5BO0B

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.2-h4 dimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
total genus 25
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bo0B00
5B33A 5B0YC 3W98C 1M19C 5B1LD 5B2ID 3WKJA 3AV2B 4KUDA 3AN2D 1P3AA 5KDMA 1KX5D 3UTAC 3X1VB 5C3IC 3AZFA 5FUGB 3KWQB 3KXBB 4XZQC 4CSRB 5AV9D 3V9RA 3X1VD 1ID3A 3O62D 3R45B 3RELB 4LD9A 2F8NK 2NZDB 4UUZB 3O62A 1A7WA 2NQBA 4EO5C 4E45A 4XUJC 5DNMC 3C1CC 1AOIB 4J8XA 3AV1A 3RELD 5AVBB 4H9QA 2BYMB 2F8NG 4YM6D 3X1SA 1EQZC 3MGRB 5F99D 4ZUXB 3VH5A 3VH6A 3X1TD 5B33C 5CPJA 4JJNA 3B0DB 3WKJC 5AVBD 1P3PD 5CP6A 4KUDC 1M18D 4Z5TA 3MGPA 4X23B 3MGRD 1P3AC 1ULYA 3X1UA 1P3BA 3NQJA 4ZUXD 3LELD 1P3LD 3AZFC 2FJ7A 3B6FD 3A6ND 5JRGB 1TAFA 1P3IA 3WAAD 3REKD 2F8NA 1P3OD 3AZEA 2YFWA 3W96B 3MVDB 1ID3C 1P34D 5JRGD 5JA4A 5DNNA 5B1MD 5B2JB 4LD9C 5B0ZA 3MNND 3O62C 3AZJB 2NQBC 5AV6A 3KUYA 1H3OA 3MVDD 5B31A 2F8NH 3AFAB 3AZMA 3AZGB 1HTAA 5BNXB 4J8XC 4H9SC 3UT9D 5B40B 3AV1C 1P3KA 3AZJD 2YFVB 3X1SC 4YS3D 5AV8D 1P3MD 3AZHB 5CPJC 4JJNC 2CV5B 5AVCD 5CP6C 3MGSA 4H9NB 4Z5TC 5E5AD 3MGPC 4G92C 1F1EA 1BH8A 3X1UC 1P3BC 2FJ7C 5AV5B 3WA9A 5CPIB 1P3GD 2HIOA 4J8VA 1P3IC 1BFMA 5B24D 3AZEC 1P3FA 1F66A 1TZYB 5DNNC 2IO5C 5B0ZC 3WTPD 4QLCB 1S32D 3LJAB 5AV6C 3KUYC 3AZKA 4CAYB 5B31C 4J8WD 1TZYD 4R8PB 3AZMC 5GT0B 1KX3A 4HGAC 1P3KC 4Z66A 3B6GA 5GSUA 3LZ1A 5B0YB 3W98B 1M19B 4WU8A 5GXQA 4M6BA 1U35A 3B0BA 3NQUB 3W97A 4R8PD 5GT0D 3REID 1M1AA 3W99D 3MGSC 2PYOD 5GT3D 4XZQB 4KGCD 3WA9C 3AZIA 1HQ3A 2HIOC 3TU4D 4J8UA 4J8VC 1ZLAA 4WU9A 3AYWD 3C1BA 5CPKA 1R4VA 3LZ0A 4EO5B 4H9RA 1P3FC 1F66C 4XUJB 3KSYA 3AZNA 5DNMB 1KX4D 3C1CB 3REJA 2BYKB 3UTBA 3AZKC 5AY8B 1KX3C 5B32B 1EQZB 5B1LA 5B2IA 5BT1D 4Z66C 3B6GC 5GSUC 3LZ1C 5B33B 3AN2A 1KX5A 4WU8C 5GXQC 3WKJB 3AV2D 4KUDB 1U35C 5B32D 1M1AC 3W97C 1P3AB 5KDMB 3AZFB 5AV9A 1WWSA 3X1VA 2CWEA 3KWQD 3KXBD 1BH9A 3AZIC 1HQ3C 4J8UC 4NFTA 3REHB 1ZLAC 4WU9C 4LD9B 3C1BC 5CPKC 2NZDD 3LZ0C 3R45A 2NQBB 3RELA 2RVQC 3AZNC 3REJC 5G49A 3REHD 4YM6A 4J8XB 4KHAA 1AOID 3UTBC 5F99A 4H9QB 3X1TA 3X1SB 5B1LC 5B2IC 5AVBA 1P3PA 5B31G 1M18A 5CPJB 3AN2C 4JJNB 3MGRA 1KX5C 1P3LA 4ZUXA 3LELA 5CP6B 3B6FA 3A6NA 4Z5TB 3MGPB 4G92B 4X23D 3AZLB 3X1UB 2FJ7B 3NQJB 3WAAA 3REKA 1P3OA 5AV9C 3X1VC 1TAFB 1P3IB 1P34A 5JRGA 2F8NB 5B1MA 3AZEB 3AZLD 3MNNA 3W96D 4H9OA 5JA4B 4H9PB 5DNNB 5B2JD 3W96A 2IO5B 3MVDA 4E44A 3UT9A 3RELC 5AV6B 3KUYB 4AWLB 4WNNA 5B31B 3AZJA 3AFAD 3AZGD 3AZMB 4YM6C 4YS3A 4HGAB 5B40D 1P3KB 5F99C 5AV8A 1P3MA 3X1TC 3MGQB 5AVCA 5AVBC 1P3PC 2YFVA 1M18C 5E5AA 3AZHD 3MGRC 2CV5D 1P3LC 4ZUXC 3LELC 2AROB 3A6NC 3MGSB 3B6FC 1P3GA 3MGQD 1BH8B 3WAAC 5AV5D 3REKC 1P3OC 5B24A 5CPID 2HIOB 3B0CT 2AROD 1P34C 5JRGC 5B1MC 3MNNC 3WTPA 1P3FB 1F66B 1S32A 3W96C 3MVDC 1Q9CA 1JFIA 4J8WA 1TZYA 4QLCD 5BS7A 3UT9C 3LJAD 3AZKB 3AZJC 1KX3B 4YS3C 3UTAB 5C3IB 3B6GB 4WZSB 5AV8C 5GSUB 3LZ1B 5B0YD 4R8PA 3W98D 5GT0A 3REIA 4WU8B 1P3MC 1M19D 5GXQB 5AVCC 3W99A 3W98A 4ZBJC 1M1AB 3W97B 5E5AC 2PYOA 3UTAD 5GT3A 4NE3A 4G91C 4KGCA 1P3GC 4DRAA 3TU4A 4XZQD 3AYWA 5B24C 1HQ3B 5BNVA 1ZLAB 4WU9B 5CPKB 1KX4A 5CHLB 3LZ0B 4H9RB 3WTPC 4XUJD 1S32C 5DNMD 4NE5A 5BO0A 3C1CD 3REJB 1N1JB 4J8WC 1TZYC 5BS7C 5AY8D 1EQZD 4NE6A 3AV2A 5AY8A 5B32A 5B33D 4R8PC 3AN2B 5GT0C 3REIC 1KX5B 3WKJD 5FUGA 4KUDD 3W99C 1P3AD 2PYOC 3V9RB 3KWQA 3KXBA 3AZFD 1ID3B 5GT3C 4KGCC 4CSRA 5AV9B 3TU4C 3O62B 1BH9B 3VH5T 4Z2MH 3VH6T 3AYWC 2NZDA 4UUZA 1B6WA 1ID3D 2HUEC 2L5AA 3AV1B 4LD9D 1KX4C 3REHA 1AOIA 2NQBD 2BYMA 5G49B 1WWIA 4YM6B 4J8XD 4KHAB 3AV1D 5F99B 5BT1C 3X1TB 4H9SA 3X1SD 1P3BB 3AV2C 1P3PB 5AY8C 1M18B 5B32C 5CPJD 4X23A 4JJND 1P3LB 3LELB 5CP6D 3B6FB 3A6NB 4Z5TD 3MGPD 2YFWB 3X1UD 1P3BD 2FJ7D 3KWQC 3KXBC 3WAAB 3REKB 1P3OB 3AZLA 5B0ZB 1P3ID 1P34B 2F8ND 5B1MB 5B2JA 3AZED 2JSSA 2NZDC 3MNNB 1H3OB 4DRBA 4H9OB 5DNND 5B0ZD 3AFAA 3AZGA 3REHC 5BNXA 1AOIC 3UT9B 4H9PA 5B40A 5AV6D 3KUYD 4WNNB 5B31D 3AZMD 3B0CW 4YS3B 1P3KD 5AV8B 1P3MB 3AZHA 3B0DC 2CV5A 5AVCB 4ZBJB 4H9NA 5E5AB 4X23C 3MGQA 3WA9B 4J8VB 5AV5A 4G91B 3MGSD 4WV4B 5CPIA 1P3GB 2AROA 3WA9D 5B24B 3AZLC 2HIOD 4J8VD 5B2JC 3WTPB 4QLCA 1P3FD 1S32B 1F66D 3LJAA 3WTPE 4Z66B 4CAYA 1JFIB 4J8WB 3AFAC 3AZGC 5B40C 3AZKD 5B0YA 1U35B 1M19A 1KX3D 4AWLC 4Z66D 3B6GD 5GSUD 3LZ1D 3NQUA 3REIB 4WU8D 3AZHC 5GXQD 3UTAA 2CV5C 3W99B 1U35D 1M1AD 1B67A 3W97D 2PYOB 3MGQC 3AZIB 4J8UB 5GT3B 4XZQA 5B32G 5AV5C 4KGCB 4Z2MG 5CPIC 3C1BB 3TU4B 2AROC 3AYWB 3AZNB 3AZID 1HQ3D 5BNVB 2HUEB 4J8UD 1KU5A 4XUJA 4WU9D 1ZLAD 3UTBB 5DNMA 3C1BD 5CPKD 1KX4B 3C1CA 3LZ0D 2BYKA 2RVQD 4QLCC 3AZND 5B1LB 5B2IB 3LJAC 5BO0B 3REJD 1EQZA 3UTBD 3VH5W 1N1JA 2LY8A 3VH6W
chains in the Genus database with same CATH superfamily
5B33A 5B0YC 3W98C 1M19C 5B1LD 5B2ID 3WKJA 3AV2B 4KUDA 3AL0C 3AN2D 1P3AA 5KDMA 1KX5D 3UTAC 3X1VB 5C3IC 3AZFA 5FUGB 3KWQB 3KXBB 4XZQC 4CSRB 5AV9D 3V9RA 3X1VD 1ID3A 3O62D 3R45B 3RELB 4LD9A 2F8NK 2NZDB 4UUZB 3O62A 1A7WA 2NQBA 4EO5C 4E45A 4XUJC 5DNMC 3C1CC 1AOIB 4J8XA 3AV1A 3RELD 5AVBB 4H9QA 2BYMB 2F8NG 2F2AC 4YM6D 3X1SA 1EQZC 3MGRB 5F99D 2Y2KA 4ZUXB 3VH5A 3VH6A 3X1TD 5B33C 5CPJA 4JJNA 3B0DB 3WKJC 5AVBD 1P3PD 5CP6A 4KUDC 1M18D 4Z5TA 3MGPA 4X23B 3MGRD 1P3AC 1ULYA 3X1UA 1P3BA 3NQJA 4ZUXD 3LELD 1P3LD 3AZFC 2FJ7A 3B6FD 3A6ND 5JRGB 1TAFA 1P3IA 3WAAD 3REKD 2F8NA 1P3OD 3AZEA 2YFWA 3W96B 4DQYB 1T3UA 3MVDB 1ID3C 2FFFB 1P34D 5JRGD 5JA4A 5DNNA 5B1MD 5B2JB 4LD9C 5B0ZA 3MNND 3O62C 3AZJB 2NQBC 5AV6A 3KUYA 1H3OA 3MVDD 5B31A 2F8NH 3AFAB 3EPJA 3AZMA 3AZGB 1HTAA 5BNXB 4J8XC 4H9SC 3UT9D 5B40B 3AV1C 1P3KA 2Y2HA 2RIQA 3AZJD 2YFVB 3X1SC 4YS3D 5AV8D 1P3MD 3AZHB 5CPJC 4JJNC 2CV5B 5AVCD 5CP6C 3MGSA 4H9NB 4Z5TC 5E5AD 3MGPC 4G92C 1F1EA 1BH8A 3X1UC 1P3BC 2FJ7C 5AV5B 3WA9A 5CPIB 1P3GD 2HIOA 3EG5B 4J8VA 1P3IC 1BFMA 5B24D 3AZEC 1P3FA 1F66A 1TZYB 5DNNC 2IO5C 5B0ZC 3WTPD 4QLCB 1S32D 3LJAB 5AV6C 3KUYC 3AZKA 4CAYB 5B31C 4J8WD 1TZYD 4R8PB 3AZMC 5GT0B 1KX3A 4HGAC 1P3KC 4Z66A 3B6GA 5GSUA 3LZ1A 5B0YB 3W98B 1M19B 4WU8A 5GXQA 3EPHA 4M6BA 1U35A 3B0BA 3NQUB 3W97A 4R8PD 5GT0D 3REID 1M1AA 3F6TA 3W99D 3MGSC 2PYOD 5GT3D 4XZQB 4KGCD 3WA9C 3AZIA 1HQ3A 2HIOC 3TU4D 4J8UA 4J8VC 1ZLAA 4WU9A 3AYWD 3C1BA 5CPKA 1R4VA 3LZ0A 4EO5B 4H9RA 1P3FC 1F66C 4XUJB 3KSYA 3AZNA 5DNMB 1KX4D 3C1CB 3REJA 2BYKB 3UTBA 3A1IA 3AZKC 5AY8B 1KX3C 5B32B 1EQZB 5B1LA 5B2IA 3FDDA 5BT1D 4Z66C 3B6GC 5GSUC 3LZ1C 5B33B 3AN2A 1KX5A 4WU8C 5GXQC 3WKJB 3AV2D 4KUDB 1U35C 5B32D 2Y2JA 1M1AC 3W97C 1P3AB 5KDMB 2DF4C 3AZFB 5AV9A 1WWSA 3X1VA 2CWEA 3KWQD 3KXBD 1BH9A 3AZIC 1HQ3C 4J8UC 4NFTA 3REHB 1ZLAC 4WU9C 4LD9B 3C1BC 5CPKC 2NZDD 3LZ0C 3R45A 2NQBB 3RELA 2RVQC 3AZNC 3KFUG 2Y2QA 3REJC 5G49A 3REHD 4YM6A 4J8XB 4KHAA 1AOID 3UTBC 5F99A 4H9QB 3X1TA 3X1SB 5B1LC 5B2IC 5AVBA 1P3PA 5B31G 1M18A 5CPJB 3AN2C 4JJNB 3MGRA 1KX5C 1P3LA 4ZUXA 3LELA 5CP6B 3B6FA 3A6NA 4Z5TB 3MGPB 4G92B 4X23D 3AZLB 3X1UB 2FJ7B 3NQJB 2Y2IA 3WAAA 3REKA 1P3OA 1PZRA 5AV9C 3X1VC 1TAFB 1P3IB 1P34A 5JRGA 2F8NB 2Y2PA 5B1MA 3AZEB 3AZLD 3MNNA 3W96D 4H9OA 5JA4B 2VQRA 4H9PB 5DNNB 3W96A 2IO5B 5B2JD 3MVDA 4E44A 3UT9A 3RELC 5AV6B 3KUYB 4AWLB 4WNNA 5B31B 3AZJA 3AFAD 3AZGD 3AZMB 4YM6C 4YS3A 4HGAB 5B40D 2Y2MA 1P3KB 5F99C 5AV8A 2XD5A 1P3MA 3X1TC 3MGQB 5AVCA 5AVBC 1P3PC 2YFVA 1M18C 5E5AA 3AZHD 3MGRC 2CV5D 1P3LC 4ZUXC 3LELC 2AROB 3A6NC 3MGSB 3P5JB 3B6FC 1P3GA 3MGQD 1BH8B 4UPKA 3WAAC 5AV5D 3REKC 1P3OC 5B24A 5CPID 2HIOB 3B0CT 2Y2LA 2AROD 1P34C 5JRGC 5B1MC 3MNNC 3WTPA 1P3FB 1F66B 1S32A 2Y2OA 3W96C 3MVDC 1Q9CA 1JFIA 4J8WA 1TZYA 4QLCD 5BS7A 3UT9C 3LJAD 3AZKB 3AZJC 1KX3B 4YS3C 3UTAB 2Y2NA 5C3IB 3B6GB 4WZSB 5AV8C 5GSUB 2Y2GA 5B0YD 4R8PA 3LZ1B 5GT0A 3EPLA 4WU8B 3REIA 1P3MC 5GXQB 1M19D 3W98D 5AVCC 3W99A 3W98A 4ZBJC 1M1AB 3W97B 5E5AC 2PYOA 3UTAD 2JCHA 2ZM5A 5GT3A 4NE3A 4G91C 4KGCA 1P3GC 4DRAA 3TU4A 4XZQD 3AYWA 5B24C 1HQ3B 5BNVA 1ZLAB 4WU9B 5CPKB 1KX4A 5CHLB 3LZ0B 4H9RB 3WTPC 4XUJD 1S32C 5DNMD 4NE5A 5BO0A 3C1CD 3REJB 1N1JB 4J8WC 1TZYC 5BS7C 5AY8D 1EQZD 4NE6A 3AV2A 5AY8A 5B32A 5B33D 4R8PC 3AN2B 5GT0C 3REIC 1KX5B 3WKJD 5FUGA 4KUDD 3W99C 1P3AD 2PYOC 3V9RB 3KWQA 3KXBA 3AZFD 1ID3B 5GT3C 4KGCC 4CSRA 5AV9B 3TU4C 3O62B 1BH9B 3VH5T 4Z2MH 3VH6T 3AYWC 2NZDA 4UUZA 1B6WA 1ID3D 2HUEC 2L5AA 3AV1B 4LD9D 1KX4C 3REHA 1AOIA 2NQBD 2G5IC 2BYMA 5G49B 2JE5A 1WWIA 4YM6B 4J8XD 4KHAB 3AV1D 4WJ3C 5F99B 5BT1C 3X1TB 4H9SA 3X1SD 1P3BB 3AV2C 1P3PB 5AY8C 1M18B 5B32C 5CPJD 4X23A 4JJND 1P3LB 2DQNC 3LELB 5CP6D 3B6FB 3A6NB 4Z5TD 3MGPD 2YFWB 3X1UD 1P3BD 2FJ7D 3KWQC 3KXBC 3H0RC 3REKB 3WAAB 1P3OB 3AZLA 2ZY4A 5B0ZB 1P3ID 1P34B 2F8ND 5B1MB 5B2JA 3AZED 2JSSA 2NZDC 3MNNB 1H3OB 4DRBA 4H9OB 5DNND 2BG1A 5B0ZD 3AFAA 3AZGA 3REHC 5BNXA 1AOIC 3UT9B 4H9PA 5B40A 5AV6D 2J8PA 3KUYD 4WNNB 5B31D 3AZMD 3B0CW 3IP4C 4YS3B 1P3KD 5AV8B 1P3MB 3AZHA 2UWXA 2ZY5A 3B0DC 5AVCB 2CV5A 4ZBJB 4H9NA 5E5AB 4X23C 3MGQA 3WA9B 4J8VB 5AV5A 4G91B 3MGSD 4WV4B 5CPIA 1P3GB 3H0LC 2AROA 3WA9D 5B24B 3AZLC 2HIOD 2W8SA 4J8VD 5B2JC 3WTPB 4QLCA 1P3FD 1S32B 1F66D 3LJAA 3WTPE 3EPKA 2G5HC 4Z66B 4CAYA 1JFIB 4J8WB 3AFAC 3AZGC 3H0MC 5B40C 3AZKD 5B0YA 1U35B 1M19A 1KX3D 4AWLC 4Z66D 3B6GD 5GSUD 3LZ1D 3NQUA 3A1KA 3REIB 4WU8D 3AZHC 5GXQD 3UTAA 1Z2CB 1W2EA 2CV5C 3W99B 1U35D 1M1AD 1B67A 3W97D 2PYOB 3MGQC 3AZIB 4J8UB 5GT3B 4XZQA 5B32G 5AV5C 4KGCB 4Z2MG 5CPIC 3C1BB 3TU4B 2XD1A 2AROC 3AYWB 2ZY3A 2ZY2A 3AZNB 3AZID 1HQ3D 5BNVB 2HUEB 4J8UD 1KU5A 4XUJA 4WU9D 1ZLAD 3UTBB 5DNMA 3C1BD 5CPKD 1KX4B 3C1CA 3LZ0D 2BYKA 2RVQD 4QLCC 3AZND 5B1LB 5B2IB 3LJAC 5BO0B 3REJD 1EQZA 3UTBD 3VH5W 1N1JA 2LY8A 3VH6W
chains in the Genus database with same CATH topology
5B33A 5B0YC 3W98C 1M19C 5B1LD 5B2ID 3WKJA 3AV2B 4KUDA 3AL0C 3AN2D 1P3AA 5KDMA 1KX5D 3UTAC 3X1VB 5C3IC 3AZFA 5FUGB 3KWQB 3KXBB 4XZQC 4CSRB 5AV9D 3V9RA 3X1VD 1ID3A 3O62D 3R45B 3RELB 4LD9A 2F8NK 2NZDB 4UUZB 3O62A 1A7WA 2NQBA 4EO5C 4E45A 4XUJC 5DNMC 3C1CC 1AOIB 4J8XA 3AV1A 3RELD 5AVBB 4H9QA 2BYMB 2F8NG 2F2AC 4YM6D 3X1SA 1EQZC 3MGRB 5F99D 2Y2KA 4ZUXB 3VH5A 3VH6A 3X1TD 5B33C 5CPJA 4JJNA 3B0DB 3WKJC 5AVBD 1P3PD 5CP6A 4KUDC 1M18D 4Z5TA 3MGPA 4X23B 3MGRD 1P3AC 1ULYA 3X1UA 1P3BA 3NQJA 4ZUXD 3LELD 1P3LD 3AZFC 2FJ7A 3B6FD 3A6ND 5JRGB 1TAFA 1P3IA 3WAAD 3REKD 2F8NA 1P3OD 3AZEA 2YFWA 3W96B 4DQYB 1T3UA 3MVDB 1ID3C 2FFFB 1P34D 5JRGD 5JA4A 5DNNA 5B1MD 5B2JB 4LD9C 5B0ZA 3MNND 3O62C 3AZJB 2NQBC 5AV6A 3KUYA 1H3OA 3MVDD 5B31A 2F8NH 3AFAB 3EPJA 3AZMA 3AZGB 1HTAA 5BNXB 4J8XC 4H9SC 3UT9D 5B40B 3AV1C 1P3KA 2Y2HA 2RIQA 3AZJD 2YFVB 3X1SC 4YS3D 5AV8D 1P3MD 3AZHB 5CPJC 4JJNC 2CV5B 5AVCD 5CP6C 3MGSA 4H9NB 4Z5TC 5E5AD 3MGPC 4G92C 1F1EA 1BH8A 3X1UC 1P3BC 2FJ7C 5AV5B 3WA9A 5CPIB 1P3GD 2HIOA 3EG5B 4J8VA 1P3IC 1BFMA 5B24D 3AZEC 1P3FA 1F66A 1TZYB 5DNNC 2IO5C 5B0ZC 3WTPD 4QLCB 1S32D 3LJAB 5AV6C 3KUYC 3AZKA 4CAYB 5B31C 4J8WD 1TZYD 4R8PB 3AZMC 5GT0B 1KX3A 4HGAC 1P3KC 4Z66A 3B6GA 5GSUA 3LZ1A 5B0YB 3W98B 1M19B 4WU8A 5GXQA 3EPHA 4M6BA 1U35A 3B0BA 3NQUB 3W97A 4R8PD 5GT0D 3REID 1M1AA 3F6TA 3W99D 3MGSC 2PYOD 5GT3D 4XZQB 4KGCD 3WA9C 3AZIA 1HQ3A 2HIOC 3TU4D 4J8UA 4J8VC 1ZLAA 4WU9A 3AYWD 3C1BA 5CPKA 1R4VA 3LZ0A 4EO5B 4H9RA 1P3FC 1F66C 4XUJB 3KSYA 3AZNA 5DNMB 1KX4D 3C1CB 3REJA 2BYKB 3UTBA 3A1IA 3AZKC 5AY8B 1KX3C 5B32B 1EQZB 5B1LA 5B2IA 3FDDA 5BT1D 4Z66C 3B6GC 5GSUC 3LZ1C 5B33B 3AN2A 1KX5A 4WU8C 5GXQC 3WKJB 3AV2D 4KUDB 1U35C 5B32D 2Y2JA 1M1AC 3W97C 1P3AB 5KDMB 2DF4C 3AZFB 5AV9A 1WWSA 3X1VA 2CWEA 3KWQD 3KXBD 1BH9A 3AZIC 1HQ3C 4J8UC 4NFTA 3REHB 1ZLAC 4WU9C 4LD9B 3C1BC 5CPKC 2NZDD 3LZ0C 3R45A 2NQBB 3RELA 2RVQC 3AZNC 3KFUG 2Y2QA 3REJC 5G49A 3REHD 4YM6A 4J8XB 4KHAA 1AOID 3UTBC 5F99A 4H9QB 3X1TA 3X1SB 5B1LC 5B2IC 5AVBA 1P3PA 5B31G 1M18A 5CPJB 3AN2C 4JJNB 3MGRA 1KX5C 1P3LA 4ZUXA 3LELA 5CP6B 3B6FA 3A6NA 4Z5TB 3MGPB 4G92B 4X23D 3AZLB 3X1UB 2FJ7B 3NQJB 2Y2IA 3WAAA 3REKA 1P3OA 1PZRA 5AV9C 3X1VC 1TAFB 1P3IB 1P34A 5JRGA 2F8NB 2Y2PA 5B1MA 3AZEB 3AZLD 3MNNA 3W96D 4H9OA 5JA4B 2VQRA 4H9PB 5DNNB 3W96A 2IO5B 5B2JD 3MVDA 4E44A 3UT9A 3RELC 5AV6B 3KUYB 4AWLB 4WNNA 5B31B 3AZJA 3AFAD 3AZGD 3AZMB 4YM6C 4YS3A 4HGAB 5B40D 2Y2MA 1P3KB 5F99C 5AV8A 2XD5A 1P3MA 3X1TC 3MGQB 5AVCA 5AVBC 1P3PC 2YFVA 1M18C 5E5AA 3AZHD 3MGRC 2CV5D 1P3LC 4ZUXC 3LELC 2AROB 3A6NC 3MGSB 3P5JB 3B6FC 1P3GA 3MGQD 1BH8B 4UPKA 3WAAC 5AV5D 3REKC 1P3OC 5B24A 5CPID 2HIOB 3B0CT 2Y2LA 2AROD 1P34C 5JRGC 5B1MC 3MNNC 3WTPA 1P3FB 1F66B 1S32A 2Y2OA 3W96C 3MVDC 1Q9CA 1JFIA 4J8WA 1TZYA 4QLCD 5BS7A 3UT9C 3LJAD 3AZKB 3AZJC 1KX3B 4YS3C 3UTAB 2Y2NA 5C3IB 3B6GB 4WZSB 5AV8C 5GSUB 2Y2GA 5B0YD 4R8PA 3LZ1B 5GT0A 3EPLA 4WU8B 3REIA 1P3MC 5GXQB 1M19D 3W98D 5AVCC 3W99A 3W98A 4ZBJC 1M1AB 3W97B 5E5AC 2PYOA 3UTAD 2JCHA 2ZM5A 5GT3A 4NE3A 4G91C 4KGCA 1P3GC 4DRAA 3TU4A 4XZQD 3AYWA 5B24C 1HQ3B 5BNVA 1ZLAB 4WU9B 5CPKB 1KX4A 5CHLB 3LZ0B 4H9RB 3WTPC 4XUJD 1S32C 5DNMD 4NE5A 5BO0A 3C1CD 3REJB 1N1JB 4J8WC 1TZYC 5BS7C 5AY8D 1EQZD 4NE6A 3AV2A 5AY8A 5B32A 5B33D 4R8PC 3AN2B 5GT0C 3REIC 1KX5B 3WKJD 5FUGA 4KUDD 3W99C 1P3AD 2PYOC 3V9RB 3KWQA 3KXBA 3AZFD 1ID3B 5GT3C 4KGCC 4CSRA 5AV9B 3TU4C 3O62B 1BH9B 3VH5T 4Z2MH 3VH6T 3AYWC 2NZDA 4UUZA 1B6WA 1ID3D 2HUEC 2L5AA 3AV1B 4LD9D 1KX4C 3REHA 1AOIA 2NQBD 2G5IC 2BYMA 5G49B 2JE5A 1WWIA 4YM6B 4J8XD 4KHAB 3AV1D 4WJ3C 5F99B 5BT1C 3X1TB 4H9SA 3X1SD 1P3BB 3AV2C 1P3PB 5AY8C 1M18B 5B32C 5CPJD 4X23A 4JJND 1P3LB 2DQNC 3LELB 5CP6D 3B6FB 3A6NB 4Z5TD 3MGPD 2YFWB 3X1UD 1P3BD 2FJ7D 3KWQC 3KXBC 3H0RC 3REKB 3WAAB 1P3OB 3AZLA 2ZY4A 5B0ZB 1P3ID 1P34B 2F8ND 5B1MB 5B2JA 3AZED 2JSSA 2NZDC 3MNNB 1H3OB 4DRBA 4H9OB 5DNND 2BG1A 5B0ZD 3AFAA 3AZGA 3REHC 5BNXA 1AOIC 3UT9B 4H9PA 5B40A 5AV6D 2J8PA 3KUYD 4WNNB 5B31D 3AZMD 3B0CW 3IP4C 4YS3B 1P3KD 5AV8B 1P3MB 3AZHA 2UWXA 2ZY5A 3B0DC 5AVCB 2CV5A 4ZBJB 4H9NA 5E5AB 4X23C 3MGQA 3WA9B 4J8VB 5AV5A 4G91B 3MGSD 4WV4B 5CPIA 1P3GB 3H0LC 2AROA 3WA9D 5B24B 3AZLC 2HIOD 2W8SA 4J8VD 5B2JC 3WTPB 4QLCA 1P3FD 1S32B 1F66D 3LJAA 3WTPE 3EPKA 2G5HC 4Z66B 4CAYA 1JFIB 4J8WB 3AFAC 3AZGC 3H0MC 5B40C 3AZKD 5B0YA 1U35B 1M19A 1KX3D 4AWLC 4Z66D 3B6GD 5GSUD 3LZ1D 3NQUA 3A1KA 3REIB 4WU8D 3AZHC 5GXQD 3UTAA 1Z2CB 1W2EA 2CV5C 3W99B 1U35D 1M1AD 1B67A 3W97D 2PYOB 3MGQC 3AZIB 4J8UB 5GT3B 4XZQA 5B32G 5AV5C 4KGCB 4Z2MG 5CPIC 3C1BB 3TU4B 2XD1A 2AROC 3AYWB 2ZY3A 2ZY2A 3AZNB 3AZID 1HQ3D 5BNVB 2HUEB 4J8UD 1KU5A 4XUJA 4WU9D 1ZLAD 3UTBB 5DNMA 3C1BD 5CPKD 1KX4B 3C1CA 3LZ0D 2BYKA 2RVQD 4QLCC 3AZND 5B1LB 5B2IB 3LJAC 5BO0B 3REJD 1EQZA 3UTBD 3VH5W 1N1JA 2LY8A 3VH6W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B33 A;  5B0Y C;  3W98 C;  1M19 C;  5B1L D;  5B2I D;  3WKJ A;  3AV2 B;  4KUD A;  3AN2 D;  1P3A A;  5KDM A;  1KX5 D;  3UTA C;  3X1V B;  5C3I C;  3AZF A;  5FUG B;  3KWQ B;  3KXB B;  4XZQ C;  4CSR B;  5AV9 D;  3V9R A;  3X1V D;  1ID3 A;  3O62 D;  3R45 B;  3REL B;  4LD9 A;  2F8N K;  2NZD B;  4UUZ B;  3O62 A;  1A7W A;  2NQB A;  4EO5 C;  4E45 A;  4XUJ C;  5DNM C;  3C1C C;  1AOI B;  4J8X A;  3AV1 A;  3REL D;  5AVB B;  4H9Q A;  2BYM B;  2F8N G;  4YM6 D;  3X1S A;  1EQZ C;  3MGR B;  5F99 D;  4ZUX B;  3VH5 A;  3VH6 A;  3X1T D;  5B33 C;  5CPJ A;  4JJN A;  3B0D B;  3WKJ C;  5AVB D;  1P3P D;  5CP6 A;  4KUD C;  1M18 D;  4Z5T A;  3MGP A;  4X23 B;  3MGR D;  1P3A C;  1ULY A;  3X1U A;  1P3B A;  3NQJ A;  4ZUX D;  3LEL D;  1P3L D;  3AZF C;  2FJ7 A;  3B6F D;  3A6N D;  5JRG B;  1TAF A;  1P3I A;  3WAA D;  3REK D;  2F8N A;  1P3O D;  3AZE A;  2YFW A;  3W96 B;  3MVD B;  1ID3 C;  1P34 D;  5JRG D;  5JA4 A;  5DNN A;  5B1M D;  5B2J B;  4LD9 C;  5B0Z A;  3MNN D;  3O62 C;  3AZJ B;  2NQB C;  5AV6 A;  3KUY A;  1H3O A;  3MVD D;  5B31 A;  2F8N H;  3AFA B;  3AZM A;  3AZG B;  1HTA A;  5BNX B;  4J8X C;  4H9S C;  3UT9 D;  5B40 B;  3AV1 C;  1P3K A;  3AZJ D;  2YFV B;  3X1S C;  4YS3 D;  5AV8 D;  1P3M D;  3AZH B;  5CPJ C;  4JJN C;  2CV5 B;  5AVC D;  5CP6 C;  3MGS A;  4H9N B;  4Z5T C;  5E5A D;  3MGP C;  4G92 C;  1F1E A;  1BH8 A;  3X1U C;  1P3B C;  2FJ7 C;  5AV5 B;  3WA9 A;  5CPI B;  1P3G D;  2HIO A;  4J8V A;  1P3I C;  1BFM A;  5B24 D;  3AZE C;  1P3F A;  1F66 A;  1TZY B;  5DNN C;  2IO5 C;  5B0Z C;  3WTP D;  4QLC B;  1S32 D;  3LJA B;  5AV6 C;  3KUY C;  3AZK A;  4CAY B;  5B31 C;  4J8W D;  1TZY D;  4R8P B;  3AZM C;  5GT0 B;  1KX3 A;  4HGA C;  1P3K C;  4Z66 A;  3B6G A;  5GSU A;  3LZ1 A;  5B0Y B;  3W98 B;  1M19 B;  4WU8 A;  5GXQ A;  4M6B A;  1U35 A;  3B0B A;  3NQU B;  3W97 A;  4R8P D;  5GT0 D;  3REI D;  1M1A A;  3W99 D;  3MGS C;  2PYO D;  5GT3 D;  4XZQ B;  4KGC D;  3WA9 C;  3AZI A;  1HQ3 A;  2HIO C;  3TU4 D;  4J8U A;  4J8V C;  1ZLA A;  4WU9 A;  3AYW D;  3C1B A;  5CPK A;  1R4V A;  3LZ0 A;  4EO5 B;  4H9R A;  1P3F C;  1F66 C;  4XUJ B;  3KSY A;  3AZN A;  5DNM B;  1KX4 D;  3C1C B;  3REJ A;  2BYK B;  3UTB A;  3AZK C;  5AY8 B;  1KX3 C;  5B32 B;  1EQZ B;  5B1L A;  5B2I A;  5BT1 D;  4Z66 C;  3B6G C;  5GSU C;  3LZ1 C;  5B33 B;  3AN2 A;  1KX5 A;  4WU8 C;  5GXQ C;  3WKJ B;  3AV2 D;  4KUD B;  1U35 C;  5B32 D;  1M1A C;  3W97 C;  1P3A B;  5KDM B;  3AZF B;  5AV9 A;  1WWS A;  3X1V A;  2CWE A;  3KWQ D;  3KXB D;  1BH9 A;  3AZI C;  1HQ3 C;  4J8U C;  4NFT A;  3REH B;  1ZLA C;  4WU9 C;  4LD9 B;  3C1B C;  5CPK C;  2NZD D;  3LZ0 C;  3R45 A;  2NQB B;  3REL A;  2RVQ C;  3AZN C;  3REJ C;  5G49 A;  3REH D;  4YM6 A;  4J8X B;  4KHA A;  1AOI D;  3UTB C;  5F99 A;  4H9Q B;  3X1T A;  3X1S B;  5B1L C;  5B2I C;  5AVB A;  1P3P A;  5B31 G;  1M18 A;  5CPJ B;  3AN2 C;  4JJN B;  3MGR A;  1KX5 C;  1P3L A;  4ZUX A;  3LEL A;  5CP6 B;  3B6F A;  3A6N A;  4Z5T B;  3MGP B;  4G92 B;  4X23 D;  3AZL B;  3X1U B;  2FJ7 B;  3NQJ B;  3WAA A;  3REK A;  1P3O A;  5AV9 C;  3X1V C;  1TAF B;  1P3I B;  1P34 A;  5JRG A;  2F8N B;  5B1M A;  3AZE B;  3AZL D;  3MNN A;  3W96 D;  4H9O A;  5JA4 B;  4H9P B;  5DNN B;  5B2J D;  3W96 A;  2IO5 B;  3MVD A;  4E44 A;  3UT9 A;  3REL C;  5AV6 B;  3KUY B;  4AWL B;  4WNN A;  5B31 B;  3AZJ A;  3AFA D;  3AZG D;  3AZM B;  4YM6 C;  4YS3 A;  4HGA B;  5B40 D;  1P3K B;  5F99 C;  5AV8 A;  1P3M A;  3X1T C;  3MGQ B;  5AVC A;  5AVB C;  1P3P C;  2YFV A;  1M18 C;  5E5A A;  3AZH D;  3MGR C;  2CV5 D;  1P3L C;  4ZUX C;  3LEL C;  2ARO B;  3A6N C;  3MGS B;  3B6F C;  1P3G A;  3MGQ D;  1BH8 B;  3WAA C;  5AV5 D;  3REK C;  1P3O C;  5B24 A;  5CPI D;  2HIO B;  3B0C T;  2ARO D;  1P34 C;  5JRG C;  5B1M C;  3MNN C;  3WTP A;  1P3F B;  1F66 B;  1S32 A;  3W96 C;  3MVD C;  1Q9C A;  1JFI A;  4J8W A;  1TZY A;  4QLC D;  5BS7 A;  3UT9 C;  3LJA D;  3AZK B;  3AZJ C;  1KX3 B;  4YS3 C;  3UTA B;  5C3I B;  3B6G B;  4WZS B;  5AV8 C;  5GSU B;  3LZ1 B;  5B0Y D;  4R8P A;  3W98 D;  5GT0 A;  3REI A;  4WU8 B;  1P3M C;  1M19 D;  5GXQ B;  5AVC C;  3W99 A;  3W98 A;  4ZBJ C;  1M1A B;  3W97 B;  5E5A C;  2PYO A;  3UTA D;  5GT3 A;  4NE3 A;  4G91 C;  4KGC A;  1P3G C;  4DRA A;  3TU4 A;  4XZQ D;  3AYW A;  5B24 C;  1HQ3 B;  5BNV A;  1ZLA B;  4WU9 B;  5CPK B;  1KX4 A;  5CHL B;  3LZ0 B;  4H9R B;  3WTP C;  4XUJ D;  1S32 C;  5DNM D;  4NE5 A;  5BO0 A;  3C1C D;  3REJ B;  1N1J B;  4J8W C;  1TZY C;  5BS7 C;  5AY8 D;  1EQZ D;  4NE6 A;  3AV2 A;  5AY8 A;  5B32 A;  5B33 D;  4R8P C;  3AN2 B;  5GT0 C;  3REI C;  1KX5 B;  3WKJ D;  5FUG A;  4KUD D;  3W99 C;  1P3A D;  2PYO C;  3V9R B;  3KWQ A;  3KXB A;  3AZF D;  1ID3 B;  5GT3 C;  4KGC C;  4CSR A;  5AV9 B;  3TU4 C;  3O62 B;  1BH9 B;  3VH5 T;  4Z2M H;  3VH6 T;  3AYW C;  2NZD A;  4UUZ A;  1B6W A;  1ID3 D;  2HUE C;  2L5A A;  3AV1 B;  4LD9 D;  1KX4 C;  3REH A;  1AOI A;  2NQB D;  2BYM A;  5G49 B;  1WWI A;  4YM6 B;  4J8X D;  4KHA B;  3AV1 D;  5F99 B;  5BT1 C;  3X1T B;  4H9S A;  3X1S D;  1P3B B;  3AV2 C;  1P3P B;  5AY8 C;  1M18 B;  5B32 C;  5CPJ D;  4X23 A;  4JJN D;  1P3L B;  3LEL B;  5CP6 D;  3B6F B;  3A6N B;  4Z5T D;  3MGP D;  2YFW B;  3X1U D;  1P3B D;  2FJ7 D;  3KWQ C;  3KXB C;  3WAA B;  3REK B;  1P3O B;  3AZL A;  5B0Z B;  1P3I D;  1P34 B;  2F8N D;  5B1M B;  5B2J A;  3AZE D;  2JSS A;  2NZD C;  3MNN B;  1H3O B;  4DRB A;  4H9O B;  5DNN D;  5B0Z D;  3AFA A;  3AZG A;  3REH C;  5BNX A;  1AOI C;  3UT9 B;  4H9P A;  5B40 A;  5AV6 D;  3KUY D;  4WNN B;  5B31 D;  3AZM D;  3B0C W;  4YS3 B;  1P3K D;  5AV8 B;  1P3M B;  3AZH A;  3B0D C;  2CV5 A;  5AVC B;  4ZBJ B;  4H9N A;  5E5A B;  4X23 C;  3MGQ A;  3WA9 B;  4J8V B;  5AV5 A;  4G91 B;  3MGS D;  4WV4 B;  5CPI A;  1P3G B;  2ARO A;  3WA9 D;  5B24 B;  3AZL C;  2HIO D;  4J8V D;  5B2J C;  3WTP B;  4QLC A;  1P3F D;  1S32 B;  1F66 D;  3LJA A;  3WTP E;  4Z66 B;  4CAY A;  1JFI B;  4J8W B;  3AFA C;  3AZG C;  5B40 C;  3AZK D;  5B0Y A;  1U35 B;  1M19 A;  1KX3 D;  4AWL C;  4Z66 D;  3B6G D;  5GSU D;  3LZ1 D;  3NQU A;  3REI B;  4WU8 D;  3AZH C;  5GXQ D;  3UTA A;  2CV5 C;  3W99 B;  1U35 D;  1M1A D;  1B67 A;  3W97 D;  2PYO B;  3MGQ C;  3AZI B;  4J8U B;  5GT3 B;  4XZQ A;  5B32 G;  5AV5 C;  4KGC B;  4Z2M G;  5CPI C;  3C1B B;  3TU4 B;  2ARO C;  3AYW B;  3AZN B;  3AZI D;  1HQ3 D;  5BNV B;  2HUE B;  4J8U D;  1KU5 A;  4XUJ A;  4WU9 D;  1ZLA D;  3UTB B;  5DNM A;  3C1B D;  5CPK D;  1KX4 B;  3C1C A;  3LZ0 D;  2BYK A;  2RVQ D;  4QLC C;  3AZN D;  5B1L B;  5B2I B;  3LJA C;  5BO0 B;  3REJ D;  1EQZ A;  3UTB D;  3VH5 W;  1N1J A;  2LY8 A;  3VH6 W; 
#chains in the Genus database with same CATH topology
 5B33 A;  5B0Y C;  3W98 C;  1M19 C;  5B1L D;  5B2I D;  3WKJ A;  3AV2 B;  4KUD A;  3AL0 C;  3AN2 D;  1P3A A;  5KDM A;  1KX5 D;  3UTA C;  3X1V B;  5C3I C;  3AZF A;  5FUG B;  3KWQ B;  3KXB B;  4XZQ C;  4CSR B;  5AV9 D;  3V9R A;  3X1V D;  1ID3 A;  3O62 D;  3R45 B;  3REL B;  4LD9 A;  2F8N K;  2NZD B;  4UUZ B;  3O62 A;  1A7W A;  2NQB A;  4EO5 C;  4E45 A;  4XUJ C;  5DNM C;  3C1C C;  1AOI B;  4J8X A;  3AV1 A;  3REL D;  5AVB B;  4H9Q A;  2BYM B;  2F8N G;  2F2A C;  4YM6 D;  3X1S A;  1EQZ C;  3MGR B;  5F99 D;  2Y2K A;  4ZUX B;  3VH5 A;  3VH6 A;  3X1T D;  5B33 C;  5CPJ A;  4JJN A;  3B0D B;  3WKJ C;  5AVB D;  1P3P D;  5CP6 A;  4KUD C;  1M18 D;  4Z5T A;  3MGP A;  4X23 B;  3MGR D;  1P3A C;  1ULY A;  3X1U A;  1P3B A;  3NQJ A;  4ZUX D;  3LEL D;  1P3L D;  3AZF C;  2FJ7 A;  3B6F D;  3A6N D;  5JRG B;  1TAF A;  1P3I A;  3WAA D;  3REK D;  2F8N A;  1P3O D;  3AZE A;  2YFW A;  3W96 B;  4DQY B;  1T3U A;  3MVD B;  1ID3 C;  2FFF B;  1P34 D;  5JRG D;  5JA4 A;  5DNN A;  5B1M D;  5B2J B;  4LD9 C;  5B0Z A;  3MNN D;  3O62 C;  3AZJ B;  2NQB C;  5AV6 A;  3KUY A;  1H3O A;  3MVD D;  5B31 A;  2F8N H;  3AFA B;  3EPJ A;  3AZM A;  3AZG B;  1HTA A;  5BNX B;  4J8X C;  4H9S C;  3UT9 D;  5B40 B;  3AV1 C;  1P3K A;  2Y2H A;  2RIQ A;  3AZJ D;  2YFV B;  3X1S C;  4YS3 D;  5AV8 D;  1P3M D;  3AZH B;  5CPJ C;  4JJN C;  2CV5 B;  5AVC D;  5CP6 C;  3MGS A;  4H9N B;  4Z5T C;  5E5A D;  3MGP C;  4G92 C;  1F1E A;  1BH8 A;  3X1U C;  1P3B C;  2FJ7 C;  5AV5 B;  3WA9 A;  5CPI B;  1P3G D;  2HIO A;  3EG5 B;  4J8V A;  1P3I C;  1BFM A;  5B24 D;  3AZE C;  1P3F A;  1F66 A;  1TZY B;  5DNN C;  2IO5 C;  5B0Z C;  3WTP D;  4QLC B;  1S32 D;  3LJA B;  5AV6 C;  3KUY C;  3AZK A;  4CAY B;  5B31 C;  4J8W D;  1TZY D;  4R8P B;  3AZM C;  5GT0 B;  1KX3 A;  4HGA C;  1P3K C;  4Z66 A;  3B6G A;  5GSU A;  3LZ1 A;  5B0Y B;  3W98 B;  1M19 B;  4WU8 A;  5GXQ A;  3EPH A;  4M6B A;  1U35 A;  3B0B A;  3NQU B;  3W97 A;  4R8P D;  5GT0 D;  3REI D;  1M1A A;  3F6T A;  3W99 D;  3MGS C;  2PYO D;  5GT3 D;  4XZQ B;  4KGC D;  3WA9 C;  3AZI A;  1HQ3 A;  2HIO C;  3TU4 D;  4J8U A;  4J8V C;  1ZLA A;  4WU9 A;  3AYW D;  3C1B A;  5CPK A;  1R4V A;  3LZ0 A;  4EO5 B;  4H9R A;  1P3F C;  1F66 C;  4XUJ B;  3KSY A;  3AZN A;  5DNM B;  1KX4 D;  3C1C B;  3REJ A;  2BYK B;  3UTB A;  3A1I A;  3AZK C;  5AY8 B;  1KX3 C;  5B32 B;  1EQZ B;  5B1L A;  5B2I A;  3FDD A;  5BT1 D;  4Z66 C;  3B6G C;  5GSU C;  3LZ1 C;  5B33 B;  3AN2 A;  1KX5 A;  4WU8 C;  5GXQ C;  3WKJ B;  3AV2 D;  4KUD B;  1U35 C;  5B32 D;  2Y2J A;  1M1A C;  3W97 C;  1P3A B;  5KDM B;  2DF4 C;  3AZF B;  5AV9 A;  1WWS A;  3X1V A;  2CWE A;  3KWQ D;  3KXB D;  1BH9 A;  3AZI C;  1HQ3 C;  4J8U C;  4NFT A;  3REH B;  1ZLA C;  4WU9 C;  4LD9 B;  3C1B C;  5CPK C;  2NZD D;  3LZ0 C;  3R45 A;  2NQB B;  3REL A;  2RVQ C;  3AZN C;  3KFU G;  2Y2Q A;  3REJ C;  5G49 A;  3REH D;  4YM6 A;  4J8X B;  4KHA A;  1AOI D;  3UTB C;  5F99 A;  4H9Q B;  3X1T A;  3X1S B;  5B1L C;  5B2I C;  5AVB A;  1P3P A;  5B31 G;  1M18 A;  5CPJ B;  3AN2 C;  4JJN B;  3MGR A;  1KX5 C;  1P3L A;  4ZUX A;  3LEL A;  5CP6 B;  3B6F A;  3A6N A;  4Z5T B;  3MGP B;  4G92 B;  4X23 D;  3AZL B;  3X1U B;  2FJ7 B;  3NQJ B;  2Y2I A;  3WAA A;  3REK A;  1P3O A;  1PZR A;  5AV9 C;  3X1V C;  1TAF B;  1P3I B;  1P34 A;  5JRG A;  2F8N B;  2Y2P A;  5B1M A;  3AZE B;  3AZL D;  3MNN A;  3W96 D;  4H9O A;  5JA4 B;  2VQR A;  4H9P B;  5DNN B;  3W96 A;  2IO5 B;  5B2J D;  3MVD A;  4E44 A;  3UT9 A;  3REL C;  5AV6 B;  3KUY B;  4AWL B;  4WNN A;  5B31 B;  3AZJ A;  3AFA D;  3AZG D;  3AZM B;  4YM6 C;  4YS3 A;  4HGA B;  5B40 D;  2Y2M A;  1P3K B;  5F99 C;  5AV8 A;  2XD5 A;  1P3M A;  3X1T C;  3MGQ B;  5AVC A;  5AVB C;  1P3P C;  2YFV A;  1M18 C;  5E5A A;  3AZH D;  3MGR C;  2CV5 D;  1P3L C;  4ZUX C;  3LEL C;  2ARO B;  3A6N C;  3MGS B;  3P5J B;  3B6F C;  1P3G A;  3MGQ D;  1BH8 B;  4UPK A;  3WAA C;  5AV5 D;  3REK C;  1P3O C;  5B24 A;  5CPI D;  2HIO B;  3B0C T;  2Y2L A;  2ARO D;  1P34 C;  5JRG C;  5B1M C;  3MNN C;  3WTP A;  1P3F B;  1F66 B;  1S32 A;  2Y2O A;  3W96 C;  3MVD C;  1Q9C A;  1JFI A;  4J8W A;  1TZY A;  4QLC D;  5BS7 A;  3UT9 C;  3LJA D;  3AZK B;  3AZJ C;  1KX3 B;  4YS3 C;  3UTA B;  2Y2N A;  5C3I B;  3B6G B;  4WZS B;  5AV8 C;  5GSU B;  2Y2G A;  5B0Y D;  4R8P A;  3LZ1 B;  5GT0 A;  3EPL A;  4WU8 B;  3REI A;  1P3M C;  5GXQ B;  1M19 D;  3W98 D;  5AVC C;  3W99 A;  3W98 A;  4ZBJ C;  1M1A B;  3W97 B;  5E5A C;  2PYO A;  3UTA D;  2JCH A;  2ZM5 A;  5GT3 A;  4NE3 A;  4G91 C;  4KGC A;  1P3G C;  4DRA A;  3TU4 A;  4XZQ D;  3AYW A;  5B24 C;  1HQ3 B;  5BNV A;  1ZLA B;  4WU9 B;  5CPK B;  1KX4 A;  5CHL B;  3LZ0 B;  4H9R B;  3WTP C;  4XUJ D;  1S32 C;  5DNM D;  4NE5 A;  5BO0 A;  3C1C D;  3REJ B;  1N1J B;  4J8W C;  1TZY C;  5BS7 C;  5AY8 D;  1EQZ D;  4NE6 A;  3AV2 A;  5AY8 A;  5B32 A;  5B33 D;  4R8P C;  3AN2 B;  5GT0 C;  3REI C;  1KX5 B;  3WKJ D;  5FUG A;  4KUD D;  3W99 C;  1P3A D;  2PYO C;  3V9R B;  3KWQ A;  3KXB A;  3AZF D;  1ID3 B;  5GT3 C;  4KGC C;  4CSR A;  5AV9 B;  3TU4 C;  3O62 B;  1BH9 B;  3VH5 T;  4Z2M H;  3VH6 T;  3AYW C;  2NZD A;  4UUZ A;  1B6W A;  1ID3 D;  2HUE C;  2L5A A;  3AV1 B;  4LD9 D;  1KX4 C;  3REH A;  1AOI A;  2NQB D;  2G5I C;  2BYM A;  5G49 B;  2JE5 A;  1WWI A;  4YM6 B;  4J8X D;  4KHA B;  3AV1 D;  4WJ3 C;  5F99 B;  5BT1 C;  3X1T B;  4H9S A;  3X1S D;  1P3B B;  3AV2 C;  1P3P B;  5AY8 C;  1M18 B;  5B32 C;  5CPJ D;  4X23 A;  4JJN D;  1P3L B;  2DQN C;  3LEL B;  5CP6 D;  3B6F B;  3A6N B;  4Z5T D;  3MGP D;  2YFW B;  3X1U D;  1P3B D;  2FJ7 D;  3KWQ C;  3KXB C;  3H0R C;  3REK B;  3WAA B;  1P3O B;  3AZL A;  2ZY4 A;  5B0Z B;  1P3I D;  1P34 B;  2F8N D;  5B1M B;  5B2J A;  3AZE D;  2JSS A;  2NZD C;  3MNN B;  1H3O B;  4DRB A;  4H9O B;  5DNN D;  2BG1 A;  5B0Z D;  3AFA A;  3AZG A;  3REH C;  5BNX A;  1AOI C;  3UT9 B;  4H9P A;  5B40 A;  5AV6 D;  2J8P A;  3KUY D;  4WNN B;  5B31 D;  3AZM D;  3B0C W;  3IP4 C;  4YS3 B;  1P3K D;  5AV8 B;  1P3M B;  3AZH A;  2UWX A;  2ZY5 A;  3B0D C;  5AVC B;  2CV5 A;  4ZBJ B;  4H9N A;  5E5A B;  4X23 C;  3MGQ A;  3WA9 B;  4J8V B;  5AV5 A;  4G91 B;  3MGS D;  4WV4 B;  5CPI A;  1P3G B;  3H0L C;  2ARO A;  3WA9 D;  5B24 B;  3AZL C;  2HIO D;  2W8S A;  4J8V D;  5B2J C;  3WTP B;  4QLC A;  1P3F D;  1S32 B;  1F66 D;  3LJA A;  3WTP E;  3EPK A;  2G5H C;  4Z66 B;  4CAY A;  1JFI B;  4J8W B;  3AFA C;  3AZG C;  3H0M C;  5B40 C;  3AZK D;  5B0Y A;  1U35 B;  1M19 A;  1KX3 D;  4AWL C;  4Z66 D;  3B6G D;  5GSU D;  3LZ1 D;  3NQU A;  3A1K A;  3REI B;  4WU8 D;  3AZH C;  5GXQ D;  3UTA A;  1Z2C B;  1W2E A;  2CV5 C;  3W99 B;  1U35 D;  1M1A D;  1B67 A;  3W97 D;  2PYO B;  3MGQ C;  3AZI B;  4J8U B;  5GT3 B;  4XZQ A;  5B32 G;  5AV5 C;  4KGC B;  4Z2M G;  5CPI C;  3C1B B;  3TU4 B;  2XD1 A;  2ARO C;  3AYW B;  2ZY3 A;  2ZY2 A;  3AZN B;  3AZI D;  1HQ3 D;  5BNV B;  2HUE B;  4J8U D;  1KU5 A;  4XUJ A;  4WU9 D;  1ZLA D;  3UTB B;  5DNM A;  3C1B D;  5CPK D;  1KX4 B;  3C1C A;  3LZ0 D;  2BYK A;  2RVQ D;  4QLC C;  3AZN D;  5B1L B;  5B2I B;  3LJA C;  5BO0 B;  3REJ D;  1EQZ A;  3UTB D;  3VH5 W;  1N1J A;  2LY8 A;  3VH6 W; 
#chains in the Genus database with same CATH homology
 5B33 A;  5B0Y C;  3W98 C;  1M19 C;  5B1L D;  5B2I D;  3WKJ A;  3AV2 B;  4KUD A;  3AL0 C;  3AN2 D;  1P3A A;  5KDM A;  1KX5 D;  3UTA C;  3X1V B;  5C3I C;  3AZF A;  5FUG B;  3KWQ B;  3KXB B;  4XZQ C;  4CSR B;  5AV9 D;  3V9R A;  3X1V D;  1ID3 A;  3O62 D;  3R45 B;  3REL B;  4LD9 A;  2F8N K;  2NZD B;  4UUZ B;  3O62 A;  1A7W A;  2NQB A;  4EO5 C;  4E45 A;  4XUJ C;  5DNM C;  3C1C C;  1AOI B;  4J8X A;  3AV1 A;  3REL D;  5AVB B;  4H9Q A;  2BYM B;  2F8N G;  2F2A C;  4YM6 D;  3X1S A;  1EQZ C;  3MGR B;  5F99 D;  2Y2K A;  4ZUX B;  3VH5 A;  3VH6 A;  3X1T D;  5B33 C;  5CPJ A;  4JJN A;  3B0D B;  3WKJ C;  5AVB D;  1P3P D;  5CP6 A;  4KUD C;  1M18 D;  4Z5T A;  3MGP A;  4X23 B;  3MGR D;  1P3A C;  1ULY A;  3X1U A;  1P3B A;  3NQJ A;  4ZUX D;  3LEL D;  1P3L D;  3AZF C;  2FJ7 A;  3B6F D;  3A6N D;  5JRG B;  1TAF A;  1P3I A;  3WAA D;  3REK D;  2F8N A;  1P3O D;  3AZE A;  2YFW A;  3W96 B;  4DQY B;  1T3U A;  3MVD B;  1ID3 C;  2FFF B;  1P34 D;  5JRG D;  5JA4 A;  5DNN A;  5B1M D;  5B2J B;  4LD9 C;  5B0Z A;  3MNN D;  3O62 C;  3AZJ B;  2NQB C;  5AV6 A;  3KUY A;  1H3O A;  3MVD D;  5B31 A;  2F8N H;  3AFA B;  3EPJ A;  3AZM A;  3AZG B;  1HTA A;  5BNX B;  4J8X C;  4H9S C;  3UT9 D;  5B40 B;  3AV1 C;  1P3K A;  2Y2H A;  2RIQ A;  3AZJ D;  2YFV B;  3X1S C;  4YS3 D;  5AV8 D;  1P3M D;  3AZH B;  5CPJ C;  4JJN C;  2CV5 B;  5AVC D;  5CP6 C;  3MGS A;  4H9N B;  4Z5T C;  5E5A D;  3MGP C;  4G92 C;  1F1E A;  1BH8 A;  3X1U C;  1P3B C;  2FJ7 C;  5AV5 B;  3WA9 A;  5CPI B;  1P3G D;  2HIO A;  3EG5 B;  4J8V A;  1P3I C;  1BFM A;  5B24 D;  3AZE C;  1P3F A;  1F66 A;  1TZY B;  5DNN C;  2IO5 C;  5B0Z C;  3WTP D;  4QLC B;  1S32 D;  3LJA B;  5AV6 C;  3KUY C;  3AZK A;  4CAY B;  5B31 C;  4J8W D;  1TZY D;  4R8P B;  3AZM C;  5GT0 B;  1KX3 A;  4HGA C;  1P3K C;  4Z66 A;  3B6G A;  5GSU A;  3LZ1 A;  5B0Y B;  3W98 B;  1M19 B;  4WU8 A;  5GXQ A;  3EPH A;  4M6B A;  1U35 A;  3B0B A;  3NQU B;  3W97 A;  4R8P D;  5GT0 D;  3REI D;  1M1A A;  3F6T A;  3W99 D;  3MGS C;  2PYO D;  5GT3 D;  4XZQ B;  4KGC D;  3WA9 C;  3AZI A;  1HQ3 A;  2HIO C;  3TU4 D;  4J8U A;  4J8V C;  1ZLA A;  4WU9 A;  3AYW D;  3C1B A;  5CPK A;  1R4V A;  3LZ0 A;  4EO5 B;  4H9R A;  1P3F C;  1F66 C;  4XUJ B;  3KSY A;  3AZN A;  5DNM B;  1KX4 D;  3C1C B;  3REJ A;  2BYK B;  3UTB A;  3A1I A;  3AZK C;  5AY8 B;  1KX3 C;  5B32 B;  1EQZ B;  5B1L A;  5B2I A;  3FDD A;  5BT1 D;  4Z66 C;  3B6G C;  5GSU C;  3LZ1 C;  5B33 B;  3AN2 A;  1KX5 A;  4WU8 C;  5GXQ C;  3WKJ B;  3AV2 D;  4KUD B;  1U35 C;  5B32 D;  2Y2J A;  1M1A C;  3W97 C;  1P3A B;  5KDM B;  2DF4 C;  3AZF B;  5AV9 A;  1WWS A;  3X1V A;  2CWE A;  3KWQ D;  3KXB D;  1BH9 A;  3AZI C;  1HQ3 C;  4J8U C;  4NFT A;  3REH B;  1ZLA C;  4WU9 C;  4LD9 B;  3C1B C;  5CPK C;  2NZD D;  3LZ0 C;  3R45 A;  2NQB B;  3REL A;  2RVQ C;  3AZN C;  3KFU G;  2Y2Q A;  3REJ C;  5G49 A;  3REH D;  4YM6 A;  4J8X B;  4KHA A;  1AOI D;  3UTB C;  5F99 A;  4H9Q B;  3X1T A;  3X1S B;  5B1L C;  5B2I C;  5AVB A;  1P3P A;  5B31 G;  1M18 A;  5CPJ B;  3AN2 C;  4JJN B;  3MGR A;  1KX5 C;  1P3L A;  4ZUX A;  3LEL A;  5CP6 B;  3B6F A;  3A6N A;  4Z5T B;  3MGP B;  4G92 B;  4X23 D;  3AZL B;  3X1U B;  2FJ7 B;  3NQJ B;  2Y2I A;  3WAA A;  3REK A;  1P3O A;  1PZR A;  5AV9 C;  3X1V C;  1TAF B;  1P3I B;  1P34 A;  5JRG A;  2F8N B;  2Y2P A;  5B1M A;  3AZE B;  3AZL D;  3MNN A;  3W96 D;  4H9O A;  5JA4 B;  2VQR A;  4H9P B;  5DNN B;  3W96 A;  2IO5 B;  5B2J D;  3MVD A;  4E44 A;  3UT9 A;  3REL C;  5AV6 B;  3KUY B;  4AWL B;  4WNN A;  5B31 B;  3AZJ A;  3AFA D;  3AZG D;  3AZM B;  4YM6 C;  4YS3 A;  4HGA B;  5B40 D;  2Y2M A;  1P3K B;  5F99 C;  5AV8 A;  2XD5 A;  1P3M A;  3X1T C;  3MGQ B;  5AVC A;  5AVB C;  1P3P C;  2YFV A;  1M18 C;  5E5A A;  3AZH D;  3MGR C;  2CV5 D;  1P3L C;  4ZUX C;  3LEL C;  2ARO B;  3A6N C;  3MGS B;  3P5J B;  3B6F C;  1P3G A;  3MGQ D;  1BH8 B;  4UPK A;  3WAA C;  5AV5 D;  3REK C;  1P3O C;  5B24 A;  5CPI D;  2HIO B;  3B0C T;  2Y2L A;  2ARO D;  1P34 C;  5JRG C;  5B1M C;  3MNN C;  3WTP A;  1P3F B;  1F66 B;  1S32 A;  2Y2O A;  3W96 C;  3MVD C;  1Q9C A;  1JFI A;  4J8W A;  1TZY A;  4QLC D;  5BS7 A;  3UT9 C;  3LJA D;  3AZK B;  3AZJ C;  1KX3 B;  4YS3 C;  3UTA B;  2Y2N A;  5C3I B;  3B6G B;  4WZS B;  5AV8 C;  5GSU B;  2Y2G A;  5B0Y D;  4R8P A;  3LZ1 B;  5GT0 A;  3EPL A;  4WU8 B;  3REI A;  1P3M C;  5GXQ B;  1M19 D;  3W98 D;  5AVC C;  3W99 A;  3W98 A;  4ZBJ C;  1M1A B;  3W97 B;  5E5A C;  2PYO A;  3UTA D;  2JCH A;  2ZM5 A;  5GT3 A;  4NE3 A;  4G91 C;  4KGC A;  1P3G C;  4DRA A;  3TU4 A;  4XZQ D;  3AYW A;  5B24 C;  1HQ3 B;  5BNV A;  1ZLA B;  4WU9 B;  5CPK B;  1KX4 A;  5CHL B;  3LZ0 B;  4H9R B;  3WTP C;  4XUJ D;  1S32 C;  5DNM D;  4NE5 A;  5BO0 A;  3C1C D;  3REJ B;  1N1J B;  4J8W C;  1TZY C;  5BS7 C;  5AY8 D;  1EQZ D;  4NE6 A;  3AV2 A;  5AY8 A;  5B32 A;  5B33 D;  4R8P C;  3AN2 B;  5GT0 C;  3REI C;  1KX5 B;  3WKJ D;  5FUG A;  4KUD D;  3W99 C;  1P3A D;  2PYO C;  3V9R B;  3KWQ A;  3KXB A;  3AZF D;  1ID3 B;  5GT3 C;  4KGC C;  4CSR A;  5AV9 B;  3TU4 C;  3O62 B;  1BH9 B;  3VH5 T;  4Z2M H;  3VH6 T;  3AYW C;  2NZD A;  4UUZ A;  1B6W A;  1ID3 D;  2HUE C;  2L5A A;  3AV1 B;  4LD9 D;  1KX4 C;  3REH A;  1AOI A;  2NQB D;  2G5I C;  2BYM A;  5G49 B;  2JE5 A;  1WWI A;  4YM6 B;  4J8X D;  4KHA B;  3AV1 D;  4WJ3 C;  5F99 B;  5BT1 C;  3X1T B;  4H9S A;  3X1S D;  1P3B B;  3AV2 C;  1P3P B;  5AY8 C;  1M18 B;  5B32 C;  5CPJ D;  4X23 A;  4JJN D;  1P3L B;  2DQN C;  3LEL B;  5CP6 D;  3B6F B;  3A6N B;  4Z5T D;  3MGP D;  2YFW B;  3X1U D;  1P3B D;  2FJ7 D;  3KWQ C;  3KXB C;  3H0R C;  3REK B;  3WAA B;  1P3O B;  3AZL A;  2ZY4 A;  5B0Z B;  1P3I D;  1P34 B;  2F8N D;  5B1M B;  5B2J A;  3AZE D;  2JSS A;  2NZD C;  3MNN B;  1H3O B;  4DRB A;  4H9O B;  5DNN D;  2BG1 A;  5B0Z D;  3AFA A;  3AZG A;  3REH C;  5BNX A;  1AOI C;  3UT9 B;  4H9P A;  5B40 A;  5AV6 D;  2J8P A;  3KUY D;  4WNN B;  5B31 D;  3AZM D;  3B0C W;  3IP4 C;  4YS3 B;  1P3K D;  5AV8 B;  1P3M B;  3AZH A;  2UWX A;  2ZY5 A;  3B0D C;  5AVC B;  2CV5 A;  4ZBJ B;  4H9N A;  5E5A B;  4X23 C;  3MGQ A;  3WA9 B;  4J8V B;  5AV5 A;  4G91 B;  3MGS D;  4WV4 B;  5CPI A;  1P3G B;  3H0L C;  2ARO A;  3WA9 D;  5B24 B;  3AZL C;  2HIO D;  2W8S A;  4J8V D;  5B2J C;  3WTP B;  4QLC A;  1P3F D;  1S32 B;  1F66 D;  3LJA A;  3WTP E;  3EPK A;  2G5H C;  4Z66 B;  4CAY A;  1JFI B;  4J8W B;  3AFA C;  3AZG C;  3H0M C;  5B40 C;  3AZK D;  5B0Y A;  1U35 B;  1M19 A;  1KX3 D;  4AWL C;  4Z66 D;  3B6G D;  5GSU D;  3LZ1 D;  3NQU A;  3A1K A;  3REI B;  4WU8 D;  3AZH C;  5GXQ D;  3UTA A;  1Z2C B;  1W2E A;  2CV5 C;  3W99 B;  1U35 D;  1M1A D;  1B67 A;  3W97 D;  2PYO B;  3MGQ C;  3AZI B;  4J8U B;  5GT3 B;  4XZQ A;  5B32 G;  5AV5 C;  4KGC B;  4Z2M G;  5CPI C;  3C1B B;  3TU4 B;  2XD1 A;  2ARO C;  3AYW B;  2ZY3 A;  2ZY2 A;  3AZN B;  3AZI D;  1HQ3 D;  5BNV B;  2HUE B;  4J8U D;  1KU5 A;  4XUJ A;  4WU9 D;  1ZLA D;  3UTB B;  5DNM A;  3C1B D;  5CPK D;  1KX4 B;  3C1C A;  3LZ0 D;  2BYK A;  2RVQ D;  4QLC C;  3AZN D;  5B1L B;  5B2I B;  3LJA C;  5BO0 B;  3REJ D;  1EQZ A;  3UTB D;  3VH5 W;  1N1J A;  2LY8 A;  3VH6 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...