5BO0B

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.2-h4 dimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/dna binding protein
molecule keywords Histone H3.2
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bo0B00
5B1MB 5AV5C 2NQBB 3AV1A 3MGQC 3AZKB 3VH5A 5F99D 1KX5C 1HQ3C 4NE3A 3W97A 5G49A 5JRGD 5B2JA 3W98D 1TZYB 5DNMD 3W98C 2NZDB 3NQJB 5DNMC 4KGCD 5B40B 4KGCC 5B1MA 3VH6W 1P3PC 5GT3D 3MVDB 5GT3C 1M19A 4EO5B 1B67A 4KUDA 5AY8A 4H9PB 2CV5D 2BYKA 4DRBA 5AVBD 1ID3B 2AROC 2F8NK 1HTAA 4QLCB 3WTPD 5B1LA 3WTPC 1M18C 5BO0B 3AZJB 5CPID 4JJNB 5CPIC 3LZ0B 3MGSA 3B6FB 2IO5B 1P3LD 3AFAD 3REJD 4H9NB 1P3LC 3B6GB 4Z5TD 5E5AD 3REJC 5E5AC 4YM6D 3X1UA 3MNNA 2YFWA 3REHD 3AZNB 3A6NB 3LZ1A 5B2ID 4WU9D 5B0ZA 5GXQB 4WU9C 5GT0D 3UT9B 4NE5A 3W97C 1N1JA 4CSRB 4AWLC 3LELB 3X1SC 3A6NA 3KXBB 1BH8B 3REKA 3C1CB 1KX3B 5B33B 5CP6A 1JFIA 5BNVA 5AVCA 2PYOB 3X1TC 5B31B 1H3OB 2JSSA 5BNXA 5AV9B 1BH8A 3X1VB 2F8ND 1P3OA 4CAYB 4XUJD 3C1CA 4XZQB 3AZHA 4UUZA 3RELD 5CPJA 1P34A 3MGSC 1BH9A 2PYOA 3AZLB 1U35D 4J8XD 3WKJB 1U35C 4J8XC 1ZLAA 3UTAC 4R8PB 3NQUA 3X1VA 3MGPC 2FJ7B 5JA4A 1P3BA 1P3IA 3LZ1C 1M1AB 1KX4C 1AOIB 5AV8D 2RVQD 1P3AA 4J8WA 4R8PA 1P3MB 4LD9D 2FJ7A 2F8NH 1P3FA 5AV6A 5AV5B 3UTBA 1M1AA 3AZMD 3AZMC 5F99B 5B0YD 5DNNC 3W96D 3W96C 5JRGB 3AZGA 5B32G 3W98B 5DNMB 4J8VA 3AZIA 4KGCB 3KWQA 3KUYD 5GT3B 5CPKA 1P3GA 1P3OC 3AN2D 2CV5B 5JRGA 4ZBJC 3WTPE 5AVBB 3AZEA 1S32A 3AYWD 3AYWC 4ZUXA 2HIOD 1ZLAC 2HIOC 3WTPB 5B24A 4G92C 3C1BA 1F66D 3WA9A 1F66C 2BYMA 1KU5A 5B32C 5CPIB 3REIC 1P3IC 1P3BC 3WAAD 3WAAC 3B0CT 4X23D 3AZFD 3MGQD 3O62D 4WNNB 4X23C 3AZFC 1P3KA 3O62C 3AFAB 3REJB 1P3LB 4Z66A 4Z5TB 5E5AB 1KX5D 1HQ3D 3R45A 2HUEB 4YM6B 4J8WC 1TAFB 4J8UD 4J8UC 4H9RB 1P3FC 4WU8A 3REHB 4H9SC 1P3PD 5B2IB 4WU9B 2NQBA 5GT0B 4NE6A 3AZKA 4Z5TA 3AV2D 3AV2C 5BS7C 1EQZC 4H9RA 3MGRD 4J8VC 1TZYA 3MGRC 3KWQC 2NZDA 3NQJA 2AROD 4DRAA 5B40A 1Q9CA 5CPKC 1P3GC 3MVDA 1M18D 4H9PA 4YS3D 4Z2MH 3LJAD 4YS3C 3LJAC 3AZEC 1S32C 1ID3A 5GSUC 2LY8A 4ZUXC 3VH6T 2F8NB 4QLCA 4XUJB 3WA9C 3W99D 5BO0A 3AZJA 3W99C 3RELB 3TU4D 4JJNA 3TU4C 3LZ0A 3AV1D 3B6FA 3AV1C 1U35B 4J8XB 4Z66C 4HGAC 4H9NA 3B6GA 2F8NA 3W97D 5B2JD 3B0DC 5B2JC 2CWEA 3X1SD 4E45A 3AZNA 5B1MC 5AV8B 5GXQA 1M19D 3UT9A 1M19C 4KUDD 4LD9B 5AY8D 4KUDC 5AY8C 4CSRA 1WWIA 3LELA 3X1TD 3AZMB 3KXBA 5B1LD 3MVDC 5C3IC 5B0YB 5B1LC 1KX3A 3W96B 4LD9A 5B33A 3MGSD 3KUYB 1ID3C 3VH6A 3UTAD 5B31A 3X1UD 4H9QB 1H3OA 4QLCC 5AV9A 3X1UC 5B0YA 3MGPD 3MNND 4CAYA 1B6WA 3AN2B 3MNNC 4ZBJB 4XZQA 4JJNC 1KX4D 3LZ1D 3AYWB 5B0ZD 3B6FC 3VH5W 1R4VA 5B0ZC 3AZLA 2IO5C 2HIOB 3WKJA 1F66B 1WWSA 3V9RB 5FUGB 4KHAB 3WAAB 3A6NC 1AOIA 3AZFB 4X23B 3MGQB 3O62B 2YFVB 5GXQC 3REKD 1F1EA 5B31G 3REKC 1KX5B 1HQ3B 5DNND 5CP6D 1P3MA 5AVCD 5CP6C 4J8UB 5AVCC 3LELC 5AV5A 1P3PB 1ULYA 2L5AA 2YFVA 1P3OD 5F99A 3AV2B 3C1CC 1HQ3A 3AZHD 1KX3C 3AZHC 5CPJD 5CPJC 1P34D 3MGRB 1P34C 3W98A 5DNMA 2PYOC 2AROB 4KGCA 1ZLAD 5B31C 5GT3A 1M18B 5AV9C 3X1VC 5B32D 4YS3B 3REID 3LJAB 2CV5A 1P3BD 1P3ID 4H9OB 5AVBA 1P3AD 3AZLC 5BT1C 1P3AC 3WKJC 4J8WD 4R8PD 5CHLB 3WTPA 4R8PC 3W99B 1P3FD 2FJ7C 3TU4B 5AV6D 5CPIA 3UTBD 4G91C 5AV6C 3UTBC 3AV1B 1AOIC 1M1AC 4H9OA 4WNNA 1P3LA 3AFAA 3REJA 3W97B 5E5AA 5G49B 5B2JB 4YM6A 1P3MC 4AWLB 1TAFA 1EQZD 3AZGD 3AZGC 4J8VD 3AZID 3X1SB 3KWQD 3AZIC 3REHA 5B2IA 4WU9A 5CPKD 5KDMB 1P3GD 1M19B 5GT0A 5F99C 4KUDB 5AY8B 2BYKB 5JRGC 3AZED 1S32D 3X1SA 5GSUD 3X1TB 4ZUXD 5C3IB 5B24D 5B1LB 5KDMA 5B24C 3C1BD 4NFTA 3WA9D 3C1BC 3MGSB 2CV5C 1P3KD 5AVBC 1P3KC 3X1TA 4Z66D 3UTAB 3X1UB 4WV4B 3MGPB 3MNNB 4XUJA 2YFWB 4WU8D 4WU8C 3LZ1B 3RELA 1KX4B 5B1MD 5B0ZB 2NQBD 2NQBC 3AZKD 1U35A 3AFAC 4J8XA 3UTAA 3AZKC 4Z5TC 1N1JB 4YM6C 2HUEC 3MGPA 1TZYD 2NZDD 1TZYC 3REHC 1KX4A 2NZDC 5B40D 5B40C 5B2IC 3MVDD 3REKB 5GT0C 5AV8A 5DNNB 4WZSB 2F8NG 4EO5C 5CP6B 1JFIB 5BNVB 5AVCB 4E44A 1ID3D 5BNXB 3AZMA 4QLCD 1P3OB 5DNNA 4UUZB 3AZHB 3AZJD 3W96A 5CPJB 3AZJC 4JJND 1P34B 1BH9B 3LZ0D 3LZ0C 3B6FD 3KUYA 1ZLAB 3B6GD 3NQUB 4G92B 3B6GC 4H9QA 3KSYA 4XUJC 5B32B 5JA4B 3AN2A 3REIB 1P3IB 1P3BB 3RELC 3AZND 3A6ND 3AZNC 1BFMA 3AYWA 5GXQD 1P3AB 3UT9D 3UT9C 2HIOA 4J8WB 1F66A 3V9RA 1P3FB 5B32A 5FUGA 4G91B 5AV6B 3UTBB 4KHAA 3LELD 3REIA 3WAAA 3KXBD 3AZFA 4X23A 3KXBC 3MGQA 3O62A 3VH5T 2RVQC 5AV8C 3C1CD 1KX3D 1KX5A 4LD9C 5B33D 1EQZB 3AZGB 5B33C 4J8UA 4J8VB 3AZIB 3KWQB 2PYOD 4H9SA 1P3PA 5CPKB 5B31D 1P3GB 5AV9D 3B0BA 3X1VD 5B0YC 3AV2A 4XZQD 4XZQC 5BS7A 1EQZA 3B0CW 3AZEB 1S32B 3MGRA 5GSUB 3AZLD 5BT1D 4ZUXB 2AROA 3KUYC 3WKJD 5B24B 3C1BB 1M18A 3WA9B 4Z2MG 2BYMB 2FJ7D 3AN2C 4YS3A 1AOID 3LJAA 1P3KB 1M1AD 5GSUA 4Z66B 4HGAB 3R45B 1P3MD 3B0DB 4M6BA 4WU8B 3W99A 3TU4A 5AV5D 1A7WA
chains in the Genus database with same CATH superfamily
5B1MB 5AV5C 2NQBB 3AV1A 3MGQC 3AZKB 3VH5A 5F99D 1KX5C 1HQ3C 4NE3A 3W97A 5G49A 2BG1A 5JRGD 5B2JA 3W98D 1TZYB 5DNMD 3W98C 2NZDB 3NQJB 5DNMC 4KGCD 5B40B 4KGCC 5B1MA 3VH6W 1P3PC 5GT3D 3MVDB 5GT3C 1M19A 4EO5B 1B67A 4KUDA 5AY8A 4H9PB 2CV5D 2BYKA 4DRBA 5AVBD 1ID3B 2AROC 2F8NK 1HTAA 4QLCB 3WTPD 5B1LA 3WTPC 1M18C 5BO0B 2DF4C 3AZJB 5CPID 4JJNB 5CPIC 2DQNC 3LZ0B 3MGSA 3B6FB 2IO5B 1P3LD 3AFAD 3REJD 4H9NB 1P3LC 3B6GB 4Z5TD 5E5AD 3REJC 5E5AC 4YM6D 3X1UA 3MNNA 2YFWA 3REHD 3AZNB 3A6NB 3LZ1A 5B2ID 4WU9D 5B0ZA 5GXQB 4WU9C 5GT0D 3UT9B 4NE5A 3W97C 1N1JA 4CSRB 4AWLC 3LELB 2FFFB 3X1SC 3A6NA 3KXBB 1BH8B 3REKA 3C1CB 1KX3B 5B33B 5CP6A 1JFIA 5BNVA 5AVCA 2PYOB 2Y2HA 3X1TC 5B31B 3EPKA 1H3OB 2JSSA 5BNXA 5AV9B 1BH8A 3X1VB 2F8ND 1P3OA 4CAYB 4XUJD 3C1CA 4XZQB 3AZHA 4UUZA 3RELD 5CPJA 1P34A 3MGSC 1BH9A 2PYOA 3AZLB 1U35D 4J8XD 3WKJB 1U35C 4J8XC 1ZLAA 2Y2MA 3UTAC 4R8PB 3NQUA 3X1VA 3MGPC 2FJ7B 2G5HC 5JA4A 1P3BA 1P3IA 3LZ1C 1M1AB 1KX4C 1AOIB 5AV8D 2RVQD 1P3AA 4J8WA 3H0RC 4R8PA 1P3MB 4LD9D 2FJ7A 2F8NH 1P3FA 5AV6A 5AV5B 3UTBA 1M1AA 3AZMD 3AZMC 5F99B 5B0YD 5DNNC 3W96D 3W96C 5JRGB 3AZGA 5B32G 3W98B 5DNMB 4J8VA 3AZIA 4KGCB 3KWQA 3KUYD 5GT3B 5CPKA 1P3GA 1P3OC 3AN2D 1Z2CB 2CV5B 5JRGA 2JE5A 4ZBJC 3WTPE 5AVBB 3AZEA 1S32A 1T3UA 3AYWD 3AYWC 4ZUXA 2HIOD 1ZLAC 2HIOC 3WTPB 3P5JB 5B24A 4G92C 3C1BA 1F66D 4UPKA 1F66C 3WA9A 2BYMA 1KU5A 5B32C 5CPIB 3REIC 1P3IC 1P3BC 3WAAD 3WAAC 3B0CT 4X23D 3AZFD 3MGQD 3O62D 4WNNB 4X23C 3AZFC 1P3KA 3O62C 3AFAB 3REJB 1P3LB 4Z66A 4Z5TB 5E5AB 1KX5D 1HQ3D 3R45A 2HUEB 4YM6B 4J8WC 1TAFB 4J8UD 4J8UC 4H9RB 1P3FC 4WU8A 3REHB 4H9SC 1P3PD 5B2IB 4WU9B 2NQBA 5GT0B 4NE6A 3AZKA 4Z5TA 3AV2D 3AV2C 5BS7C 1EQZC 4H9RA 3MGRD 4J8VC 1TZYA 3MGRC 3KWQC 2NZDA 2AROD 3NQJA 4DRAA 2RIQA 5B40A 1Q9CA 5CPKC 1P3GC 3MVDA 1M18D 4H9PA 4YS3D 4Z2MH 3LJAD 4YS3C 3LJAC 3AZEC 1S32C 1ID3A 5GSUC 2LY8A 4ZUXC 3VH6T 2F8NB 4QLCA 2Y2NA 4XUJB 3WA9C 3W99D 5BO0A 3AZJA 3W99C 3RELB 3TU4D 4JJNA 3TU4C 3LZ0A 2UWXA 3AV1D 3B6FA 3AV1C 1U35B 4J8XB 4Z66C 4HGAC 4H9NA 3B6GA 2F8NA 3W97D 5B2JD 3B0DC 5B2JC 2Y2LA 2CWEA 3X1SD 4E45A 3AZNA 5B1MC 5AV8B 5GXQA 1M19D 3UT9A 2G5IC 1M19C 4KUDD 4LD9B 5AY8D 4KUDC 3IP4C 5AY8C 3AL0C 4CSRA 1WWIA 3LELA 3EPJA 3X1TD 3AZMB 3KXBA 5B1LD 3MVDC 5C3IC 5B0YB 5B1LC 1KX3A 3W96B 4LD9A 5B33A 3MGSD 2ZY2A 3KUYB 1ID3C 3VH6A 3UTAD 5B31A 3X1UD 4H9QB 1H3OA 4QLCC 5AV9A 3X1UC 5B0YA 3MGPD 3MNND 4CAYA 1B6WA 3AN2B 3MNNC 4ZBJB 4XZQA 4JJNC 1KX4D 3LZ1D 3AYWB 5B0ZD 3B6FC 3VH5W 1R4VA 5B0ZC 3AZLA 2IO5C 2HIOB 3WKJA 1F66B 1WWSA 3V9RB 5FUGB 4KHAB 3WAAB 3A6NC 1AOIA 3AZFB 4X23B 3MGQB 3O62B 2Y2JA 2YFVB 5GXQC 3REKD 1F1EA 4WJ3C 5B31G 3REKC 1KX5B 1HQ3B 5DNND 1PZRA 5CP6D 2XD5A 1P3MA 5AVCD 5CP6C 4J8UB 5AVCC 3LELC 5AV5A 1P3PB 1ULYA 3H0MC 2L5AA 2YFVA 3F6TA 1P3OD 5F99A 3AV2B 3C1CC 1HQ3A 3AZHD 1KX3C 3AZHC 5CPJD 5CPJC 1P34D 3MGRB 1P34C 3W98A 5DNMA 3KFUG 2PYOC 2AROB 4KGCA 1ZLAD 5B31C 5GT3A 1M18B 5AV9C 3X1VC 5B32D 4YS3B 3REID 3LJAB 2CV5A 1P3BD 1P3ID 4H9OB 5AVBA 1P3AD 3AZLC 5BT1C 1P3AC 3WKJC 4J8WD 4R8PD 5CHLB 3WTPA 4R8PC 3W99B 1P3FD 2FJ7C 3TU4B 5AV6D 5CPIA 3UTBD 4G91C 5AV6C 3UTBC 3AV1B 1AOIC 1M1AC 4H9OA 2VQRA 4WNNA 1P3LA 3AFAA 3REJA 3W97B 5E5AA 5G49B 5B2JB 4YM6A 1P3MC 4AWLB 1TAFA 1EQZD 3AZGD 3AZGC 4J8VD 3AZID 3X1SB 3KWQD 3AZIC 3REHA 5B2IA 4WU9A 5CPKD 5KDMB 1P3GD 1M19B 5GT0A 3EPHA 5F99C 4KUDB 5AY8B 2BYKB 5JRGC 3AZED 1S32D 3X1SA 5GSUD 3X1TB 4ZUXD 5C3IB 5B24D 5B1LB 5KDMA 5B24C 3C1BD 4NFTA 3WA9D 3C1BC 1W2EA 3MGSB 2CV5C 1P3KD 5AVBC 1P3KC 3H0LC 3X1TA 4Z66D 3UTAB 4WV4B 3X1UB 2XD1A 3MGPB 3MNNB 4XUJA 2YFWB 4WU8D 4WU8C 3LZ1B 3RELA 1KX4B 5B1MD 5B0ZB 2NQBD 2NQBC 3AZKD 1U35A 2W8SA 3AFAC 4J8XA 3UTAA 3AZKC 4Z5TC 1N1JB 2Y2OA 4YM6C 2HUEC 3MGPA 2ZM5A 1TZYD 2NZDD 1TZYC 3REHC 1KX4A 2NZDC 5B40D 5B40C 5B2IC 2Y2IA 3MVDD 3REKB 5GT0C 5AV8A 5DNNB 4WZSB 2F8NG 4EO5C 5CP6B 1JFIB 5BNVB 5AVCB 4E44A 1ID3D 5BNXB 3AZMA 4QLCD 1P3OB 4DQYB 5DNNA 4UUZB 2F2AC 3AZHB 3AZJD 3W96A 5CPJB 3AZJC 4JJND 1P34B 1BH9B 3LZ0D 3LZ0C 3B6FD 3KUYA 1ZLAB 3B6GD 3NQUB 4G92B 3B6GC 4H9QA 3KSYA 4XUJC 5B32B 5JA4B 3AN2A 3REIB 2J8PA 1P3IB 3A1IA 3RELC 3AZND 3A6ND 1P3BB 3AZNC 2ZY4A 1BFMA 3AYWA 5GXQD 1P3AB 3UT9D 3UT9C 2HIOA 4J8WB 1F66A 3V9RA 1P3FB 5B32A 5FUGA 4G91B 5AV6B 3UTBB 4KHAA 3LELD 3REIA 3WAAA 3KXBD 3AZFA 4X23A 3KXBC 3MGQA 3O62A 3VH5T 2RVQC 5AV8C 3A1KA 3C1CD 1KX3D 1KX5A 2JCHA 4LD9C 2Y2GA 5B33D 1EQZB 3AZGB 5B33C 2Y2PA 4J8UA 2ZY3A 4J8VB 3AZIB 3KWQB 2PYOD 4H9SA 2ZY5A 1P3PA 5CPKB 5B31D 1P3GB 5AV9D 3B0BA 3X1VD 5B0YC 3AV2A 4XZQD 4XZQC 5BS7A 1EQZA 2Y2QA 3B0CW 3AZEB 1S32B 3MGRA 2Y2KA 5GSUB 3AZLD 5BT1D 4ZUXB 2AROA 3KUYC 3WKJD 5B24B 3C1BB 1M18A 3WA9B 4Z2MG 2BYMB 2FJ7D 3AN2C 3EPLA 4YS3A 3FDDA 3LJAA 1P3KB 1M1AD 1AOID 5GSUA 4Z66B 4HGAB 3R45B 1P3MD 3B0DB 3EG5B 4M6BA 4WU8B 3W99A 3TU4A 5AV5D 1A7WA
chains in the Genus database with same CATH topology
5B1MB 5AV5C 2NQBB 3AV1A 3MGQC 3AZKB 3VH5A 5F99D 1KX5C 1HQ3C 4NE3A 3W97A 5G49A 2BG1A 5JRGD 5B2JA 3W98D 1TZYB 5DNMD 3W98C 2NZDB 3NQJB 5DNMC 4KGCD 5B40B 4KGCC 5B1MA 3VH6W 1P3PC 5GT3D 3MVDB 5GT3C 1M19A 4EO5B 1B67A 4KUDA 5AY8A 4H9PB 2CV5D 2BYKA 4DRBA 5AVBD 1ID3B 2AROC 2F8NK 1HTAA 4QLCB 3WTPD 5B1LA 3WTPC 1M18C 5BO0B 2DF4C 3AZJB 5CPID 4JJNB 5CPIC 2DQNC 3LZ0B 3MGSA 3B6FB 2IO5B 1P3LD 3AFAD 3REJD 4H9NB 1P3LC 3B6GB 4Z5TD 5E5AD 3REJC 5E5AC 4YM6D 3X1UA 3MNNA 2YFWA 3REHD 3AZNB 3A6NB 3LZ1A 5B2ID 4WU9D 5B0ZA 5GXQB 4WU9C 5GT0D 3UT9B 4NE5A 3W97C 1N1JA 4CSRB 4AWLC 3LELB 2FFFB 3X1SC 3A6NA 3KXBB 1BH8B 3REKA 3C1CB 1KX3B 5B33B 5CP6A 1JFIA 5BNVA 5AVCA 2PYOB 2Y2HA 3X1TC 5B31B 3EPKA 1H3OB 2JSSA 5BNXA 5AV9B 1BH8A 3X1VB 2F8ND 1P3OA 4CAYB 4XUJD 3C1CA 4XZQB 3AZHA 4UUZA 3RELD 5CPJA 1P34A 3MGSC 1BH9A 2PYOA 3AZLB 1U35D 4J8XD 3WKJB 1U35C 4J8XC 1ZLAA 2Y2MA 3UTAC 4R8PB 3NQUA 3X1VA 3MGPC 2FJ7B 2G5HC 5JA4A 1P3BA 1P3IA 3LZ1C 1M1AB 1KX4C 1AOIB 5AV8D 2RVQD 1P3AA 4J8WA 3H0RC 4R8PA 1P3MB 4LD9D 2FJ7A 2F8NH 1P3FA 5AV6A 5AV5B 3UTBA 1M1AA 3AZMD 3AZMC 5F99B 5B0YD 5DNNC 3W96D 3W96C 5JRGB 3AZGA 5B32G 3W98B 5DNMB 4J8VA 3AZIA 4KGCB 3KWQA 3KUYD 5GT3B 5CPKA 1P3GA 1P3OC 3AN2D 1Z2CB 2CV5B 5JRGA 2JE5A 4ZBJC 3WTPE 5AVBB 3AZEA 1S32A 1T3UA 3AYWD 3AYWC 4ZUXA 2HIOD 1ZLAC 2HIOC 3WTPB 3P5JB 5B24A 4G92C 3C1BA 1F66D 4UPKA 1F66C 3WA9A 2BYMA 1KU5A 5B32C 5CPIB 3REIC 1P3IC 1P3BC 3WAAD 3WAAC 3B0CT 4X23D 3AZFD 3MGQD 3O62D 4WNNB 4X23C 3AZFC 1P3KA 3O62C 3AFAB 3REJB 1P3LB 4Z66A 4Z5TB 5E5AB 1KX5D 1HQ3D 3R45A 2HUEB 4YM6B 4J8WC 1TAFB 4J8UD 4J8UC 4H9RB 1P3FC 4WU8A 3REHB 4H9SC 1P3PD 5B2IB 4WU9B 2NQBA 5GT0B 4NE6A 3AZKA 4Z5TA 3AV2D 3AV2C 5BS7C 1EQZC 4H9RA 3MGRD 4J8VC 1TZYA 3MGRC 3KWQC 2NZDA 2AROD 3NQJA 4DRAA 2RIQA 5B40A 1Q9CA 5CPKC 1P3GC 3MVDA 1M18D 4H9PA 4YS3D 4Z2MH 3LJAD 4YS3C 3LJAC 3AZEC 1S32C 1ID3A 5GSUC 2LY8A 4ZUXC 3VH6T 2F8NB 4QLCA 2Y2NA 4XUJB 3WA9C 3W99D 5BO0A 3AZJA 3W99C 3RELB 3TU4D 4JJNA 3TU4C 3LZ0A 2UWXA 3AV1D 3B6FA 3AV1C 1U35B 4J8XB 4Z66C 4HGAC 4H9NA 3B6GA 2F8NA 3W97D 5B2JD 3B0DC 5B2JC 2Y2LA 2CWEA 3X1SD 4E45A 3AZNA 5B1MC 5AV8B 5GXQA 1M19D 3UT9A 2G5IC 1M19C 4KUDD 4LD9B 5AY8D 4KUDC 3IP4C 5AY8C 3AL0C 4CSRA 1WWIA 3LELA 3EPJA 3X1TD 3AZMB 3KXBA 5B1LD 3MVDC 5C3IC 5B0YB 5B1LC 1KX3A 3W96B 4LD9A 5B33A 3MGSD 2ZY2A 3KUYB 1ID3C 3VH6A 3UTAD 5B31A 3X1UD 4H9QB 1H3OA 4QLCC 5AV9A 3X1UC 5B0YA 3MGPD 3MNND 4CAYA 1B6WA 3AN2B 3MNNC 4ZBJB 4XZQA 4JJNC 1KX4D 3LZ1D 3AYWB 5B0ZD 3B6FC 3VH5W 1R4VA 5B0ZC 3AZLA 2IO5C 2HIOB 3WKJA 1F66B 1WWSA 3V9RB 5FUGB 4KHAB 3WAAB 3A6NC 1AOIA 3AZFB 4X23B 3MGQB 3O62B 2Y2JA 2YFVB 5GXQC 3REKD 1F1EA 4WJ3C 5B31G 3REKC 1KX5B 1HQ3B 5DNND 1PZRA 5CP6D 2XD5A 1P3MA 5AVCD 5CP6C 4J8UB 5AVCC 3LELC 5AV5A 1P3PB 1ULYA 3H0MC 2L5AA 2YFVA 3F6TA 1P3OD 5F99A 3AV2B 3C1CC 1HQ3A 3AZHD 1KX3C 3AZHC 5CPJD 5CPJC 1P34D 3MGRB 1P34C 3W98A 5DNMA 3KFUG 2PYOC 2AROB 4KGCA 1ZLAD 5B31C 5GT3A 1M18B 5AV9C 3X1VC 5B32D 4YS3B 3REID 3LJAB 2CV5A 1P3BD 1P3ID 4H9OB 5AVBA 1P3AD 3AZLC 5BT1C 1P3AC 3WKJC 4J8WD 4R8PD 5CHLB 3WTPA 4R8PC 3W99B 1P3FD 2FJ7C 3TU4B 5AV6D 5CPIA 3UTBD 4G91C 5AV6C 3UTBC 3AV1B 1AOIC 1M1AC 4H9OA 2VQRA 4WNNA 1P3LA 3AFAA 3REJA 3W97B 5E5AA 5G49B 5B2JB 4YM6A 1P3MC 4AWLB 1TAFA 1EQZD 3AZGD 3AZGC 4J8VD 3AZID 3X1SB 3KWQD 3AZIC 3REHA 5B2IA 4WU9A 5CPKD 5KDMB 1P3GD 1M19B 5GT0A 3EPHA 5F99C 4KUDB 5AY8B 2BYKB 5JRGC 3AZED 1S32D 3X1SA 5GSUD 3X1TB 4ZUXD 5C3IB 5B24D 5B1LB 5KDMA 5B24C 3C1BD 4NFTA 3WA9D 3C1BC 1W2EA 3MGSB 2CV5C 1P3KD 5AVBC 1P3KC 3H0LC 3X1TA 4Z66D 3UTAB 4WV4B 3X1UB 2XD1A 3MGPB 3MNNB 4XUJA 2YFWB 4WU8D 4WU8C 3LZ1B 3RELA 1KX4B 5B1MD 5B0ZB 2NQBD 2NQBC 3AZKD 1U35A 2W8SA 3AFAC 4J8XA 3UTAA 3AZKC 4Z5TC 1N1JB 2Y2OA 4YM6C 2HUEC 3MGPA 2ZM5A 1TZYD 2NZDD 1TZYC 3REHC 1KX4A 2NZDC 5B40D 5B40C 5B2IC 2Y2IA 3MVDD 3REKB 5GT0C 5AV8A 5DNNB 4WZSB 2F8NG 4EO5C 5CP6B 1JFIB 5BNVB 5AVCB 4E44A 1ID3D 5BNXB 3AZMA 4QLCD 1P3OB 4DQYB 5DNNA 4UUZB 2F2AC 3AZHB 3AZJD 3W96A 5CPJB 3AZJC 4JJND 1P34B 1BH9B 3LZ0D 3LZ0C 3B6FD 3KUYA 1ZLAB 3B6GD 3NQUB 4G92B 3B6GC 4H9QA 3KSYA 4XUJC 5B32B 5JA4B 3AN2A 3REIB 2J8PA 1P3IB 3A1IA 3RELC 3AZND 3A6ND 1P3BB 3AZNC 2ZY4A 1BFMA 3AYWA 5GXQD 1P3AB 3UT9D 3UT9C 2HIOA 4J8WB 1F66A 3V9RA 1P3FB 5B32A 5FUGA 4G91B 5AV6B 3UTBB 4KHAA 3LELD 3REIA 3WAAA 3KXBD 3AZFA 4X23A 3KXBC 3MGQA 3O62A 3VH5T 2RVQC 5AV8C 3A1KA 3C1CD 1KX3D 1KX5A 2JCHA 4LD9C 2Y2GA 5B33D 1EQZB 3AZGB 5B33C 2Y2PA 4J8UA 2ZY3A 4J8VB 3AZIB 3KWQB 2PYOD 4H9SA 2ZY5A 1P3PA 5CPKB 5B31D 1P3GB 5AV9D 3B0BA 3X1VD 5B0YC 3AV2A 4XZQD 4XZQC 5BS7A 1EQZA 2Y2QA 3B0CW 3AZEB 1S32B 3MGRA 2Y2KA 5GSUB 3AZLD 5BT1D 4ZUXB 2AROA 3KUYC 3WKJD 5B24B 3C1BB 1M18A 3WA9B 4Z2MG 2BYMB 2FJ7D 3AN2C 3EPLA 4YS3A 3FDDA 3LJAA 1P3KB 1M1AD 1AOID 5GSUA 4Z66B 4HGAB 3R45B 1P3MD 3B0DB 3EG5B 4M6BA 4WU8B 3W99A 3TU4A 5AV5D 1A7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M B;  5AV5 C;  2NQB B;  3AV1 A;  3MGQ C;  3AZK B;  3VH5 A;  5F99 D;  1KX5 C;  1HQ3 C;  4NE3 A;  3W97 A;  5G49 A;  5JRG D;  5B2J A;  3W98 D;  1TZY B;  5DNM D;  3W98 C;  2NZD B;  3NQJ B;  5DNM C;  4KGC D;  5B40 B;  4KGC C;  5B1M A;  3VH6 W;  1P3P C;  5GT3 D;  3MVD B;  5GT3 C;  1M19 A;  4EO5 B;  1B67 A;  4KUD A;  5AY8 A;  4H9P B;  2CV5 D;  2BYK A;  4DRB A;  5AVB D;  1ID3 B;  2ARO C;  2F8N K;  1HTA A;  4QLC B;  3WTP D;  5B1L A;  3WTP C;  1M18 C;  5BO0 B;  3AZJ B;  5CPI D;  4JJN B;  5CPI C;  3LZ0 B;  3MGS A;  3B6F B;  2IO5 B;  1P3L D;  3AFA D;  3REJ D;  4H9N B;  1P3L C;  3B6G B;  4Z5T D;  5E5A D;  3REJ C;  5E5A C;  4YM6 D;  3X1U A;  3MNN A;  2YFW A;  3REH D;  3AZN B;  3A6N B;  3LZ1 A;  5B2I D;  4WU9 D;  5B0Z A;  5GXQ B;  4WU9 C;  5GT0 D;  3UT9 B;  4NE5 A;  3W97 C;  1N1J A;  4CSR B;  4AWL C;  3LEL B;  3X1S C;  3A6N A;  3KXB B;  1BH8 B;  3REK A;  3C1C B;  1KX3 B;  5B33 B;  5CP6 A;  1JFI A;  5BNV A;  5AVC A;  2PYO B;  3X1T C;  5B31 B;  1H3O B;  2JSS A;  5BNX A;  5AV9 B;  1BH8 A;  3X1V B;  2F8N D;  1P3O A;  4CAY B;  4XUJ D;  3C1C A;  4XZQ B;  3AZH A;  4UUZ A;  3REL D;  5CPJ A;  1P34 A;  3MGS C;  1BH9 A;  2PYO A;  3AZL B;  1U35 D;  4J8X D;  3WKJ B;  1U35 C;  4J8X C;  1ZLA A;  3UTA C;  4R8P B;  3NQU A;  3X1V A;  3MGP C;  2FJ7 B;  5JA4 A;  1P3B A;  1P3I A;  3LZ1 C;  1M1A B;  1KX4 C;  1AOI B;  5AV8 D;  2RVQ D;  1P3A A;  4J8W A;  4R8P A;  1P3M B;  4LD9 D;  2FJ7 A;  2F8N H;  1P3F A;  5AV6 A;  5AV5 B;  3UTB A;  1M1A A;  3AZM D;  3AZM C;  5F99 B;  5B0Y D;  5DNN C;  3W96 D;  3W96 C;  5JRG B;  3AZG A;  5B32 G;  3W98 B;  5DNM B;  4J8V A;  3AZI A;  4KGC B;  3KWQ A;  3KUY D;  5GT3 B;  5CPK A;  1P3G A;  1P3O C;  3AN2 D;  2CV5 B;  5JRG A;  4ZBJ C;  3WTP E;  5AVB B;  3AZE A;  1S32 A;  3AYW D;  3AYW C;  4ZUX A;  2HIO D;  1ZLA C;  2HIO C;  3WTP B;  5B24 A;  4G92 C;  3C1B A;  1F66 D;  3WA9 A;  1F66 C;  2BYM A;  1KU5 A;  5B32 C;  5CPI B;  3REI C;  1P3I C;  1P3B C;  3WAA D;  3WAA C;  3B0C T;  4X23 D;  3AZF D;  3MGQ D;  3O62 D;  4WNN B;  4X23 C;  3AZF C;  1P3K A;  3O62 C;  3AFA B;  3REJ B;  1P3L B;  4Z66 A;  4Z5T B;  5E5A B;  1KX5 D;  1HQ3 D;  3R45 A;  2HUE B;  4YM6 B;  4J8W C;  1TAF B;  4J8U D;  4J8U C;  4H9R B;  1P3F C;  4WU8 A;  3REH B;  4H9S C;  1P3P D;  5B2I B;  4WU9 B;  2NQB A;  5GT0 B;  4NE6 A;  3AZK A;  4Z5T A;  3AV2 D;  3AV2 C;  5BS7 C;  1EQZ C;  4H9R A;  3MGR D;  4J8V C;  1TZY A;  3MGR C;  3KWQ C;  2NZD A;  3NQJ A;  2ARO D;  4DRA A;  5B40 A;  1Q9C A;  5CPK C;  1P3G C;  3MVD A;  1M18 D;  4H9P A;  4YS3 D;  4Z2M H;  3LJA D;  4YS3 C;  3LJA C;  3AZE C;  1S32 C;  1ID3 A;  5GSU C;  2LY8 A;  4ZUX C;  3VH6 T;  2F8N B;  4QLC A;  4XUJ B;  3WA9 C;  3W99 D;  5BO0 A;  3AZJ A;  3W99 C;  3REL B;  3TU4 D;  4JJN A;  3TU4 C;  3LZ0 A;  3AV1 D;  3B6F A;  3AV1 C;  1U35 B;  4J8X B;  4Z66 C;  4HGA C;  4H9N A;  3B6G A;  2F8N A;  3W97 D;  5B2J D;  3B0D C;  5B2J C;  2CWE A;  3X1S D;  4E45 A;  3AZN A;  5B1M C;  5AV8 B;  5GXQ A;  1M19 D;  3UT9 A;  1M19 C;  4KUD D;  4LD9 B;  5AY8 D;  4KUD C;  5AY8 C;  4CSR A;  1WWI A;  3LEL A;  3X1T D;  3AZM B;  3KXB A;  5B1L D;  3MVD C;  5C3I C;  5B0Y B;  5B1L C;  1KX3 A;  3W96 B;  4LD9 A;  5B33 A;  3MGS D;  3KUY B;  1ID3 C;  3VH6 A;  3UTA D;  5B31 A;  3X1U D;  4H9Q B;  1H3O A;  4QLC C;  5AV9 A;  3X1U C;  5B0Y A;  3MGP D;  3MNN D;  4CAY A;  1B6W A;  3AN2 B;  3MNN C;  4ZBJ B;  4XZQ A;  4JJN C;  1KX4 D;  3LZ1 D;  3AYW B;  5B0Z D;  3B6F C;  3VH5 W;  1R4V A;  5B0Z C;  3AZL A;  2IO5 C;  2HIO B;  3WKJ A;  1F66 B;  1WWS A;  3V9R B;  5FUG B;  4KHA B;  3WAA B;  3A6N C;  1AOI A;  3AZF B;  4X23 B;  3MGQ B;  3O62 B;  2YFV B;  5GXQ C;  3REK D;  1F1E A;  5B31 G;  3REK C;  1KX5 B;  1HQ3 B;  5DNN D;  5CP6 D;  1P3M A;  5AVC D;  5CP6 C;  4J8U B;  5AVC C;  3LEL C;  5AV5 A;  1P3P B;  1ULY A;  2L5A A;  2YFV A;  1P3O D;  5F99 A;  3AV2 B;  3C1C C;  1HQ3 A;  3AZH D;  1KX3 C;  3AZH C;  5CPJ D;  5CPJ C;  1P34 D;  3MGR B;  1P34 C;  3W98 A;  5DNM A;  2PYO C;  2ARO B;  4KGC A;  1ZLA D;  5B31 C;  5GT3 A;  1M18 B;  5AV9 C;  3X1V C;  5B32 D;  4YS3 B;  3REI D;  3LJA B;  2CV5 A;  1P3B D;  1P3I D;  4H9O B;  5AVB A;  1P3A D;  3AZL C;  5BT1 C;  1P3A C;  3WKJ C;  4J8W D;  4R8P D;  5CHL B;  3WTP A;  4R8P C;  3W99 B;  1P3F D;  2FJ7 C;  3TU4 B;  5AV6 D;  5CPI A;  3UTB D;  4G91 C;  5AV6 C;  3UTB C;  3AV1 B;  1AOI C;  1M1A C;  4H9O A;  4WNN A;  1P3L A;  3AFA A;  3REJ A;  3W97 B;  5E5A A;  5G49 B;  5B2J B;  4YM6 A;  1P3M C;  4AWL B;  1TAF A;  1EQZ D;  3AZG D;  3AZG C;  4J8V D;  3AZI D;  3X1S B;  3KWQ D;  3AZI C;  3REH A;  5B2I A;  4WU9 A;  5CPK D;  5KDM B;  1P3G D;  1M19 B;  5GT0 A;  5F99 C;  4KUD B;  5AY8 B;  2BYK B;  5JRG C;  3AZE D;  1S32 D;  3X1S A;  5GSU D;  3X1T B;  4ZUX D;  5C3I B;  5B24 D;  5B1L B;  5KDM A;  5B24 C;  3C1B D;  4NFT A;  3WA9 D;  3C1B C;  3MGS B;  2CV5 C;  1P3K D;  5AVB C;  1P3K C;  3X1T A;  4Z66 D;  3UTA B;  3X1U B;  4WV4 B;  3MGP B;  3MNN B;  4XUJ A;  2YFW B;  4WU8 D;  4WU8 C;  3LZ1 B;  3REL A;  1KX4 B;  5B1M D;  5B0Z B;  2NQB D;  2NQB C;  3AZK D;  1U35 A;  3AFA C;  4J8X A;  3UTA A;  3AZK C;  4Z5T C;  1N1J B;  4YM6 C;  2HUE C;  3MGP A;  1TZY D;  2NZD D;  1TZY C;  3REH C;  1KX4 A;  2NZD C;  5B40 D;  5B40 C;  5B2I C;  3MVD D;  3REK B;  5GT0 C;  5AV8 A;  5DNN B;  4WZS B;  2F8N G;  4EO5 C;  5CP6 B;  1JFI B;  5BNV B;  5AVC B;  4E44 A;  1ID3 D;  5BNX B;  3AZM A;  4QLC D;  1P3O B;  5DNN A;  4UUZ B;  3AZH B;  3AZJ D;  3W96 A;  5CPJ B;  3AZJ C;  4JJN D;  1P34 B;  1BH9 B;  3LZ0 D;  3LZ0 C;  3B6F D;  3KUY A;  1ZLA B;  3B6G D;  3NQU B;  4G92 B;  3B6G C;  4H9Q A;  3KSY A;  4XUJ C;  5B32 B;  5JA4 B;  3AN2 A;  3REI B;  1P3I B;  1P3B B;  3REL C;  3AZN D;  3A6N D;  3AZN C;  1BFM A;  3AYW A;  5GXQ D;  1P3A B;  3UT9 D;  3UT9 C;  2HIO A;  4J8W B;  1F66 A;  3V9R A;  1P3F B;  5B32 A;  5FUG A;  4G91 B;  5AV6 B;  3UTB B;  4KHA A;  3LEL D;  3REI A;  3WAA A;  3KXB D;  3AZF A;  4X23 A;  3KXB C;  3MGQ A;  3O62 A;  3VH5 T;  2RVQ C;  5AV8 C;  3C1C D;  1KX3 D;  1KX5 A;  4LD9 C;  5B33 D;  1EQZ B;  3AZG B;  5B33 C;  4J8U A;  4J8V B;  3AZI B;  3KWQ B;  2PYO D;  4H9S A;  1P3P A;  5CPK B;  5B31 D;  1P3G B;  5AV9 D;  3B0B A;  3X1V D;  5B0Y C;  3AV2 A;  4XZQ D;  4XZQ C;  5BS7 A;  1EQZ A;  3B0C W;  3AZE B;  1S32 B;  3MGR A;  5GSU B;  3AZL D;  5BT1 D;  4ZUX B;  2ARO A;  3KUY C;  3WKJ D;  5B24 B;  3C1B B;  1M18 A;  3WA9 B;  4Z2M G;  2BYM B;  2FJ7 D;  3AN2 C;  4YS3 A;  1AOI D;  3LJA A;  1P3K B;  1M1A D;  5GSU A;  4Z66 B;  4HGA B;  3R45 B;  1P3M D;  3B0D B;  4M6B A;  4WU8 B;  3W99 A;  3TU4 A;  5AV5 D;  1A7W A; 
#chains in the Genus database with same CATH topology
 5B1M B;  5AV5 C;  2NQB B;  3AV1 A;  3MGQ C;  3AZK B;  3VH5 A;  5F99 D;  1KX5 C;  1HQ3 C;  4NE3 A;  3W97 A;  5G49 A;  2BG1 A;  5JRG D;  5B2J A;  3W98 D;  1TZY B;  5DNM D;  3W98 C;  2NZD B;  3NQJ B;  5DNM C;  4KGC D;  5B40 B;  4KGC C;  5B1M A;  3VH6 W;  1P3P C;  5GT3 D;  3MVD B;  5GT3 C;  1M19 A;  4EO5 B;  1B67 A;  4KUD A;  5AY8 A;  4H9P B;  2CV5 D;  2BYK A;  4DRB A;  5AVB D;  1ID3 B;  2ARO C;  2F8N K;  1HTA A;  4QLC B;  3WTP D;  5B1L A;  3WTP C;  1M18 C;  5BO0 B;  2DF4 C;  3AZJ B;  5CPI D;  4JJN B;  5CPI C;  2DQN C;  3LZ0 B;  3MGS A;  3B6F B;  2IO5 B;  1P3L D;  3AFA D;  3REJ D;  4H9N B;  1P3L C;  3B6G B;  4Z5T D;  5E5A D;  3REJ C;  5E5A C;  4YM6 D;  3X1U A;  3MNN A;  2YFW A;  3REH D;  3AZN B;  3A6N B;  3LZ1 A;  5B2I D;  4WU9 D;  5B0Z A;  5GXQ B;  4WU9 C;  5GT0 D;  3UT9 B;  4NE5 A;  3W97 C;  1N1J A;  4CSR B;  4AWL C;  3LEL B;  2FFF B;  3X1S C;  3A6N A;  3KXB B;  1BH8 B;  3REK A;  3C1C B;  1KX3 B;  5B33 B;  5CP6 A;  1JFI A;  5BNV A;  5AVC A;  2PYO B;  2Y2H A;  3X1T C;  5B31 B;  3EPK A;  1H3O B;  2JSS A;  5BNX A;  5AV9 B;  1BH8 A;  3X1V B;  2F8N D;  1P3O A;  4CAY B;  4XUJ D;  3C1C A;  4XZQ B;  3AZH A;  4UUZ A;  3REL D;  5CPJ A;  1P34 A;  3MGS C;  1BH9 A;  2PYO A;  3AZL B;  1U35 D;  4J8X D;  3WKJ B;  1U35 C;  4J8X C;  1ZLA A;  2Y2M A;  3UTA C;  4R8P B;  3NQU A;  3X1V A;  3MGP C;  2FJ7 B;  2G5H C;  5JA4 A;  1P3B A;  1P3I A;  3LZ1 C;  1M1A B;  1KX4 C;  1AOI B;  5AV8 D;  2RVQ D;  1P3A A;  4J8W A;  3H0R C;  4R8P A;  1P3M B;  4LD9 D;  2FJ7 A;  2F8N H;  1P3F A;  5AV6 A;  5AV5 B;  3UTB A;  1M1A A;  3AZM D;  3AZM C;  5F99 B;  5B0Y D;  5DNN C;  3W96 D;  3W96 C;  5JRG B;  3AZG A;  5B32 G;  3W98 B;  5DNM B;  4J8V A;  3AZI A;  4KGC B;  3KWQ A;  3KUY D;  5GT3 B;  5CPK A;  1P3G A;  1P3O C;  3AN2 D;  1Z2C B;  2CV5 B;  5JRG A;  2JE5 A;  4ZBJ C;  3WTP E;  5AVB B;  3AZE A;  1S32 A;  1T3U A;  3AYW D;  3AYW C;  4ZUX A;  2HIO D;  1ZLA C;  2HIO C;  3WTP B;  3P5J B;  5B24 A;  4G92 C;  3C1B A;  1F66 D;  4UPK A;  1F66 C;  3WA9 A;  2BYM A;  1KU5 A;  5B32 C;  5CPI B;  3REI C;  1P3I C;  1P3B C;  3WAA D;  3WAA C;  3B0C T;  4X23 D;  3AZF D;  3MGQ D;  3O62 D;  4WNN B;  4X23 C;  3AZF C;  1P3K A;  3O62 C;  3AFA B;  3REJ B;  1P3L B;  4Z66 A;  4Z5T B;  5E5A B;  1KX5 D;  1HQ3 D;  3R45 A;  2HUE B;  4YM6 B;  4J8W C;  1TAF B;  4J8U D;  4J8U C;  4H9R B;  1P3F C;  4WU8 A;  3REH B;  4H9S C;  1P3P D;  5B2I B;  4WU9 B;  2NQB A;  5GT0 B;  4NE6 A;  3AZK A;  4Z5T A;  3AV2 D;  3AV2 C;  5BS7 C;  1EQZ C;  4H9R A;  3MGR D;  4J8V C;  1TZY A;  3MGR C;  3KWQ C;  2NZD A;  2ARO D;  3NQJ A;  4DRA A;  2RIQ A;  5B40 A;  1Q9C A;  5CPK C;  1P3G C;  3MVD A;  1M18 D;  4H9P A;  4YS3 D;  4Z2M H;  3LJA D;  4YS3 C;  3LJA C;  3AZE C;  1S32 C;  1ID3 A;  5GSU C;  2LY8 A;  4ZUX C;  3VH6 T;  2F8N B;  4QLC A;  2Y2N A;  4XUJ B;  3WA9 C;  3W99 D;  5BO0 A;  3AZJ A;  3W99 C;  3REL B;  3TU4 D;  4JJN A;  3TU4 C;  3LZ0 A;  2UWX A;  3AV1 D;  3B6F A;  3AV1 C;  1U35 B;  4J8X B;  4Z66 C;  4HGA C;  4H9N A;  3B6G A;  2F8N A;  3W97 D;  5B2J D;  3B0D C;  5B2J C;  2Y2L A;  2CWE A;  3X1S D;  4E45 A;  3AZN A;  5B1M C;  5AV8 B;  5GXQ A;  1M19 D;  3UT9 A;  2G5I C;  1M19 C;  4KUD D;  4LD9 B;  5AY8 D;  4KUD C;  3IP4 C;  5AY8 C;  3AL0 C;  4CSR A;  1WWI A;  3LEL A;  3EPJ A;  3X1T D;  3AZM B;  3KXB A;  5B1L D;  3MVD C;  5C3I C;  5B0Y B;  5B1L C;  1KX3 A;  3W96 B;  4LD9 A;  5B33 A;  3MGS D;  2ZY2 A;  3KUY B;  1ID3 C;  3VH6 A;  3UTA D;  5B31 A;  3X1U D;  4H9Q B;  1H3O A;  4QLC C;  5AV9 A;  3X1U C;  5B0Y A;  3MGP D;  3MNN D;  4CAY A;  1B6W A;  3AN2 B;  3MNN C;  4ZBJ B;  4XZQ A;  4JJN C;  1KX4 D;  3LZ1 D;  3AYW B;  5B0Z D;  3B6F C;  3VH5 W;  1R4V A;  5B0Z C;  3AZL A;  2IO5 C;  2HIO B;  3WKJ A;  1F66 B;  1WWS A;  3V9R B;  5FUG B;  4KHA B;  3WAA B;  3A6N C;  1AOI A;  3AZF B;  4X23 B;  3MGQ B;  3O62 B;  2Y2J A;  2YFV B;  5GXQ C;  3REK D;  1F1E A;  4WJ3 C;  5B31 G;  3REK C;  1KX5 B;  1HQ3 B;  5DNN D;  1PZR A;  5CP6 D;  2XD5 A;  1P3M A;  5AVC D;  5CP6 C;  4J8U B;  5AVC C;  3LEL C;  5AV5 A;  1P3P B;  1ULY A;  3H0M C;  2L5A A;  2YFV A;  3F6T A;  1P3O D;  5F99 A;  3AV2 B;  3C1C C;  1HQ3 A;  3AZH D;  1KX3 C;  3AZH C;  5CPJ D;  5CPJ C;  1P34 D;  3MGR B;  1P34 C;  3W98 A;  5DNM A;  3KFU G;  2PYO C;  2ARO B;  4KGC A;  1ZLA D;  5B31 C;  5GT3 A;  1M18 B;  5AV9 C;  3X1V C;  5B32 D;  4YS3 B;  3REI D;  3LJA B;  2CV5 A;  1P3B D;  1P3I D;  4H9O B;  5AVB A;  1P3A D;  3AZL C;  5BT1 C;  1P3A C;  3WKJ C;  4J8W D;  4R8P D;  5CHL B;  3WTP A;  4R8P C;  3W99 B;  1P3F D;  2FJ7 C;  3TU4 B;  5AV6 D;  5CPI A;  3UTB D;  4G91 C;  5AV6 C;  3UTB C;  3AV1 B;  1AOI C;  1M1A C;  4H9O A;  2VQR A;  4WNN A;  1P3L A;  3AFA A;  3REJ A;  3W97 B;  5E5A A;  5G49 B;  5B2J B;  4YM6 A;  1P3M C;  4AWL B;  1TAF A;  1EQZ D;  3AZG D;  3AZG C;  4J8V D;  3AZI D;  3X1S B;  3KWQ D;  3AZI C;  3REH A;  5B2I A;  4WU9 A;  5CPK D;  5KDM B;  1P3G D;  1M19 B;  5GT0 A;  3EPH A;  5F99 C;  4KUD B;  5AY8 B;  2BYK B;  5JRG C;  3AZE D;  1S32 D;  3X1S A;  5GSU D;  3X1T B;  4ZUX D;  5C3I B;  5B24 D;  5B1L B;  5KDM A;  5B24 C;  3C1B D;  4NFT A;  3WA9 D;  3C1B C;  1W2E A;  3MGS B;  2CV5 C;  1P3K D;  5AVB C;  1P3K C;  3H0L C;  3X1T A;  4Z66 D;  3UTA B;  4WV4 B;  3X1U B;  2XD1 A;  3MGP B;  3MNN B;  4XUJ A;  2YFW B;  4WU8 D;  4WU8 C;  3LZ1 B;  3REL A;  1KX4 B;  5B1M D;  5B0Z B;  2NQB D;  2NQB C;  3AZK D;  1U35 A;  2W8S A;  3AFA C;  4J8X A;  3UTA A;  3AZK C;  4Z5T C;  1N1J B;  2Y2O A;  4YM6 C;  2HUE C;  3MGP A;  2ZM5 A;  1TZY D;  2NZD D;  1TZY C;  3REH C;  1KX4 A;  2NZD C;  5B40 D;  5B40 C;  5B2I C;  2Y2I A;  3MVD D;  3REK B;  5GT0 C;  5AV8 A;  5DNN B;  4WZS B;  2F8N G;  4EO5 C;  5CP6 B;  1JFI B;  5BNV B;  5AVC B;  4E44 A;  1ID3 D;  5BNX B;  3AZM A;  4QLC D;  1P3O B;  4DQY B;  5DNN A;  4UUZ B;  2F2A C;  3AZH B;  3AZJ D;  3W96 A;  5CPJ B;  3AZJ C;  4JJN D;  1P34 B;  1BH9 B;  3LZ0 D;  3LZ0 C;  3B6F D;  3KUY A;  1ZLA B;  3B6G D;  3NQU B;  4G92 B;  3B6G C;  4H9Q A;  3KSY A;  4XUJ C;  5B32 B;  5JA4 B;  3AN2 A;  3REI B;  2J8P A;  1P3I B;  3A1I A;  3REL C;  3AZN D;  3A6N D;  1P3B B;  3AZN C;  2ZY4 A;  1BFM A;  3AYW A;  5GXQ D;  1P3A B;  3UT9 D;  3UT9 C;  2HIO A;  4J8W B;  1F66 A;  3V9R A;  1P3F B;  5B32 A;  5FUG A;  4G91 B;  5AV6 B;  3UTB B;  4KHA A;  3LEL D;  3REI A;  3WAA A;  3KXB D;  3AZF A;  4X23 A;  3KXB C;  3MGQ A;  3O62 A;  3VH5 T;  2RVQ C;  5AV8 C;  3A1K A;  3C1C D;  1KX3 D;  1KX5 A;  2JCH A;  4LD9 C;  2Y2G A;  5B33 D;  1EQZ B;  3AZG B;  5B33 C;  2Y2P A;  4J8U A;  2ZY3 A;  4J8V B;  3AZI B;  3KWQ B;  2PYO D;  4H9S A;  2ZY5 A;  1P3P A;  5CPK B;  5B31 D;  1P3G B;  5AV9 D;  3B0B A;  3X1V D;  5B0Y C;  3AV2 A;  4XZQ D;  4XZQ C;  5BS7 A;  1EQZ A;  2Y2Q A;  3B0C W;  3AZE B;  1S32 B;  3MGR A;  2Y2K A;  5GSU B;  3AZL D;  5BT1 D;  4ZUX B;  2ARO A;  3KUY C;  3WKJ D;  5B24 B;  3C1B B;  1M18 A;  3WA9 B;  4Z2M G;  2BYM B;  2FJ7 D;  3AN2 C;  3EPL A;  4YS3 A;  3FDD A;  3LJA A;  1P3K B;  1M1A D;  1AOI D;  5GSU A;  4Z66 B;  4HGA B;  3R45 B;  1P3M D;  3B0D B;  3EG5 B;  4M6B A;  4WU8 B;  3W99 A;  3TU4 A;  5AV5 D;  1A7W A; 
#chains in the Genus database with same CATH homology
 5B1M B;  5AV5 C;  2NQB B;  3AV1 A;  3MGQ C;  3AZK B;  3VH5 A;  5F99 D;  1KX5 C;  1HQ3 C;  4NE3 A;  3W97 A;  5G49 A;  2BG1 A;  5JRG D;  5B2J A;  3W98 D;  1TZY B;  5DNM D;  3W98 C;  2NZD B;  3NQJ B;  5DNM C;  4KGC D;  5B40 B;  4KGC C;  5B1M A;  3VH6 W;  1P3P C;  5GT3 D;  3MVD B;  5GT3 C;  1M19 A;  4EO5 B;  1B67 A;  4KUD A;  5AY8 A;  4H9P B;  2CV5 D;  2BYK A;  4DRB A;  5AVB D;  1ID3 B;  2ARO C;  2F8N K;  1HTA A;  4QLC B;  3WTP D;  5B1L A;  3WTP C;  1M18 C;  5BO0 B;  2DF4 C;  3AZJ B;  5CPI D;  4JJN B;  5CPI C;  2DQN C;  3LZ0 B;  3MGS A;  3B6F B;  2IO5 B;  1P3L D;  3AFA D;  3REJ D;  4H9N B;  1P3L C;  3B6G B;  4Z5T D;  5E5A D;  3REJ C;  5E5A C;  4YM6 D;  3X1U A;  3MNN A;  2YFW A;  3REH D;  3AZN B;  3A6N B;  3LZ1 A;  5B2I D;  4WU9 D;  5B0Z A;  5GXQ B;  4WU9 C;  5GT0 D;  3UT9 B;  4NE5 A;  3W97 C;  1N1J A;  4CSR B;  4AWL C;  3LEL B;  2FFF B;  3X1S C;  3A6N A;  3KXB B;  1BH8 B;  3REK A;  3C1C B;  1KX3 B;  5B33 B;  5CP6 A;  1JFI A;  5BNV A;  5AVC A;  2PYO B;  2Y2H A;  3X1T C;  5B31 B;  3EPK A;  1H3O B;  2JSS A;  5BNX A;  5AV9 B;  1BH8 A;  3X1V B;  2F8N D;  1P3O A;  4CAY B;  4XUJ D;  3C1C A;  4XZQ B;  3AZH A;  4UUZ A;  3REL D;  5CPJ A;  1P34 A;  3MGS C;  1BH9 A;  2PYO A;  3AZL B;  1U35 D;  4J8X D;  3WKJ B;  1U35 C;  4J8X C;  1ZLA A;  2Y2M A;  3UTA C;  4R8P B;  3NQU A;  3X1V A;  3MGP C;  2FJ7 B;  2G5H C;  5JA4 A;  1P3B A;  1P3I A;  3LZ1 C;  1M1A B;  1KX4 C;  1AOI B;  5AV8 D;  2RVQ D;  1P3A A;  4J8W A;  3H0R C;  4R8P A;  1P3M B;  4LD9 D;  2FJ7 A;  2F8N H;  1P3F A;  5AV6 A;  5AV5 B;  3UTB A;  1M1A A;  3AZM D;  3AZM C;  5F99 B;  5B0Y D;  5DNN C;  3W96 D;  3W96 C;  5JRG B;  3AZG A;  5B32 G;  3W98 B;  5DNM B;  4J8V A;  3AZI A;  4KGC B;  3KWQ A;  3KUY D;  5GT3 B;  5CPK A;  1P3G A;  1P3O C;  3AN2 D;  1Z2C B;  2CV5 B;  5JRG A;  2JE5 A;  4ZBJ C;  3WTP E;  5AVB B;  3AZE A;  1S32 A;  1T3U A;  3AYW D;  3AYW C;  4ZUX A;  2HIO D;  1ZLA C;  2HIO C;  3WTP B;  3P5J B;  5B24 A;  4G92 C;  3C1B A;  1F66 D;  4UPK A;  1F66 C;  3WA9 A;  2BYM A;  1KU5 A;  5B32 C;  5CPI B;  3REI C;  1P3I C;  1P3B C;  3WAA D;  3WAA C;  3B0C T;  4X23 D;  3AZF D;  3MGQ D;  3O62 D;  4WNN B;  4X23 C;  3AZF C;  1P3K A;  3O62 C;  3AFA B;  3REJ B;  1P3L B;  4Z66 A;  4Z5T B;  5E5A B;  1KX5 D;  1HQ3 D;  3R45 A;  2HUE B;  4YM6 B;  4J8W C;  1TAF B;  4J8U D;  4J8U C;  4H9R B;  1P3F C;  4WU8 A;  3REH B;  4H9S C;  1P3P D;  5B2I B;  4WU9 B;  2NQB A;  5GT0 B;  4NE6 A;  3AZK A;  4Z5T A;  3AV2 D;  3AV2 C;  5BS7 C;  1EQZ C;  4H9R A;  3MGR D;  4J8V C;  1TZY A;  3MGR C;  3KWQ C;  2NZD A;  2ARO D;  3NQJ A;  4DRA A;  2RIQ A;  5B40 A;  1Q9C A;  5CPK C;  1P3G C;  3MVD A;  1M18 D;  4H9P A;  4YS3 D;  4Z2M H;  3LJA D;  4YS3 C;  3LJA C;  3AZE C;  1S32 C;  1ID3 A;  5GSU C;  2LY8 A;  4ZUX C;  3VH6 T;  2F8N B;  4QLC A;  2Y2N A;  4XUJ B;  3WA9 C;  3W99 D;  5BO0 A;  3AZJ A;  3W99 C;  3REL B;  3TU4 D;  4JJN A;  3TU4 C;  3LZ0 A;  2UWX A;  3AV1 D;  3B6F A;  3AV1 C;  1U35 B;  4J8X B;  4Z66 C;  4HGA C;  4H9N A;  3B6G A;  2F8N A;  3W97 D;  5B2J D;  3B0D C;  5B2J C;  2Y2L A;  2CWE A;  3X1S D;  4E45 A;  3AZN A;  5B1M C;  5AV8 B;  5GXQ A;  1M19 D;  3UT9 A;  2G5I C;  1M19 C;  4KUD D;  4LD9 B;  5AY8 D;  4KUD C;  3IP4 C;  5AY8 C;  3AL0 C;  4CSR A;  1WWI A;  3LEL A;  3EPJ A;  3X1T D;  3AZM B;  3KXB A;  5B1L D;  3MVD C;  5C3I C;  5B0Y B;  5B1L C;  1KX3 A;  3W96 B;  4LD9 A;  5B33 A;  3MGS D;  2ZY2 A;  3KUY B;  1ID3 C;  3VH6 A;  3UTA D;  5B31 A;  3X1U D;  4H9Q B;  1H3O A;  4QLC C;  5AV9 A;  3X1U C;  5B0Y A;  3MGP D;  3MNN D;  4CAY A;  1B6W A;  3AN2 B;  3MNN C;  4ZBJ B;  4XZQ A;  4JJN C;  1KX4 D;  3LZ1 D;  3AYW B;  5B0Z D;  3B6F C;  3VH5 W;  1R4V A;  5B0Z C;  3AZL A;  2IO5 C;  2HIO B;  3WKJ A;  1F66 B;  1WWS A;  3V9R B;  5FUG B;  4KHA B;  3WAA B;  3A6N C;  1AOI A;  3AZF B;  4X23 B;  3MGQ B;  3O62 B;  2Y2J A;  2YFV B;  5GXQ C;  3REK D;  1F1E A;  4WJ3 C;  5B31 G;  3REK C;  1KX5 B;  1HQ3 B;  5DNN D;  1PZR A;  5CP6 D;  2XD5 A;  1P3M A;  5AVC D;  5CP6 C;  4J8U B;  5AVC C;  3LEL C;  5AV5 A;  1P3P B;  1ULY A;  3H0M C;  2L5A A;  2YFV A;  3F6T A;  1P3O D;  5F99 A;  3AV2 B;  3C1C C;  1HQ3 A;  3AZH D;  1KX3 C;  3AZH C;  5CPJ D;  5CPJ C;  1P34 D;  3MGR B;  1P34 C;  3W98 A;  5DNM A;  3KFU G;  2PYO C;  2ARO B;  4KGC A;  1ZLA D;  5B31 C;  5GT3 A;  1M18 B;  5AV9 C;  3X1V C;  5B32 D;  4YS3 B;  3REI D;  3LJA B;  2CV5 A;  1P3B D;  1P3I D;  4H9O B;  5AVB A;  1P3A D;  3AZL C;  5BT1 C;  1P3A C;  3WKJ C;  4J8W D;  4R8P D;  5CHL B;  3WTP A;  4R8P C;  3W99 B;  1P3F D;  2FJ7 C;  3TU4 B;  5AV6 D;  5CPI A;  3UTB D;  4G91 C;  5AV6 C;  3UTB C;  3AV1 B;  1AOI C;  1M1A C;  4H9O A;  2VQR A;  4WNN A;  1P3L A;  3AFA A;  3REJ A;  3W97 B;  5E5A A;  5G49 B;  5B2J B;  4YM6 A;  1P3M C;  4AWL B;  1TAF A;  1EQZ D;  3AZG D;  3AZG C;  4J8V D;  3AZI D;  3X1S B;  3KWQ D;  3AZI C;  3REH A;  5B2I A;  4WU9 A;  5CPK D;  5KDM B;  1P3G D;  1M19 B;  5GT0 A;  3EPH A;  5F99 C;  4KUD B;  5AY8 B;  2BYK B;  5JRG C;  3AZE D;  1S32 D;  3X1S A;  5GSU D;  3X1T B;  4ZUX D;  5C3I B;  5B24 D;  5B1L B;  5KDM A;  5B24 C;  3C1B D;  4NFT A;  3WA9 D;  3C1B C;  1W2E A;  3MGS B;  2CV5 C;  1P3K D;  5AVB C;  1P3K C;  3H0L C;  3X1T A;  4Z66 D;  3UTA B;  4WV4 B;  3X1U B;  2XD1 A;  3MGP B;  3MNN B;  4XUJ A;  2YFW B;  4WU8 D;  4WU8 C;  3LZ1 B;  3REL A;  1KX4 B;  5B1M D;  5B0Z B;  2NQB D;  2NQB C;  3AZK D;  1U35 A;  2W8S A;  3AFA C;  4J8X A;  3UTA A;  3AZK C;  4Z5T C;  1N1J B;  2Y2O A;  4YM6 C;  2HUE C;  3MGP A;  2ZM5 A;  1TZY D;  2NZD D;  1TZY C;  3REH C;  1KX4 A;  2NZD C;  5B40 D;  5B40 C;  5B2I C;  2Y2I A;  3MVD D;  3REK B;  5GT0 C;  5AV8 A;  5DNN B;  4WZS B;  2F8N G;  4EO5 C;  5CP6 B;  1JFI B;  5BNV B;  5AVC B;  4E44 A;  1ID3 D;  5BNX B;  3AZM A;  4QLC D;  1P3O B;  4DQY B;  5DNN A;  4UUZ B;  2F2A C;  3AZH B;  3AZJ D;  3W96 A;  5CPJ B;  3AZJ C;  4JJN D;  1P34 B;  1BH9 B;  3LZ0 D;  3LZ0 C;  3B6F D;  3KUY A;  1ZLA B;  3B6G D;  3NQU B;  4G92 B;  3B6G C;  4H9Q A;  3KSY A;  4XUJ C;  5B32 B;  5JA4 B;  3AN2 A;  3REI B;  2J8P A;  1P3I B;  3A1I A;  3REL C;  3AZN D;  3A6N D;  1P3B B;  3AZN C;  2ZY4 A;  1BFM A;  3AYW A;  5GXQ D;  1P3A B;  3UT9 D;  3UT9 C;  2HIO A;  4J8W B;  1F66 A;  3V9R A;  1P3F B;  5B32 A;  5FUG A;  4G91 B;  5AV6 B;  3UTB B;  4KHA A;  3LEL D;  3REI A;  3WAA A;  3KXB D;  3AZF A;  4X23 A;  3KXB C;  3MGQ A;  3O62 A;  3VH5 T;  2RVQ C;  5AV8 C;  3A1K A;  3C1C D;  1KX3 D;  1KX5 A;  2JCH A;  4LD9 C;  2Y2G A;  5B33 D;  1EQZ B;  3AZG B;  5B33 C;  2Y2P A;  4J8U A;  2ZY3 A;  4J8V B;  3AZI B;  3KWQ B;  2PYO D;  4H9S A;  2ZY5 A;  1P3P A;  5CPK B;  5B31 D;  1P3G B;  5AV9 D;  3B0B A;  3X1V D;  5B0Y C;  3AV2 A;  4XZQ D;  4XZQ C;  5BS7 A;  1EQZ A;  2Y2Q A;  3B0C W;  3AZE B;  1S32 B;  3MGR A;  2Y2K A;  5GSU B;  3AZL D;  5BT1 D;  4ZUX B;  2ARO A;  3KUY C;  3WKJ D;  5B24 B;  3C1B B;  1M18 A;  3WA9 B;  4Z2M G;  2BYM B;  2FJ7 D;  3AN2 C;  3EPL A;  4YS3 A;  3FDD A;  3LJA A;  1P3K B;  1M1A D;  1AOI D;  5GSU A;  4Z66 B;  4HGA B;  3R45 B;  1P3M D;  3B0D B;  3EG5 B;  4M6B A;  4WU8 B;  3W99 A;  3TU4 A;  5AV5 D;  1A7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...