5BO0B

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.2-h4 dimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
b'RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
molecule tags Chaperone/dna binding protein
source organism Homo sapiens
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
total genus 25
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bo0B00
1TZYA 2RVQD 2YFVA 4E44A 5E5AC 4QLCD 3AZMA 2BYKB 4YS3D 1KX3D 3VH5T 2BYMA 5F99A 5BO0A 4J8VB 3REKC 3KWQC 3AZLA 1S32A 4ZBJB 1P3KD 1ID3C 3WTPB 3W99B 3AZEB 5AVBA 5CP6A 4UUZB 5JA4B 5B1LA 3AZIA 4KUDB 5C3IB 5B0YA 3MVDC 1P3GD 4YS3B 3WKJC 5B40A 5CPID 4J8VC 5GXQC 2F8NG 5JRGA 1F66D 5GSUC 1BH8A 4J8UC 2FJ7B 3AZHC 3W96C 1P3IA 1M1AA 3AZIC 3UTBA 5GT3C 4KGCB 3MVDA 3AZGC 5DNMC 4WZSB 4LD9B 5B40C 5GSUA 4J8UA 3TU4B 1KX4C 5AV9A 5B33B 3W96A 1P3IC 4J8WA 1M1AB 1P3FA 3AFAD 3O62A 4WU8C 3WA9B 4R8PB 3LJAD 3UTAD 1ZLAC 3AYWB 1HQ3A 3X1UB 3UT9B 1P34B 5B31C 4H9QB 5BNXB 3KXBA 4J8WC 1P3FB 1P3FC 3WA9A 4XZQD 5GXQD 3X1SD 1EQZC 4JJNC 5B31B 3B0DB 5AVBB 3B6FD 3RELB 3AZHD 1P3LB 5AV5B 1WWSA 5BNVA 3A6NC 3W97C 3AYWC 4ZUXD 5AV8C 5B2JC 4NE6A 1U35A 1M18A 1P3MB 2F8NB 3REKD 2FJ7A 5B0ZC 3AZKC 4XUJA 3MNNC 3AZKB 1TZYD 1P3LA 1F1EA 5AV5A 5FUGB 5AY8A 3AZFD 5B24B 1S32D 3W98C 4LD9D 5AV8B 1TAFA 3LZ0D 3AZNC 5JRGB 5AV6D 5AVBD 5GSUB 4J8UB 2FJ7C 5B1LD 3WAAC 3V9RB 4XUJC 3W99A 3O62B 4YS3C 1P3GA 5FUGA 5AY8B 3MVDB 5KDMB 5CPIA 5B1MC 5AVCC 1F66A 3AZJA 3AZNA 3X1UC 3UT9C 1P34C 3KWQB 3UTBD 1KX4D 5CPJA 5B32B 3LJAC 5B32G 3REID 1P3BC 1KX3B 1F66C 3KUYA 1TZYC 5BT1D 5BNXA 4G91C 1P3AB 4KHAB 3O62D 1P3PB 1M19D 1Q9CA 3MGPD 3UTAA 3MGSA 2PYOB 4CSRA 2AROC 2YFWA 4R8PA 4XZQC 4XUJB 3X1SC 3KUYB 3KUYC 4Z5TC 3X1SB 3AV2A 2BYKA 3REHA 1P3PD 4WU8D 5B2JD 4H9OB 3WA9D 2BYMB 5F99B 3AZLB 5GXQA 3UTAC 4Z66C 4J8XD 5B2IC 2YFWB 3B0CW 3AZEC 1B6WA 3V9RA 5B0ZD 3WTPC 5JA4A 3MGRA 4Z5TA 3UTBC 1H3OB 3LJAB 5KDMA 5B32C 1M18D 3REKA 1P3BD 3AV1B 4Z66A 1EQZD 4H9PA 5AV6C 5AV9C 5AV5D 4Z2MH 3B0DC 1WWIA 5AVBC 3WTPA 3KWQA 3B6FB 3MGRB 5AY8D 2NQBD 3AZFA 1M19C 1ID3A 4NFTA 3MGPC 2CV5D 5CP6C 1ZLAA 5B32A 4LD9A 1ULYA 2NZDD 4EO5B 3AZMB 2AROD 5B1MD 5AVCD 4Z66B 3WAAB 5B24D 1S32B 4Z2MG 3W99D 3C1BA 2F8NK 3X1UD 3UT9D 1P34D 1KX5D 5CPKB 5JRGC 3B0BA 5B33D 4WU9A 5CPKC 3WA9C 3VH6W 1A7WA 4CSRB 3C1CD 1M1AC 3AZND 5B2ID 3LELD 2AROB 3AZED 3REIC 3AZGA 3R45B 5DNMA 1P3MD 3WAAD 2CV5B 5GT0C 3B6GA 4YM6A 3AN2B 5BT1C 4X23D 4QLCA 3AZMD 4DRAA 4KGCD 1P3OD 5G49B 1BH9B 1HQ3C 5AV5C 4JJNB 5CHLB 4KUDD 4QLCC 4E45A 4J8WB 3X1VB 5B2IB 1KU5A 1N1JB 1R4VA 3AV2D 1AOIB 3W99C 1ID3B 4JJNA 5B2JA 1ZLAB 5B0YB 3MVDD 3A6NA 3W97A 5AV8A 5E5AB 3LZ1A 4NE3A 3X1VA 2PYOD 5B0ZA 3W98B 5GSUD 4J8UD 5AV9D 3NQJA 4X23C 3W96D 2HIOD 3AZKA 3AFAA 3MNNA 2YFVB 3AN2D 3LJAA 5GT3B 2CV5C 4KGCC 1KX3C 1F66B 3REIB 1P3BB 1U35B 1HQ3D 3W98A 1ID3D 3MGQA 5BS7A 1KX5C 3REJA 5B32D 4H9NA 3X1TB 5CPKD 3RELC 5DNNA 4XZQA 5C3IC 4YS3A 1P3GC 1KX3A 3X1TD 5B24A 5B1MB 5AVCB 1BFMA 5F99D 3AZLD 3X1UA 3UT9A 1P34A 5B31D 4G92B 3B6GB 4QLCB 5GT0D 3C1BB 1M19B 5CP6D 4WV4B 1U35D 3C1CA 4H9NB 1P3OB 2NZDC 5B2IA 3LELA 5AV6B 5DNNB 2HUEC 5CPJC 3AZGD 5B40D 5B24C 2HIOB 4YM6D 3AZJB 2IO5B 5JRGD 3AYWD 5B33C 3TU4C 1KX4B 3AN2C 3MGSC 3C1CB 3C1CC 1P3OA 3LZ0A 1M1AD 3MGSB 5B0ZB 3LELC 5AV6A 2LY8A 5G49A 2IO5C 3VH6T 1H3OA 3AZIB 4KUDA 3NQUA 5B2JB 3AV2B 1AOID 3A6NB 2F8NH 3RELD 2JSSA 5E5AA 3LZ1B 1S32C 4J8WD 1P3OC 3REHC 4ZUXB 5GXQB 3LZ0C 3REJD 3C1BC 2PYOC 1N1JA 5B1LC 4JJND 5CP6B 4UUZA 3MGPB 4KUDC 3W97D 1P3GB 3MGRC 1JFIA 3LZ1D 4HGAC 1TZYB 3REIA 4H9OA 3KXBD 1M18B 3REKB 3AV1C 4H9RA 5BO0B 4J8VA 4NE5A 3MGQB 1M19A 3MNND 1P3IB 3B6FA 3TU4D 3NQJB 3MGPA 3AZHA 3MGSD 3UTBB 3LELB 4J8XB 1JFIB 3AFAB 3AZFC 5GT3A 3VH5W 2L5AA 3R45A 5DNMB 4LD9C 3AV1A 3MGQD 4H9RB 4YM6B 5F99C 3AZLC 4AWLC 4H9QA 1P3PA 4WU8A 3O62C 4XUJD 5CPKA 3W96B 3KXBB 5DNND 3AZHB 1P3LD 4WU9B 4J8XA 3X1TA 2NZDB 4WU9C 5CPIB 5B0YC 4XZQB 5B31A 3WKJA 4Z5TD 5BNVB 5GT0A 4G92C 3B6GC 4YM6C 4DRBA 1B67A 4CAYB 1P3AC 4G91B 1P3PC 3X1VC 2F8NA 4Z66D 4J8XC 1EQZA 3X1TC 3KWQD 3WTPD 3AYWA 1P3KC 1P3KB 3AZJD 3NQUB 1HQ3B 2CV5A 1U35C 3W97B 1M18C 1P3AA 1KX4A 5CPJD 1EQZB 3C1BD 1KX5A 1AOIA 5B1LB 5AY8C 1P3KA 3KUYD 3RELA 2RVQC 5E5AD 3REHB 3AZID 3LZ1C 5B0YD 1TAFB 3AZNB 3KXBC 5DNMD 1P3MA 3WAAA 4WNNA 3B6GD 4R8PD 4WU8B 4X23A 1AOIC 3KSYA 3VH6A 3B0CT 4KGCA 4EO5C 3MNNB 1P3ID 3REHD 3AFAC 3VH5A 4J8VD 5B40B 3AZGB 1P3MC 4H9PB 3AZJC 3MGQC 3TU4A 5BS7C 5AV9B 3REJC 2NQBC 3MGRD 2NQBB 5CPJB 3REJB 2HUEB 5DNNC 1P3LC 5GT3D 4HGAB 4M6BA 1P3FD 3WTPE 3AV1D 3WKJB 1P3BA 5GT0B 4H9SA 1BH8B 3A6ND 2NQBA 4ZUXC 5AV8D 3LZ0B 3UTAB 2CWEA 3X1VD 2PYOA 1ZLAD 4ZBJC 2NZDA 3WKJD 1KX5B 3AV2C 2AROA 5CPIC 4R8PC 4Z5TB 5B1MA 2HIOA 3X1SA 5AVCA 3AZKD 4H9SC 3AN2A 3AZMC 4CAYA 2F8ND 4KHAA 4ZUXA 5B33A 4AWLB 4WU9D 1HTAA 4WNNB 3W98D 4X23B 3B6FC 1BH9A 3AZEA 3AZFB 2FJ7D 5B31G 2HIOC 1P3AD
chains in the Genus database with same CATH superfamily
1TZYA 2RVQD 2YFVA 4E44A 5E5AC 4QLCD 3AZMA 2BYKB 4YS3D 1KX3D 3VH5T 3H0RC 2BYMA 5F99A 5BO0A 4J8VB 3REKC 3KWQC 3AZLA 1S32A 4ZBJB 1P3KD 1ID3C 3WTPB 3W99B 3AZEB 5AVBA 5CP6A 4UUZB 5JA4B 5B1LA 3AZIA 4KUDB 5C3IB 5B0YA 3MVDC 1P3GD 4YS3B 3WKJC 5B40A 5CPID 4J8VC 5GXQC 2F8NG 5JRGA 1F66D 5GSUC 1BH8A 4J8UC 2FJ7B 3AZHC 3W96C 1P3IA 1M1AA 3AZIC 1W2EA 3UTBA 5GT3C 4KGCB 3MVDA 3AZGC 5DNMC 4WZSB 4LD9B 5B40C 3EPLA 5GSUA 4J8UA 3TU4B 1KX4C 5AV9A 5B33B 3W96A 1P3IC 4J8WA 1M1AB 1P3FA 3AFAD 3FDDA 3O62A 4WU8C 3WA9B 4R8PB 3LJAD 3EG5B 3UTAD 1ZLAC 3AYWB 1HQ3A 3X1UB 3UT9B 1P34B 5B31C 4H9QB 5BNXB 3KXBA 4J8WC 2F2AC 1P3FB 1P3FC 3WA9A 4XZQD 5GXQD 3X1SD 1EQZC 3IP4C 4JJNC 5B31B 3B0DB 5AVBB 3B6FD 3RELB 3AZHD 1P3LB 5AV5B 1WWSA 5BNVA 3A6NC 3W97C 3AYWC 4ZUXD 5AV8C 5B2JC 4WJ3C 4NE6A 1U35A 1M18A 1P3MB 2F8NB 3REKD 2FJ7A 5B0ZC 3AZKC 4XUJA 3MNNC 3AZKB 1TZYD 1P3LA 1F1EA 5AV5A 5FUGB 5AY8A 3AZFD 4DQYB 5B24B 2ZY2A 1S32D 3W98C 4LD9D 5AV8B 1TAFA 2FFFB 3LZ0D 3AZNC 5JRGB 5AV6D 5AVBD 5GSUB 4UPKA 4J8UB 2FJ7C 5B1LD 3WAAC 3V9RB 4XUJC 3W99A 3O62B 4YS3C 1P3GA 5FUGA 5AY8B 3MVDB 5KDMB 5CPIA 2W8SA 5AVCC 5B1MC 2JE5A 1F66A 3AZJA 3AZNA 3X1UC 3UT9C 1P34C 3A1IA 3KWQB 3UTBD 1KX4D 5CPJA 5B32B 3LJAC 5B32G 3REID 1P3BC 2ZY4A 1KX3B 3KUYA 1F66C 1TZYC 5BT1D 5BNXA 4G91C 1P3AB 4KHAB 3O62D 1P3PB 1M19D 1Q9CA 3MGPD 3UTAA 3MGSA 2PYOB 4CSRA 3P5JB 2AROC 2YFWA 4R8PA 4XZQC 4XUJB 1PZRA 3X1SC 3KUYB 3KUYC 4Z5TC 3X1SB 3AV2A 2BYKA 3REHA 2Y2LA 1P3PD 4WU8D 5B2JD 4H9OB 3WA9D 2BYMB 5F99B 3AZLB 5GXQA 3UTAC 4Z66C 4J8XD 5B2IC 2YFWB 3B0CW 3AZEC 1B6WA 3V9RA 5B0ZD 3WTPC 5JA4A 3MGRA 4Z5TA 3UTBC 1H3OB 3LJAB 5KDMA 5B32C 1M18D 3REKA 1P3BD 3AV1B 4Z66A 1EQZD 4H9PA 5AV6C 5AV9C 5AV5D 4Z2MH 3B0DC 1WWIA 5AVBC 3WTPA 3KWQA 3B6FB 3MGRB 5AY8D 2NQBD 3AZFA 1M19C 1ID3A 4NFTA 3MGPC 2CV5D 5CP6C 1ZLAA 5B32A 4LD9A 1ULYA 2NZDD 4EO5B 3AZMB 2AROD 5B1MD 5AVCD 4Z66B 3WAAB 5B24D 1S32B 4Z2MG 3W99D 3C1BA 2F8NK 3X1UD 3UT9D 1P34D 1KX5D 5CPKB 5JRGC 3B0BA 2Y2KA 5B33D 4WU9A 5CPKC 2G5HC 3EPJA 3WA9C 3VH6W 1A7WA 2Y2GA 4CSRB 2Y2NA 3C1CD 1M1AC 3AZND 5B2ID 3LELD 2AROB 3AZED 3REIC 3AZGA 3R45B 5DNMA 1P3MD 3WAAD 2CV5B 5GT0C 3B6GA 4YM6A 3AN2B 5BT1C 4X23D 3F6TA 2BG1A 4QLCA 3AZMD 4DRAA 2XD1A 4KGCD 1P3OD 5G49B 1BH9B 1HQ3C 5AV5C 4JJNB 5CHLB 4KUDD 4QLCC 4E45A 4J8WB 3X1VB 5B2IB 2ZM5A 1KU5A 1N1JB 1R4VA 3AV2D 1AOIB 3W99C 1ID3B 4JJNA 1Z2CB 5B2JA 1ZLAB 5B0YB 3MVDD 3A6NA 3W97A 5AV8A 5E5AB 3LZ1A 4NE3A 3X1VA 2PYOD 5B0ZA 3W98B 3EPHA 5GSUD 4J8UD 2Y2HA 5AV9D 3NQJA 4X23C 3W96D 2HIOD 3AZKA 3AFAA 3MNNA 2YFVB 3AN2D 3LJAA 5GT3B 2CV5C 4KGCC 2J8PA 1KX3C 3REIB 1F66B 1P3BB 1U35B 1HQ3D 3W98A 1ID3D 3MGQA 5BS7A 1KX5C 3REJA 5B32D 4H9NA 3X1TB 5CPKD 3RELC 5DNNA 4XZQA 5C3IC 2Y2PA 4YS3A 1P3GC 3X1TD 1KX3A 5B24A 5B1MB 5AVCB 1BFMA 5F99D 3AZLD 3X1UA 3UT9A 1P34A 5B31D 4G92B 3B6GB 3H0LC 4QLCB 5GT0D 3C1BB 1M19B 5CP6D 4WV4B 1U35D 3C1CA 4H9NB 1P3OB 2NZDC 5B2IA 3LELA 5AV6B 5DNNB 2HUEC 5CPJC 3AZGD 5B40D 5B24C 2HIOB 4YM6D 3AZJB 2IO5B 5JRGD 3AYWD 5B33C 3H0MC 3TU4C 1KX4B 3AN2C 3MGSC 3C1CB 3C1CC 1P3OA 3LZ0A 1M1AD 2XD5A 3MGSB 5B0ZB 2VQRA 5AV6A 3LELC 3EPKA 2LY8A 5G49A 2IO5C 3VH6T 3KFUG 1H3OA 3AZIB 4KUDA 3NQUA 5B2JB 3AV2B 1AOID 3A6NB 2F8NH 3RELD 2JSSA 5E5AA 3LZ1B 1S32C 4J8WD 1P3OC 3REHC 4ZUXB 5GXQB 3LZ0C 3REJD 3C1BC 2PYOC 1N1JA 2G5IC 5B1LC 4JJND 5CP6B 4UUZA 3MGPB 4KUDC 3W97D 1P3GB 3MGRC 1JFIA 3LZ1D 2JCHA 4HGAC 1TZYB 3REIA 4H9OA 3KXBD 1M18B 3REKB 3AV1C 4H9RA 5BO0B 4J8VA 4NE5A 3MGQB 1M19A 3MNND 1P3IB 3B6FA 3TU4D 3NQJB 3MGPA 3AZHA 3MGSD 3UTBB 3LELB 4J8XB 1JFIB 3AFAB 3AZFC 5GT3A 3VH5W 2L5AA 3R45A 5DNMB 4LD9C 3AV1A 3MGQD 4H9RB 4YM6B 5F99C 3AZLC 4AWLC 4H9QA 3A1KA 1P3PA 4WU8A 3O62C 2ZY5A 4XUJD 5CPKA 3KXBB 3W96B 5DNND 3AZHB 1P3LD 2DQNC 4WU9B 4J8XA 3X1TA 2NZDB 4WU9C 5CPIB 5B0YC 4XZQB 2Y2QA 5B31A 3WKJA 4Z5TD 5BNVB 5GT0A 4G92C 3B6GC 4YM6C 4DRBA 1B67A 4CAYB 1P3AC 4G91B 1P3PC 3X1VC 2F8NA 4Z66D 4J8XC 1EQZA 3X1TC 2Y2JA 2Y2OA 3KWQD 3WTPD 3AYWA 1P3KC 1P3KB 3AZJD 3NQUB 1HQ3B 2CV5A 2Y2IA 1U35C 3W97B 1M18C 1P3AA 1KX4A 5CPJD 1EQZB 3C1BD 1KX5A 1AOIA 5B1LB 5AY8C 1P3KA 3KUYD 3RELA 2RVQC 5E5AD 3REHB 3AZID 3LZ1C 5B0YD 1TAFB 3AZNB 3KXBC 5DNMD 1P3MA 3WAAA 4WNNA 3B6GD 4R8PD 4WU8B 4X23A 1AOIC 3KSYA 3VH6A 3B0CT 4KGCA 4EO5C 3MNNB 1P3ID 3REHD 3AL0C 3AFAC 3VH5A 4J8VD 5B40B 3AZGB 1P3MC 4H9PB 3AZJC 3MGQC 3TU4A 5BS7C 5AV9B 2Y2MA 3REJC 2NQBC 3MGRD 2NQBB 5CPJB 3REJB 2HUEB 5DNNC 1P3LC 5GT3D 4HGAB 4M6BA 1P3FD 3WTPE 3AV1D 3WKJB 1P3BA 5GT0B 4H9SA 1BH8B 3A6ND 2DF4C 2NQBA 4ZUXC 5AV8D 3LZ0B 3UTAB 2CWEA 3X1VD 2PYOA 1ZLAD 2ZY3A 4ZBJC 2NZDA 3WKJD 1KX5B 3AV2C 2AROA 5CPIC 4R8PC 4Z5TB 5AVCA 2HIOA 5B1MA 3X1SA 3AZKD 4H9SC 3AN2A 2UWXA 3AZMC 4CAYA 2F8ND 4KHAA 4ZUXA 5B33A 4AWLB 4WU9D 1HTAA 2RIQA 4WNNB 3W98D 1T3UA 4X23B 3B6FC 1BH9A 3AZEA 3AZFB 2FJ7D 5B31G 2HIOC 1P3AD
chains in the Genus database with same CATH topology
1TZYA 2RVQD 2YFVA 4E44A 5E5AC 4QLCD 3AZMA 2BYKB 4YS3D 1KX3D 3VH5T 3H0RC 2BYMA 5F99A 5BO0A 4J8VB 3REKC 3KWQC 3AZLA 1S32A 4ZBJB 1P3KD 1ID3C 3WTPB 3W99B 3AZEB 5AVBA 5CP6A 4UUZB 5JA4B 5B1LA 3AZIA 4KUDB 5C3IB 5B0YA 3MVDC 1P3GD 4YS3B 3WKJC 5B40A 5CPID 4J8VC 5GXQC 2F8NG 5JRGA 1F66D 5GSUC 1BH8A 4J8UC 2FJ7B 3AZHC 3W96C 1P3IA 1M1AA 3AZIC 1W2EA 3UTBA 5GT3C 4KGCB 3MVDA 3AZGC 5DNMC 4WZSB 4LD9B 5B40C 3EPLA 5GSUA 4J8UA 3TU4B 1KX4C 5AV9A 5B33B 3W96A 1P3IC 4J8WA 1M1AB 1P3FA 3AFAD 3FDDA 3O62A 4WU8C 3WA9B 4R8PB 3LJAD 3EG5B 3UTAD 1ZLAC 3AYWB 1HQ3A 3X1UB 3UT9B 1P34B 5B31C 4H9QB 5BNXB 3KXBA 4J8WC 2F2AC 1P3FB 1P3FC 3WA9A 4XZQD 5GXQD 3X1SD 1EQZC 3IP4C 4JJNC 5B31B 3B0DB 5AVBB 3B6FD 3RELB 3AZHD 1P3LB 5AV5B 1WWSA 5BNVA 3A6NC 3W97C 3AYWC 4ZUXD 5AV8C 5B2JC 4WJ3C 4NE6A 1U35A 1M18A 1P3MB 2F8NB 3REKD 2FJ7A 5B0ZC 3AZKC 4XUJA 3MNNC 3AZKB 1TZYD 1P3LA 1F1EA 5AV5A 5FUGB 5AY8A 3AZFD 4DQYB 5B24B 2ZY2A 1S32D 3W98C 4LD9D 5AV8B 1TAFA 2FFFB 3LZ0D 3AZNC 5JRGB 5AV6D 5AVBD 5GSUB 4UPKA 4J8UB 2FJ7C 5B1LD 3WAAC 3V9RB 4XUJC 3W99A 3O62B 4YS3C 1P3GA 5FUGA 5AY8B 3MVDB 5KDMB 5CPIA 2W8SA 5AVCC 5B1MC 2JE5A 1F66A 3AZJA 3AZNA 3X1UC 3UT9C 1P34C 3A1IA 3KWQB 3UTBD 1KX4D 5CPJA 5B32B 3LJAC 5B32G 3REID 1P3BC 2ZY4A 1KX3B 3KUYA 1F66C 1TZYC 5BT1D 5BNXA 4G91C 1P3AB 4KHAB 3O62D 1P3PB 1M19D 1Q9CA 3MGPD 3UTAA 3MGSA 2PYOB 4CSRA 3P5JB 2AROC 2YFWA 4R8PA 4XZQC 4XUJB 1PZRA 3X1SC 3KUYB 3KUYC 4Z5TC 3X1SB 3AV2A 2BYKA 3REHA 2Y2LA 1P3PD 4WU8D 5B2JD 4H9OB 3WA9D 2BYMB 5F99B 3AZLB 5GXQA 3UTAC 4Z66C 4J8XD 5B2IC 2YFWB 3B0CW 3AZEC 1B6WA 3V9RA 5B0ZD 3WTPC 5JA4A 3MGRA 4Z5TA 3UTBC 1H3OB 3LJAB 5KDMA 5B32C 1M18D 3REKA 1P3BD 3AV1B 4Z66A 1EQZD 4H9PA 5AV6C 5AV9C 5AV5D 4Z2MH 3B0DC 1WWIA 5AVBC 3WTPA 3KWQA 3B6FB 3MGRB 5AY8D 2NQBD 3AZFA 1M19C 1ID3A 4NFTA 3MGPC 2CV5D 5CP6C 1ZLAA 5B32A 4LD9A 1ULYA 2NZDD 4EO5B 3AZMB 2AROD 5B1MD 5AVCD 4Z66B 3WAAB 5B24D 1S32B 4Z2MG 3W99D 3C1BA 2F8NK 3X1UD 3UT9D 1P34D 1KX5D 5CPKB 5JRGC 3B0BA 2Y2KA 5B33D 4WU9A 5CPKC 2G5HC 3EPJA 3WA9C 3VH6W 1A7WA 2Y2GA 4CSRB 2Y2NA 3C1CD 1M1AC 3AZND 5B2ID 3LELD 2AROB 3AZED 3REIC 3AZGA 3R45B 5DNMA 1P3MD 3WAAD 2CV5B 5GT0C 3B6GA 4YM6A 3AN2B 5BT1C 4X23D 3F6TA 2BG1A 4QLCA 3AZMD 4DRAA 2XD1A 4KGCD 1P3OD 5G49B 1BH9B 1HQ3C 5AV5C 4JJNB 5CHLB 4KUDD 4QLCC 4E45A 4J8WB 3X1VB 5B2IB 2ZM5A 1KU5A 1N1JB 1R4VA 3AV2D 1AOIB 3W99C 1ID3B 4JJNA 1Z2CB 5B2JA 1ZLAB 5B0YB 3MVDD 3A6NA 3W97A 5AV8A 5E5AB 3LZ1A 4NE3A 3X1VA 2PYOD 5B0ZA 3W98B 3EPHA 5GSUD 4J8UD 2Y2HA 5AV9D 3NQJA 4X23C 3W96D 2HIOD 3AZKA 3AFAA 3MNNA 2YFVB 3AN2D 3LJAA 5GT3B 2CV5C 4KGCC 2J8PA 1KX3C 3REIB 1F66B 1P3BB 1U35B 1HQ3D 3W98A 1ID3D 3MGQA 5BS7A 1KX5C 3REJA 5B32D 4H9NA 3X1TB 5CPKD 3RELC 5DNNA 4XZQA 5C3IC 2Y2PA 4YS3A 1P3GC 3X1TD 1KX3A 5B24A 5B1MB 5AVCB 1BFMA 5F99D 3AZLD 3X1UA 3UT9A 1P34A 5B31D 4G92B 3B6GB 3H0LC 4QLCB 5GT0D 3C1BB 1M19B 5CP6D 4WV4B 1U35D 3C1CA 4H9NB 1P3OB 2NZDC 5B2IA 3LELA 5AV6B 5DNNB 2HUEC 5CPJC 3AZGD 5B40D 5B24C 2HIOB 4YM6D 3AZJB 2IO5B 5JRGD 3AYWD 5B33C 3H0MC 3TU4C 1KX4B 3AN2C 3MGSC 3C1CB 3C1CC 1P3OA 3LZ0A 1M1AD 2XD5A 3MGSB 5B0ZB 2VQRA 5AV6A 3LELC 3EPKA 2LY8A 5G49A 2IO5C 3VH6T 3KFUG 1H3OA 3AZIB 4KUDA 3NQUA 5B2JB 3AV2B 1AOID 3A6NB 2F8NH 3RELD 2JSSA 5E5AA 3LZ1B 1S32C 4J8WD 1P3OC 3REHC 4ZUXB 5GXQB 3LZ0C 3REJD 3C1BC 2PYOC 1N1JA 2G5IC 5B1LC 4JJND 5CP6B 4UUZA 3MGPB 4KUDC 3W97D 1P3GB 3MGRC 1JFIA 3LZ1D 2JCHA 4HGAC 1TZYB 3REIA 4H9OA 3KXBD 1M18B 3REKB 3AV1C 4H9RA 5BO0B 4J8VA 4NE5A 3MGQB 1M19A 3MNND 1P3IB 3B6FA 3TU4D 3NQJB 3MGPA 3AZHA 3MGSD 3UTBB 3LELB 4J8XB 1JFIB 3AFAB 3AZFC 5GT3A 3VH5W 2L5AA 3R45A 5DNMB 4LD9C 3AV1A 3MGQD 4H9RB 4YM6B 5F99C 3AZLC 4AWLC 4H9QA 3A1KA 1P3PA 4WU8A 3O62C 2ZY5A 4XUJD 5CPKA 3KXBB 3W96B 5DNND 3AZHB 1P3LD 2DQNC 4WU9B 4J8XA 3X1TA 2NZDB 4WU9C 5CPIB 5B0YC 4XZQB 2Y2QA 5B31A 3WKJA 4Z5TD 5BNVB 5GT0A 4G92C 3B6GC 4YM6C 4DRBA 1B67A 4CAYB 1P3AC 4G91B 1P3PC 3X1VC 2F8NA 4Z66D 4J8XC 1EQZA 3X1TC 2Y2JA 2Y2OA 3KWQD 3WTPD 3AYWA 1P3KC 1P3KB 3AZJD 3NQUB 1HQ3B 2CV5A 2Y2IA 1U35C 3W97B 1M18C 1P3AA 1KX4A 5CPJD 1EQZB 3C1BD 1KX5A 1AOIA 5B1LB 5AY8C 1P3KA 3KUYD 3RELA 2RVQC 5E5AD 3REHB 3AZID 3LZ1C 5B0YD 1TAFB 3AZNB 3KXBC 5DNMD 1P3MA 3WAAA 4WNNA 3B6GD 4R8PD 4WU8B 4X23A 1AOIC 3KSYA 3VH6A 3B0CT 4KGCA 4EO5C 3MNNB 1P3ID 3REHD 3AL0C 3AFAC 3VH5A 4J8VD 5B40B 3AZGB 1P3MC 4H9PB 3AZJC 3MGQC 3TU4A 5BS7C 5AV9B 2Y2MA 3REJC 2NQBC 3MGRD 2NQBB 5CPJB 3REJB 2HUEB 5DNNC 1P3LC 5GT3D 4HGAB 4M6BA 1P3FD 3WTPE 3AV1D 3WKJB 1P3BA 5GT0B 4H9SA 1BH8B 3A6ND 2DF4C 2NQBA 4ZUXC 5AV8D 3LZ0B 3UTAB 2CWEA 3X1VD 2PYOA 1ZLAD 2ZY3A 4ZBJC 2NZDA 3WKJD 1KX5B 3AV2C 2AROA 5CPIC 4R8PC 4Z5TB 5AVCA 2HIOA 5B1MA 3X1SA 3AZKD 4H9SC 3AN2A 2UWXA 3AZMC 4CAYA 2F8ND 4KHAA 4ZUXA 5B33A 4AWLB 4WU9D 1HTAA 2RIQA 4WNNB 3W98D 1T3UA 4X23B 3B6FC 1BH9A 3AZEA 3AZFB 2FJ7D 5B31G 2HIOC 1P3AD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZY A;  2RVQ D;  2YFV A;  4E44 A;  5E5A C;  4QLC D;  3AZM A;  2BYK B;  4YS3 D;  1KX3 D;  3VH5 T;  2BYM A;  5F99 A;  5BO0 A;  4J8V B;  3REK C;  3KWQ C;  3AZL A;  1S32 A;  4ZBJ B;  1P3K D;  1ID3 C;  3WTP B;  3W99 B;  3AZE B;  5AVB A;  5CP6 A;  4UUZ B;  5JA4 B;  5B1L A;  3AZI A;  4KUD B;  5C3I B;  5B0Y A;  3MVD C;  1P3G D;  4YS3 B;  3WKJ C;  5B40 A;  5CPI D;  4J8V C;  5GXQ C;  2F8N G;  5JRG A;  1F66 D;  5GSU C;  1BH8 A;  4J8U C;  2FJ7 B;  3AZH C;  3W96 C;  1P3I A;  1M1A A;  3AZI C;  3UTB A;  5GT3 C;  4KGC B;  3MVD A;  3AZG C;  5DNM C;  4WZS B;  4LD9 B;  5B40 C;  5GSU A;  4J8U A;  3TU4 B;  1KX4 C;  5AV9 A;  5B33 B;  3W96 A;  1P3I C;  4J8W A;  1M1A B;  1P3F A;  3AFA D;  3O62 A;  4WU8 C;  3WA9 B;  4R8P B;  3LJA D;  3UTA D;  1ZLA C;  3AYW B;  1HQ3 A;  3X1U B;  3UT9 B;  1P34 B;  5B31 C;  4H9Q B;  5BNX B;  3KXB A;  4J8W C;  1P3F B;  1P3F C;  3WA9 A;  4XZQ D;  5GXQ D;  3X1S D;  1EQZ C;  4JJN C;  5B31 B;  3B0D B;  5AVB B;  3B6F D;  3REL B;  3AZH D;  1P3L B;  5AV5 B;  1WWS A;  5BNV A;  3A6N C;  3W97 C;  3AYW C;  4ZUX D;  5AV8 C;  5B2J C;  4NE6 A;  1U35 A;  1M18 A;  1P3M B;  2F8N B;  3REK D;  2FJ7 A;  5B0Z C;  3AZK C;  4XUJ A;  3MNN C;  3AZK B;  1TZY D;  1P3L A;  1F1E A;  5AV5 A;  5FUG B;  5AY8 A;  3AZF D;  5B24 B;  1S32 D;  3W98 C;  4LD9 D;  5AV8 B;  1TAF A;  3LZ0 D;  3AZN C;  5JRG B;  5AV6 D;  5AVB D;  5GSU B;  4J8U B;  2FJ7 C;  5B1L D;  3WAA C;  3V9R B;  4XUJ C;  3W99 A;  3O62 B;  4YS3 C;  1P3G A;  5FUG A;  5AY8 B;  3MVD B;  5KDM B;  5CPI A;  5B1M C;  5AVC C;  1F66 A;  3AZJ A;  3AZN A;  3X1U C;  3UT9 C;  1P34 C;  3KWQ B;  3UTB D;  1KX4 D;  5CPJ A;  5B32 B;  3LJA C;  5B32 G;  3REI D;  1P3B C;  1KX3 B;  1F66 C;  3KUY A;  1TZY C;  5BT1 D;  5BNX A;  4G91 C;  1P3A B;  4KHA B;  3O62 D;  1P3P B;  1M19 D;  1Q9C A;  3MGP D;  3UTA A;  3MGS A;  2PYO B;  4CSR A;  2ARO C;  2YFW A;  4R8P A;  4XZQ C;  4XUJ B;  3X1S C;  3KUY B;  3KUY C;  4Z5T C;  3X1S B;  3AV2 A;  2BYK A;  3REH A;  1P3P D;  4WU8 D;  5B2J D;  4H9O B;  3WA9 D;  2BYM B;  5F99 B;  3AZL B;  5GXQ A;  3UTA C;  4Z66 C;  4J8X D;  5B2I C;  2YFW B;  3B0C W;  3AZE C;  1B6W A;  3V9R A;  5B0Z D;  3WTP C;  5JA4 A;  3MGR A;  4Z5T A;  3UTB C;  1H3O B;  3LJA B;  5KDM A;  5B32 C;  1M18 D;  3REK A;  1P3B D;  3AV1 B;  4Z66 A;  1EQZ D;  4H9P A;  5AV6 C;  5AV9 C;  5AV5 D;  4Z2M H;  3B0D C;  1WWI A;  5AVB C;  3WTP A;  3KWQ A;  3B6F B;  3MGR B;  5AY8 D;  2NQB D;  3AZF A;  1M19 C;  1ID3 A;  4NFT A;  3MGP C;  2CV5 D;  5CP6 C;  1ZLA A;  5B32 A;  4LD9 A;  1ULY A;  2NZD D;  4EO5 B;  3AZM B;  2ARO D;  5B1M D;  5AVC D;  4Z66 B;  3WAA B;  5B24 D;  1S32 B;  4Z2M G;  3W99 D;  3C1B A;  2F8N K;  3X1U D;  3UT9 D;  1P34 D;  1KX5 D;  5CPK B;  5JRG C;  3B0B A;  5B33 D;  4WU9 A;  5CPK C;  3WA9 C;  3VH6 W;  1A7W A;  4CSR B;  3C1C D;  1M1A C;  3AZN D;  5B2I D;  3LEL D;  2ARO B;  3AZE D;  3REI C;  3AZG A;  3R45 B;  5DNM A;  1P3M D;  3WAA D;  2CV5 B;  5GT0 C;  3B6G A;  4YM6 A;  3AN2 B;  5BT1 C;  4X23 D;  4QLC A;  3AZM D;  4DRA A;  4KGC D;  1P3O D;  5G49 B;  1BH9 B;  1HQ3 C;  5AV5 C;  4JJN B;  5CHL B;  4KUD D;  4QLC C;  4E45 A;  4J8W B;  3X1V B;  5B2I B;  1KU5 A;  1N1J B;  1R4V A;  3AV2 D;  1AOI B;  3W99 C;  1ID3 B;  4JJN A;  5B2J A;  1ZLA B;  5B0Y B;  3MVD D;  3A6N A;  3W97 A;  5AV8 A;  5E5A B;  3LZ1 A;  4NE3 A;  3X1V A;  2PYO D;  5B0Z A;  3W98 B;  5GSU D;  4J8U D;  5AV9 D;  3NQJ A;  4X23 C;  3W96 D;  2HIO D;  3AZK A;  3AFA A;  3MNN A;  2YFV B;  3AN2 D;  3LJA A;  5GT3 B;  2CV5 C;  4KGC C;  1KX3 C;  1F66 B;  3REI B;  1P3B B;  1U35 B;  1HQ3 D;  3W98 A;  1ID3 D;  3MGQ A;  5BS7 A;  1KX5 C;  3REJ A;  5B32 D;  4H9N A;  3X1T B;  5CPK D;  3REL C;  5DNN A;  4XZQ A;  5C3I C;  4YS3 A;  1P3G C;  1KX3 A;  3X1T D;  5B24 A;  5B1M B;  5AVC B;  1BFM A;  5F99 D;  3AZL D;  3X1U A;  3UT9 A;  1P34 A;  5B31 D;  4G92 B;  3B6G B;  4QLC B;  5GT0 D;  3C1B B;  1M19 B;  5CP6 D;  4WV4 B;  1U35 D;  3C1C A;  4H9N B;  1P3O B;  2NZD C;  5B2I A;  3LEL A;  5AV6 B;  5DNN B;  2HUE C;  5CPJ C;  3AZG D;  5B40 D;  5B24 C;  2HIO B;  4YM6 D;  3AZJ B;  2IO5 B;  5JRG D;  3AYW D;  5B33 C;  3TU4 C;  1KX4 B;  3AN2 C;  3MGS C;  3C1C B;  3C1C C;  1P3O A;  3LZ0 A;  1M1A D;  3MGS B;  5B0Z B;  3LEL C;  5AV6 A;  2LY8 A;  5G49 A;  2IO5 C;  3VH6 T;  1H3O A;  3AZI B;  4KUD A;  3NQU A;  5B2J B;  3AV2 B;  1AOI D;  3A6N B;  2F8N H;  3REL D;  2JSS A;  5E5A A;  3LZ1 B;  1S32 C;  4J8W D;  1P3O C;  3REH C;  4ZUX B;  5GXQ B;  3LZ0 C;  3REJ D;  3C1B C;  2PYO C;  1N1J A;  5B1L C;  4JJN D;  5CP6 B;  4UUZ A;  3MGP B;  4KUD C;  3W97 D;  1P3G B;  3MGR C;  1JFI A;  3LZ1 D;  4HGA C;  1TZY B;  3REI A;  4H9O A;  3KXB D;  1M18 B;  3REK B;  3AV1 C;  4H9R A;  5BO0 B;  4J8V A;  4NE5 A;  3MGQ B;  1M19 A;  3MNN D;  1P3I B;  3B6F A;  3TU4 D;  3NQJ B;  3MGP A;  3AZH A;  3MGS D;  3UTB B;  3LEL B;  4J8X B;  1JFI B;  3AFA B;  3AZF C;  5GT3 A;  3VH5 W;  2L5A A;  3R45 A;  5DNM B;  4LD9 C;  3AV1 A;  3MGQ D;  4H9R B;  4YM6 B;  5F99 C;  3AZL C;  4AWL C;  4H9Q A;  1P3P A;  4WU8 A;  3O62 C;  4XUJ D;  5CPK A;  3W96 B;  3KXB B;  5DNN D;  3AZH B;  1P3L D;  4WU9 B;  4J8X A;  3X1T A;  2NZD B;  4WU9 C;  5CPI B;  5B0Y C;  4XZQ B;  5B31 A;  3WKJ A;  4Z5T D;  5BNV B;  5GT0 A;  4G92 C;  3B6G C;  4YM6 C;  4DRB A;  1B67 A;  4CAY B;  1P3A C;  4G91 B;  1P3P C;  3X1V C;  2F8N A;  4Z66 D;  4J8X C;  1EQZ A;  3X1T C;  3KWQ D;  3WTP D;  3AYW A;  1P3K C;  1P3K B;  3AZJ D;  3NQU B;  1HQ3 B;  2CV5 A;  1U35 C;  3W97 B;  1M18 C;  1P3A A;  1KX4 A;  5CPJ D;  1EQZ B;  3C1B D;  1KX5 A;  1AOI A;  5B1L B;  5AY8 C;  1P3K A;  3KUY D;  3REL A;  2RVQ C;  5E5A D;  3REH B;  3AZI D;  3LZ1 C;  5B0Y D;  1TAF B;  3AZN B;  3KXB C;  5DNM D;  1P3M A;  3WAA A;  4WNN A;  3B6G D;  4R8P D;  4WU8 B;  4X23 A;  1AOI C;  3KSY A;  3VH6 A;  3B0C T;  4KGC A;  4EO5 C;  3MNN B;  1P3I D;  3REH D;  3AFA C;  3VH5 A;  4J8V D;  5B40 B;  3AZG B;  1P3M C;  4H9P B;  3AZJ C;  3MGQ C;  3TU4 A;  5BS7 C;  5AV9 B;  3REJ C;  2NQB C;  3MGR D;  2NQB B;  5CPJ B;  3REJ B;  2HUE B;  5DNN C;  1P3L C;  5GT3 D;  4HGA B;  4M6B A;  1P3F D;  3WTP E;  3AV1 D;  3WKJ B;  1P3B A;  5GT0 B;  4H9S A;  1BH8 B;  3A6N D;  2NQB A;  4ZUX C;  5AV8 D;  3LZ0 B;  3UTA B;  2CWE A;  3X1V D;  2PYO A;  1ZLA D;  4ZBJ C;  2NZD A;  3WKJ D;  1KX5 B;  3AV2 C;  2ARO A;  5CPI C;  4R8P C;  4Z5T B;  5B1M A;  2HIO A;  3X1S A;  5AVC A;  3AZK D;  4H9S C;  3AN2 A;  3AZM C;  4CAY A;  2F8N D;  4KHA A;  4ZUX A;  5B33 A;  4AWL B;  4WU9 D;  1HTA A;  4WNN B;  3W98 D;  4X23 B;  3B6F C;  1BH9 A;  3AZE A;  3AZF B;  2FJ7 D;  5B31 G;  2HIO C;  1P3A D; 
#chains in the Genus database with same CATH topology
 1TZY A;  2RVQ D;  2YFV A;  4E44 A;  5E5A C;  4QLC D;  3AZM A;  2BYK B;  4YS3 D;  1KX3 D;  3VH5 T;  3H0R C;  2BYM A;  5F99 A;  5BO0 A;  4J8V B;  3REK C;  3KWQ C;  3AZL A;  1S32 A;  4ZBJ B;  1P3K D;  1ID3 C;  3WTP B;  3W99 B;  3AZE B;  5AVB A;  5CP6 A;  4UUZ B;  5JA4 B;  5B1L A;  3AZI A;  4KUD B;  5C3I B;  5B0Y A;  3MVD C;  1P3G D;  4YS3 B;  3WKJ C;  5B40 A;  5CPI D;  4J8V C;  5GXQ C;  2F8N G;  5JRG A;  1F66 D;  5GSU C;  1BH8 A;  4J8U C;  2FJ7 B;  3AZH C;  3W96 C;  1P3I A;  1M1A A;  3AZI C;  1W2E A;  3UTB A;  5GT3 C;  4KGC B;  3MVD A;  3AZG C;  5DNM C;  4WZS B;  4LD9 B;  5B40 C;  3EPL A;  5GSU A;  4J8U A;  3TU4 B;  1KX4 C;  5AV9 A;  5B33 B;  3W96 A;  1P3I C;  4J8W A;  1M1A B;  1P3F A;  3AFA D;  3FDD A;  3O62 A;  4WU8 C;  3WA9 B;  4R8P B;  3LJA D;  3EG5 B;  3UTA D;  1ZLA C;  3AYW B;  1HQ3 A;  3X1U B;  3UT9 B;  1P34 B;  5B31 C;  4H9Q B;  5BNX B;  3KXB A;  4J8W C;  2F2A C;  1P3F B;  1P3F C;  3WA9 A;  4XZQ D;  5GXQ D;  3X1S D;  1EQZ C;  3IP4 C;  4JJN C;  5B31 B;  3B0D B;  5AVB B;  3B6F D;  3REL B;  3AZH D;  1P3L B;  5AV5 B;  1WWS A;  5BNV A;  3A6N C;  3W97 C;  3AYW C;  4ZUX D;  5AV8 C;  5B2J C;  4WJ3 C;  4NE6 A;  1U35 A;  1M18 A;  1P3M B;  2F8N B;  3REK D;  2FJ7 A;  5B0Z C;  3AZK C;  4XUJ A;  3MNN C;  3AZK B;  1TZY D;  1P3L A;  1F1E A;  5AV5 A;  5FUG B;  5AY8 A;  3AZF D;  4DQY B;  5B24 B;  2ZY2 A;  1S32 D;  3W98 C;  4LD9 D;  5AV8 B;  1TAF A;  2FFF B;  3LZ0 D;  3AZN C;  5JRG B;  5AV6 D;  5AVB D;  5GSU B;  4UPK A;  4J8U B;  2FJ7 C;  5B1L D;  3WAA C;  3V9R B;  4XUJ C;  3W99 A;  3O62 B;  4YS3 C;  1P3G A;  5FUG A;  5AY8 B;  3MVD B;  5KDM B;  5CPI A;  2W8S A;  5AVC C;  5B1M C;  2JE5 A;  1F66 A;  3AZJ A;  3AZN A;  3X1U C;  3UT9 C;  1P34 C;  3A1I A;  3KWQ B;  3UTB D;  1KX4 D;  5CPJ A;  5B32 B;  3LJA C;  5B32 G;  3REI D;  1P3B C;  2ZY4 A;  1KX3 B;  3KUY A;  1F66 C;  1TZY C;  5BT1 D;  5BNX A;  4G91 C;  1P3A B;  4KHA B;  3O62 D;  1P3P B;  1M19 D;  1Q9C A;  3MGP D;  3UTA A;  3MGS A;  2PYO B;  4CSR A;  3P5J B;  2ARO C;  2YFW A;  4R8P A;  4XZQ C;  4XUJ B;  1PZR A;  3X1S C;  3KUY B;  3KUY C;  4Z5T C;  3X1S B;  3AV2 A;  2BYK A;  3REH A;  2Y2L A;  1P3P D;  4WU8 D;  5B2J D;  4H9O B;  3WA9 D;  2BYM B;  5F99 B;  3AZL B;  5GXQ A;  3UTA C;  4Z66 C;  4J8X D;  5B2I C;  2YFW B;  3B0C W;  3AZE C;  1B6W A;  3V9R A;  5B0Z D;  3WTP C;  5JA4 A;  3MGR A;  4Z5T A;  3UTB C;  1H3O B;  3LJA B;  5KDM A;  5B32 C;  1M18 D;  3REK A;  1P3B D;  3AV1 B;  4Z66 A;  1EQZ D;  4H9P A;  5AV6 C;  5AV9 C;  5AV5 D;  4Z2M H;  3B0D C;  1WWI A;  5AVB C;  3WTP A;  3KWQ A;  3B6F B;  3MGR B;  5AY8 D;  2NQB D;  3AZF A;  1M19 C;  1ID3 A;  4NFT A;  3MGP C;  2CV5 D;  5CP6 C;  1ZLA A;  5B32 A;  4LD9 A;  1ULY A;  2NZD D;  4EO5 B;  3AZM B;  2ARO D;  5B1M D;  5AVC D;  4Z66 B;  3WAA B;  5B24 D;  1S32 B;  4Z2M G;  3W99 D;  3C1B A;  2F8N K;  3X1U D;  3UT9 D;  1P34 D;  1KX5 D;  5CPK B;  5JRG C;  3B0B A;  2Y2K A;  5B33 D;  4WU9 A;  5CPK C;  2G5H C;  3EPJ A;  3WA9 C;  3VH6 W;  1A7W A;  2Y2G A;  4CSR B;  2Y2N A;  3C1C D;  1M1A C;  3AZN D;  5B2I D;  3LEL D;  2ARO B;  3AZE D;  3REI C;  3AZG A;  3R45 B;  5DNM A;  1P3M D;  3WAA D;  2CV5 B;  5GT0 C;  3B6G A;  4YM6 A;  3AN2 B;  5BT1 C;  4X23 D;  3F6T A;  2BG1 A;  4QLC A;  3AZM D;  4DRA A;  2XD1 A;  4KGC D;  1P3O D;  5G49 B;  1BH9 B;  1HQ3 C;  5AV5 C;  4JJN B;  5CHL B;  4KUD D;  4QLC C;  4E45 A;  4J8W B;  3X1V B;  5B2I B;  2ZM5 A;  1KU5 A;  1N1J B;  1R4V A;  3AV2 D;  1AOI B;  3W99 C;  1ID3 B;  4JJN A;  1Z2C B;  5B2J A;  1ZLA B;  5B0Y B;  3MVD D;  3A6N A;  3W97 A;  5AV8 A;  5E5A B;  3LZ1 A;  4NE3 A;  3X1V A;  2PYO D;  5B0Z A;  3W98 B;  3EPH A;  5GSU D;  4J8U D;  2Y2H A;  5AV9 D;  3NQJ A;  4X23 C;  3W96 D;  2HIO D;  3AZK A;  3AFA A;  3MNN A;  2YFV B;  3AN2 D;  3LJA A;  5GT3 B;  2CV5 C;  4KGC C;  2J8P A;  1KX3 C;  3REI B;  1F66 B;  1P3B B;  1U35 B;  1HQ3 D;  3W98 A;  1ID3 D;  3MGQ A;  5BS7 A;  1KX5 C;  3REJ A;  5B32 D;  4H9N A;  3X1T B;  5CPK D;  3REL C;  5DNN A;  4XZQ A;  5C3I C;  2Y2P A;  4YS3 A;  1P3G C;  3X1T D;  1KX3 A;  5B24 A;  5B1M B;  5AVC B;  1BFM A;  5F99 D;  3AZL D;  3X1U A;  3UT9 A;  1P34 A;  5B31 D;  4G92 B;  3B6G B;  3H0L C;  4QLC B;  5GT0 D;  3C1B B;  1M19 B;  5CP6 D;  4WV4 B;  1U35 D;  3C1C A;  4H9N B;  1P3O B;  2NZD C;  5B2I A;  3LEL A;  5AV6 B;  5DNN B;  2HUE C;  5CPJ C;  3AZG D;  5B40 D;  5B24 C;  2HIO B;  4YM6 D;  3AZJ B;  2IO5 B;  5JRG D;  3AYW D;  5B33 C;  3H0M C;  3TU4 C;  1KX4 B;  3AN2 C;  3MGS C;  3C1C B;  3C1C C;  1P3O A;  3LZ0 A;  1M1A D;  2XD5 A;  3MGS B;  5B0Z B;  2VQR A;  5AV6 A;  3LEL C;  3EPK A;  2LY8 A;  5G49 A;  2IO5 C;  3VH6 T;  3KFU G;  1H3O A;  3AZI B;  4KUD A;  3NQU A;  5B2J B;  3AV2 B;  1AOI D;  3A6N B;  2F8N H;  3REL D;  2JSS A;  5E5A A;  3LZ1 B;  1S32 C;  4J8W D;  1P3O C;  3REH C;  4ZUX B;  5GXQ B;  3LZ0 C;  3REJ D;  3C1B C;  2PYO C;  1N1J A;  2G5I C;  5B1L C;  4JJN D;  5CP6 B;  4UUZ A;  3MGP B;  4KUD C;  3W97 D;  1P3G B;  3MGR C;  1JFI A;  3LZ1 D;  2JCH A;  4HGA C;  1TZY B;  3REI A;  4H9O A;  3KXB D;  1M18 B;  3REK B;  3AV1 C;  4H9R A;  5BO0 B;  4J8V A;  4NE5 A;  3MGQ B;  1M19 A;  3MNN D;  1P3I B;  3B6F A;  3TU4 D;  3NQJ B;  3MGP A;  3AZH A;  3MGS D;  3UTB B;  3LEL B;  4J8X B;  1JFI B;  3AFA B;  3AZF C;  5GT3 A;  3VH5 W;  2L5A A;  3R45 A;  5DNM B;  4LD9 C;  3AV1 A;  3MGQ D;  4H9R B;  4YM6 B;  5F99 C;  3AZL C;  4AWL C;  4H9Q A;  3A1K A;  1P3P A;  4WU8 A;  3O62 C;  2ZY5 A;  4XUJ D;  5CPK A;  3KXB B;  3W96 B;  5DNN D;  3AZH B;  1P3L D;  2DQN C;  4WU9 B;  4J8X A;  3X1T A;  2NZD B;  4WU9 C;  5CPI B;  5B0Y C;  4XZQ B;  2Y2Q A;  5B31 A;  3WKJ A;  4Z5T D;  5BNV B;  5GT0 A;  4G92 C;  3B6G C;  4YM6 C;  4DRB A;  1B67 A;  4CAY B;  1P3A C;  4G91 B;  1P3P C;  3X1V C;  2F8N A;  4Z66 D;  4J8X C;  1EQZ A;  3X1T C;  2Y2J A;  2Y2O A;  3KWQ D;  3WTP D;  3AYW A;  1P3K C;  1P3K B;  3AZJ D;  3NQU B;  1HQ3 B;  2CV5 A;  2Y2I A;  1U35 C;  3W97 B;  1M18 C;  1P3A A;  1KX4 A;  5CPJ D;  1EQZ B;  3C1B D;  1KX5 A;  1AOI A;  5B1L B;  5AY8 C;  1P3K A;  3KUY D;  3REL A;  2RVQ C;  5E5A D;  3REH B;  3AZI D;  3LZ1 C;  5B0Y D;  1TAF B;  3AZN B;  3KXB C;  5DNM D;  1P3M A;  3WAA A;  4WNN A;  3B6G D;  4R8P D;  4WU8 B;  4X23 A;  1AOI C;  3KSY A;  3VH6 A;  3B0C T;  4KGC A;  4EO5 C;  3MNN B;  1P3I D;  3REH D;  3AL0 C;  3AFA C;  3VH5 A;  4J8V D;  5B40 B;  3AZG B;  1P3M C;  4H9P B;  3AZJ C;  3MGQ C;  3TU4 A;  5BS7 C;  5AV9 B;  2Y2M A;  3REJ C;  2NQB C;  3MGR D;  2NQB B;  5CPJ B;  3REJ B;  2HUE B;  5DNN C;  1P3L C;  5GT3 D;  4HGA B;  4M6B A;  1P3F D;  3WTP E;  3AV1 D;  3WKJ B;  1P3B A;  5GT0 B;  4H9S A;  1BH8 B;  3A6N D;  2DF4 C;  2NQB A;  4ZUX C;  5AV8 D;  3LZ0 B;  3UTA B;  2CWE A;  3X1V D;  2PYO A;  1ZLA D;  2ZY3 A;  4ZBJ C;  2NZD A;  3WKJ D;  1KX5 B;  3AV2 C;  2ARO A;  5CPI C;  4R8P C;  4Z5T B;  5AVC A;  2HIO A;  5B1M A;  3X1S A;  3AZK D;  4H9S C;  3AN2 A;  2UWX A;  3AZM C;  4CAY A;  2F8N D;  4KHA A;  4ZUX A;  5B33 A;  4AWL B;  4WU9 D;  1HTA A;  2RIQ A;  4WNN B;  3W98 D;  1T3U A;  4X23 B;  3B6F C;  1BH9 A;  3AZE A;  3AZF B;  2FJ7 D;  5B31 G;  2HIO C;  1P3A D; 
#chains in the Genus database with same CATH homology
 1TZY A;  2RVQ D;  2YFV A;  4E44 A;  5E5A C;  4QLC D;  3AZM A;  2BYK B;  4YS3 D;  1KX3 D;  3VH5 T;  3H0R C;  2BYM A;  5F99 A;  5BO0 A;  4J8V B;  3REK C;  3KWQ C;  3AZL A;  1S32 A;  4ZBJ B;  1P3K D;  1ID3 C;  3WTP B;  3W99 B;  3AZE B;  5AVB A;  5CP6 A;  4UUZ B;  5JA4 B;  5B1L A;  3AZI A;  4KUD B;  5C3I B;  5B0Y A;  3MVD C;  1P3G D;  4YS3 B;  3WKJ C;  5B40 A;  5CPI D;  4J8V C;  5GXQ C;  2F8N G;  5JRG A;  1F66 D;  5GSU C;  1BH8 A;  4J8U C;  2FJ7 B;  3AZH C;  3W96 C;  1P3I A;  1M1A A;  3AZI C;  1W2E A;  3UTB A;  5GT3 C;  4KGC B;  3MVD A;  3AZG C;  5DNM C;  4WZS B;  4LD9 B;  5B40 C;  3EPL A;  5GSU A;  4J8U A;  3TU4 B;  1KX4 C;  5AV9 A;  5B33 B;  3W96 A;  1P3I C;  4J8W A;  1M1A B;  1P3F A;  3AFA D;  3FDD A;  3O62 A;  4WU8 C;  3WA9 B;  4R8P B;  3LJA D;  3EG5 B;  3UTA D;  1ZLA C;  3AYW B;  1HQ3 A;  3X1U B;  3UT9 B;  1P34 B;  5B31 C;  4H9Q B;  5BNX B;  3KXB A;  4J8W C;  2F2A C;  1P3F B;  1P3F C;  3WA9 A;  4XZQ D;  5GXQ D;  3X1S D;  1EQZ C;  3IP4 C;  4JJN C;  5B31 B;  3B0D B;  5AVB B;  3B6F D;  3REL B;  3AZH D;  1P3L B;  5AV5 B;  1WWS A;  5BNV A;  3A6N C;  3W97 C;  3AYW C;  4ZUX D;  5AV8 C;  5B2J C;  4WJ3 C;  4NE6 A;  1U35 A;  1M18 A;  1P3M B;  2F8N B;  3REK D;  2FJ7 A;  5B0Z C;  3AZK C;  4XUJ A;  3MNN C;  3AZK B;  1TZY D;  1P3L A;  1F1E A;  5AV5 A;  5FUG B;  5AY8 A;  3AZF D;  4DQY B;  5B24 B;  2ZY2 A;  1S32 D;  3W98 C;  4LD9 D;  5AV8 B;  1TAF A;  2FFF B;  3LZ0 D;  3AZN C;  5JRG B;  5AV6 D;  5AVB D;  5GSU B;  4UPK A;  4J8U B;  2FJ7 C;  5B1L D;  3WAA C;  3V9R B;  4XUJ C;  3W99 A;  3O62 B;  4YS3 C;  1P3G A;  5FUG A;  5AY8 B;  3MVD B;  5KDM B;  5CPI A;  2W8S A;  5AVC C;  5B1M C;  2JE5 A;  1F66 A;  3AZJ A;  3AZN A;  3X1U C;  3UT9 C;  1P34 C;  3A1I A;  3KWQ B;  3UTB D;  1KX4 D;  5CPJ A;  5B32 B;  3LJA C;  5B32 G;  3REI D;  1P3B C;  2ZY4 A;  1KX3 B;  3KUY A;  1F66 C;  1TZY C;  5BT1 D;  5BNX A;  4G91 C;  1P3A B;  4KHA B;  3O62 D;  1P3P B;  1M19 D;  1Q9C A;  3MGP D;  3UTA A;  3MGS A;  2PYO B;  4CSR A;  3P5J B;  2ARO C;  2YFW A;  4R8P A;  4XZQ C;  4XUJ B;  1PZR A;  3X1S C;  3KUY B;  3KUY C;  4Z5T C;  3X1S B;  3AV2 A;  2BYK A;  3REH A;  2Y2L A;  1P3P D;  4WU8 D;  5B2J D;  4H9O B;  3WA9 D;  2BYM B;  5F99 B;  3AZL B;  5GXQ A;  3UTA C;  4Z66 C;  4J8X D;  5B2I C;  2YFW B;  3B0C W;  3AZE C;  1B6W A;  3V9R A;  5B0Z D;  3WTP C;  5JA4 A;  3MGR A;  4Z5T A;  3UTB C;  1H3O B;  3LJA B;  5KDM A;  5B32 C;  1M18 D;  3REK A;  1P3B D;  3AV1 B;  4Z66 A;  1EQZ D;  4H9P A;  5AV6 C;  5AV9 C;  5AV5 D;  4Z2M H;  3B0D C;  1WWI A;  5AVB C;  3WTP A;  3KWQ A;  3B6F B;  3MGR B;  5AY8 D;  2NQB D;  3AZF A;  1M19 C;  1ID3 A;  4NFT A;  3MGP C;  2CV5 D;  5CP6 C;  1ZLA A;  5B32 A;  4LD9 A;  1ULY A;  2NZD D;  4EO5 B;  3AZM B;  2ARO D;  5B1M D;  5AVC D;  4Z66 B;  3WAA B;  5B24 D;  1S32 B;  4Z2M G;  3W99 D;  3C1B A;  2F8N K;  3X1U D;  3UT9 D;  1P34 D;  1KX5 D;  5CPK B;  5JRG C;  3B0B A;  2Y2K A;  5B33 D;  4WU9 A;  5CPK C;  2G5H C;  3EPJ A;  3WA9 C;  3VH6 W;  1A7W A;  2Y2G A;  4CSR B;  2Y2N A;  3C1C D;  1M1A C;  3AZN D;  5B2I D;  3LEL D;  2ARO B;  3AZE D;  3REI C;  3AZG A;  3R45 B;  5DNM A;  1P3M D;  3WAA D;  2CV5 B;  5GT0 C;  3B6G A;  4YM6 A;  3AN2 B;  5BT1 C;  4X23 D;  3F6T A;  2BG1 A;  4QLC A;  3AZM D;  4DRA A;  2XD1 A;  4KGC D;  1P3O D;  5G49 B;  1BH9 B;  1HQ3 C;  5AV5 C;  4JJN B;  5CHL B;  4KUD D;  4QLC C;  4E45 A;  4J8W B;  3X1V B;  5B2I B;  2ZM5 A;  1KU5 A;  1N1J B;  1R4V A;  3AV2 D;  1AOI B;  3W99 C;  1ID3 B;  4JJN A;  1Z2C B;  5B2J A;  1ZLA B;  5B0Y B;  3MVD D;  3A6N A;  3W97 A;  5AV8 A;  5E5A B;  3LZ1 A;  4NE3 A;  3X1V A;  2PYO D;  5B0Z A;  3W98 B;  3EPH A;  5GSU D;  4J8U D;  2Y2H A;  5AV9 D;  3NQJ A;  4X23 C;  3W96 D;  2HIO D;  3AZK A;  3AFA A;  3MNN A;  2YFV B;  3AN2 D;  3LJA A;  5GT3 B;  2CV5 C;  4KGC C;  2J8P A;  1KX3 C;  3REI B;  1F66 B;  1P3B B;  1U35 B;  1HQ3 D;  3W98 A;  1ID3 D;  3MGQ A;  5BS7 A;  1KX5 C;  3REJ A;  5B32 D;  4H9N A;  3X1T B;  5CPK D;  3REL C;  5DNN A;  4XZQ A;  5C3I C;  2Y2P A;  4YS3 A;  1P3G C;  3X1T D;  1KX3 A;  5B24 A;  5B1M B;  5AVC B;  1BFM A;  5F99 D;  3AZL D;  3X1U A;  3UT9 A;  1P34 A;  5B31 D;  4G92 B;  3B6G B;  3H0L C;  4QLC B;  5GT0 D;  3C1B B;  1M19 B;  5CP6 D;  4WV4 B;  1U35 D;  3C1C A;  4H9N B;  1P3O B;  2NZD C;  5B2I A;  3LEL A;  5AV6 B;  5DNN B;  2HUE C;  5CPJ C;  3AZG D;  5B40 D;  5B24 C;  2HIO B;  4YM6 D;  3AZJ B;  2IO5 B;  5JRG D;  3AYW D;  5B33 C;  3H0M C;  3TU4 C;  1KX4 B;  3AN2 C;  3MGS C;  3C1C B;  3C1C C;  1P3O A;  3LZ0 A;  1M1A D;  2XD5 A;  3MGS B;  5B0Z B;  2VQR A;  5AV6 A;  3LEL C;  3EPK A;  2LY8 A;  5G49 A;  2IO5 C;  3VH6 T;  3KFU G;  1H3O A;  3AZI B;  4KUD A;  3NQU A;  5B2J B;  3AV2 B;  1AOI D;  3A6N B;  2F8N H;  3REL D;  2JSS A;  5E5A A;  3LZ1 B;  1S32 C;  4J8W D;  1P3O C;  3REH C;  4ZUX B;  5GXQ B;  3LZ0 C;  3REJ D;  3C1B C;  2PYO C;  1N1J A;  2G5I C;  5B1L C;  4JJN D;  5CP6 B;  4UUZ A;  3MGP B;  4KUD C;  3W97 D;  1P3G B;  3MGR C;  1JFI A;  3LZ1 D;  2JCH A;  4HGA C;  1TZY B;  3REI A;  4H9O A;  3KXB D;  1M18 B;  3REK B;  3AV1 C;  4H9R A;  5BO0 B;  4J8V A;  4NE5 A;  3MGQ B;  1M19 A;  3MNN D;  1P3I B;  3B6F A;  3TU4 D;  3NQJ B;  3MGP A;  3AZH A;  3MGS D;  3UTB B;  3LEL B;  4J8X B;  1JFI B;  3AFA B;  3AZF C;  5GT3 A;  3VH5 W;  2L5A A;  3R45 A;  5DNM B;  4LD9 C;  3AV1 A;  3MGQ D;  4H9R B;  4YM6 B;  5F99 C;  3AZL C;  4AWL C;  4H9Q A;  3A1K A;  1P3P A;  4WU8 A;  3O62 C;  2ZY5 A;  4XUJ D;  5CPK A;  3KXB B;  3W96 B;  5DNN D;  3AZH B;  1P3L D;  2DQN C;  4WU9 B;  4J8X A;  3X1T A;  2NZD B;  4WU9 C;  5CPI B;  5B0Y C;  4XZQ B;  2Y2Q A;  5B31 A;  3WKJ A;  4Z5T D;  5BNV B;  5GT0 A;  4G92 C;  3B6G C;  4YM6 C;  4DRB A;  1B67 A;  4CAY B;  1P3A C;  4G91 B;  1P3P C;  3X1V C;  2F8N A;  4Z66 D;  4J8X C;  1EQZ A;  3X1T C;  2Y2J A;  2Y2O A;  3KWQ D;  3WTP D;  3AYW A;  1P3K C;  1P3K B;  3AZJ D;  3NQU B;  1HQ3 B;  2CV5 A;  2Y2I A;  1U35 C;  3W97 B;  1M18 C;  1P3A A;  1KX4 A;  5CPJ D;  1EQZ B;  3C1B D;  1KX5 A;  1AOI A;  5B1L B;  5AY8 C;  1P3K A;  3KUY D;  3REL A;  2RVQ C;  5E5A D;  3REH B;  3AZI D;  3LZ1 C;  5B0Y D;  1TAF B;  3AZN B;  3KXB C;  5DNM D;  1P3M A;  3WAA A;  4WNN A;  3B6G D;  4R8P D;  4WU8 B;  4X23 A;  1AOI C;  3KSY A;  3VH6 A;  3B0C T;  4KGC A;  4EO5 C;  3MNN B;  1P3I D;  3REH D;  3AL0 C;  3AFA C;  3VH5 A;  4J8V D;  5B40 B;  3AZG B;  1P3M C;  4H9P B;  3AZJ C;  3MGQ C;  3TU4 A;  5BS7 C;  5AV9 B;  2Y2M A;  3REJ C;  2NQB C;  3MGR D;  2NQB B;  5CPJ B;  3REJ B;  2HUE B;  5DNN C;  1P3L C;  5GT3 D;  4HGA B;  4M6B A;  1P3F D;  3WTP E;  3AV1 D;  3WKJ B;  1P3B A;  5GT0 B;  4H9S A;  1BH8 B;  3A6N D;  2DF4 C;  2NQB A;  4ZUX C;  5AV8 D;  3LZ0 B;  3UTA B;  2CWE A;  3X1V D;  2PYO A;  1ZLA D;  2ZY3 A;  4ZBJ C;  2NZD A;  3WKJ D;  1KX5 B;  3AV2 C;  2ARO A;  5CPI C;  4R8P C;  4Z5T B;  5AVC A;  2HIO A;  5B1M A;  3X1S A;  3AZK D;  4H9S C;  3AN2 A;  2UWX A;  3AZM C;  4CAY A;  2F8N D;  4KHA A;  4ZUX A;  5B33 A;  4AWL B;  4WU9 D;  1HTA A;  2RIQ A;  4WNN B;  3W98 D;  1T3U A;  4X23 B;  3B6F C;  1BH9 A;  3AZE A;  3AZF B;  2FJ7 D;  5B31 G;  2HIO C;  1P3A D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...