AZK A;  2BYM B;  4NE6 A;  5GSU D;  3X1V C;  2HUE B;  2YFW A;  5AV5 D;  3AZH D;  3AZE D;  3NQJ B;  5B2J D;  5CPJ A;  5AV5 A;  3AZH A;  5DNN B;  3AZE A;  3MGR B;  1KU5 A;  4J8X B;  5B2J A;  1KX4 B;  4J8U C;  3AYW C;  1JFI A;  5B40 D;  4WU8 B;  2ARO D;  5B40 A;  3VH6 T;  3MVD D;  1BFM A;  5B24 B;  1Q9C A;  2RVQ D;  3W99 B;  4H9R A;  3C1B D;  3REK A;  2ARO A;  5AV9 A;  3MVD A;  3AN2 C;  4WU9 B;  3UTB C;  1F1E A;  3C1B A;  5G49 B;  4KGC D;  3B6F C;  3X1V D;  2NZD C;  3AZG B;  2LY8 A;  5FUG B;  3X1V A;  3VH5 A;  5F99 A;  4YM6 D;  3AZK B;  3O62 C;  4AWL C;  3REL B;  4CAY B;  3AYW D;  3B0D B;  3KXB C;  3V9R A;  5GSU B;  5B0Y D;  5B0Z C;  4J8U A;  3AYW A;  1WWS A;  3R45 B;  5AV5 B;  4ZBJ C;  5B2J B;  3UTB D;  5AV8 C;  3UT9 D;  3AN2 A;  3AZJ C;  3UTB A;  5B40 B;  5GT3 C;  1N1J B;  4NE3 A;  4H9R B;  1P34 C;  2ARO B;  2IO5 B;  3MVD B;  3LZ1 C;  1P3O C;  3B6F A;  2NZD A;  1ULY A;  3C1B B;  4E44 A;  5BO0 A;  3WAA D;  5JRG C;  3O62 D;  4YS3 A;  3AZF C;  3O62 A;  4KGC B;  3X1U C;  5GXQ C;  3KXB A;  1AOI C;  5B0Z A;  5CPI C;  4H9N A;  5B1L C;  4YM6 B;  3V9R B;  1KX3 C;  3WTP C;  3AZJ D;  3AYW B;  5AY8 C;  5GT3 D;  5AV8 A;  5B0Y B;  3MGS C;  3AZJ A;  1P34 D;  5GT3 A;  3LZ1 D;  1P3O D;  5DNM C;  3AFA A;  5B32 B;  3LZ1 A;  1P3O A;  5JRG D;  3UTB B;  4ZUX C;  3UT9 B;  2HIO C;  3AZF D;  5JRG A;  1P3B D;  3X1U D;  5GXQ D;  3AZF A;  4KHA B;  3X1U A;  5BO0 B;  5GXQ A;  5CPI D;  5B1L D;  4H9S C;  5BNX B;  1AOI A;  5B1M C;  1WWI A;  3C1C B;  5CPI A;  5B1L A;  4H9P A;  3WTP D;  3O62 B;  3LEL C;  4AWL B;  1KX3 D;  1P3I B;  5AY8 D;  4LD9 C;  1KX3 A;  3WTP A;  3MGS D;  3REH B;  5AY8 A;  4J8V C;  1EQZ C;  5DNM D;  3B6G D;  3B0C T;  4DRA A;  1BH8 A;  3MGS A;  5DNM A;  5C3I C;  3KWQ C;  2HIO D;  3AZJ B;  3AZN C;  1TAF A;  4ZUX A;  3AZM D;  2HIO A;  3W98 C;  1P34 B;  3LZ1 B;  4NE5 A;  1P3O B;  1M18 C;  2PYO C;  3AV1 C;  5B1M D;  4H9S A;  3LEL D;  2YFV B;  3X1S C;  5B1M A;  3AZF B;  5AV6 C;  3LEL A;  1P3B B;  3REJ D;  3W97 D;  5GXQ B;  4J8V D;  1EQZ D;  4LD9 A;  5CHL B;  5B1L B;  4J8V A;  1EQZ A;  1KX5 D;  3KWQ D;  3W96 B;  1KX3 B;  3WTP B; 
#chains in the Genus database with same CATH topology
 3KWQ A;  4DRB A;  3W98 D;  2G5H C;  3AZN A;  3B6G B;  5DNM B;  3W98 A;  2PYO D;  1ZLA C;  1M18 A;  5JA4 A;  2PYO A;  3AV1 A;  3AL0 C;  1TAF B;  1P3L C;  2HIO B;  3X1S D;  4XUJ C;  5AV6 D;  3EPK A;  3AZM B;  3X1S A;  1BH9 B;  5AV6 A;  1P3A C;  5F99 C;  5B31 C;  5CPJ D;  3A1I A;  3P5J B;  5B1M B;  5AVC B;  4Z5T C;  1PZR A;  3VH6 W;  5B2I C;  2G5I C;  3REJ B;  3W97 B;  5BT1 D;  1TZY C;  3REK D;  5AV9 D;  1EQZ B;  2BYK A;  1HQ3 C;  4J8W A;  1KX5 B;  2F8N B;  5C3I B;  3KWQ B;  1ZLA A;  3WKJ C;  4H9Q A;  5B32 G;  1P3L A;  3AV2 C;  3W98 B;  3WAA B;  4XUJ A;  1P3A D;  5F99 D;  5B31 D;  5JA4 B;  2PYO B;  2ZY4 A;  1P3A A;  5B31 A;  3UTA C;  5CP6 C;  4Z5T D;  2Y2M A;  4YS3 C;  3AZL A;  2FJ7 C;  5AVB C;  5B2I D;  3X1S B;  4J8U D;  4Z5T A;  5AV6 B;  4XZQ C;  2YFW B;  5B2I A;  1TZY D;  2Y2N A;  3LJA C;  5CPJ B;  1HQ3 D;  1TZY A;  3AZH B;  3AZE B;  3AN2 D;  1HQ3 A;  1HTA A;  1JFI B;  1P3P C;  3WKJ D;  1M19 C;  3B6F D;  3WKJ A;  2NZD D;  3AFA C;  3REK B;  5AV9 B;  3AV2 A;  3UTA D;  2ZY2 A;  4HGA C;  3VH5 T;  4YS3 D;  1ID3 C;  2F8N K;  2FJ7 D;  5KDM A;  3UTA A;  5AVB D;  5CP6 A;  3KXB D;  2FJ7 A;  5B0Z D;  5AVB A;  3X1V B;  1P3A B;  4XZQ A;  5B31 B;  5F99 B;  2W8S A;  3LJA A;  2JCH A;  1P3P D;  5AV8 D;  1F66 C;  5B2I B;  4J8U B;  4WJ3 C;  1P3P A;  1M19 D;  2CV5 C;  1TZY B;  3AFA D;  1M19 A;  3AN2 B;  1ID3 D;  1H3O A;  1S32 C;  1ID3 A;  1Z2C B;  3B6F B;  2NZD B;  1AOI D;  4Z2M G;  3WTP E;  3UTA B;  4YS3 B;  1F66 D;  4E45 A;  2Y2L A;  3KXB B;  1F66 A;  5B0Z B;  4H9N B;  1P3M C;  2CV5 A;  4ZBJ B;  2NQB C;  2DQN C;  1U35 C;  5CPK C;  3LZ0 C;  1P3P B;  5AV8 B;  4ZUX D;  1S32 D;  5GT3 B;  1S32 A;  3AFA B;  2F8N G;  3A6N C;  3EPJ A;  1H3O B;  4HGA B;  1ID3 B;  5JRG B;  5DNN C;  3REI C;  4WNN A;  1W2E A;  3MGR C;  1KX4 C;  4LD9 D;  3X1U B;  4Z66 A;  1AOI B;  1P3M D;  4WU8 C;  2ZY5 A;  5B24 C;  5CPI B;  4H9P B;  4WU9 C;  1P3M A;  2NQB A;  1U35 A;  1F66 B;  5CPK A;  2BG1 A;  3LZ0 A;  3AZN D;  3WA9 A;  5AY8 B;  2Y2P A;  3MGS B;  1BH8 B;  2BYM A;  5B33 C;  1B6W A;  1M18 D;  4J8W C;  3A6N D;  3AV1 D;  3A6N A;  3REI D;  4ZUX B;  2ZM5 A;  3MGR D;  3REL C;  4M6B A;  5DNN A;  3REI A;  5GSU C;  3MGR A;  1M1A C;  1KX4 A;  4KUD C;  2L5A A;  4WU8 A;  3AZL C;  3KUY C;  5B24 A;  3LEL B;  3MNN C;  4WU9 A;  4LD9 B;  4Z2M H;  5B33 D;  3VH6 A;  4J8V B;  1P3M B;  2IO5 C;  4J8W D;  1A7W A;  5B33 A;  1ZLA D;  4H9O A;  4EO5 C;  1R4V A;  2UWX A;  5FUG A;  4X23 C;  1P3L D;  4XUJ D;  3AZN B;  5BS7 C;  2FFF B;  2JSS A;  3REL A;  4CAY A;  1M1A D;  4KGC C;  4KUD D;  5GSU A;  1M18 B;  3A6N B;  1M1A A;  3AV1 B;  4KUD A;  4G91 C;  3AZL D;  3R45 A;  4YM6 C;  3KUY D;  4WV4 B;  3MNN D;  3REI B;  3KUY A;  2F8N H;  3MNN A;  5B0Y C;  2RIQ A;  4JJN C;  1N1J A;  4QLC C;  5B32 C;  3MGP C;  4X23 D;  3UT9 C;  4X23 A;  3AV2 D;  2BYK B;  3VH5 W;  5B33 B;  4H9O B;  5BS7 A;  4J8W B;  4KGC A;  4R8P C;  1ZLA B;  3FDD A;  4H9Q B;  5CP6 D;  3WAA C;  3C1C C;  1P3L B;  5E5A C;  4YM6 A;  3MGQ C;  4XUJ B;  1P3I C;  4XZQ D;  3LJA D;  1M1A B;  4KUD B;  4JJN D;  3REH C;  1P3F C;  5B0Y A;  4QLC D;  5B32 D;  4JJN A;  3AZL B;  3MGP D;  3KUY B;  4QLC A;  4Z5T B;  5B32 A;  3MNN B;  3MGP A;  2JE5 A;  5GT0 C;  3UT9 A;  4UUZ A;  4R8P D;  1HQ3 B;  4KHA A;  4EO5 B;  4R8P A;  3C1C D;  4X23 B;  5BNX A;  3X1T C;  5E5A D;  3MGQ D;  3WKJ B;  1P3I D;  3C1C A;  3WAA A;  5E5A A;  4G92 C;  3AV2 B;  1P3B C;  3MGQ A;  1P3I A;  3REH D;  4WZS B;  1P3F D;  4G91 B;  3REH A;  5KDM B;  1P3F A;  5CP6 B;  3W96 C;  2DF4 C;  5BNV A;  3AZI C;  2FJ7 B;  5AVB B;  3B0C W;  2XD1 A;  4Z66 C;  1T3U A;  4CSR A;  4XZQ B;  1P3G C;  5GT0 D;  3KSY A;  2CV5 D;  3EPH A;  3LJA B;  4JJN B;  3B6G C;  5GT0 A;  4QLC B;  1P34 A;  1B67 A;  2VQR A;  3MGP B;  3X1T D;  3WA9 C;  3TU4 C;  4UUZ B;  1P3K C;  3X1T A;  1M19 B;  2YFV A;  3AZM C;  1P3B A;  2HUE C;  4R8P B;  5AVC C;  3W96 D;  3AZI D;  3IP4 C;  5E5A B;  3MGQ B;  4Z66 D;  4J8X C;  3W96 A;  3AZI A;  1P3G D;  3REJ C;  3W97 C;  3NQU A;  1P3F B;  1P3G A;  2Y2I A;  2NQB D;  3W99 C;  1U35 D;  5BNV B;  5CPK D;  3B6G A;  3LZ0 D;  1KX5 C;  3WA9 D;  4CSR B;  3TU4 D;  1P3K D;  5GT0 B;  3TU4 A;  2CV5 B;  1P3K A;  3AZG C;  4UPK A;  3AZM A;  1BH9 A;  5AVC D;  3AZK C;  3X1T B;  5DNN D;  4J8X D;  3NQJ A;  5AVC A;  1S32 B;  1KX4 D;  3B0D C;  4NFT A;  4G92 B;  4J8X A;  2F2A C;  4WU8 D;  3REJ A;  3W97 A;  5B24 D;  5CPJ C;  3W99 D;  3B0B A;  5AV5 C;  3AZH C;  4WU9 D;  3AZE C;  4WNN B;  5B2J C;  2F8N D;  3W99 A;  3AZI B;  5B31 G;  1KX5 A;  4Z66 B;  3NQU B;  2F8N A;  1P3G B;  5B40 C;  5BT1 C;  2CWE A;  5G49 A;  3REK C;  2ARO C;  5AV9 C;  3MVD C;  3AZG D;  2RVQ C;  2NQB B;  1U35 B;  5CPK B;  3C1B C;  3AZG A;  3LZ0 B;  3AZK D;  3WA9 B;  3REL D;  3TU4 B;  1P3K B;  3AZK A;  2BYM B;  3F6T A;  4NE6 A;  5GSU D;  3H0R C;  3X1V C;  2HUE B;  3H0L C;  2YFW A;  5AV5 D;  3AZH D;  3AZE D;  3NQJ B;  5B2J D;  5CPJ A;  5AV5 A;  3AZH A;  5DNN B;  3AZE A;  3MGR B;  1KU5 A;  4J8X B;  5B2J A;  1KX4 B;  4J8U C;  3AYW C;  1JFI A;  5B40 D;  2J8P A;  2ARO D;  4WU8 B;  5B40 A;  3VH6 T;  3MVD D;  1BFM A;  5B24 B;  1Q9C A;  2RVQ D;  3W99 B;  4H9R A;  3C1B D;  3REK A;  2ARO A;  5AV9 A;  3MVD A;  3AN2 C;  4WU9 B;  3UTB C;  1F1E A;  3C1B A;  5G49 B;  4KGC D;  3B6F C;  3X1V D;  2NZD C;  3AZG B;  2LY8 A;  5FUG B;  3X1V A;  3VH5 A;  5F99 A;  4YM6 D;  3AZK B;  3O62 C;  4AWL C;  3REL B;  4CAY B;  3AYW D;  3B0D B;  3KXB C;  3V9R A;  5GSU B;  5B0Y D;  5B0Z C;  4J8U A;  3AYW A;  1WWS A;  3R45 B;  3A1K A;  4ZBJ C;  5AV5 B;  5B2J B;  3UTB D;  5AV8 C;  3UT9 D;  3AN2 A;  3AZJ C;  2ZY3 A;  3UTB A;  5B40 B;  5GT3 C;  3EPL A;  1N1J B;  4NE3 A;  4H9R B;  1P34 C;  2ARO B;  2IO5 B;  3MVD B;  3LZ1 C;  2XD5 A;  1P3O C;  3B6F A;  2NZD A;  1ULY A;  3C1B B;  4E44 A;  5BO0 A;  3WAA D;  5JRG C;  3O62 D;  4YS3 A;  3AZF C;  3O62 A;  4KGC B;  3X1U C;  5GXQ C;  3KXB A;  1AOI C;  5B0Z A;  5CPI C;  4H9N A;  5B1L C;  4YM6 B;  3V9R B;  1KX3 C;  3WTP C;  3AZJ D;  3AYW B;  2Y2G A;  5AY8 C;  5GT3 D;  5AV8 A;  5B0Y B;  2Y2K A;  3MGS C;  3AZJ A;  1P34 D;  5GT3 A;  3LZ1 D;  1P3O D;  5DNM C;  3AFA A;  5B32 B;  4DQY B;  3LZ1 A;  1P3O A;  5JRG D;  3UTB B;  4ZUX C;  3UT9 B;  2HIO C;  3EG5 B;  3AZF D;  3H0M C;  5JRG A;  1P3B D;  3X1U D;  5GXQ D;  3AZF A;  4KHA B;  3X1U A;  5BO0 B;  5GXQ A;  5CPI D;  5B1L D;  4H9S C;  5BNX B;  1AOI A;  5B1M C;  1WWI A;  3C1C B;  5CPI A;  5B1L A;  4H9P A;  3WTP D;  3O62 B;  3LEL C;  4AWL B;  1KX3 D;  1P3I B;  5AY8 D;  4LD9 C;  1KX3 A;  3WTP A;  3MGS D;  3REH B;  5AY8 A;  4J8V C;  1EQZ C;  5DNM D;  2Y2J A;  3B6G D;  3B0C T;  4DRA A;  1BH8 A;  3MGS A;  5DNM A;  5C3I C;  3KWQ C;  3KFU G;  2HIO D;  3AZJ B;  3AZN C;  1TAF A;  4ZUX A;  3AZM D;  2HIO A;  3W98 C;  2Y2H A;  1P34 B;  3LZ1 B;  4NE5 A;  1P3O B;  1M18 C;  2PYO C;  3AV1 C;  5B1M D;  4H9S A;  2Y2Q A;  3LEL D;  2YFV B;  2Y2O A;  3X1S C;  5B1M A;  3AZF B;  5AV6 C;  3LEL A;  1P3B B;  3REJ D;  3W97 D;  5GXQ B;  4J8V D;  1EQZ D;  4LD9 A;  5CHL B;  5B1L B;  4J8V A;  1EQZ A;  1KX5 D;  3KWQ D;  3W96 B;  1KX3 B;  3WTP B; 
#chains in the Genus database with same CATH homology
 3KWQ A;  4DRB A;  3W98 D;  2G5H C;  3AZN A;  3B6G B;  5DNM B;  3W98 A;  2PYO D;  1ZLA C;  1M18 A;  5JA4 A;  2PYO A;  3AV1 A;  3AL0 C;  1TAF B;  1P3L C;  2HIO B;  3X1S D;  4XUJ C;  5AV6 D;  3EPK A;  3AZM B;  3X1S A;  1BH9 B;  5AV6 A;  1P3A C;  5F99 C;  5B31 C;  5CPJ D;  3A1I A;  3P5J B;  5B1M B;  5AVC B;  4Z5T C;  1PZR A;  3VH6 W;  5B2I C;  2G5I C;  3REJ B;  3W97 B;  5BT1 D;  1TZY C;  3REK D;  5AV9 D;  1EQZ B;  2BYK A;  1HQ3 C;  4J8W A;  1KX5 B;  2F8N B;  5C3I B;  3KWQ B;  1ZLA A;  3WKJ C;  4H9Q A;  5B32 G;  1P3L A;  3AV2 C;  3W98 B;  3WAA B;  4XUJ A;  1P3A D;  5F99 D;  5B31 D;  5JA4 B;  2PYO B;  2ZY4 A;  1P3A A;  5B31 A;  3UTA C;  5CP6 C;  4Z5T D;  2Y2M A;  4YS3 C;  3AZL A;  2FJ7 C;  5AVB C;  5B2I D;  3X1S B;  4J8U D;  4Z5T A;  5AV6 B;  4XZQ C;  2YFW B;  5B2I A;  1TZY D;  2Y2N A;  3LJA C;  5CPJ B;  1HQ3 D;  1TZY A;  3AZH B;  3AZE B;  3AN2 D;  1HQ3 A;  1HTA A;  1JFI B;  1P3P C;  3WKJ D;  1M19 C;  3B6F D;  3WKJ A;  2NZD D;  3AFA C;  3REK B;  5AV9 B;  3AV2 A;  3UTA D;  2ZY2 A;  4HGA C;  3VH5 T;  4YS3 D;  1ID3 C;  2F8N K;  2FJ7 D;  5KDM A;  3UTA A;  5AVB D;  5CP6 A;  3KXB D;  2FJ7 A;  5B0Z D;  5AVB A;  3X1V B;  1P3A B;  4XZQ A;  5B31 B;  5F99 B;  2W8S A;  3LJA A;  2JCH A;  1P3P D;  5AV8 D;  1F66 C;  5B2I B;  4J8U B;  4WJ3 C;  1P3P A;  1M19 D;  2CV5 C;  1TZY B;  3AFA D;  1M19 A;  3AN2 B;  1ID3 D;  1H3O A;  1S32 C;  1ID3 A;  1Z2C B;  3B6F B;  2NZD B;  1AOI D;  4Z2M G;  3WTP E;  3UTA B;  4YS3 B;  1F66 D;  4E45 A;  2Y2L A;  3KXB B;  1F66 A;  5B0Z B;  4H9N B;  1P3M C;  2CV5 A;  4ZBJ B;  2NQB C;  2DQN C;  1U35 C;  5CPK C;  3LZ0 C;  1P3P B;  5AV8 B;  4ZUX D;  1S32 D;  5GT3 B;  1S32 A;  3AFA B;  2F8N G;  3A6N C;  3EPJ A;  1H3O B;  4HGA B;  1ID3 B;  5JRG B;  5DNN C;  3REI C;  4WNN A;  1W2E A;  3MGR C;  1KX4 C;  4LD9 D;  3X1U B;  4Z66 A;  1AOI B;  1P3M D;  4WU8 C;  2ZY5 A;  5B24 C;  5CPI B;  4H9P B;  4WU9 C;  1P3M A;  2NQB A;  1U35 A;  1F66 B;  5CPK A;  2BG1 A;  3LZ0 A;  3AZN D;  3WA9 A;  5AY8 B;  2Y2P A;  3MGS B;  1BH8 B;  2BYM A;  5B33 C;  1B6W A;  1M18 D;  4J8W C;  3A6N D;  3AV1 D;  3A6N A;  3REI D;  4ZUX B;  2ZM5 A;  3MGR D;  3REL C;  4M6B A;  5DNN A;  3REI A;  5GSU C;  3MGR A;  1M1A C;  1KX4 A;  4KUD C;  2L5A A;  4WU8 A;  3AZL C;  3KUY C;  5B24 A;  3LEL B;  3MNN C;  4WU9 A;  4LD9 B;  4Z2M H;  5B33 D;  3VH6 A;  4J8V B;  1P3M B;  2IO5 C;  4J8W D;  1A7W A;  5B33 A;  1ZLA D;  4H9O A;  4EO5 C;  1R4V A;  2UWX A;  5FUG A;  4X23 C;  1P3L D;  4XUJ D;  3AZN B;  5BS7 C;  2FFF B;  2JSS A;  3REL A;  4CAY A;  1M1A D;  4KGC C;  4KUD D;  5GSU A;  1M18 B;  3A6N B;  1M1A A;  3AV1 B;  4KUD A;  4G91 C;  3AZL D;  3R45 A;  4YM6 C;  3KUY D;  4WV4 B;  3MNN D;  3REI B;  3KUY A;  2F8N H;  3MNN A;  5B0Y C;  2RIQ A;  4JJN C;  1N1J A;  4QLC C;  5B32 C;  3MGP C;  4X23 D;  3UT9 C;  4X23 A;  3AV2 D;  2BYK B;  3VH5 W;  5B33 B;  4H9O B;  5BS7 A;  4J8W B;  4KGC A;  4R8P C;  1ZLA B;  3FDD A;  4H9Q B;  5CP6 D;  3WAA C;  3C1C C;  1P3L B;  5E5A C;  4YM6 A;  3MGQ C;  4XUJ B;  1P3I C;  4XZQ D;  3LJA D;  1M1A B;  4KUD B;  4JJN D;  3REH C;  1P3F C;  5B0Y A;  4QLC D;  5B32 D;  4JJN A;  3AZL B;  3MGP D;  3KUY B;  4QLC A;  4Z5T B;  5B32 A;  3MNN B;  3MGP A;  2JE5 A;  5GT0 C;  3UT9 A;  4UUZ A;  4R8P D;  1HQ3 B;  4KHA A;  4EO5 B;  4R8P A;  3C1C D;  4X23 B;  5BNX A;  3X1T C;  5E5A D;  3MGQ D;  3WKJ B;  1P3I D;  3C1C A;  3WAA A;  5E5A A;  4G92 C;  3AV2 B;  1P3B C;  3MGQ A;  1P3I A;  3REH D;  4WZS B;  1P3F D;  4G91 B;  3REH A;  5KDM B;  1P3F A;  5CP6 B;  3W96 C;  2DF4 C;  5BNV A;  3AZI C;  2FJ7 B;  5AVB B;  3B0C W;  2XD1 A;  4Z66 C;  1T3U A;  4CSR A;  4XZQ B;  1P3G C;  5GT0 D;  3KSY A;  2CV5 D;  3EPH A;  3LJA B;  4JJN B;  3B6G C;  5GT0 A;  4QLC B;  1P34 A;  1B67 A;  2VQR A;  3MGP B;  3X1T D;  3WA9 C;  3TU4 C;  4UUZ B;  1P3K C;  3X1T A;  1M19 B;  2YFV A;  3AZM C;  1P3B A;  2HUE C;  4R8P B;  5AVC C;  3W96 D;  3AZI D;  3IP4 C;  5E5A B;  3MGQ B;  4Z66 D;  4J8X C;  3W96 A;  3AZI A;  1P3G D;  3REJ C;  3W97 C;  3NQU A;  1P3F B;  1P3G A;  2Y2I A;  2NQB D;  3W99 C;  1U35 D;  5BNV B;  5CPK D;  3B6G A;  3LZ0 D;  1KX5 C;  3WA9 D;  4CSR B;  3TU4 D;  1P3K D;  5GT0 B;  3TU4 A;  2CV5 B;  1P3K A;  3AZG C;  4UPK A;  3AZM A;  1BH9 A;  5AVC D;  3AZK C;  3X1T B;  5DNN D;  4J8X D;  3NQJ A;  5AVC A;  1S32 B;  1KX4 D;  3B0D C;  4NFT A;  4G92 B;  4J8X A;  2F2A C;  4WU8 D;  3REJ A;  3W97 A;  5B24 D;  5CPJ C;  3W99 D;  3B0B A;  5AV5 C;  3AZH C;  4WU9 D;  3AZE C;  4WNN B;  5B2J C;  2F8N D;  3W99 A;  3AZI B;  5B31 G;  1KX5 A;  4Z66 B;  3NQU B;  2F8N A;  1P3G B;  5B40 C;  5BT1 C;  2CWE A;  5G49 A;  3REK C;  2ARO C;  5AV9 C;  3MVD C;  3AZG D;  2RVQ C;  2NQB B;  1U35 B;  5CPK B;  3C1B C;  3AZG A;  3LZ0 B;  3AZK D;  3WA9 B;  3REL D;  3TU4 B;  1P3K B;  3AZK A;  2BYM B;  3F6T A;  4NE6 A;  5GSU D;  3H0R C;  3X1V C;  2HUE B;  3H0L C;  2YFW A;  5AV5 D;  3AZH D;  3AZE D;  3NQJ B;  5B2J D;  5CPJ A;  5AV5 A;  3AZH A;  5DNN B;  3AZE A;  3MGR B;  1KU5 A;  4J8X B;  5B2J A;  1KX4 B;  4J8U C;  3AYW C;  1JFI A;  5B40 D;  2J8P A;  2ARO D;  4WU8 B;  5B40 A;  3VH6 T;  3MVD D;  1BFM A;  5B24 B;  1Q9C A;  2RVQ D;  3W99 B;  4H9R A;  3C1B D;  3REK A;  2ARO A;  5AV9 A;  3MVD A;  3AN2 C;  4WU9 B;  3UTB C;  1F1E A;  3C1B A;  5G49 B;  4KGC D;  3B6F C;  3X1V D;  2NZD C;  3AZG B;  2LY8 A;  5FUG B;  3X1V A;  3VH5 A;  5F99 A;  4YM6 D;  3AZK B;  3O62 C;  4AWL C;  3REL B;  4CAY B;  3AYW D;  3B0D B;  3KXB C;  3V9R A;  5GSU B;  5B0Y D;  5B0Z C;  4J8U A;  3AYW A;  1WWS A;  3R45 B;  3A1K A;  4ZBJ C;  5AV5 B;  5B2J B;  3UTB D;  5AV8 C;  3UT9 D;  3AN2 A;  3AZJ C;  2ZY3 A;  3UTB A;  5B40 B;  5GT3 C;  3EPL A;  1N1J B;  4NE3 A;  4H9R B;  1P34 C;  2ARO B;  2IO5 B;  3MVD B;  3LZ1 C;  2XD5 A;  1P3O C;  3B6F A;  2NZD A;  1ULY A;  3C1B B;  4E44 A;  5BO0 A;  3WAA D;  5JRG C;  3O62 D;  4YS3 A;  3AZF C;  3O62 A;  4KGC B;  3X1U C;  5GXQ C;  3KXB A;  1AOI C;  5B0Z A;  5CPI C;  4H9N A;  5B1L C;  4YM6 B;  3V9R B;  1KX3 C;  3WTP C;  3AZJ D;  3AYW B;  2Y2G A;  5AY8 C;  5GT3 D;  5AV8 A;  5B0Y B;  2Y2K A;  3MGS C;  3AZJ A;  1P34 D;  5GT3 A;  3LZ1 D;  1P3O D;  5DNM C;  3AFA A;  5B32 B;  4DQY B;  3LZ1 A;  1P3O A;  5JRG D;  3UTB B;  4ZUX C;  3UT9 B;  2HIO C;  3EG5 B;  3AZF D;  3H0M C;  5JRG A;  1P3B D;  3X1U D;  5GXQ D;  3AZF A;  4KHA B;  3X1U A;  5BO0 B;  5GXQ A;  5CPI D;  5B1L D;  4H9S C;  5BNX B;  1AOI A;  5B1M C;  1WWI A;  3C1C B;  5CPI A;  5B1L A;  4H9P A;  3WTP D;  3O62 B;  3LEL C;  4AWL B;  1KX3 D;  1P3I B;  5AY8 D;  4LD9 C;  1KX3 A;  3WTP A;  3MGS D;  3REH B;  5AY8 A;  4J8V C;  1EQZ C;  5DNM D;  2Y2J A;  3B6G D;  3B0C T;  4DRA A;  1BH8 A;  3MGS A;  5DNM A;  5C3I C;  3KWQ C;  3KFU G;  2HIO D;  3AZJ B;  3AZN C;  1TAF A;  4ZUX A;  3AZM D;  2HIO A;  3W98 C;  2Y2H A;  1P34 B;  3LZ1 B;  4NE5 A;  1P3O B;  1M18 C;  2PYO C;  3AV1 C;  5B1M D;  4H9S A;  2Y2Q A;  3LEL D;  2YFV B;  2Y2O A;  3X1S C;  5B1M A;  3AZF B;  5AV6 C;  3LEL A;  1P3B B;  3REJ D;  3W97 D;  5GXQ B;  4J8V D;  1EQZ D;  4LD9 A;  5CHL B;  5B1L B;  4J8V A;  1EQZ A;  1KX5 D;  3KWQ D;  3W96 B;  1KX3 B;  3WTP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...