5KDMA

Crystal structure of ebv tegument protein bnrf1 in complex with histone chaperone daxx and histones h3.3-h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone / dna binding protein
molecule keywords Histone H3.3
publication title Structural basis underlying viral hijacking of a histone chaperone complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5kdmA00
1ZLAC 4XUJC 3B0DB 4WU9B 4Z5TB 1TZYD 3LELB 2NZDD 4XUJD 5JRGB 4Z66A 5DNNB 1TAFA 2CV5A 3W98B 4M6BA 1P3LC 4E44A 1P3LD 1P3IC 1N1JB 3AZJB 2RVQC 4H9NA 3X1UB 1P3ID 3AN2C 5AVCB 3AV2A 5AV9C 1P3KC 5CPKA 4R8PA 1P3BD 1P3KD 3B6GC 3KXBC 3AZEC 3AZNA 3B6GD 3REJB 3MGSA 5GSUD 1P3MB 5B1LA 4QLCB 3AYWB 1EQZC 3X1SA 5B32G 1EQZD 4UUZA 5BNVB 4H9RA 3A6NA 4JJNC 1M19A 3WTPB 3MNNB 5F99B 4JJND 2NQBC 3B6FA 3AZHB 4KGCA 1M1AC 3W97C 3MVDB 3W97D 4Z5TC 1AOIC 4Z5TD 5BNXA 3LELD 4CAYB 3REIB 3NQUB 5DNND 3V9RB 5CPIB 3MGPB 3MGQC 3WKJA 5B24A 4WU8A 3AV1B 2AROC 3AZKA 4YM6A 3X1UD 4YS3C 1F66A 3RELB 5B32C 4YS3D 5AV8B 5DNMB 5AVCD 1P34B 5B32D 1P3GA 3AZMB 3W99C 2FJ7A 3C1CB 4H9QA 1P3MD 1H3OB 4QLCD 2L5AA 2HIOB 3LZ1A 1P3OC 5C3IC 1P3FB 3LJAA 1P3OD 3NQJA 5GT3A 4LD9A 3MNND 5F99D 4XZQC 1ID3B 3AZHD 5CP6A 3KWQB 4J8UB 3UTAB 1BFMA 4WZSB 4X23B 2IO5C 3AZIB 5FUGB 3REHB 2CWEA 3MGPD 5CPID 1M18B 1KX5A 2PYOA 3AV1C 5AV6B 3AFAA 3AV1D 1WWSA 5AV5B 4KUDA 2F8NB 2BYMA 1U35C 1P34D 1BH9B 4Z66C 1U35D 3C1CC 4J8VB 4J8XA 2CV5C 5BS7A 3X1VA 3C1CD 4XUJB 1ZLAB 5E5AA 2F8NG 2HIOD 1P3FD 4WU9A 3UT9A 3B0CT 3AV2C 1P3IB 3W98A 4ZUXA 5AVBA 2YFWB 3UTAC 3AN2B 3AZNC 3KWQD 3AZJA 3MGSC 3UTAD 5AV9B 5B1LC 3B6GB 3KXBB 3REKA 3AZEB 5BO0A 3AZID 4G91C 1M19C 3REHD 4H9SC 4WV4B 1M18D 1HQ3A 3B6FC 1EQZB 3C1BA 3WAAA 3REJA 5AV6D 3MGRA 4JJNB 2HUEC 5CHLB 2NQBB 5BNVA 2F8ND 3WTPA 1M1AB 4J8VC 5B2IA 4J8VD 1KX4A 5B24C 1AOIB 1ZLAD 5JA4A 4HGAC 5GT0C 3MVDA 5GT0D 1JFIB 3B0CW 5B33B 3MGQB 1F66C 1P3AA 3REIA 3AZGA 2AROB 3LZ0A 1P3GC 2RVQD 5B31A 3WA9A 3O62A 4YS3B 5G49A 3AN2D 5B32B 5AV9D 3LZ1C 3RELA 3W99B 4G92C 5AV8A 5GT3C 3KXBD 3AZED 5KDMA 3AZMA 4LD9C 5B40B 3WTPE 1P3OB 3X1TA 3AZFA 5C3IB 1KX3A 3TU4A 5B0ZB 1H3OA 5B0YA 5GXQA 4XZQB 2NQBD 5B1MC 3B0BA 3R45A 3VH6T 5B2JC 5B1MD 1ID3A 1M1AD 3KSYA 5B2JD 2IO5B 4NE3A 1KX5C 2PYOC 1AOID 4J8UA 4AWLC 4X23A 3UTBC 3AFAC 5B33C 3UTBD 5B33D 3KUYA 3MGQD 4KUDC 1S32A 1Q9CA 1P3PB 2AROD 1BH8B 4J8XC 4KHAB 5AV5A 1U35B 5E5AC 4Z66B 5CPJA 3W99D 1TAFB 2CV5B 3AZLA 5B40C 1KU5A 5B40D 1TZYA 5B0ZC 2NZDA 4Z2MH 4XUJA 4H9NB 4ZUXC 5AVBC 3VH5A 5B0ZD 3AV2B 3VH6W 4XZQD 1P3LA 4H9PA 1P3IA 3AZNB 3MGSB 3W96C 5B1LB 5AY8C 3WAAC 4H9OA 4NE5A 4WNNA 3C1BC 3W96D 5AY8D 3MGRC 1P3BA 1P3KA 4UUZB 5BT1C 4H9RB 1M19B 4G91B 3B6GA 3B6FB 5GSUA 4J8WC 1P3PC 4J8WD 1P3PD 2HUEB 5B2IC 1EQZA 2YFVB 1KX4C 4JJNA 4DRAA 5BNXB 4Z66D 2BYKA 4NFTA 2CV5D 5B24B 3W97A 4HGAB 5GT0B 3AZGC 4Z5TA 3LELA 3LZ0C 3AZKB 5B31C 4YM6B 3WA9C 5JRGA 3O62C 5DNNA 1F66B 5B31D 5CPKC 1ULYA 4R8PC 3AV2D 1JFIA 5CPKD 1P3GB 4R8PD 1N1JA 3VH6A 2FJ7B 3X1UA 3AZND 4H9QB 3MGSD 3X1SC 5B1LD 3LZ1B 4EO5C 3X1TC 3AZFC 1R4VA 5AVCA 5B32A 3X1SD 4G92B 3A6NC 3TU4C 3NQJB 5GT3B 3A6ND 5B0YC 1F1EA 5GXQC 1M19D 4LD9B 4KGCC 3VH5T 1P3MA 3B6FD 4KGCD 4QLCA 3AYWA 5CP6B 1P3OA 5B1MB 4NE6A 3MNNA 5F99A 5B2JB 3AZHA 3WKJC 1KX5B 4WU8C 2PYOB 5B24D 3WKJD 4AWLB 4WU8D 3AZKC 4YM6C 3UTBB 3AFAB 3AZKD 4CAYA 1HTAA 4YM6D 3NQUA 1F66D 4KUDB 3V9RA 5CPIA 3MGPA 2F8NK 2FJ7C 1P3GD 3AV1A 4J8XB 2FJ7D 3AZLC 5E5AB 3LZ1D 1TZYC 5DNMA 3LJAC 4KHAA 1P34A 2NZDC 3LJAD 1U35A 5GT3D 3VH5W 3UT9B 2LY8A 4LD9D 3C1CA 5CP6C 4DRBA 4ZUXB 2HIOA 5AVBB 5CP6D 1P3FA 4ZBJC 1P3BC 3REKB 5BO0B 3W96B 5AY8B 3KWQA 3UTAA 4CSRB 1HQ3B 5GSUC 1KX5D 3C1BB 2PYOD 3WAAB 3MGRB 3AFAD 3AZIA 5FUGA 4KUDD 3REHA 4J8WB 1M18A 5AV6A 4H9SA 5B2IB 5BS7C 3X1VC 1KX4B 4J8XD 3X1VD 5JA4B 5E5AD 2YFVA 3B0DC 4WU9C 3LELC 2F8NA 1BH9A 5JRGC 4WU9D 3UT9C 5DNNC 1P3AB 4J8VA 3UT9D 5JRGD 1WWIA 3W98C 3AZGB 1ZLAA 3W98D 3LZ0B 3WA9B 5B31B 4ZUXD 5AVBD 3O62B 3AZJC 5GT0A 5G49B 3X1UC 5CPKB 3AZJD 4R8PB 5AVCC 3REKC 5B31G 3REKD 5KDMB 2YFWA 1HQ3C 3AN2A 3X1SB 3REJC 4EO5B 3X1TB 3AZFB 1P3MC 1HQ3D 5AV9A 3WAAD 3C1BD 4QLCC 1KX3B 3A6NB 3REJD 3TU4B 3AYWC 3MGRD 5BT1D 5B0YB 3AYWD 5GXQB 3KXBA 3AZEA 4KGCB 3WTPC 3MNNC 5F99C 3R45B 3AZHC 1B6WA 4Z2MG 3WTPD 5B2ID 1KX4D 2NQBA 3MVDC 3MVDD 2F8NH 5B1MA 3WKJB 1B67A 1P3AC 1M1AA 5B2JA 3KUYB 3REIC 4WU8B 1P3AD 5CPIC 3MGPC 1S32B 3REID 1AOIA 3AZGD 3LZ0D 3WA9D 2JSSA 3O62D 3UTBA 5B33A 3MGQA 3RELC 5DNMC 5AV8C 5CPJB 4E45A 3RELD 1P34C 2AROA 5DNMD 5AV8D 3AZMC 3AZLB 4YS3A 3AZMD 1KX3C 1TZYB 3X1TD 3LJAB 3AZFD 2NZDB 1KX3D 2HIOC 3TU4D 1A7WA 3W99A 1P3FC 5B0YD 5GXQD 5B40A 1P3LB 1ID3C 4H9PB 1ID3D 5B0ZA 4ZBJB 3KWQC 4J8UC 4H9OB 4WNNB 4XZQA 4X23C 4J8UD 1P3BB 4X23D 1P3KB 3KUYC 1S32C 3KUYD 5GSUB 3AZIC 3REHC 1S32D 1M18C 3W96A 5AY8A 5AV6C 4CSRA 2BYMB 5AV5C 5CPJC 5AV5D 5CPJD 2BYKB 4J8WA 1P3PA 3X1VB 1BH8A 3AZLD 3W97B
chains in the Genus database with same CATH superfamily
1ZLAC 2F2AC 3B0DB 4XUJC 4Z5TB 1TZYD 3LELB 4WU9B 2NZDD 4XUJD 5JRGB 4Z66A 5DNNB 2Y2OA 1TAFA 2CV5A 3W98B 1Z2CB 2Y2PA 4M6BA 1P3LC 2XD5A 4E44A 1P3LD 1P3IC 1N1JB 2Y2HA 3AZJB 2RVQC 4H9NA 3X1UB 1P3ID 3AN2C 5AVCB 3AV2A 5AV9C 1P3KC 5CPKA 4R8PA 2RIQA 1P3BD 1P3KD 3B6GC 3KXBC 3AZEC 3H0LC 3AZNA 3REJB 3B6GD 2VQRA 3P5JB 5GSUD 3MGSA 1P3MB 5B1LA 4QLCB 3AYWB 1EQZC 3X1SA 5B32G 1EQZD 2Y2KA 4UUZA 5BNVB 4H9RA 3A6NA 4JJNC 1M19A 3WTPB 3MNNB 5F99B 4JJND 2NQBC 3B6FA 3AZHB 4KGCA 1M1AC 3W97C 3MVDB 3W97D 4Z5TC 1AOIC 4Z5TD 5BNXA 3LELD 4CAYB 3REIB 3NQUB 5DNND 3KFUG 3V9RB 5CPIB 3MGPB 3MGQC 3WKJA 5B24A 2ZY5A 4WU8A 3AV1B 2AROC 3AZKA 4YM6A 3X1UD 4YS3C 3FDDA 1F66A 3RELB 5B32C 4YS3D 5AV8B 5DNMB 5AVCD 1P34B 5B32D 1P3GA 3AZMB 3W99C 3EG5B 2FJ7A 3C1CB 4H9QA 1P3MD 1H3OB 4QLCD 2L5AA 2HIOB 3LZ1A 1P3OC 5C3IC 1P3FB 3LJAA 1P3OD 3NQJA 5GT3A 4LD9A 3MNND 5F99D 4XZQC 1ID3B 3AZHD 5CP6A 3KWQB 4J8UB 3UTAB 1BFMA 2Y2JA 4WZSB 4X23B 2IO5C 1T3UA 3AZIB 5FUGB 3REHB 2CWEA 3MGPD 5CPID 1M18B 1KX5A 2PYOA 3AV1C 5AV6B 3AFAA 3AV1D 1WWSA 5AV5B 4KUDA 2F8NB 2BYMA 1U35C 1P34D 1BH9B 4Z66C 3A1IA 1U35D 3C1CC 4J8VB 4J8XA 2CV5C 5BS7A 3X1VA 3C1CD 4XUJB 1ZLAB 5E5AA 2F8NG 2HIOD 1P3FD 4WU9A 3UT9A 3B0CT 3AV2C 1P3IB 3W98A 3AL0C 4ZUXA 5AVBA 2YFWB 3UTAC 3AN2B 3AZNC 3KWQD 3AZJA 3MGSC 3UTAD 5AV9B 5B1LC 3B6GB 3H0MC 3KXBB 3REKA 3AZEB 3F6TA 5BO0A 3AZID 4G91C 1M19C 2DQNC 3REHD 4H9SC 4WV4B 1M18D 1HQ3A 3B6FC 1EQZB 3C1BA 3WAAA 3REJA 5AV6D 3MGRA 4JJNB 2HUEC 5CHLB 2NQBB 5BNVA 2F8ND 3WTPA 1M1AB 4J8VC 5B2IA 4J8VD 1KX4A 5B24C 1AOIB 1ZLAD 5JA4A 2Y2MA 4HGAC 5GT0C 3MVDA 5GT0D 1JFIB 3B0CW 5B33B 3MGQB 1F66C 1P3AA 3REIA 3AZGA 2AROB 3LZ0A 1P3GC 2RVQD 5B31A 3WA9A 3O62A 4YS3B 2Y2QA 5G49A 3AN2D 5B32B 5AV9D 3LZ1C 3RELA 3W99B 4G92C 5AV8A 5GT3C 3KXBD 3AZED 5KDMA 3AZMA 4LD9C 5B40B 3WTPE 1P3OB 3X1TA 3AZFA 5C3IB 1KX3A 3TU4A 5B0ZB 1H3OA 5B0YA 5GXQA 4XZQB 2NQBD 5B1MC 3B0BA 3R45A 3VH6T 5B2JC 5B1MD 1ID3A 1M1AD 3KSYA 5B2JD 2IO5B 4NE3A 1KX5C 2PYOC 1AOID 4J8UA 4AWLC 4X23A 3UTBC 3AFAC 5B33C 3UTBD 5B33D 3KUYA 3MGQD 2G5IC 4KUDC 3IP4C 1S32A 1Q9CA 1P3PB 2AROD 2BG1A 1BH8B 4J8XC 4KHAB 2ZY3A 5AV5A 1U35B 5E5AC 4Z66B 5CPJA 3W99D 1TAFB 2CV5B 3AZLA 5B40C 1KU5A 5B40D 1TZYA 3A1KA 5B0ZC 2NZDA 4Z2MH 4XUJA 4H9NB 4ZUXC 5AVBC 3VH5A 5B0ZD 3AV2B 3VH6W 2Y2IA 4XZQD 1P3LA 4H9PA 2DF4C 1PZRA 1P3IA 3AZNB 3MGSB 3W96C 5B1LB 5AY8C 3WAAC 4H9OA 4NE5A 4WNNA 3C1BC 3W96D 5AY8D 3MGRC 1P3BA 1P3KA 4UUZB 5BT1C 4H9RB 1M19B 4G91B 3B6GA 3B6FB 5GSUA 4J8WC 1P3PC 4J8WD 2W8SA 2HUEB 5B2IC 1P3PD 1EQZA 2YFVB 1KX4C 4JJNA 4DRAA 5BNXB 4Z66D 2BYKA 4NFTA 2CV5D 5B24B 3W97A 4HGAB 5GT0B 3AZGC 4Z5TA 3LELA 3LZ0C 3AZKB 5B31C 4YM6B 3WA9C 5JRGA 3O62C 5DNNA 1F66B 5B31D 5CPKC 1ULYA 4R8PC 3AV2D 1JFIA 4UPKA 5CPKD 1P3GB 4R8PD 1N1JA 2JE5A 3VH6A 2FJ7B 3X1UA 3AZND 4H9QB 3MGSD 3X1SC 5B1LD 3LZ1B 4EO5C 3X1TC 3AZFC 1R4VA 5AVCA 5B32A 3X1SD 4G92B 3A6NC 3TU4C 3NQJB 5GT3B 3A6ND 5B0YC 1F1EA 5GXQC 2J8PA 1M19D 4KGCC 4LD9B 3VH5T 1P3MA 3B6FD 4KGCD 4QLCA 3AYWA 5CP6B 1P3OA 5B1MB 4NE6A 3MNNA 5F99A 5B2JB 3AZHA 3WKJC 1KX5B 4WU8C 2PYOB 5B24D 3WKJD 4AWLB 4WU8D 3AZKC 4YM6C 3UTBB 3AFAB 3AZKD 4CAYA 1HTAA 4YM6D 2ZY4A 3NQUA 1F66D 4KUDB 3V9RA 5CPIA 3MGPA 2F8NK 2FJ7C 1P3GD 3AV1A 1W2EA 4J8XB 2FJ7D 3AZLC 2Y2LA 5E5AB 3LZ1D 1TZYC 5DNMA 3LJAC 4KHAA 1P34A 2NZDC 2Y2GA 3LJAD 1U35A 5GT3D 3VH5W 3UT9B 2LY8A 4LD9D 3C1CA 5CP6C 4DRBA 4ZUXB 2HIOA 5AVBB 5CP6D 1P3FA 4ZBJC 1P3BC 3REKB 4WJ3C 5BO0B 3W96B 5AY8B 3KWQA 3UTAA 4CSRB 1HQ3B 5GSUC 2ZY2A 3C1BB 1KX5D 2PYOD 3WAAB 3MGRB 2UWXA 3AFAD 3AZIA 3EPLA 5FUGA 4KUDD 3REHA 4J8WB 1M18A 5AV6A 4H9SA 5B2IB 5BS7C 3X1VC 1KX4B 4J8XD 3X1VD 5JA4B 2Y2NA 2YFVA 3B0DC 5E5AD 3LELC 4WU9C 2F8NA 1BH9A 5JRGC 4WU9D 3UT9C 5DNNC 1P3AB 4J8VA 3UT9D 5JRGD 1WWIA 3W98C 3AZGB 1ZLAA 3W98D 3LZ0B 3WA9B 5B31B 4ZUXD 5AVBD 3O62B 3AZJC 5GT0A 5G49B 3X1UC 5CPKB 3AZJD 4R8PB 5AVCC 3REKC 2JCHA 5B31G 3REKD 5KDMB 2YFWA 2G5HC 1HQ3C 3AN2A 3X1SB 3REJC 4EO5B 3X1TB 3AZFB 1P3MC 1HQ3D 5AV9A 3WAAD 3C1BD 4QLCC 1KX3B 3A6NB 3REJD 3TU4B 3AYWC 3MGRD 2ZM5A 5BT1D 5B0YB 3AYWD 5GXQB 3KXBA 3AZEA 4KGCB 3WTPC 3MNNC 5F99C 3R45B 3AZHC 1B6WA 4Z2MG 3WTPD 5B2ID 1KX4D 2NQBA 3MVDC 3MVDD 2F8NH 5B1MA 3WKJB 1B67A 1P3AC 1M1AA 5B2JA 3KUYB 3REIC 4WU8B 1P3AD 5CPIC 3MGPC 2XD1A 1S32B 3REID 3EPKA 1AOIA 3AZGD 3LZ0D 3WA9D 2JSSA 3O62D 3UTBA 5B33A 3MGQA 3RELC 5DNMC 5AV8C 5CPJB 4E45A 3RELD 1P34C 2AROA 5DNMD 5AV8D 3AZMC 3AZLB 4YS3A 3AZMD 1KX3C 1TZYB 3X1TD 3LJAB 3AZFD 2NZDB 1KX3D 2HIOC 3TU4D 1A7WA 3W99A 1P3FC 5B0YD 5GXQD 5B40A 1P3LB 1ID3C 3EPHA 4H9PB 1ID3D 5B0ZA 4DQYB 2FFFB 4ZBJB 3KWQC 4J8UC 4H9OB 4WNNB 4XZQA 4X23C 4J8UD 1P3BB 4X23D 1P3KB 3KUYC 1S32C 3KUYD 5GSUB 3AZIC 3REHC 1S32D 1M18C 3W96A 5AY8A 5AV6C 4CSRA 3EPJA 2BYMB 3H0RC 5AV5C 5CPJC 5AV5D 5CPJD 2BYKB 4J8WA 1P3PA 3X1VB 1BH8A 3AZLD 3W97B
chains in the Genus database with same CATH topology
1ZLAC 2F2AC 3B0DB 4XUJC 4Z5TB 1TZYD 3LELB 4WU9B 2NZDD 4XUJD 5JRGB 4Z66A 5DNNB 2Y2OA 1TAFA 2CV5A 3W98B 1Z2CB 2Y2PA 4M6BA 1P3LC 2XD5A 4E44A 1P3LD 1P3IC 1N1JB 2Y2HA 3AZJB 2RVQC 4H9NA 3X1UB 1P3ID 3AN2C 5AVCB 3AV2A 5AV9C 1P3KC 5CPKA 4R8PA 2RIQA 1P3BD 1P3KD 3B6GC 3KXBC 3AZEC 3H0LC 3AZNA 3REJB 3B6GD 2VQRA 3P5JB 5GSUD 3MGSA 1P3MB 5B1LA 4QLCB 3AYWB 1EQZC 3X1SA 5B32G 1EQZD 2Y2KA 4UUZA 5BNVB 4H9RA 3A6NA 4JJNC 1M19A 3WTPB 3MNNB 5F99B 4JJND 2NQBC 3B6FA 3AZHB 4KGCA 1M1AC 3W97C 3MVDB 3W97D 4Z5TC 1AOIC 4Z5TD 5BNXA 3LELD 4CAYB 3REIB 3NQUB 5DNND 3KFUG 3V9RB 5CPIB 3MGPB 3MGQC 3WKJA 5B24A 2ZY5A 4WU8A 3AV1B 2AROC 3AZKA 4YM6A 3X1UD 4YS3C 3FDDA 1F66A 3RELB 5B32C 4YS3D 5AV8B 5DNMB 5AVCD 1P34B 5B32D 1P3GA 3AZMB 3W99C 3EG5B 2FJ7A 3C1CB 4H9QA 1P3MD 1H3OB 4QLCD 2L5AA 2HIOB 3LZ1A 1P3OC 5C3IC 1P3FB 3LJAA 1P3OD 3NQJA 5GT3A 4LD9A 3MNND 5F99D 4XZQC 1ID3B 3AZHD 5CP6A 3KWQB 4J8UB 3UTAB 1BFMA 2Y2JA 4WZSB 4X23B 2IO5C 1T3UA 3AZIB 5FUGB 3REHB 2CWEA 3MGPD 5CPID 1M18B 1KX5A 2PYOA 3AV1C 5AV6B 3AFAA 3AV1D 1WWSA 5AV5B 4KUDA 2F8NB 2BYMA 1U35C 1P34D 1BH9B 4Z66C 3A1IA 1U35D 3C1CC 4J8VB 4J8XA 2CV5C 5BS7A 3X1VA 3C1CD 4XUJB 1ZLAB 5E5AA 2F8NG 2HIOD 1P3FD 4WU9A 3UT9A 3B0CT 3AV2C 1P3IB 3W98A 3AL0C 4ZUXA 5AVBA 2YFWB 3UTAC 3AN2B 3AZNC 3KWQD 3AZJA 3MGSC 3UTAD 5AV9B 5B1LC 3B6GB 3H0MC 3KXBB 3REKA 3AZEB 3F6TA 5BO0A 3AZID 4G91C 1M19C 2DQNC 3REHD 4H9SC 4WV4B 1M18D 1HQ3A 3B6FC 1EQZB 3C1BA 3WAAA 3REJA 5AV6D 3MGRA 4JJNB 2HUEC 5CHLB 2NQBB 5BNVA 2F8ND 3WTPA 1M1AB 4J8VC 5B2IA 4J8VD 1KX4A 5B24C 1AOIB 1ZLAD 5JA4A 2Y2MA 4HGAC 5GT0C 3MVDA 5GT0D 1JFIB 3B0CW 5B33B 3MGQB 1F66C 1P3AA 3REIA 3AZGA 2AROB 3LZ0A 1P3GC 2RVQD 5B31A 3WA9A 3O62A 4YS3B 2Y2QA 5G49A 3AN2D 5B32B 5AV9D 3LZ1C 3RELA 3W99B 4G92C 5AV8A 5GT3C 3KXBD 3AZED 5KDMA 3AZMA 4LD9C 5B40B 3WTPE 1P3OB 3X1TA 3AZFA 5C3IB 1KX3A 3TU4A 5B0ZB 1H3OA 5B0YA 5GXQA 4XZQB 2NQBD 5B1MC 3B0BA 3R45A 3VH6T 5B2JC 5B1MD 1ID3A 1M1AD 3KSYA 5B2JD 2IO5B 4NE3A 1KX5C 2PYOC 1AOID 4J8UA 4AWLC 4X23A 3UTBC 3AFAC 5B33C 3UTBD 5B33D 3KUYA 3MGQD 2G5IC 4KUDC 3IP4C 1S32A 1Q9CA 1P3PB 2AROD 2BG1A 1BH8B 4J8XC 4KHAB 2ZY3A 5AV5A 1U35B 5E5AC 4Z66B 5CPJA 3W99D 1TAFB 2CV5B 3AZLA 5B40C 1KU5A 5B40D 1TZYA 3A1KA 5B0ZC 2NZDA 4Z2MH 4XUJA 4H9NB 4ZUXC 5AVBC 3VH5A 5B0ZD 3AV2B 3VH6W 2Y2IA 4XZQD 1P3LA 4H9PA 2DF4C 1PZRA 1P3IA 3AZNB 3MGSB 3W96C 5B1LB 5AY8C 3WAAC 4H9OA 4NE5A 4WNNA 3C1BC 3W96D 5AY8D 3MGRC 1P3BA 1P3KA 4UUZB 5BT1C 4H9RB 1M19B 4G91B 3B6GA 3B6FB 5GSUA 4J8WC 1P3PC 4J8WD 2W8SA 2HUEB 5B2IC 1P3PD 1EQZA 2YFVB 1KX4C 4JJNA 4DRAA 5BNXB 4Z66D 2BYKA 4NFTA 2CV5D 5B24B 3W97A 4HGAB 5GT0B 3AZGC 4Z5TA 3LELA 3LZ0C 3AZKB 5B31C 4YM6B 3WA9C 5JRGA 3O62C 5DNNA 1F66B 5B31D 5CPKC 1ULYA 4R8PC 3AV2D 1JFIA 4UPKA 5CPKD 1P3GB 4R8PD 1N1JA 2JE5A 3VH6A 2FJ7B 3X1UA 3AZND 4H9QB 3MGSD 3X1SC 5B1LD 3LZ1B 4EO5C 3X1TC 3AZFC 1R4VA 5AVCA 5B32A 3X1SD 4G92B 3A6NC 3TU4C 3NQJB 5GT3B 3A6ND 5B0YC 1F1EA 5GXQC 2J8PA 1M19D 4KGCC 4LD9B 3VH5T 1P3MA 3B6FD 4KGCD 4QLCA 3AYWA 5CP6B 1P3OA 5B1MB 4NE6A 3MNNA 5F99A 5B2JB 3AZHA 3WKJC 1KX5B 4WU8C 2PYOB 5B24D 3WKJD 4AWLB 4WU8D 3AZKC 4YM6C 3UTBB 3AFAB 3AZKD 4CAYA 1HTAA 4YM6D 2ZY4A 3NQUA 1F66D 4KUDB 3V9RA 5CPIA 3MGPA 2F8NK 2FJ7C 1P3GD 3AV1A 1W2EA 4J8XB 2FJ7D 3AZLC 2Y2LA 5E5AB 3LZ1D 1TZYC 5DNMA 3LJAC 4KHAA 1P34A 2NZDC 2Y2GA 3LJAD 1U35A 5GT3D 3VH5W 3UT9B 2LY8A 4LD9D 3C1CA 5CP6C 4DRBA 4ZUXB 2HIOA 5AVBB 5CP6D 1P3FA 4ZBJC 1P3BC 3REKB 4WJ3C 5BO0B 3W96B 5AY8B 3KWQA 3UTAA 4CSRB 1HQ3B 5GSUC 2ZY2A 3C1BB 1KX5D 2PYOD 3WAAB 3MGRB 2UWXA 3AFAD 3AZIA 3EPLA 5FUGA 4KUDD 3REHA 4J8WB 1M18A 5AV6A 4H9SA 5B2IB 5BS7C 3X1VC 1KX4B 4J8XD 3X1VD 5JA4B 2Y2NA 2YFVA 3B0DC 5E5AD 3LELC 4WU9C 2F8NA 1BH9A 5JRGC 4WU9D 3UT9C 5DNNC 1P3AB 4J8VA 3UT9D 5JRGD 1WWIA 3W98C 3AZGB 1ZLAA 3W98D 3LZ0B 3WA9B 5B31B 4ZUXD 5AVBD 3O62B 3AZJC 5GT0A 5G49B 3X1UC 5CPKB 3AZJD 4R8PB 5AVCC 3REKC 2JCHA 5B31G 3REKD 5KDMB 2YFWA 2G5HC 1HQ3C 3AN2A 3X1SB 3REJC 4EO5B 3X1TB 3AZFB 1P3MC 1HQ3D 5AV9A 3WAAD 3C1BD 4QLCC 1KX3B 3A6NB 3REJD 3TU4B 3AYWC 3MGRD 2ZM5A 5BT1D 5B0YB 3AYWD 5GXQB 3KXBA 3AZEA 4KGCB 3WTPC 3MNNC 5F99C 3R45B 3AZHC 1B6WA 4Z2MG 3WTPD 5B2ID 1KX4D 2NQBA 3MVDC 3MVDD 2F8NH 5B1MA 3WKJB 1B67A 1P3AC 1M1AA 5B2JA 3KUYB 3REIC 4WU8B 1P3AD 5CPIC 3MGPC 2XD1A 1S32B 3REID 3EPKA 1AOIA 3AZGD 3LZ0D 3WA9D 2JSSA 3O62D 3UTBA 5B33A 3MGQA 3RELC 5DNMC 5AV8C 5CPJB 4E45A 3RELD 1P34C 2AROA 5DNMD 5AV8D 3AZMC 3AZLB 4YS3A 3AZMD 1KX3C 1TZYB 3X1TD 3LJAB 3AZFD 2NZDB 1KX3D 2HIOC 3TU4D 1A7WA 3W99A 1P3FC 5B0YD 5GXQD 5B40A 1P3LB 1ID3C 3EPHA 4H9PB 1ID3D 5B0ZA 4DQYB 2FFFB 4ZBJB 3KWQC 4J8UC 4H9OB 4WNNB 4XZQA 4X23C 4J8UD 1P3BB 4X23D 1P3KB 3KUYC 1S32C 3KUYD 5GSUB 3AZIC 3REHC 1S32D 1M18C 3W96A 5AY8A 5AV6C 4CSRA 3EPJA 2BYMB 3H0RC 5AV5C 5CPJC 5AV5D 5CPJD 2BYKB 4J8WA 1P3PA 3X1VB 1BH8A 3AZLD 3W97B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLA C;  4XUJ C;  3B0D B;  4WU9 B;  4Z5T B;  1TZY D;  3LEL B;  2NZD D;  4XUJ D;  5JRG B;  4Z66 A;  5DNN B;  1TAF A;  2CV5 A;  3W98 B;  4M6B A;  1P3L C;  4E44 A;  1P3L D;  1P3I C;  1N1J B;  3AZJ B;  2RVQ C;  4H9N A;  3X1U B;  1P3I D;  3AN2 C;  5AVC B;  3AV2 A;  5AV9 C;  1P3K C;  5CPK A;  4R8P A;  1P3B D;  1P3K D;  3B6G C;  3KXB C;  3AZE C;  3AZN A;  3B6G D;  3REJ B;  3MGS A;  5GSU D;  1P3M B;  5B1L A;  4QLC B;  3AYW B;  1EQZ C;  3X1S A;  5B32 G;  1EQZ D;  4UUZ A;  5BNV B;  4H9R A;  3A6N A;  4JJN C;  1M19 A;  3WTP B;  3MNN B;  5F99 B;  4JJN D;  2NQB C;  3B6F A;  3AZH B;  4KGC A;  1M1A C;  3W97 C;  3MVD B;  3W97 D;  4Z5T C;  1AOI C;  4Z5T D;  5BNX A;  3LEL D;  4CAY B;  3REI B;  3NQU B;  5DNN D;  3V9R B;  5CPI B;  3MGP B;  3MGQ C;  3WKJ A;  5B24 A;  4WU8 A;  3AV1 B;  2ARO C;  3AZK A;  4YM6 A;  3X1U D;  4YS3 C;  1F66 A;  3REL B;  5B32 C;  4YS3 D;  5AV8 B;  5DNM B;  5AVC D;  1P34 B;  5B32 D;  1P3G A;  3AZM B;  3W99 C;  2FJ7 A;  3C1C B;  4H9Q A;  1P3M D;  1H3O B;  4QLC D;  2L5A A;  2HIO B;  3LZ1 A;  1P3O C;  5C3I C;  1P3F B;  3LJA A;  1P3O D;  3NQJ A;  5GT3 A;  4LD9 A;  3MNN D;  5F99 D;  4XZQ C;  1ID3 B;  3AZH D;  5CP6 A;  3KWQ B;  4J8U B;  3UTA B;  1BFM A;  4WZS B;  4X23 B;  2IO5 C;  3AZI B;  5FUG B;  3REH B;  2CWE A;  3MGP D;  5CPI D;  1M18 B;  1KX5 A;  2PYO A;  3AV1 C;  5AV6 B;  3AFA A;  3AV1 D;  1WWS A;  5AV5 B;  4KUD A;  2F8N B;  2BYM A;  1U35 C;  1P34 D;  1BH9 B;  4Z66 C;  1U35 D;  3C1C C;  4J8V B;  4J8X A;  2CV5 C;  5BS7 A;  3X1V A;  3C1C D;  4XUJ B;  1ZLA B;  5E5A A;  2F8N G;  2HIO D;  1P3F D;  4WU9 A;  3UT9 A;  3B0C T;  3AV2 C;  1P3I B;  3W98 A;  4ZUX A;  5AVB A;  2YFW B;  3UTA C;  3AN2 B;  3AZN C;  3KWQ D;  3AZJ A;  3MGS C;  3UTA D;  5AV9 B;  5B1L C;  3B6G B;  3KXB B;  3REK A;  3AZE B;  5BO0 A;  3AZI D;  4G91 C;  1M19 C;  3REH D;  4H9S C;  4WV4 B;  1M18 D;  1HQ3 A;  3B6F C;  1EQZ B;  3C1B A;  3WAA A;  3REJ A;  5AV6 D;  3MGR A;  4JJN B;  2HUE C;  5CHL B;  2NQB B;  5BNV A;  2F8N D;  3WTP A;  1M1A B;  4J8V C;  5B2I A;  4J8V D;  1KX4 A;  5B24 C;  1AOI B;  1ZLA D;  5JA4 A;  4HGA C;  5GT0 C;  3MVD A;  5GT0 D;  1JFI B;  3B0C W;  5B33 B;  3MGQ B;  1F66 C;  1P3A A;  3REI A;  3AZG A;  2ARO B;  3LZ0 A;  1P3G C;  2RVQ D;  5B31 A;  3WA9 A;  3O62 A;  4YS3 B;  5G49 A;  3AN2 D;  5B32 B;  5AV9 D;  3LZ1 C;  3REL A;  3W99 B;  4G92 C;  5AV8 A;  5GT3 C;  3KXB D;  3AZE D;  5KDM A;  3AZM A;  4LD9 C;  5B40 B;  3WTP E;  1P3O B;  3X1T A;  3AZF A;  5C3I B;  1KX3 A;  3TU4 A;  5B0Z B;  1H3O A;  5B0Y A;  5GXQ A;  4XZQ B;  2NQB D;  5B1M C;  3B0B A;  3R45 A;  3VH6 T;  5B2J C;  5B1M D;  1ID3 A;  1M1A D;  3KSY A;  5B2J D;  2IO5 B;  4NE3 A;  1KX5 C;  2PYO C;  1AOI D;  4J8U A;  4AWL C;  4X23 A;  3UTB C;  3AFA C;  5B33 C;  3UTB D;  5B33 D;  3KUY A;  3MGQ D;  4KUD C;  1S32 A;  1Q9C A;  1P3P B;  2ARO D;  1BH8 B;  4J8X C;  4KHA B;  5AV5 A;  1U35 B;  5E5A C;  4Z66 B;  5CPJ A;  3W99 D;  1TAF B;  2CV5 B;  3AZL A;  5B40 C;  1KU5 A;  5B40 D;  1TZY A;  5B0Z C;  2NZD A;  4Z2M H;  4XUJ A;  4H9N B;  4ZUX C;  5AVB C;  3VH5 A;  5B0Z D;  3AV2 B;  3VH6 W;  4XZQ D;  1P3L A;  4H9P A;  1P3I A;  3AZN B;  3MGS B;  3W96 C;  5B1L B;  5AY8 C;  3WAA C;  4H9O A;  4NE5 A;  4WNN A;  3C1B C;  3W96 D;  5AY8 D;  3MGR C;  1P3B A;  1P3K A;  4UUZ B;  5BT1 C;  4H9R B;  1M19 B;  4G91 B;  3B6G A;  3B6F B;  5GSU A;  4J8W C;  1P3P C;  4J8W D;  1P3P D;  2HUE B;  5B2I C;  1EQZ A;  2YFV B;  1KX4 C;  4JJN A;  4DRA A;  5BNX B;  4Z66 D;  2BYK A;  4NFT A;  2CV5 D;  5B24 B;  3W97 A;  4HGA B;  5GT0 B;  3AZG C;  4Z5T A;  3LEL A;  3LZ0 C;  3AZK B;  5B31 C;  4YM6 B;  3WA9 C;  5JRG A;  3O62 C;  5DNN A;  1F66 B;  5B31 D;  5CPK C;  1ULY A;  4R8P C;  3AV2 D;  1JFI A;  5CPK D;  1P3G B;  4R8P D;  1N1J A;  3VH6 A;  2FJ7 B;  3X1U A;  3AZN D;  4H9Q B;  3MGS D;  3X1S C;  5B1L D;  3LZ1 B;  4EO5 C;  3X1T C;  3AZF C;  1R4V A;  5AVC A;  5B32 A;  3X1S D;  4G92 B;  3A6N C;  3TU4 C;  3NQJ B;  5GT3 B;  3A6N D;  5B0Y C;  1F1E A;  5GXQ C;  1M19 D;  4LD9 B;  4KGC C;  3VH5 T;  1P3M A;  3B6F D;  4KGC D;  4QLC A;  3AYW A;  5CP6 B;  1P3O A;  5B1M B;  4NE6 A;  3MNN A;  5F99 A;  5B2J B;  3AZH A;  3WKJ C;  1KX5 B;  4WU8 C;  2PYO B;  5B24 D;  3WKJ D;  4AWL B;  4WU8 D;  3AZK C;  4YM6 C;  3UTB B;  3AFA B;  3AZK D;  4CAY A;  1HTA A;  4YM6 D;  3NQU A;  1F66 D;  4KUD B;  3V9R A;  5CPI A;  3MGP A;  2F8N K;  2FJ7 C;  1P3G D;  3AV1 A;  4J8X B;  2FJ7 D;  3AZL C;  5E5A B;  3LZ1 D;  1TZY C;  5DNM A;  3LJA C;  4KHA A;  1P34 A;  2NZD C;  3LJA D;  1U35 A;  5GT3 D;  3VH5 W;  3UT9 B;  2LY8 A;  4LD9 D;  3C1C A;  5CP6 C;  4DRB A;  4ZUX B;  2HIO A;  5AVB B;  5CP6 D;  1P3F A;  4ZBJ C;  1P3B C;  3REK B;  5BO0 B;  3W96 B;  5AY8 B;  3KWQ A;  3UTA A;  4CSR B;  1HQ3 B;  5GSU C;  1KX5 D;  3C1B B;  2PYO D;  3WAA B;  3MGR B;  3AFA D;  3AZI A;  5FUG A;  4KUD D;  3REH A;  4J8W B;  1M18 A;  5AV6 A;  4H9S A;  5B2I B;  5BS7 C;  3X1V C;  1KX4 B;  4J8X D;  3X1V D;  5JA4 B;  5E5A D;  2YFV A;  3B0D C;  4WU9 C;  3LEL C;  2F8N A;  1BH9 A;  5JRG C;  4WU9 D;  3UT9 C;  5DNN C;  1P3A B;  4J8V A;  3UT9 D;  5JRG D;  1WWI A;  3W98 C;  3AZG B;  1ZLA A;  3W98 D;  3LZ0 B;  3WA9 B;  5B31 B;  4ZUX D;  5AVB D;  3O62 B;  3AZJ C;  5GT0 A;  5G49 B;  3X1U C;  5CPK B;  3AZJ D;  4R8P B;  5AVC C;  3REK C;  5B31 G;  3REK D;  5KDM B;  2YFW A;  1HQ3 C;  3AN2 A;  3X1S B;  3REJ C;  4EO5 B;  3X1T B;  3AZF B;  1P3M C;  1HQ3 D;  5AV9 A;  3WAA D;  3C1B D;  4QLC C;  1KX3 B;  3A6N B;  3REJ D;  3TU4 B;  3AYW C;  3MGR D;  5BT1 D;  5B0Y B;  3AYW D;  5GXQ B;  3KXB A;  3AZE A;  4KGC B;  3WTP C;  3MNN C;  5F99 C;  3R45 B;  3AZH C;  1B6W A;  4Z2M G;  3WTP D;  5B2I D;  1KX4 D;  2NQB A;  3MVD C;  3MVD D;  2F8N H;  5B1M A;  3WKJ B;  1B67 A;  1P3A C;  1M1A A;  5B2J A;  3KUY B;  3REI C;  4WU8 B;  1P3A D;  5CPI C;  3MGP C;  1S32 B;  3REI D;  1AOI A;  3AZG D;  3LZ0 D;  3WA9 D;  2JSS A;  3O62 D;  3UTB A;  5B33 A;  3MGQ A;  3REL C;  5DNM C;  5AV8 C;  5CPJ B;  4E45 A;  3REL D;  1P34 C;  2ARO A;  5DNM D;  5AV8 D;  3AZM C;  3AZL B;  4YS3 A;  3AZM D;  1KX3 C;  1TZY B;  3X1T D;  3LJA B;  3AZF D;  2NZD B;  1KX3 D;  2HIO C;  3TU4 D;  1A7W A;  3W99 A;  1P3F C;  5B0Y D;  5GXQ D;  5B40 A;  1P3L B;  1ID3 C;  4H9P B;  1ID3 D;  5B0Z A;  4ZBJ B;  3KWQ C;  4J8U C;  4H9O B;  4WNN B;  4XZQ A;  4X23 C;  4J8U D;  1P3B B;  4X23 D;  1P3K B;  3KUY C;  1S32 C;  3KUY D;  5GSU B;  3AZI C;  3REH C;  1S32 D;  1M18 C;  3W96 A;  5AY8 A;  5AV6 C;  4CSR A;  2BYM B;  5AV5 C;  5CPJ C;  5AV5 D;  5CPJ D;  2BYK B;  4J8W A;  1P3P A;  3X1V B;  1BH8 A;  3AZL D;  3W97 B; 
#chains in the Genus database with same CATH topology
 1ZLA C;  2F2A C;  3B0D B;  4XUJ C;  4Z5T B;  1TZY D;  3LEL B;  4WU9 B;  2NZD D;  4XUJ D;  5JRG B;  4Z66 A;  5DNN B;  2Y2O A;  1TAF A;  2CV5 A;  3W98 B;  1Z2C B;  2Y2P A;  4M6B A;  1P3L C;  2XD5 A;  4E44 A;  1P3L D;  1P3I C;  1N1J B;  2Y2H A;  3AZJ B;  2RVQ C;  4H9N A;  3X1U B;  1P3I D;  3AN2 C;  5AVC B;  3AV2 A;  5AV9 C;  1P3K C;  5CPK A;  4R8P A;  2RIQ A;  1P3B D;  1P3K D;  3B6G C;  3KXB C;  3AZE C;  3H0L C;  3AZN A;  3REJ B;  3B6G D;  2VQR A;  3P5J B;  5GSU D;  3MGS A;  1P3M B;  5B1L A;  4QLC B;  3AYW B;  1EQZ C;  3X1S A;  5B32 G;  1EQZ D;  2Y2K A;  4UUZ A;  5BNV B;  4H9R A;  3A6N A;  4JJN C;  1M19 A;  3WTP B;  3MNN B;  5F99 B;  4JJN D;  2NQB C;  3B6F A;  3AZH B;  4KGC A;  1M1A C;  3W97 C;  3MVD B;  3W97 D;  4Z5T C;  1AOI C;  4Z5T D;  5BNX A;  3LEL D;  4CAY B;  3REI B;  3NQU B;  5DNN D;  3KFU G;  3V9R B;  5CPI B;  3MGP B;  3MGQ C;  3WKJ A;  5B24 A;  2ZY5 A;  4WU8 A;  3AV1 B;  2ARO C;  3AZK A;  4YM6 A;  3X1U D;  4YS3 C;  3FDD A;  1F66 A;  3REL B;  5B32 C;  4YS3 D;  5AV8 B;  5DNM B;  5AVC D;  1P34 B;  5B32 D;  1P3G A;  3AZM B;  3W99 C;  3EG5 B;  2FJ7 A;  3C1C B;  4H9Q A;  1P3M D;  1H3O B;  4QLC D;  2L5A A;  2HIO B;  3LZ1 A;  1P3O C;  5C3I C;  1P3F B;  3LJA A;  1P3O D;  3NQJ A;  5GT3 A;  4LD9 A;  3MNN D;  5F99 D;  4XZQ C;  1ID3 B;  3AZH D;  5CP6 A;  3KWQ B;  4J8U B;  3UTA B;  1BFM A;  2Y2J A;  4WZS B;  4X23 B;  2IO5 C;  1T3U A;  3AZI B;  5FUG B;  3REH B;  2CWE A;  3MGP D;  5CPI D;  1M18 B;  1KX5 A;  2PYO A;  3AV1 C;  5AV6 B;  3AFA A;  3AV1 D;  1WWS A;  5AV5 B;  4KUD A;  2F8N B;  2BYM A;  1U35 C;  1P34 D;  1BH9 B;  4Z66 C;  3A1I A;  1U35 D;  3C1C C;  4J8V B;  4J8X A;  2CV5 C;  5BS7 A;  3X1V A;  3C1C D;  4XUJ B;  1ZLA B;  5E5A A;  2F8N G;  2HIO D;  1P3F D;  4WU9 A;  3UT9 A;  3B0C T;  3AV2 C;  1P3I B;  3W98 A;  3AL0 C;  4ZUX A;  5AVB A;  2YFW B;  3UTA C;  3AN2 B;  3AZN C;  3KWQ D;  3AZJ A;  3MGS C;  3UTA D;  5AV9 B;  5B1L C;  3B6G B;  3H0M C;  3KXB B;  3REK A;  3AZE B;  3F6T A;  5BO0 A;  3AZI D;  4G91 C;  1M19 C;  2DQN C;  3REH D;  4H9S C;  4WV4 B;  1M18 D;  1HQ3 A;  3B6F C;  1EQZ B;  3C1B A;  3WAA A;  3REJ A;  5AV6 D;  3MGR A;  4JJN B;  2HUE C;  5CHL B;  2NQB B;  5BNV A;  2F8N D;  3WTP A;  1M1A B;  4J8V C;  5B2I A;  4J8V D;  1KX4 A;  5B24 C;  1AOI B;  1ZLA D;  5JA4 A;  2Y2M A;  4HGA C;  5GT0 C;  3MVD A;  5GT0 D;  1JFI B;  3B0C W;  5B33 B;  3MGQ B;  1F66 C;  1P3A A;  3REI A;  3AZG A;  2ARO B;  3LZ0 A;  1P3G C;  2RVQ D;  5B31 A;  3WA9 A;  3O62 A;  4YS3 B;  2Y2Q A;  5G49 A;  3AN2 D;  5B32 B;  5AV9 D;  3LZ1 C;  3REL A;  3W99 B;  4G92 C;  5AV8 A;  5GT3 C;  3KXB D;  3AZE D;  5KDM A;  3AZM A;  4LD9 C;  5B40 B;  3WTP E;  1P3O B;  3X1T A;  3AZF A;  5C3I B;  1KX3 A;  3TU4 A;  5B0Z B;  1H3O A;  5B0Y A;  5GXQ A;  4XZQ B;  2NQB D;  5B1M C;  3B0B A;  3R45 A;  3VH6 T;  5B2J C;  5B1M D;  1ID3 A;  1M1A D;  3KSY A;  5B2J D;  2IO5 B;  4NE3 A;  1KX5 C;  2PYO C;  1AOI D;  4J8U A;  4AWL C;  4X23 A;  3UTB C;  3AFA C;  5B33 C;  3UTB D;  5B33 D;  3KUY A;  3MGQ D;  2G5I C;  4KUD C;  3IP4 C;  1S32 A;  1Q9C A;  1P3P B;  2ARO D;  2BG1 A;  1BH8 B;  4J8X C;  4KHA B;  2ZY3 A;  5AV5 A;  1U35 B;  5E5A C;  4Z66 B;  5CPJ A;  3W99 D;  1TAF B;  2CV5 B;  3AZL A;  5B40 C;  1KU5 A;  5B40 D;  1TZY A;  3A1K A;  5B0Z C;  2NZD A;  4Z2M H;  4XUJ A;  4H9N B;  4ZUX C;  5AVB C;  3VH5 A;  5B0Z D;  3AV2 B;  3VH6 W;  2Y2I A;  4XZQ D;  1P3L A;  4H9P A;  2DF4 C;  1PZR A;  1P3I A;  3AZN B;  3MGS B;  3W96 C;  5B1L B;  5AY8 C;  3WAA C;  4H9O A;  4NE5 A;  4WNN A;  3C1B C;  3W96 D;  5AY8 D;  3MGR C;  1P3B A;  1P3K A;  4UUZ B;  5BT1 C;  4H9R B;  1M19 B;  4G91 B;  3B6G A;  3B6F B;  5GSU A;  4J8W C;  1P3P C;  4J8W D;  2W8S A;  2HUE B;  5B2I C;  1P3P D;  1EQZ A;  2YFV B;  1KX4 C;  4JJN A;  4DRA A;  5BNX B;  4Z66 D;  2BYK A;  4NFT A;  2CV5 D;  5B24 B;  3W97 A;  4HGA B;  5GT0 B;  3AZG C;  4Z5T A;  3LEL A;  3LZ0 C;  3AZK B;  5B31 C;  4YM6 B;  3WA9 C;  5JRG A;  3O62 C;  5DNN A;  1F66 B;  5B31 D;  5CPK C;  1ULY A;  4R8P C;  3AV2 D;  1JFI A;  4UPK A;  5CPK D;  1P3G B;  4R8P D;  1N1J A;  2JE5 A;  3VH6 A;  2FJ7 B;  3X1U A;  3AZN D;  4H9Q B;  3MGS D;  3X1S C;  5B1L D;  3LZ1 B;  4EO5 C;  3X1T C;  3AZF C;  1R4V A;  5AVC A;  5B32 A;  3X1S D;  4G92 B;  3A6N C;  3TU4 C;  3NQJ B;  5GT3 B;  3A6N D;  5B0Y C;  1F1E A;  5GXQ C;  2J8P A;  1M19 D;  4KGC C;  4LD9 B;  3VH5 T;  1P3M A;  3B6F D;  4KGC D;  4QLC A;  3AYW A;  5CP6 B;  1P3O A;  5B1M B;  4NE6 A;  3MNN A;  5F99 A;  5B2J B;  3AZH A;  3WKJ C;  1KX5 B;  4WU8 C;  2PYO B;  5B24 D;  3WKJ D;  4AWL B;  4WU8 D;  3AZK C;  4YM6 C;  3UTB B;  3AFA B;  3AZK D;  4CAY A;  1HTA A;  4YM6 D;  2ZY4 A;  3NQU A;  1F66 D;  4KUD B;  3V9R A;  5CPI A;  3MGP A;  2F8N K;  2FJ7 C;  1P3G D;  3AV1 A;  1W2E A;  4J8X B;  2FJ7 D;  3AZL C;  2Y2L A;  5E5A B;  3LZ1 D;  1TZY C;  5DNM A;  3LJA C;  4KHA A;  1P34 A;  2NZD C;  2Y2G A;  3LJA D;  1U35 A;  5GT3 D;  3VH5 W;  3UT9 B;  2LY8 A;  4LD9 D;  3C1C A;  5CP6 C;  4DRB A;  4ZUX B;  2HIO A;  5AVB B;  5CP6 D;  1P3F A;  4ZBJ C;  1P3B C;  3REK B;  4WJ3 C;  5BO0 B;  3W96 B;  5AY8 B;  3KWQ A;  3UTA A;  4CSR B;  1HQ3 B;  5GSU C;  2ZY2 A;  3C1B B;  1KX5 D;  2PYO D;  3WAA B;  3MGR B;  2UWX A;  3AFA D;  3AZI A;  3EPL A;  5FUG A;  4KUD D;  3REH A;  4J8W B;  1M18 A;  5AV6 A;  4H9S A;  5B2I B;  5BS7 C;  3X1V C;  1KX4 B;  4J8X D;  3X1V D;  5JA4 B;  2Y2N A;  2YFV A;  3B0D C;  5E5A D;  3LEL C;  4WU9 C;  2F8N A;  1BH9 A;  5JRG C;  4WU9 D;  3UT9 C;  5DNN C;  1P3A B;  4J8V A;  3UT9 D;  5JRG D;  1WWI A;  3W98 C;  3AZG B;  1ZLA A;  3W98 D;  3LZ0 B;  3WA9 B;  5B31 B;  4ZUX D;  5AVB D;  3O62 B;  3AZJ C;  5GT0 A;  5G49 B;  3X1U C;  5CPK B;  3AZJ D;  4R8P B;  5AVC C;  3REK C;  2JCH A;  5B31 G;  3REK D;  5KDM B;  2YFW A;  2G5H C;  1HQ3 C;  3AN2 A;  3X1S B;  3REJ C;  4EO5 B;  3X1T B;  3AZF B;  1P3M C;  1HQ3 D;  5AV9 A;  3WAA D;  3C1B D;  4QLC C;  1KX3 B;  3A6N B;  3REJ D;  3TU4 B;  3AYW C;  3MGR D;  2ZM5 A;  5BT1 D;  5B0Y B;  3AYW D;  5GXQ B;  3KXB A;  3AZE A;  4KGC B;  3WTP C;  3MNN C;  5F99 C;  3R45 B;  3AZH C;  1B6W A;  4Z2M G;  3WTP D;  5B2I D;  1KX4 D;  2NQB A;  3MVD C;  3MVD D;  2F8N H;  5B1M A;  3WKJ B;  1B67 A;  1P3A C;  1M1A A;  5B2J A;  3KUY B;  3REI C;  4WU8 B;  1P3A D;  5CPI C;  3MGP C;  2XD1 A;  1S32 B;  3REI D;  3EPK A;  1AOI A;  3AZG D;  3LZ0 D;  3WA9 D;  2JSS A;  3O62 D;  3UTB A;  5B33 A;  3MGQ A;  3REL C;  5DNM C;  5AV8 C;  5CPJ B;  4E45 A;  3REL D;  1P34 C;  2ARO A;  5DNM D;  5AV8 D;  3AZM C;  3AZL B;  4YS3 A;  3AZM D;  1KX3 C;  1TZY B;  3X1T D;  3LJA B;  3AZF D;  2NZD B;  1KX3 D;  2HIO C;  3TU4 D;  1A7W A;  3W99 A;  1P3F C;  5B0Y D;  5GXQ D;  5B40 A;  1P3L B;  1ID3 C;  3EPH A;  4H9P B;  1ID3 D;  5B0Z A;  4DQY B;  2FFF B;  4ZBJ B;  3KWQ C;  4J8U C;  4H9O B;  4WNN B;  4XZQ A;  4X23 C;  4J8U D;  1P3B B;  4X23 D;  1P3K B;  3KUY C;  1S32 C;  3KUY D;  5GSU B;  3AZI C;  3REH C;  1S32 D;  1M18 C;  3W96 A;  5AY8 A;  5AV6 C;  4CSR A;  3EPJ A;  2BYM B;  3H0R C;  5AV5 C;  5CPJ C;  5AV5 D;  5CPJ D;  2BYK B;  4J8W A;  1P3P A;  3X1V B;  1BH8 A;  3AZL D;  3W97 B; 
#chains in the Genus database with same CATH homology
 1ZLA C;  2F2A C;  3B0D B;  4XUJ C;  4Z5T B;  1TZY D;  3LEL B;  4WU9 B;  2NZD D;  4XUJ D;  5JRG B;  4Z66 A;  5DNN B;  2Y2O A;  1TAF A;  2CV5 A;  3W98 B;  1Z2C B;  2Y2P A;  4M6B A;  1P3L C;  2XD5 A;  4E44 A;  1P3L D;  1P3I C;  1N1J B;  2Y2H A;  3AZJ B;  2RVQ C;  4H9N A;  3X1U B;  1P3I D;  3AN2 C;  5AVC B;  3AV2 A;  5AV9 C;  1P3K C;  5CPK A;  4R8P A;  2RIQ A;  1P3B D;  1P3K D;  3B6G C;  3KXB C;  3AZE C;  3H0L C;  3AZN A;  3REJ B;  3B6G D;  2VQR A;  3P5J B;  5GSU D;  3MGS A;  1P3M B;  5B1L A;  4QLC B;  3AYW B;  1EQZ C;  3X1S A;  5B32 G;  1EQZ D;  2Y2K A;  4UUZ A;  5BNV B;  4H9R A;  3A6N A;  4JJN C;  1M19 A;  3WTP B;  3MNN B;  5F99 B;  4JJN D;  2NQB C;  3B6F A;  3AZH B;  4KGC A;  1M1A C;  3W97 C;  3MVD B;  3W97 D;  4Z5T C;  1AOI C;  4Z5T D;  5BNX A;  3LEL D;  4CAY B;  3REI B;  3NQU B;  5DNN D;  3KFU G;  3V9R B;  5CPI B;  3MGP B;  3MGQ C;  3WKJ A;  5B24 A;  2ZY5 A;  4WU8 A;  3AV1 B;  2ARO C;  3AZK A;  4YM6 A;  3X1U D;  4YS3 C;  3FDD A;  1F66 A;  3REL B;  5B32 C;  4YS3 D;  5AV8 B;  5DNM B;  5AVC D;  1P34 B;  5B32 D;  1P3G A;  3AZM B;  3W99 C;  3EG5 B;  2FJ7 A;  3C1C B;  4H9Q A;  1P3M D;  1H3O B;  4QLC D;  2L5A A;  2HIO B;  3LZ1 A;  1P3O C;  5C3I C;  1P3F B;  3LJA A;  1P3O D;  3NQJ A;  5GT3 A;  4LD9 A;  3MNN D;  5F99 D;  4XZQ C;  1ID3 B;  3AZH D;  5CP6 A;  3KWQ B;  4J8U B;  3UTA B;  1BFM A;  2Y2J A;  4WZS B;  4X23 B;  2IO5 C;  1T3U A;  3AZI B;  5FUG B;  3REH B;  2CWE A;  3MGP D;  5CPI D;  1M18 B;  1KX5 A;  2PYO A;  3AV1 C;  5AV6 B;  3AFA A;  3AV1 D;  1WWS A;  5AV5 B;  4KUD A;  2F8N B;  2BYM A;  1U35 C;  1P34 D;  1BH9 B;  4Z66 C;  3A1I A;  1U35 D;  3C1C C;  4J8V B;  4J8X A;  2CV5 C;  5BS7 A;  3X1V A;  3C1C D;  4XUJ B;  1ZLA B;  5E5A A;  2F8N G;  2HIO D;  1P3F D;  4WU9 A;  3UT9 A;  3B0C T;  3AV2 C;  1P3I B;  3W98 A;  3AL0 C;  4ZUX A;  5AVB A;  2YFW B;  3UTA C;  3AN2 B;  3AZN C;  3KWQ D;  3AZJ A;  3MGS C;  3UTA D;  5AV9 B;  5B1L C;  3B6G B;  3H0M C;  3KXB B;  3REK A;  3AZE B;  3F6T A;  5BO0 A;  3AZI D;  4G91 C;  1M19 C;  2DQN C;  3REH D;  4H9S C;  4WV4 B;  1M18 D;  1HQ3 A;  3B6F C;  1EQZ B;  3C1B A;  3WAA A;  3REJ A;  5AV6 D;  3MGR A;  4JJN B;  2HUE C;  5CHL B;  2NQB B;  5BNV A;  2F8N D;  3WTP A;  1M1A B;  4J8V C;  5B2I A;  4J8V D;  1KX4 A;  5B24 C;  1AOI B;  1ZLA D;  5JA4 A;  2Y2M A;  4HGA C;  5GT0 C;  3MVD A;  5GT0 D;  1JFI B;  3B0C W;  5B33 B;  3MGQ B;  1F66 C;  1P3A A;  3REI A;  3AZG A;  2ARO B;  3LZ0 A;  1P3G C;  2RVQ D;  5B31 A;  3WA9 A;  3O62 A;  4YS3 B;  2Y2Q A;  5G49 A;  3AN2 D;  5B32 B;  5AV9 D;  3LZ1 C;  3REL A;  3W99 B;  4G92 C;  5AV8 A;  5GT3 C;  3KXB D;  3AZE D;  5KDM A;  3AZM A;  4LD9 C;  5B40 B;  3WTP E;  1P3O B;  3X1T A;  3AZF A;  5C3I B;  1KX3 A;  3TU4 A;  5B0Z B;  1H3O A;  5B0Y A;  5GXQ A;  4XZQ B;  2NQB D;  5B1M C;  3B0B A;  3R45 A;  3VH6 T;  5B2J C;  5B1M D;  1ID3 A;  1M1A D;  3KSY A;  5B2J D;  2IO5 B;  4NE3 A;  1KX5 C;  2PYO C;  1AOI D;  4J8U A;  4AWL C;  4X23 A;  3UTB C;  3AFA C;  5B33 C;  3UTB D;  5B33 D;  3KUY A;  3MGQ D;  2G5I C;  4KUD C;  3IP4 C;  1S32 A;  1Q9C A;  1P3P B;  2ARO D;  2BG1 A;  1BH8 B;  4J8X C;  4KHA B;  2ZY3 A;  5AV5 A;  1U35 B;  5E5A C;  4Z66 B;  5CPJ A;  3W99 D;  1TAF B;  2CV5 B;  3AZL A;  5B40 C;  1KU5 A;  5B40 D;  1TZY A;  3A1K A;  5B0Z C;  2NZD A;  4Z2M H;  4XUJ A;  4H9N B;  4ZUX C;  5AVB C;  3VH5 A;  5B0Z D;  3AV2 B;  3VH6 W;  2Y2I A;  4XZQ D;  1P3L A;  4H9P A;  2DF4 C;  1PZR A;  1P3I A;  3AZN B;  3MGS B;  3W96 C;  5B1L B;  5AY8 C;  3WAA C;  4H9O A;  4NE5 A;  4WNN A;  3C1B C;  3W96 D;  5AY8 D;  3MGR C;  1P3B A;  1P3K A;  4UUZ B;  5BT1 C;  4H9R B;  1M19 B;  4G91 B;  3B6G A;  3B6F B;  5GSU A;  4J8W C;  1P3P C;  4J8W D;  2W8S A;  2HUE B;  5B2I C;  1P3P D;  1EQZ A;  2YFV B;  1KX4 C;  4JJN A;  4DRA A;  5BNX B;  4Z66 D;  2BYK A;  4NFT A;  2CV5 D;  5B24 B;  3W97 A;  4HGA B;  5GT0 B;  3AZG C;  4Z5T A;  3LEL A;  3LZ0 C;  3AZK B;  5B31 C;  4YM6 B;  3WA9 C;  5JRG A;  3O62 C;  5DNN A;  1F66 B;  5B31 D;  5CPK C;  1ULY A;  4R8P C;  3AV2 D;  1JFI A;  4UPK A;  5CPK D;  1P3G B;  4R8P D;  1N1J A;  2JE5 A;  3VH6 A;  2FJ7 B;  3X1U A;  3AZN D;  4H9Q B;  3MGS D;  3X1S C;  5B1L D;  3LZ1 B;  4EO5 C;  3X1T C;  3AZF C;  1R4V A;  5AVC A;  5B32 A;  3X1S D;  4G92 B;  3A6N C;  3TU4 C;  3NQJ B;  5GT3 B;  3A6N D;  5B0Y C;  1F1E A;  5GXQ C;  2J8P A;  1M19 D;  4KGC C;  4LD9 B;  3VH5 T;  1P3M A;  3B6F D;  4KGC D;  4QLC A;  3AYW A;  5CP6 B;  1P3O A;  5B1M B;  4NE6 A;  3MNN A;  5F99 A;  5B2J B;  3AZH A;  3WKJ C;  1KX5 B;  4WU8 C;  2PYO B;  5B24 D;  3WKJ D;  4AWL B;  4WU8 D;  3AZK C;  4YM6 C;  3UTB B;  3AFA B;  3AZK D;  4CAY A;  1HTA A;  4YM6 D;  2ZY4 A;  3NQU A;  1F66 D;  4KUD B;  3V9R A;  5CPI A;  3MGP A;  2F8N K;  2FJ7 C;  1P3G D;  3AV1 A;  1W2E A;  4J8X B;  2FJ7 D;  3AZL C;  2Y2L A;  5E5A B;  3LZ1 D;  1TZY C;  5DNM A;  3LJA C;  4KHA A;  1P34 A;  2NZD C;  2Y2G A;  3LJA D;  1U35 A;  5GT3 D;  3VH5 W;  3UT9 B;  2LY8 A;  4LD9 D;  3C1C A;  5CP6 C;  4DRB A;  4ZUX B;  2HIO A;  5AVB B;  5CP6 D;  1P3F A;  4ZBJ C;  1P3B C;  3REK B;  4WJ3 C;  5BO0 B;  3W96 B;  5AY8 B;  3KWQ A;  3UTA A;  4CSR B;  1HQ3 B;  5GSU C;  2ZY2 A;  3C1B B;  1KX5 D;  2PYO D;  3WAA B;  3MGR B;  2UWX A;  3AFA D;  3AZI A;  3EPL A;  5FUG A;  4KUD D;  3REH A;  4J8W B;  1M18 A;  5AV6 A;  4H9S A;  5B2I B;  5BS7 C;  3X1V C;  1KX4 B;  4J8X D;  3X1V D;  5JA4 B;  2Y2N A;  2YFV A;  3B0D C;  5E5A D;  3LEL C;  4WU9 C;  2F8N A;  1BH9 A;  5JRG C;  4WU9 D;  3UT9 C;  5DNN C;  1P3A B;  4J8V A;  3UT9 D;  5JRG D;  1WWI A;  3W98 C;  3AZG B;  1ZLA A;  3W98 D;  3LZ0 B;  3WA9 B;  5B31 B;  4ZUX D;  5AVB D;  3O62 B;  3AZJ C;  5GT0 A;  5G49 B;  3X1U C;  5CPK B;  3AZJ D;  4R8P B;  5AVC C;  3REK C;  2JCH A;  5B31 G;  3REK D;  5KDM B;  2YFW A;  2G5H C;  1HQ3 C;  3AN2 A;  3X1S B;  3REJ C;  4EO5 B;  3X1T B;  3AZF B;  1P3M C;  1HQ3 D;  5AV9 A;  3WAA D;  3C1B D;  4QLC C;  1KX3 B;  3A6N B;  3REJ D;  3TU4 B;  3AYW C;  3MGR D;  2ZM5 A;  5BT1 D;  5B0Y B;  3AYW D;  5GXQ B;  3KXB A;  3AZE A;  4KGC B;  3WTP C;  3MNN C;  5F99 C;  3R45 B;  3AZH C;  1B6W A;  4Z2M G;  3WTP D;  5B2I D;  1KX4 D;  2NQB A;  3MVD C;  3MVD D;  2F8N H;  5B1M A;  3WKJ B;  1B67 A;  1P3A C;  1M1A A;  5B2J A;  3KUY B;  3REI C;  4WU8 B;  1P3A D;  5CPI C;  3MGP C;  2XD1 A;  1S32 B;  3REI D;  3EPK A;  1AOI A;  3AZG D;  3LZ0 D;  3WA9 D;  2JSS A;  3O62 D;  3UTB A;  5B33 A;  3MGQ A;  3REL C;  5DNM C;  5AV8 C;  5CPJ B;  4E45 A;  3REL D;  1P34 C;  2ARO A;  5DNM D;  5AV8 D;  3AZM C;  3AZL B;  4YS3 A;  3AZM D;  1KX3 C;  1TZY B;  3X1T D;  3LJA B;  3AZF D;  2NZD B;  1KX3 D;  2HIO C;  3TU4 D;  1A7W A;  3W99 A;  1P3F C;  5B0Y D;  5GXQ D;  5B40 A;  1P3L B;  1ID3 C;  3EPH A;  4H9P B;  1ID3 D;  5B0Z A;  4DQY B;  2FFF B;  4ZBJ B;  3KWQ C;  4J8U C;  4H9O B;  4WNN B;  4XZQ A;  4X23 C;  4J8U D;  1P3B B;  4X23 D;  1P3K B;  3KUY C;  1S32 C;  3KUY D;  5GSU B;  3AZI C;  3REH C;  1S32 D;  1M18 C;  3W96 A;  5AY8 A;  5AV6 C;  4CSR A;  3EPJ A;  2BYM B;  3H0R C;  5AV5 C;  5CPJ C;  5AV5 D;  5CPJ D;  2BYK B;  4J8W A;  1P3P A;  3X1V B;  1BH8 A;  3AZL D;  3W97 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...