5KDMA

Crystal structure of ebv tegument protein bnrf1 in complex with histone chaperone daxx and histones h3.3-h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structural basis underlying viral hijacking of a histone chaperone complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone / dna binding protein
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5kdmA00
1U35D 5CP6A 3W99C 3TU4B 3AZKB 1ZLAD 3AV1B 2RVQC 4LD9C 1ZLAA 3X1SD 3AZIA 5B24A 2BYKA 3B0DB 2F8NA 4XUJD 4DRAA 3X1SA 3KUYC 4JJND 3AZIC 4QLCA 5B24C 3REJA 3UTAB 3W98D 1WWSA 2IO5B 1P3FD 5AY8B 3UT9A 3B6GA 2CV5D 4XUJA 1B6WA 4H9NB 4G92C 3W98A 4QLCC 3MGSC 3REJC 2AROA 1P3FA 4J8UC 5CPKB 5AV5A 3NQUB 4J8XD 5GXQC 2AROC 5AV8D 2NZDA 1ID3C 3AZFD 4X23B 5AV5C 4J8XA 3MNND 5B0YB 3B6FB 2NZDC 4YS3D 1TZYB 5JRGA 3MVDD 4Z66D 5B33B 4WV4B 4J8WB 2L5AA 1KX5D 3RELC 4UUZB 4Z66A 2NQBA 1KU5A 5B2IA 1P3AB 1H3OB 5BT1C 3AYWB 3X1VB 5CPJA 2NQBC 5GT3D 5AVCD 3WKJC 1WWIA 1HQ3B 4ZUXA 4KHAA 1BH8A 4ZUXC 1JFIB 1KX4C 5B0ZD 3MGQB 1M19D 4J8VB 3TU4A 3AZKA 5B40B 5B1MC 3AV1A 5AV6D 3WA9D 3UTAD 2HIOD 3AV1C 1P3KB 5BS7A 4LD9B 3UTAA 3X1UC 4WU8B 1P3PD 5DNMB 3AFAB 3B0DC 5AY8A 4KUDD 5E5AB 3KUYB 5G49B 4H9NA 2YFVB 2CWEA 4KGCB 2IO5C 4YM6B 4WU9C 3C1CC 3REIC 5CPKA 4G92B 3MGSB 3NQUA 5CPIB 4J8UB 5CPKC 3AZMB 1TZYD 4H9PB 5F99D 4X23A 5B33D 4NE5A 5GXQB 3AZND 3MGRC 5B0YA 1F66B 3B6FA 1ID3B 1TZYA 5AV9C 1EQZB 5GSUD 3B0CT 5B33A 4X23C 4J8WA 4G91B 1M18C 3B6FC 4UUZA 5B32D 3W97C 4J8WC 1P3AA 1B67A 1H3OA 3A6NB 3AYWA 3X1VA 3RELB 3AZED 1M1AD 3AN2B 5B31G 3REHB 1P3AC 5AVBD 3AYWC 3LZ0D 1HQ3A 4CSRB 1P3LD 3WKJB 4WNNB 2PYOC 5B1LD 1HQ3C 1JFIA 3AV2D 2FJ7C 1F1EA 1AOID 3MGQA 3KSYA 5B2JC 3W99D 5B40A 4NE6A 1KX4B 3VH6A 5FUGB 3MGQC 1BFMA 5CP6D 2RVQD 3WAAC 4J8VC 5B40C 5JA4B 5B1MB 4WZSB 3AZGB 1P3KA 4LD9A 3AZID 5B24D 4WU8A 5DNMA 3AFAA 1P3KC 5E5AA 2F8ND 4XZQC 5G49A 3KUYA 2YFVA 4QLCD 3X1UB 3REJD 4WU8C 4KGCA 4YM6A 5DNMC 3AFAC 3KWQB 3UT9D 1P3GC 5E5AC 3B6GD 4Z5TC 3MGSA 2JSSA 5CPIA 2AROD 3LZ1C 4J8UA 4KGCC 4YM6C 3C1CB 3REIB 4WU9B 3AZMA 1ID3D 4H9PA 4ZBJC 1P3OC 5AV5D 1S32B 5GXQA 2HUEC 1P3IB 3C1BB 5CPIC 1F66A 2NZDD 1ID3A 3AZMC 1EQZA 3O62B 3MGRB 3AZHC 1F66C 3X1TC 3RELD 5AV9B 5JRGD 1EQZC 3WTPB 3B0CW 3LJAC 3A6NA 4G91C 5BT1D 1M18B 3RELA 2YFWB 3W97B 4HGAC 1P3BC 3VH5T 2NQBD 3AN2A 5B2ID 3REHA 3WKJD 3KXBB 3A6NC 4NE3A 5CPJD 4CSRA 3WKJA 4WNNA 3AN2C 3REHC 3UTBB 3VH6W 1KX5C 4ZUXD 1A7WA 4H9OB 2PYOB 3VH5A 1KX4A 2FJ7B 5BO0B 2LY8A 5B1MD 5FUGA 5B2JB 3LELB 3TU4D 3AZKD 1AOIC 5JA4A 5B1MA 3AZGA 3AV1D 3WAAB 1P34B 3AZGC 3REKB 3X1UA 1BH9B 3KWQA 5AY8D 4WU9D 2BYMB 4XZQB 5GT0B 4WU9A 3C1CA 3KWQC 3REIA 5CPKD 1P3GB 4Z5TB 1S32A 1P3IA 3LZ1B 3C1BA 5CHLB 4CAYB 1KX3B 4ZBJB 1P3OB 3O62A 4X23D 2HUEB 1S32C 3MGRA 1P3IC 3C1BC 5B0YD 5DNNB 3B6FD 3MGPB 3V9RB 5AV9A 1P3MB 4H9SA 3WTPA 5B0ZC 3O62C 4J8WD 3AZHB 1M18A 3X1TB 3W96B 2YFWA 3W97A 4H9SC 3WTPC 3LJAB 1P3AD 3KXBA 1U35B 3AYWD 3X1VD 4R8PC 4HGAB 4H9RB 1P3BB 3VH5W 5B32G 2PYOD 3KXBC 3UTBA 4H9QB 1HQ3D 5KDMB 4H9OA 2PYOA 1P3PC 3AZJC 3UTBC 1KX5B 4JJNB 2FJ7A 5BO0A 3MGQD 5B2JA 3LELA 2CV5B 4J8VD 5B40D 5BNXB 3LELC 4J8VA 3WAAA 1P34A 5F99C 4NFTA 3AZLC 3AZNC 4M6BA 5AV8B 1P3KD 4DRBA 3AZFB 3REKA 1P34C 5GSUC 4LD9D 3MNNB 1BH9A 4AWLC 4WU8D 5DNMD 3AFAD 4YS3B 2BYMA 5E5AD 4XZQA 3MVDB 4Z5TD 3KUYD 3REKC 5BNVB 3LZ1D 5GT0A 4KGCD 4YM6D 1P3GA 4Z5TA 5B31C 2F8NG 3MGSD 3LZ1A 5CPID 5GT0C 4J8UD 4CAYA 1KX3A 3B0BA 3AZMD 1P3OA 5GT3B 1P3LC 5AVCB 5GXQD 3AZHD 1F66D 5DNNA 3X1TD 3MGPA 3V9RA 1KX3C 1P3MA 1EQZD 1TAFB 3AZHA 3NQJB 3W96A 3X1TA 5DNNC 3MGPC 1P3MC 1P3BD 5B0ZB 3LJAA 3A6ND 1U35A 4Z2MG 1M19B 3W96C 5CP6C 4H9RA 1P3BA 3AN2D 3REHD 3R45B 5AV6B 3WA9B 1U35C 4H9QA 4R8PB 4EO5C 5KDMA 1ZLAC 2HIOB 4E44A 1KX5A 4JJNA 3X1SC 1P3PB 4KUDB 3AZJB 3UT9C 2CV5A 3B6GC 4XUJC 4JJNC 1KX4D 3W98C 5BNXA 1P3FC 2F8NH 2CV5C 5AV8A 3AZGD 3AZFA 5F99B 3MNNA 4J8XC 3AZLB 3AZNB 5AV8C 4YS3A 3MVDA 3AZFC 5JRGC 5GSUB 3MNNC 3X1UD 4AWLB 5BNVA 3KWQD 4YS3C 5B32B 4Z66C 3MVDC 4Z2MH 5B2IC 1R4VA 3C1CD 3REID 5B31B 5CPJC 1N1JB 4E45A 3AZEB 1M1AB 5GT3A 5AVCA 1S32D 5AVBB 1P3ID 3LZ0B 3C1BD 1P3LB 5GT3C 3O62D 1TAFA 5AVCC 5B1LB 3MGRD 3NQJA 5AV9D 3AV2B 3WTPD 5B0ZA 1AOIB 5C3IB 1Q9CA 1M19A 1M18D 3W99B 1HTAA 4R8PD 3TU4C 3AZKC 3W97D 3R45A 5AV6A 3KXBD 3WA9A 1M19C 5CP6B 1ULYA 4R8PA 2HIOA 5AV6C 3WA9C 3AZJD 3UTBD 4EO5B 5BS7C 3AZIB 1ZLAB 5B24B 2BYKB 3UTAC 2HIOC 1P3PA 4KUDA 3AZJA 5AY8C 2F8NB 3X1SB 4QLCB 3REJB 2F8NK 2FJ7D 4KUDC 3UT9B 5B2JD 3LELD 3B6GB 4XUJB 3W98B 2AROB 3AZLD 1P3FB 3WAAD 5F99A 1P34D 5AV5B 3AZNA 3AZLA 5B0YC 2NZDB 1TZYC 5GSUA 3REKD 4J8XB 5B33C 5JRGB 5B32A 5B31D 4XZQD 3X1VC 5GT0D 3VH6T 1P3GD 5B31A 4Z66B 1N1JA 5B32C 3AZEA 1M1AA 2NQBB 5B2IB 5AVBA 3LZ0A 5CPJB 1KX3D 3WTPE 3AZEC 1P3LA 1P3OD 1M1AC 5B1LA 5AVBC 3LZ0C 5DNND 4ZUXB 3MGPD 1P3MD 3AV2A 4KHAB 1AOIA 1BH8B 5B1LC 3W99A 3W96D 3AV2C 3LJAD 5C3IC
chains in the Genus database with same CATH superfamily
1U35D 5CP6A 3W99C 3TU4B 3AZKB 1ZLAD 3KFUG 3AV1B 2RVQC 4LD9C 1ZLAA 3X1SD 3AZIA 5B24A 2BYKA 3B0DB 2F8NA 4XUJD 4DRAA 3X1SA 3KUYC 4JJND 3AZIC 4QLCA 5B24C 3REJA 3UTAB 3W98D 1WWSA 2IO5B 1P3FD 5AY8B 3UT9A 3B6GA 2CV5D 4XUJA 1B6WA 4H9NB 2ZY3A 4G92C 3W98A 4QLCC 3MGSC 3REJC 2AROA 1P3FA 4J8UC 5CPKB 5AV5A 3NQUB 4J8XD 5GXQC 2AROC 5AV8D 1PZRA 2NZDA 1ID3C 3AZFD 2Y2MA 4X23B 5AV5C 4J8XA 3MNND 5B0YB 3B6FB 2NZDC 4YS3D 1TZYB 5JRGA 3MVDD 4Z66D 5B33B 4WV4B 4J8WB 2L5AA 1KX5D 2JCHA 3RELC 4UUZB 4Z66A 2G5IC 2NQBA 1KU5A 5B2IA 1P3AB 1H3OB 5BT1C 2UWXA 3AYWB 3X1VB 5CPJA 2NQBC 5GT3D 5AVCD 3WKJC 1WWIA 1HQ3B 4ZUXA 2Y2QA 4KHAA 1BH8A 4ZUXC 1JFIB 1KX4C 5B0ZD 3MGQB 1M19D 4J8VB 3TU4A 3AZKA 5B40B 5B1MC 3AV1A 5AV6D 3WA9D 2Y2OA 3UTAD 2HIOD 3AV1C 1P3KB 5BS7A 4LD9B 3UTAA 3X1UC 4WU8B 1P3PD 5DNMB 3AFAB 3B0DC 5AY8A 4KUDD 5E5AB 3KUYB 5G49B 4H9NA 2YFVB 2CWEA 4KGCB 2IO5C 4YM6B 4WU9C 3C1CC 3REIC 5CPKA 2VQRA 4G92B 3MGSB 3NQUA 5CPIB 4J8UB 5CPKC 3AZMB 1TZYD 4H9PB 2W8SA 5F99D 4X23A 5B33D 4NE5A 5GXQB 3AZND 3MGRC 5B0YA 1F66B 2ZY5A 3B6FA 2Y2JA 1TZYA 1ID3B 5AV9C 1EQZB 5GSUD 3B0CT 5B33A 4X23C 4J8WA 4G91B 1M18C 3B6FC 4UUZA 5B32D 3W97C 4J8WC 1P3AA 1B67A 1H3OA 3A6NB 3AYWA 3X1VA 3RELB 3AZED 1M1AD 3AN2B 5B31G 3REHB 1P3AC 5AVBD 3AYWC 3LZ0D 1HQ3A 4CSRB 1P3LD 3WKJB 4WNNB 2PYOC 5B1LD 1HQ3C 2Y2GA 1JFIA 3AV2D 2FJ7C 1F1EA 1AOID 3MGQA 3KSYA 5B2JC 3W99D 5B40A 4NE6A 1KX4B 3VH6A 5FUGB 3MGQC 1BFMA 5CP6D 2RVQD 3WAAC 4J8VC 5B40C 1Z2CB 5JA4B 5B1MB 4WZSB 3AZGB 1P3KA 4LD9A 2ZY2A 3AZID 5B24D 4WU8A 5DNMA 3AFAA 1P3KC 5E5AA 2F8ND 4XZQC 5G49A 3KUYA 2YFVA 4QLCD 3X1UB 2G5HC 3REJD 4WU8C 4KGCA 4YM6A 5DNMC 3AFAC 3KWQB 3UT9D 1P3GC 5E5AC 3B6GD 4Z5TC 3MGSA 2JSSA 5CPIA 2AROD 1W2EA 3LZ1C 4J8UA 4KGCC 4YM6C 3C1CB 3REIB 4WU9B 3AZMA 1ID3D 4H9PA 4ZBJC 1P3OC 5AV5D 1S32B 5GXQA 2HUEC 1P3IB 3C1BB 5CPIC 1F66A 2XD1A 2NZDD 1ID3A 3AZMC 1EQZA 3O62B 3MGRB 3AZHC 1F66C 3X1TC 3RELD 5AV9B 5JRGD 1EQZC 3WTPB 3B0CW 3LJAC 3A6NA 4G91C 5BT1D 1M18B 2F2AC 3RELA 2YFWB 3W97B 4HGAC 1P3BC 3VH5T 2NQBD 3AN2A 5B2ID 3REHA 3WKJD 3KXBB 3A6NC 4NE3A 5CPJD 4CSRA 3WKJA 4WNNA 3AN2C 3REHC 3UTBB 3VH6W 1KX5C 4ZUXD 1A7WA 4H9OB 2PYOB 3VH5A 1KX4A 2FJ7B 5BO0B 2LY8A 5B1MD 5FUGA 5B2JB 3LELB 3H0RC 3TU4D 3AZKD 1AOIC 5JA4A 5B1MA 3AZGA 3AV1D 3WAAB 1P34B 3AZGC 2ZM5A 3REKB 3X1UA 1BH9B 2Y2IA 3KWQA 5AY8D 4WU9D 2BYMB 4XZQB 5GT0B 4WU9A 3C1CA 3KWQC 3REIA 5CPKD 1P3GB 4Z5TB 1S32A 1P3IA 3LZ1B 3C1BA 5CHLB 4CAYB 1KX3B 3EPKA 4WJ3C 4ZBJB 1P3OB 3O62A 4X23D 2HUEB 1S32C 3MGRA 1P3IC 3C1BC 5B0YD 5DNNB 3B6FD 3MGPB 3V9RB 5AV9A 1P3MB 4H9SA 3WTPA 5B0ZC 3O62C 4J8WD 2JE5A 3AZHB 1M18A 3X1TB 3W96B 2YFWA 3W97A 4H9SC 3WTPC 3LJAB 1P3AD 3KXBA 1U35B 3AYWD 3X1VD 4R8PC 4HGAB 4H9RB 1P3BB 3VH5W 5B32G 2PYOD 3KXBC 3UTBA 4H9QB 1HQ3D 5KDMB 4H9OA 2PYOA 1P3PC 3AZJC 3UTBC 1KX5B 4JJNB 2Y2KA 2FJ7A 5BO0A 3MGQD 5B2JA 3LELA 2CV5B 4J8VD 5B40D 5BNXB 2DF4C 3LELC 4J8VA 3WAAA 1P34A 5F99C 4NFTA 3AZLC 3AZNC 4M6BA 5AV8B 1P3KD 4DRBA 3AZFB 3REKA 1P34C 5GSUC 4LD9D 3MNNB 1BH9A 4AWLC 4WU8D 5DNMD 3AFAD 4YS3B 2BYMA 5E5AD 4XZQA 3MVDB 4Z5TD 3KUYD 3REKC 5BNVB 3LZ1D 5GT0A 4KGCD 4YM6D 1P3GA 4UPKA 4Z5TA 5B31C 2F8NG 3MGSD 3LZ1A 5CPID 5GT0C 4J8UD 4CAYA 1KX3A 3B0BA 3AZMD 1P3OA 5GT3B 1P3LC 5AVCB 5GXQD 3AZHD 1F66D 4DQYB 5DNNA 3X1TD 3MGPA 3V9RA 1KX3C 1P3MA 1EQZD 1TAFB 3AZHA 3NQJB 3W96A 3X1TA 5DNNC 3MGPC 1P3MC 1P3BD 5B0ZB 3LJAA 3A6ND 1U35A 4Z2MG 1M19B 3W96C 5CP6C 4H9RA 1P3BA 3AN2D 3REHD 3R45B 5AV6B 3WA9B 1U35C 2XD5A 4H9QA 4R8PB 4EO5C 5KDMA 1ZLAC 2HIOB 2BG1A 4E44A 3AL0C 2DQNC 1KX5A 4JJNA 3X1SC 1P3PB 4KUDB 3AZJB 3UT9C 2CV5A 3B6GC 4XUJC 4JJNC 1KX4D 3W98C 2Y2PA 3A1IA 5BNXA 1P3FC 3FDDA 2F8NH 2CV5C 3F6TA 5AV8A 3AZGD 3AZFA 5F99B 2Y2NA 3MNNA 4J8XC 3AZLB 3AZNB 5AV8C 4YS3A 3MVDA 3AZFC 5JRGC 5GSUB 3MNNC 3X1UD 4AWLB 5BNVA 3KWQD 4YS3C 3EPLA 5B32B 3EG5B 4Z66C 3MVDC 2FFFB 4Z2MH 5B2IC 2RIQA 3EPJA 1R4VA 3C1CD 3REID 5B31B 5CPJC 1N1JB 4E45A 3AZEB 1M1AB 5GT3A 5AVCA 1S32D 2ZY4A 5AVBB 1P3ID 3LZ0B 3C1BD 1P3LB 3H0MC 5GT3C 3O62D 1TAFA 5AVCC 5B1LB 3MGRD 3NQJA 5AV9D 3AV2B 3WTPD 5B0ZA 1AOIB 5C3IB 1Q9CA 1M19A 1M18D 3W99B 1HTAA 4R8PD 3TU4C 3AZKC 3W97D 3IP4C 3H0LC 5AV6A 3R45A 3KXBD 3WA9A 1M19C 5CP6B 1ULYA 4R8PA 2HIOA 5AV6C 3WA9C 3AZJD 3UTBD 4EO5B 5BS7C 3AZIB 1ZLAB 5B24B 2BYKB 3UTAC 2HIOC 1P3PA 4KUDA 3AZJA 5AY8C 2F8NB 3X1SB 4QLCB 3REJB 2F8NK 2FJ7D 4KUDC 3UT9B 5B2JD 3LELD 3B6GB 4XUJB 3W98B 2AROB 3AZLD 1P3FB 3WAAD 5F99A 1P34D 5AV5B 3AZNA 3AZLA 5B0YC 2NZDB 1TZYC 2Y2HA 5GSUA 3A1KA 3REKD 4J8XB 5B33C 5JRGB 5B32A 5B31D 4XZQD 3X1VC 5GT0D 3VH6T 1P3GD 5B31A 4Z66B 1N1JA 5B32C 3AZEA 1M1AA 2NQBB 5B2IB 3EPHA 5AVBA 3LZ0A 2J8PA 5CPJB 1KX3D 2Y2LA 3WTPE 3AZEC 1P3LA 1P3OD 3P5JB 1M1AC 5B1LA 5AVBC 3LZ0C 5DNND 1T3UA 4ZUXB 3MGPD 1P3MD 3AV2A 4KHAB 1AOIA 1BH8B 5B1LC 3W99A 3W96D 3AV2C 3LJAD 5C3IC
chains in the Genus database with same CATH topology
1U35D 5CP6A 3W99C 3TU4B 3AZKB 1ZLAD 3KFUG 3AV1B 2RVQC 4LD9C 1ZLAA 3X1SD 3AZIA 5B24A 2BYKA 3B0DB 2F8NA 4XUJD 4DRAA 3X1SA 3KUYC 4JJND 3AZIC 4QLCA 5B24C 3REJA 3UTAB 3W98D 1WWSA 2IO5B 1P3FD 5AY8B 3UT9A 3B6GA 2CV5D 4XUJA 1B6WA 4H9NB 2ZY3A 4G92C 3W98A 4QLCC 3MGSC 3REJC 2AROA 1P3FA 4J8UC 5CPKB 5AV5A 3NQUB 4J8XD 5GXQC 2AROC 5AV8D 1PZRA 2NZDA 1ID3C 3AZFD 2Y2MA 4X23B 5AV5C 4J8XA 3MNND 5B0YB 3B6FB 2NZDC 4YS3D 1TZYB 5JRGA 3MVDD 4Z66D 5B33B 4WV4B 4J8WB 2L5AA 1KX5D 2JCHA 3RELC 4UUZB 4Z66A 2G5IC 2NQBA 1KU5A 5B2IA 1P3AB 1H3OB 5BT1C 2UWXA 3AYWB 3X1VB 5CPJA 2NQBC 5GT3D 5AVCD 3WKJC 1WWIA 1HQ3B 4ZUXA 2Y2QA 4KHAA 1BH8A 4ZUXC 1JFIB 1KX4C 5B0ZD 3MGQB 1M19D 4J8VB 3TU4A 3AZKA 5B40B 5B1MC 3AV1A 5AV6D 3WA9D 2Y2OA 3UTAD 2HIOD 3AV1C 1P3KB 5BS7A 4LD9B 3UTAA 3X1UC 4WU8B 1P3PD 5DNMB 3AFAB 3B0DC 5AY8A 4KUDD 5E5AB 3KUYB 5G49B 4H9NA 2YFVB 2CWEA 4KGCB 2IO5C 4YM6B 4WU9C 3C1CC 3REIC 5CPKA 2VQRA 4G92B 3MGSB 3NQUA 5CPIB 4J8UB 5CPKC 3AZMB 1TZYD 4H9PB 2W8SA 5F99D 4X23A 5B33D 4NE5A 5GXQB 3AZND 3MGRC 5B0YA 1F66B 2ZY5A 3B6FA 2Y2JA 1TZYA 1ID3B 5AV9C 1EQZB 5GSUD 3B0CT 5B33A 4X23C 4J8WA 4G91B 1M18C 3B6FC 4UUZA 5B32D 3W97C 4J8WC 1P3AA 1B67A 1H3OA 3A6NB 3AYWA 3X1VA 3RELB 3AZED 1M1AD 3AN2B 5B31G 3REHB 1P3AC 5AVBD 3AYWC 3LZ0D 1HQ3A 4CSRB 1P3LD 3WKJB 4WNNB 2PYOC 5B1LD 1HQ3C 2Y2GA 1JFIA 3AV2D 2FJ7C 1F1EA 1AOID 3MGQA 3KSYA 5B2JC 3W99D 5B40A 4NE6A 1KX4B 3VH6A 5FUGB 3MGQC 1BFMA 5CP6D 2RVQD 3WAAC 4J8VC 5B40C 1Z2CB 5JA4B 5B1MB 4WZSB 3AZGB 1P3KA 4LD9A 2ZY2A 3AZID 5B24D 4WU8A 5DNMA 3AFAA 1P3KC 5E5AA 2F8ND 4XZQC 5G49A 3KUYA 2YFVA 4QLCD 3X1UB 2G5HC 3REJD 4WU8C 4KGCA 4YM6A 5DNMC 3AFAC 3KWQB 3UT9D 1P3GC 5E5AC 3B6GD 4Z5TC 3MGSA 2JSSA 5CPIA 2AROD 1W2EA 3LZ1C 4J8UA 4KGCC 4YM6C 3C1CB 3REIB 4WU9B 3AZMA 1ID3D 4H9PA 4ZBJC 1P3OC 5AV5D 1S32B 5GXQA 2HUEC 1P3IB 3C1BB 5CPIC 1F66A 2XD1A 2NZDD 1ID3A 3AZMC 1EQZA 3O62B 3MGRB 3AZHC 1F66C 3X1TC 3RELD 5AV9B 5JRGD 1EQZC 3WTPB 3B0CW 3LJAC 3A6NA 4G91C 5BT1D 1M18B 2F2AC 3RELA 2YFWB 3W97B 4HGAC 1P3BC 3VH5T 2NQBD 3AN2A 5B2ID 3REHA 3WKJD 3KXBB 3A6NC 4NE3A 5CPJD 4CSRA 3WKJA 4WNNA 3AN2C 3REHC 3UTBB 3VH6W 1KX5C 4ZUXD 1A7WA 4H9OB 2PYOB 3VH5A 1KX4A 2FJ7B 5BO0B 2LY8A 5B1MD 5FUGA 5B2JB 3LELB 3H0RC 3TU4D 3AZKD 1AOIC 5JA4A 5B1MA 3AZGA 3AV1D 3WAAB 1P34B 3AZGC 2ZM5A 3REKB 3X1UA 1BH9B 2Y2IA 3KWQA 5AY8D 4WU9D 2BYMB 4XZQB 5GT0B 4WU9A 3C1CA 3KWQC 3REIA 5CPKD 1P3GB 4Z5TB 1S32A 1P3IA 3LZ1B 3C1BA 5CHLB 4CAYB 1KX3B 3EPKA 4WJ3C 4ZBJB 1P3OB 3O62A 4X23D 2HUEB 1S32C 3MGRA 1P3IC 3C1BC 5B0YD 5DNNB 3B6FD 3MGPB 3V9RB 5AV9A 1P3MB 4H9SA 3WTPA 5B0ZC 3O62C 4J8WD 2JE5A 3AZHB 1M18A 3X1TB 3W96B 2YFWA 3W97A 4H9SC 3WTPC 3LJAB 1P3AD 3KXBA 1U35B 3AYWD 3X1VD 4R8PC 4HGAB 4H9RB 1P3BB 3VH5W 5B32G 2PYOD 3KXBC 3UTBA 4H9QB 1HQ3D 5KDMB 4H9OA 2PYOA 1P3PC 3AZJC 3UTBC 1KX5B 4JJNB 2Y2KA 2FJ7A 5BO0A 3MGQD 5B2JA 3LELA 2CV5B 4J8VD 5B40D 5BNXB 2DF4C 3LELC 4J8VA 3WAAA 1P34A 5F99C 4NFTA 3AZLC 3AZNC 4M6BA 5AV8B 1P3KD 4DRBA 3AZFB 3REKA 1P34C 5GSUC 4LD9D 3MNNB 1BH9A 4AWLC 4WU8D 5DNMD 3AFAD 4YS3B 2BYMA 5E5AD 4XZQA 3MVDB 4Z5TD 3KUYD 3REKC 5BNVB 3LZ1D 5GT0A 4KGCD 4YM6D 1P3GA 4UPKA 4Z5TA 5B31C 2F8NG 3MGSD 3LZ1A 5CPID 5GT0C 4J8UD 4CAYA 1KX3A 3B0BA 3AZMD 1P3OA 5GT3B 1P3LC 5AVCB 5GXQD 3AZHD 1F66D 4DQYB 5DNNA 3X1TD 3MGPA 3V9RA 1KX3C 1P3MA 1EQZD 1TAFB 3AZHA 3NQJB 3W96A 3X1TA 5DNNC 3MGPC 1P3MC 1P3BD 5B0ZB 3LJAA 3A6ND 1U35A 4Z2MG 1M19B 3W96C 5CP6C 4H9RA 1P3BA 3AN2D 3REHD 3R45B 5AV6B 3WA9B 1U35C 2XD5A 4H9QA 4R8PB 4EO5C 5KDMA 1ZLAC 2HIOB 2BG1A 4E44A 3AL0C 2DQNC 1KX5A 4JJNA 3X1SC 1P3PB 4KUDB 3AZJB 3UT9C 2CV5A 3B6GC 4XUJC 4JJNC 1KX4D 3W98C 2Y2PA 3A1IA 5BNXA 1P3FC 3FDDA 2F8NH 2CV5C 3F6TA 5AV8A 3AZGD 3AZFA 5F99B 2Y2NA 3MNNA 4J8XC 3AZLB 3AZNB 5AV8C 4YS3A 3MVDA 3AZFC 5JRGC 5GSUB 3MNNC 3X1UD 4AWLB 5BNVA 3KWQD 4YS3C 3EPLA 5B32B 3EG5B 4Z66C 3MVDC 2FFFB 4Z2MH 5B2IC 2RIQA 3EPJA 1R4VA 3C1CD 3REID 5B31B 5CPJC 1N1JB 4E45A 3AZEB 1M1AB 5GT3A 5AVCA 1S32D 2ZY4A 5AVBB 1P3ID 3LZ0B 3C1BD 1P3LB 3H0MC 5GT3C 3O62D 1TAFA 5AVCC 5B1LB 3MGRD 3NQJA 5AV9D 3AV2B 3WTPD 5B0ZA 1AOIB 5C3IB 1Q9CA 1M19A 1M18D 3W99B 1HTAA 4R8PD 3TU4C 3AZKC 3W97D 3IP4C 3H0LC 5AV6A 3R45A 3KXBD 3WA9A 1M19C 5CP6B 1ULYA 4R8PA 2HIOA 5AV6C 3WA9C 3AZJD 3UTBD 4EO5B 5BS7C 3AZIB 1ZLAB 5B24B 2BYKB 3UTAC 2HIOC 1P3PA 4KUDA 3AZJA 5AY8C 2F8NB 3X1SB 4QLCB 3REJB 2F8NK 2FJ7D 4KUDC 3UT9B 5B2JD 3LELD 3B6GB 4XUJB 3W98B 2AROB 3AZLD 1P3FB 3WAAD 5F99A 1P34D 5AV5B 3AZNA 3AZLA 5B0YC 2NZDB 1TZYC 2Y2HA 5GSUA 3A1KA 3REKD 4J8XB 5B33C 5JRGB 5B32A 5B31D 4XZQD 3X1VC 5GT0D 3VH6T 1P3GD 5B31A 4Z66B 1N1JA 5B32C 3AZEA 1M1AA 2NQBB 5B2IB 3EPHA 5AVBA 3LZ0A 2J8PA 5CPJB 1KX3D 2Y2LA 3WTPE 3AZEC 1P3LA 1P3OD 3P5JB 1M1AC 5B1LA 5AVBC 3LZ0C 5DNND 1T3UA 4ZUXB 3MGPD 1P3MD 3AV2A 4KHAB 1AOIA 1BH8B 5B1LC 3W99A 3W96D 3AV2C 3LJAD 5C3IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U35 D;  5CP6 A;  3W99 C;  3TU4 B;  3AZK B;  1ZLA D;  3AV1 B;  2RVQ C;  4LD9 C;  1ZLA A;  3X1S D;  3AZI A;  5B24 A;  2BYK A;  3B0D B;  2F8N A;  4XUJ D;  4DRA A;  3X1S A;  3KUY C;  4JJN D;  3AZI C;  4QLC A;  5B24 C;  3REJ A;  3UTA B;  3W98 D;  1WWS A;  2IO5 B;  1P3F D;  5AY8 B;  3UT9 A;  3B6G A;  2CV5 D;  4XUJ A;  1B6W A;  4H9N B;  4G92 C;  3W98 A;  4QLC C;  3MGS C;  3REJ C;  2ARO A;  1P3F A;  4J8U C;  5CPK B;  5AV5 A;  3NQU B;  4J8X D;  5GXQ C;  2ARO C;  5AV8 D;  2NZD A;  1ID3 C;  3AZF D;  4X23 B;  5AV5 C;  4J8X A;  3MNN D;  5B0Y B;  3B6F B;  2NZD C;  4YS3 D;  1TZY B;  5JRG A;  3MVD D;  4Z66 D;  5B33 B;  4WV4 B;  4J8W B;  2L5A A;  1KX5 D;  3REL C;  4UUZ B;  4Z66 A;  2NQB A;  1KU5 A;  5B2I A;  1P3A B;  1H3O B;  5BT1 C;  3AYW B;  3X1V B;  5CPJ A;  2NQB C;  5GT3 D;  5AVC D;  3WKJ C;  1WWI A;  1HQ3 B;  4ZUX A;  4KHA A;  1BH8 A;  4ZUX C;  1JFI B;  1KX4 C;  5B0Z D;  3MGQ B;  1M19 D;  4J8V B;  3TU4 A;  3AZK A;  5B40 B;  5B1M C;  3AV1 A;  5AV6 D;  3WA9 D;  3UTA D;  2HIO D;  3AV1 C;  1P3K B;  5BS7 A;  4LD9 B;  3UTA A;  3X1U C;  4WU8 B;  1P3P D;  5DNM B;  3AFA B;  3B0D C;  5AY8 A;  4KUD D;  5E5A B;  3KUY B;  5G49 B;  4H9N A;  2YFV B;  2CWE A;  4KGC B;  2IO5 C;  4YM6 B;  4WU9 C;  3C1C C;  3REI C;  5CPK A;  4G92 B;  3MGS B;  3NQU A;  5CPI B;  4J8U B;  5CPK C;  3AZM B;  1TZY D;  4H9P B;  5F99 D;  4X23 A;  5B33 D;  4NE5 A;  5GXQ B;  3AZN D;  3MGR C;  5B0Y A;  1F66 B;  3B6F A;  1ID3 B;  1TZY A;  5AV9 C;  1EQZ B;  5GSU D;  3B0C T;  5B33 A;  4X23 C;  4J8W A;  4G91 B;  1M18 C;  3B6F C;  4UUZ A;  5B32 D;  3W97 C;  4J8W C;  1P3A A;  1B67 A;  1H3O A;  3A6N B;  3AYW A;  3X1V A;  3REL B;  3AZE D;  1M1A D;  3AN2 B;  5B31 G;  3REH B;  1P3A C;  5AVB D;  3AYW C;  3LZ0 D;  1HQ3 A;  4CSR B;  1P3L D;  3WKJ B;  4WNN B;  2PYO C;  5B1L D;  1HQ3 C;  1JFI A;  3AV2 D;  2FJ7 C;  1F1E A;  1AOI D;  3MGQ A;  3KSY A;  5B2J C;  3W99 D;  5B40 A;  4NE6 A;  1KX4 B;  3VH6 A;  5FUG B;  3MGQ C;  1BFM A;  5CP6 D;  2RVQ D;  3WAA C;  4J8V C;  5B40 C;  5JA4 B;  5B1M B;  4WZS B;  3AZG B;  1P3K A;  4LD9 A;  3AZI D;  5B24 D;  4WU8 A;  5DNM A;  3AFA A;  1P3K C;  5E5A A;  2F8N D;  4XZQ C;  5G49 A;  3KUY A;  2YFV A;  4QLC D;  3X1U B;  3REJ D;  4WU8 C;  4KGC A;  4YM6 A;  5DNM C;  3AFA C;  3KWQ B;  3UT9 D;  1P3G C;  5E5A C;  3B6G D;  4Z5T C;  3MGS A;  2JSS A;  5CPI A;  2ARO D;  3LZ1 C;  4J8U A;  4KGC C;  4YM6 C;  3C1C B;  3REI B;  4WU9 B;  3AZM A;  1ID3 D;  4H9P A;  4ZBJ C;  1P3O C;  5AV5 D;  1S32 B;  5GXQ A;  2HUE C;  1P3I B;  3C1B B;  5CPI C;  1F66 A;  2NZD D;  1ID3 A;  3AZM C;  1EQZ A;  3O62 B;  3MGR B;  3AZH C;  1F66 C;  3X1T C;  3REL D;  5AV9 B;  5JRG D;  1EQZ C;  3WTP B;  3B0C W;  3LJA C;  3A6N A;  4G91 C;  5BT1 D;  1M18 B;  3REL A;  2YFW B;  3W97 B;  4HGA C;  1P3B C;  3VH5 T;  2NQB D;  3AN2 A;  5B2I D;  3REH A;  3WKJ D;  3KXB B;  3A6N C;  4NE3 A;  5CPJ D;  4CSR A;  3WKJ A;  4WNN A;  3AN2 C;  3REH C;  3UTB B;  3VH6 W;  1KX5 C;  4ZUX D;  1A7W A;  4H9O B;  2PYO B;  3VH5 A;  1KX4 A;  2FJ7 B;  5BO0 B;  2LY8 A;  5B1M D;  5FUG A;  5B2J B;  3LEL B;  3TU4 D;  3AZK D;  1AOI C;  5JA4 A;  5B1M A;  3AZG A;  3AV1 D;  3WAA B;  1P34 B;  3AZG C;  3REK B;  3X1U A;  1BH9 B;  3KWQ A;  5AY8 D;  4WU9 D;  2BYM B;  4XZQ B;  5GT0 B;  4WU9 A;  3C1C A;  3KWQ C;  3REI A;  5CPK D;  1P3G B;  4Z5T B;  1S32 A;  1P3I A;  3LZ1 B;  3C1B A;  5CHL B;  4CAY B;  1KX3 B;  4ZBJ B;  1P3O B;  3O62 A;  4X23 D;  2HUE B;  1S32 C;  3MGR A;  1P3I C;  3C1B C;  5B0Y D;  5DNN B;  3B6F D;  3MGP B;  3V9R B;  5AV9 A;  1P3M B;  4H9S A;  3WTP A;  5B0Z C;  3O62 C;  4J8W D;  3AZH B;  1M18 A;  3X1T B;  3W96 B;  2YFW A;  3W97 A;  4H9S C;  3WTP C;  3LJA B;  1P3A D;  3KXB A;  1U35 B;  3AYW D;  3X1V D;  4R8P C;  4HGA B;  4H9R B;  1P3B B;  3VH5 W;  5B32 G;  2PYO D;  3KXB C;  3UTB A;  4H9Q B;  1HQ3 D;  5KDM B;  4H9O A;  2PYO A;  1P3P C;  3AZJ C;  3UTB C;  1KX5 B;  4JJN B;  2FJ7 A;  5BO0 A;  3MGQ D;  5B2J A;  3LEL A;  2CV5 B;  4J8V D;  5B40 D;  5BNX B;  3LEL C;  4J8V A;  3WAA A;  1P34 A;  5F99 C;  4NFT A;  3AZL C;  3AZN C;  4M6B A;  5AV8 B;  1P3K D;  4DRB A;  3AZF B;  3REK A;  1P34 C;  5GSU C;  4LD9 D;  3MNN B;  1BH9 A;  4AWL C;  4WU8 D;  5DNM D;  3AFA D;  4YS3 B;  2BYM A;  5E5A D;  4XZQ A;  3MVD B;  4Z5T D;  3KUY D;  3REK C;  5BNV B;  3LZ1 D;  5GT0 A;  4KGC D;  4YM6 D;  1P3G A;  4Z5T A;  5B31 C;  2F8N G;  3MGS D;  3LZ1 A;  5CPI D;  5GT0 C;  4J8U D;  4CAY A;  1KX3 A;  3B0B A;  3AZM D;  1P3O A;  5GT3 B;  1P3L C;  5AVC B;  5GXQ D;  3AZH D;  1F66 D;  5DNN A;  3X1T D;  3MGP A;  3V9R A;  1KX3 C;  1P3M A;  1EQZ D;  1TAF B;  3AZH A;  3NQJ B;  3W96 A;  3X1T A;  5DNN C;  3MGP C;  1P3M C;  1P3B D;  5B0Z B;  3LJA A;  3A6N D;  1U35 A;  4Z2M G;  1M19 B;  3W96 C;  5CP6 C;  4H9R A;  1P3B A;  3AN2 D;  3REH D;  3R45 B;  5AV6 B;  3WA9 B;  1U35 C;  4H9Q A;  4R8P B;  4EO5 C;  5KDM A;  1ZLA C;  2HIO B;  4E44 A;  1KX5 A;  4JJN A;  3X1S C;  1P3P B;  4KUD B;  3AZJ B;  3UT9 C;  2CV5 A;  3B6G C;  4XUJ C;  4JJN C;  1KX4 D;  3W98 C;  5BNX A;  1P3F C;  2F8N H;  2CV5 C;  5AV8 A;  3AZG D;  3AZF A;  5F99 B;  3MNN A;  4J8X C;  3AZL B;  3AZN B;  5AV8 C;  4YS3 A;  3MVD A;  3AZF C;  5JRG C;  5GSU B;  3MNN C;  3X1U D;  4AWL B;  5BNV A;  3KWQ D;  4YS3 C;  5B32 B;  4Z66 C;  3MVD C;  4Z2M H;  5B2I C;  1R4V A;  3C1C D;  3REI D;  5B31 B;  5CPJ C;  1N1J B;  4E45 A;  3AZE B;  1M1A B;  5GT3 A;  5AVC A;  1S32 D;  5AVB B;  1P3I D;  3LZ0 B;  3C1B D;  1P3L B;  5GT3 C;  3O62 D;  1TAF A;  5AVC C;  5B1L B;  3MGR D;  3NQJ A;  5AV9 D;  3AV2 B;  3WTP D;  5B0Z A;  1AOI B;  5C3I B;  1Q9C A;  1M19 A;  1M18 D;  3W99 B;  1HTA A;  4R8P D;  3TU4 C;  3AZK C;  3W97 D;  3R45 A;  5AV6 A;  3KXB D;  3WA9 A;  1M19 C;  5CP6 B;  1ULY A;  4R8P A;  2HIO A;  5AV6 C;  3WA9 C;  3AZJ D;  3UTB D;  4EO5 B;  5BS7 C;  3AZI B;  1ZLA B;  5B24 B;  2BYK B;  3UTA C;  2HIO C;  1P3P A;  4KUD A;  3AZJ A;  5AY8 C;  2F8N B;  3X1S B;  4QLC B;  3REJ B;  2F8N K;  2FJ7 D;  4KUD C;  3UT9 B;  5B2J D;  3LEL D;  3B6G B;  4XUJ B;  3W98 B;  2ARO B;  3AZL D;  1P3F B;  3WAA D;  5F99 A;  1P34 D;  5AV5 B;  3AZN A;  3AZL A;  5B0Y C;  2NZD B;  1TZY C;  5GSU A;  3REK D;  4J8X B;  5B33 C;  5JRG B;  5B32 A;  5B31 D;  4XZQ D;  3X1V C;  5GT0 D;  3VH6 T;  1P3G D;  5B31 A;  4Z66 B;  1N1J A;  5B32 C;  3AZE A;  1M1A A;  2NQB B;  5B2I B;  5AVB A;  3LZ0 A;  5CPJ B;  1KX3 D;  3WTP E;  3AZE C;  1P3L A;  1P3O D;  1M1A C;  5B1L A;  5AVB C;  3LZ0 C;  5DNN D;  4ZUX B;  3MGP D;  1P3M D;  3AV2 A;  4KHA B;  1AOI A;  1BH8 B;  5B1L C;  3W99 A;  3W96 D;  3AV2 C;  3LJA D;  5C3I C; 
#chains in the Genus database with same CATH topology
 1U35 D;  5CP6 A;  3W99 C;  3TU4 B;  3AZK B;  1ZLA D;  3KFU G;  3AV1 B;  2RVQ C;  4LD9 C;  1ZLA A;  3X1S D;  3AZI A;  5B24 A;  2BYK A;  3B0D B;  2F8N A;  4XUJ D;  4DRA A;  3X1S A;  3KUY C;  4JJN D;  3AZI C;  4QLC A;  5B24 C;  3REJ A;  3UTA B;  3W98 D;  1WWS A;  2IO5 B;  1P3F D;  5AY8 B;  3UT9 A;  3B6G A;  2CV5 D;  4XUJ A;  1B6W A;  4H9N B;  2ZY3 A;  4G92 C;  3W98 A;  4QLC C;  3MGS C;  3REJ C;  2ARO A;  1P3F A;  4J8U C;  5CPK B;  5AV5 A;  3NQU B;  4J8X D;  5GXQ C;  2ARO C;  5AV8 D;  1PZR A;  2NZD A;  1ID3 C;  3AZF D;  2Y2M A;  4X23 B;  5AV5 C;  4J8X A;  3MNN D;  5B0Y B;  3B6F B;  2NZD C;  4YS3 D;  1TZY B;  5JRG A;  3MVD D;  4Z66 D;  5B33 B;  4WV4 B;  4J8W B;  2L5A A;  1KX5 D;  2JCH A;  3REL C;  4UUZ B;  4Z66 A;  2G5I C;  2NQB A;  1KU5 A;  5B2I A;  1P3A B;  1H3O B;  5BT1 C;  2UWX A;  3AYW B;  3X1V B;  5CPJ A;  2NQB C;  5GT3 D;  5AVC D;  3WKJ C;  1WWI A;  1HQ3 B;  4ZUX A;  2Y2Q A;  4KHA A;  1BH8 A;  4ZUX C;  1JFI B;  1KX4 C;  5B0Z D;  3MGQ B;  1M19 D;  4J8V B;  3TU4 A;  3AZK A;  5B40 B;  5B1M C;  3AV1 A;  5AV6 D;  3WA9 D;  2Y2O A;  3UTA D;  2HIO D;  3AV1 C;  1P3K B;  5BS7 A;  4LD9 B;  3UTA A;  3X1U C;  4WU8 B;  1P3P D;  5DNM B;  3AFA B;  3B0D C;  5AY8 A;  4KUD D;  5E5A B;  3KUY B;  5G49 B;  4H9N A;  2YFV B;  2CWE A;  4KGC B;  2IO5 C;  4YM6 B;  4WU9 C;  3C1C C;  3REI C;  5CPK A;  2VQR A;  4G92 B;  3MGS B;  3NQU A;  5CPI B;  4J8U B;  5CPK C;  3AZM B;  1TZY D;  4H9P B;  2W8S A;  5F99 D;  4X23 A;  5B33 D;  4NE5 A;  5GXQ B;  3AZN D;  3MGR C;  5B0Y A;  1F66 B;  2ZY5 A;  3B6F A;  2Y2J A;  1TZY A;  1ID3 B;  5AV9 C;  1EQZ B;  5GSU D;  3B0C T;  5B33 A;  4X23 C;  4J8W A;  4G91 B;  1M18 C;  3B6F C;  4UUZ A;  5B32 D;  3W97 C;  4J8W C;  1P3A A;  1B67 A;  1H3O A;  3A6N B;  3AYW A;  3X1V A;  3REL B;  3AZE D;  1M1A D;  3AN2 B;  5B31 G;  3REH B;  1P3A C;  5AVB D;  3AYW C;  3LZ0 D;  1HQ3 A;  4CSR B;  1P3L D;  3WKJ B;  4WNN B;  2PYO C;  5B1L D;  1HQ3 C;  2Y2G A;  1JFI A;  3AV2 D;  2FJ7 C;  1F1E A;  1AOI D;  3MGQ A;  3KSY A;  5B2J C;  3W99 D;  5B40 A;  4NE6 A;  1KX4 B;  3VH6 A;  5FUG B;  3MGQ C;  1BFM A;  5CP6 D;  2RVQ D;  3WAA C;  4J8V C;  5B40 C;  1Z2C B;  5JA4 B;  5B1M B;  4WZS B;  3AZG B;  1P3K A;  4LD9 A;  2ZY2 A;  3AZI D;  5B24 D;  4WU8 A;  5DNM A;  3AFA A;  1P3K C;  5E5A A;  2F8N D;  4XZQ C;  5G49 A;  3KUY A;  2YFV A;  4QLC D;  3X1U B;  2G5H C;  3REJ D;  4WU8 C;  4KGC A;  4YM6 A;  5DNM C;  3AFA C;  3KWQ B;  3UT9 D;  1P3G C;  5E5A C;  3B6G D;  4Z5T C;  3MGS A;  2JSS A;  5CPI A;  2ARO D;  1W2E A;  3LZ1 C;  4J8U A;  4KGC C;  4YM6 C;  3C1C B;  3REI B;  4WU9 B;  3AZM A;  1ID3 D;  4H9P A;  4ZBJ C;  1P3O C;  5AV5 D;  1S32 B;  5GXQ A;  2HUE C;  1P3I B;  3C1B B;  5CPI C;  1F66 A;  2XD1 A;  2NZD D;  1ID3 A;  3AZM C;  1EQZ A;  3O62 B;  3MGR B;  3AZH C;  1F66 C;  3X1T C;  3REL D;  5AV9 B;  5JRG D;  1EQZ C;  3WTP B;  3B0C W;  3LJA C;  3A6N A;  4G91 C;  5BT1 D;  1M18 B;  2F2A C;  3REL A;  2YFW B;  3W97 B;  4HGA C;  1P3B C;  3VH5 T;  2NQB D;  3AN2 A;  5B2I D;  3REH A;  3WKJ D;  3KXB B;  3A6N C;  4NE3 A;  5CPJ D;  4CSR A;  3WKJ A;  4WNN A;  3AN2 C;  3REH C;  3UTB B;  3VH6 W;  1KX5 C;  4ZUX D;  1A7W A;  4H9O B;  2PYO B;  3VH5 A;  1KX4 A;  2FJ7 B;  5BO0 B;  2LY8 A;  5B1M D;  5FUG A;  5B2J B;  3LEL B;  3H0R C;  3TU4 D;  3AZK D;  1AOI C;  5JA4 A;  5B1M A;  3AZG A;  3AV1 D;  3WAA B;  1P34 B;  3AZG C;  2ZM5 A;  3REK B;  3X1U A;  1BH9 B;  2Y2I A;  3KWQ A;  5AY8 D;  4WU9 D;  2BYM B;  4XZQ B;  5GT0 B;  4WU9 A;  3C1C A;  3KWQ C;  3REI A;  5CPK D;  1P3G B;  4Z5T B;  1S32 A;  1P3I A;  3LZ1 B;  3C1B A;  5CHL B;  4CAY B;  1KX3 B;  3EPK A;  4WJ3 C;  4ZBJ B;  1P3O B;  3O62 A;  4X23 D;  2HUE B;  1S32 C;  3MGR A;  1P3I C;  3C1B C;  5B0Y D;  5DNN B;  3B6F D;  3MGP B;  3V9R B;  5AV9 A;  1P3M B;  4H9S A;  3WTP A;  5B0Z C;  3O62 C;  4J8W D;  2JE5 A;  3AZH B;  1M18 A;  3X1T B;  3W96 B;  2YFW A;  3W97 A;  4H9S C;  3WTP C;  3LJA B;  1P3A D;  3KXB A;  1U35 B;  3AYW D;  3X1V D;  4R8P C;  4HGA B;  4H9R B;  1P3B B;  3VH5 W;  5B32 G;  2PYO D;  3KXB C;  3UTB A;  4H9Q B;  1HQ3 D;  5KDM B;  4H9O A;  2PYO A;  1P3P C;  3AZJ C;  3UTB C;  1KX5 B;  4JJN B;  2Y2K A;  2FJ7 A;  5BO0 A;  3MGQ D;  5B2J A;  3LEL A;  2CV5 B;  4J8V D;  5B40 D;  5BNX B;  2DF4 C;  3LEL C;  4J8V A;  3WAA A;  1P34 A;  5F99 C;  4NFT A;  3AZL C;  3AZN C;  4M6B A;  5AV8 B;  1P3K D;  4DRB A;  3AZF B;  3REK A;  1P34 C;  5GSU C;  4LD9 D;  3MNN B;  1BH9 A;  4AWL C;  4WU8 D;  5DNM D;  3AFA D;  4YS3 B;  2BYM A;  5E5A D;  4XZQ A;  3MVD B;  4Z5T D;  3KUY D;  3REK C;  5BNV B;  3LZ1 D;  5GT0 A;  4KGC D;  4YM6 D;  1P3G A;  4UPK A;  4Z5T A;  5B31 C;  2F8N G;  3MGS D;  3LZ1 A;  5CPI D;  5GT0 C;  4J8U D;  4CAY A;  1KX3 A;  3B0B A;  3AZM D;  1P3O A;  5GT3 B;  1P3L C;  5AVC B;  5GXQ D;  3AZH D;  1F66 D;  4DQY B;  5DNN A;  3X1T D;  3MGP A;  3V9R A;  1KX3 C;  1P3M A;  1EQZ D;  1TAF B;  3AZH A;  3NQJ B;  3W96 A;  3X1T A;  5DNN C;  3MGP C;  1P3M C;  1P3B D;  5B0Z B;  3LJA A;  3A6N D;  1U35 A;  4Z2M G;  1M19 B;  3W96 C;  5CP6 C;  4H9R A;  1P3B A;  3AN2 D;  3REH D;  3R45 B;  5AV6 B;  3WA9 B;  1U35 C;  2XD5 A;  4H9Q A;  4R8P B;  4EO5 C;  5KDM A;  1ZLA C;  2HIO B;  2BG1 A;  4E44 A;  3AL0 C;  2DQN C;  1KX5 A;  4JJN A;  3X1S C;  1P3P B;  4KUD B;  3AZJ B;  3UT9 C;  2CV5 A;  3B6G C;  4XUJ C;  4JJN C;  1KX4 D;  3W98 C;  2Y2P A;  3A1I A;  5BNX A;  1P3F C;  3FDD A;  2F8N H;  2CV5 C;  3F6T A;  5AV8 A;  3AZG D;  3AZF A;  5F99 B;  2Y2N A;  3MNN A;  4J8X C;  3AZL B;  3AZN B;  5AV8 C;  4YS3 A;  3MVD A;  3AZF C;  5JRG C;  5GSU B;  3MNN C;  3X1U D;  4AWL B;  5BNV A;  3KWQ D;  4YS3 C;  3EPL A;  5B32 B;  3EG5 B;  4Z66 C;  3MVD C;  2FFF B;  4Z2M H;  5B2I C;  2RIQ A;  3EPJ A;  1R4V A;  3C1C D;  3REI D;  5B31 B;  5CPJ C;  1N1J B;  4E45 A;  3AZE B;  1M1A B;  5GT3 A;  5AVC A;  1S32 D;  2ZY4 A;  5AVB B;  1P3I D;  3LZ0 B;  3C1B D;  1P3L B;  3H0M C;  5GT3 C;  3O62 D;  1TAF A;  5AVC C;  5B1L B;  3MGR D;  3NQJ A;  5AV9 D;  3AV2 B;  3WTP D;  5B0Z A;  1AOI B;  5C3I B;  1Q9C A;  1M19 A;  1M18 D;  3W99 B;  1HTA A;  4R8P D;  3TU4 C;  3AZK C;  3W97 D;  3IP4 C;  3H0L C;  5AV6 A;  3R45 A;  3KXB D;  3WA9 A;  1M19 C;  5CP6 B;  1ULY A;  4R8P A;  2HIO A;  5AV6 C;  3WA9 C;  3AZJ D;  3UTB D;  4EO5 B;  5BS7 C;  3AZI B;  1ZLA B;  5B24 B;  2BYK B;  3UTA C;  2HIO C;  1P3P A;  4KUD A;  3AZJ A;  5AY8 C;  2F8N B;  3X1S B;  4QLC B;  3REJ B;  2F8N K;  2FJ7 D;  4KUD C;  3UT9 B;  5B2J D;  3LEL D;  3B6G B;  4XUJ B;  3W98 B;  2ARO B;  3AZL D;  1P3F B;  3WAA D;  5F99 A;  1P34 D;  5AV5 B;  3AZN A;  3AZL A;  5B0Y C;  2NZD B;  1TZY C;  2Y2H A;  5GSU A;  3A1K A;  3REK D;  4J8X B;  5B33 C;  5JRG B;  5B32 A;  5B31 D;  4XZQ D;  3X1V C;  5GT0 D;  3VH6 T;  1P3G D;  5B31 A;  4Z66 B;  1N1J A;  5B32 C;  3AZE A;  1M1A A;  2NQB B;  5B2I B;  3EPH A;  5AVB A;  3LZ0 A;  2J8P A;  5CPJ B;  1KX3 D;  2Y2L A;  3WTP E;  3AZE C;  1P3L A;  1P3O D;  3P5J B;  1M1A C;  5B1L A;  5AVB C;  3LZ0 C;  5DNN D;  1T3U A;  4ZUX B;  3MGP D;  1P3M D;  3AV2 A;  4KHA B;  1AOI A;  1BH8 B;  5B1L C;  3W99 A;  3W96 D;  3AV2 C;  3LJA D;  5C3I C; 
#chains in the Genus database with same CATH homology
 1U35 D;  5CP6 A;  3W99 C;  3TU4 B;  3AZK B;  1ZLA D;  3KFU G;  3AV1 B;  2RVQ C;  4LD9 C;  1ZLA A;  3X1S D;  3AZI A;  5B24 A;  2BYK A;  3B0D B;  2F8N A;  4XUJ D;  4DRA A;  3X1S A;  3KUY C;  4JJN D;  3AZI C;  4QLC A;  5B24 C;  3REJ A;  3UTA B;  3W98 D;  1WWS A;  2IO5 B;  1P3F D;  5AY8 B;  3UT9 A;  3B6G A;  2CV5 D;  4XUJ A;  1B6W A;  4H9N B;  2ZY3 A;  4G92 C;  3W98 A;  4QLC C;  3MGS C;  3REJ C;  2ARO A;  1P3F A;  4J8U C;  5CPK B;  5AV5 A;  3NQU B;  4J8X D;  5GXQ C;  2ARO C;  5AV8 D;  1PZR A;  2NZD A;  1ID3 C;  3AZF D;  2Y2M A;  4X23 B;  5AV5 C;  4J8X A;  3MNN D;  5B0Y B;  3B6F B;  2NZD C;  4YS3 D;  1TZY B;  5JRG A;  3MVD D;  4Z66 D;  5B33 B;  4WV4 B;  4J8W B;  2L5A A;  1KX5 D;  2JCH A;  3REL C;  4UUZ B;  4Z66 A;  2G5I C;  2NQB A;  1KU5 A;  5B2I A;  1P3A B;  1H3O B;  5BT1 C;  2UWX A;  3AYW B;  3X1V B;  5CPJ A;  2NQB C;  5GT3 D;  5AVC D;  3WKJ C;  1WWI A;  1HQ3 B;  4ZUX A;  2Y2Q A;  4KHA A;  1BH8 A;  4ZUX C;  1JFI B;  1KX4 C;  5B0Z D;  3MGQ B;  1M19 D;  4J8V B;  3TU4 A;  3AZK A;  5B40 B;  5B1M C;  3AV1 A;  5AV6 D;  3WA9 D;  2Y2O A;  3UTA D;  2HIO D;  3AV1 C;  1P3K B;  5BS7 A;  4LD9 B;  3UTA A;  3X1U C;  4WU8 B;  1P3P D;  5DNM B;  3AFA B;  3B0D C;  5AY8 A;  4KUD D;  5E5A B;  3KUY B;  5G49 B;  4H9N A;  2YFV B;  2CWE A;  4KGC B;  2IO5 C;  4YM6 B;  4WU9 C;  3C1C C;  3REI C;  5CPK A;  2VQR A;  4G92 B;  3MGS B;  3NQU A;  5CPI B;  4J8U B;  5CPK C;  3AZM B;  1TZY D;  4H9P B;  2W8S A;  5F99 D;  4X23 A;  5B33 D;  4NE5 A;  5GXQ B;  3AZN D;  3MGR C;  5B0Y A;  1F66 B;  2ZY5 A;  3B6F A;  2Y2J A;  1TZY A;  1ID3 B;  5AV9 C;  1EQZ B;  5GSU D;  3B0C T;  5B33 A;  4X23 C;  4J8W A;  4G91 B;  1M18 C;  3B6F C;  4UUZ A;  5B32 D;  3W97 C;  4J8W C;  1P3A A;  1B67 A;  1H3O A;  3A6N B;  3AYW A;  3X1V A;  3REL B;  3AZE D;  1M1A D;  3AN2 B;  5B31 G;  3REH B;  1P3A C;  5AVB D;  3AYW C;  3LZ0 D;  1HQ3 A;  4CSR B;  1P3L D;  3WKJ B;  4WNN B;  2PYO C;  5B1L D;  1HQ3 C;  2Y2G A;  1JFI A;  3AV2 D;  2FJ7 C;  1F1E A;  1AOI D;  3MGQ A;  3KSY A;  5B2J C;  3W99 D;  5B40 A;  4NE6 A;  1KX4 B;  3VH6 A;  5FUG B;  3MGQ C;  1BFM A;  5CP6 D;  2RVQ D;  3WAA C;  4J8V C;  5B40 C;  1Z2C B;  5JA4 B;  5B1M B;  4WZS B;  3AZG B;  1P3K A;  4LD9 A;  2ZY2 A;  3AZI D;  5B24 D;  4WU8 A;  5DNM A;  3AFA A;  1P3K C;  5E5A A;  2F8N D;  4XZQ C;  5G49 A;  3KUY A;  2YFV A;  4QLC D;  3X1U B;  2G5H C;  3REJ D;  4WU8 C;  4KGC A;  4YM6 A;  5DNM C;  3AFA C;  3KWQ B;  3UT9 D;  1P3G C;  5E5A C;  3B6G D;  4Z5T C;  3MGS A;  2JSS A;  5CPI A;  2ARO D;  1W2E A;  3LZ1 C;  4J8U A;  4KGC C;  4YM6 C;  3C1C B;  3REI B;  4WU9 B;  3AZM A;  1ID3 D;  4H9P A;  4ZBJ C;  1P3O C;  5AV5 D;  1S32 B;  5GXQ A;  2HUE C;  1P3I B;  3C1B B;  5CPI C;  1F66 A;  2XD1 A;  2NZD D;  1ID3 A;  3AZM C;  1EQZ A;  3O62 B;  3MGR B;  3AZH C;  1F66 C;  3X1T C;  3REL D;  5AV9 B;  5JRG D;  1EQZ C;  3WTP B;  3B0C W;  3LJA C;  3A6N A;  4G91 C;  5BT1 D;  1M18 B;  2F2A C;  3REL A;  2YFW B;  3W97 B;  4HGA C;  1P3B C;  3VH5 T;  2NQB D;  3AN2 A;  5B2I D;  3REH A;  3WKJ D;  3KXB B;  3A6N C;  4NE3 A;  5CPJ D;  4CSR A;  3WKJ A;  4WNN A;  3AN2 C;  3REH C;  3UTB B;  3VH6 W;  1KX5 C;  4ZUX D;  1A7W A;  4H9O B;  2PYO B;  3VH5 A;  1KX4 A;  2FJ7 B;  5BO0 B;  2LY8 A;  5B1M D;  5FUG A;  5B2J B;  3LEL B;  3H0R C;  3TU4 D;  3AZK D;  1AOI C;  5JA4 A;  5B1M A;  3AZG A;  3AV1 D;  3WAA B;  1P34 B;  3AZG C;  2ZM5 A;  3REK B;  3X1U A;  1BH9 B;  2Y2I A;  3KWQ A;  5AY8 D;  4WU9 D;  2BYM B;  4XZQ B;  5GT0 B;  4WU9 A;  3C1C A;  3KWQ C;  3REI A;  5CPK D;  1P3G B;  4Z5T B;  1S32 A;  1P3I A;  3LZ1 B;  3C1B A;  5CHL B;  4CAY B;  1KX3 B;  3EPK A;  4WJ3 C;  4ZBJ B;  1P3O B;  3O62 A;  4X23 D;  2HUE B;  1S32 C;  3MGR A;  1P3I C;  3C1B C;  5B0Y D;  5DNN B;  3B6F D;  3MGP B;  3V9R B;  5AV9 A;  1P3M B;  4H9S A;  3WTP A;  5B0Z C;  3O62 C;  4J8W D;  2JE5 A;  3AZH B;  1M18 A;  3X1T B;  3W96 B;  2YFW A;  3W97 A;  4H9S C;  3WTP C;  3LJA B;  1P3A D;  3KXB A;  1U35 B;  3AYW D;  3X1V D;  4R8P C;  4HGA B;  4H9R B;  1P3B B;  3VH5 W;  5B32 G;  2PYO D;  3KXB C;  3UTB A;  4H9Q B;  1HQ3 D;  5KDM B;  4H9O A;  2PYO A;  1P3P C;  3AZJ C;  3UTB C;  1KX5 B;  4JJN B;  2Y2K A;  2FJ7 A;  5BO0 A;  3MGQ D;  5B2J A;  3LEL A;  2CV5 B;  4J8V D;  5B40 D;  5BNX B;  2DF4 C;  3LEL C;  4J8V A;  3WAA A;  1P34 A;  5F99 C;  4NFT A;  3AZL C;  3AZN C;  4M6B A;  5AV8 B;  1P3K D;  4DRB A;  3AZF B;  3REK A;  1P34 C;  5GSU C;  4LD9 D;  3MNN B;  1BH9 A;  4AWL C;  4WU8 D;  5DNM D;  3AFA D;  4YS3 B;  2BYM A;  5E5A D;  4XZQ A;  3MVD B;  4Z5T D;  3KUY D;  3REK C;  5BNV B;  3LZ1 D;  5GT0 A;  4KGC D;  4YM6 D;  1P3G A;  4UPK A;  4Z5T A;  5B31 C;  2F8N G;  3MGS D;  3LZ1 A;  5CPI D;  5GT0 C;  4J8U D;  4CAY A;  1KX3 A;  3B0B A;  3AZM D;  1P3O A;  5GT3 B;  1P3L C;  5AVC B;  5GXQ D;  3AZH D;  1F66 D;  4DQY B;  5DNN A;  3X1T D;  3MGP A;  3V9R A;  1KX3 C;  1P3M A;  1EQZ D;  1TAF B;  3AZH A;  3NQJ B;  3W96 A;  3X1T A;  5DNN C;  3MGP C;  1P3M C;  1P3B D;  5B0Z B;  3LJA A;  3A6N D;  1U35 A;  4Z2M G;  1M19 B;  3W96 C;  5CP6 C;  4H9R A;  1P3B A;  3AN2 D;  3REH D;  3R45 B;  5AV6 B;  3WA9 B;  1U35 C;  2XD5 A;  4H9Q A;  4R8P B;  4EO5 C;  5KDM A;  1ZLA C;  2HIO B;  2BG1 A;  4E44 A;  3AL0 C;  2DQN C;  1KX5 A;  4JJN A;  3X1S C;  1P3P B;  4KUD B;  3AZJ B;  3UT9 C;  2CV5 A;  3B6G C;  4XUJ C;  4JJN C;  1KX4 D;  3W98 C;  2Y2P A;  3A1I A;  5BNX A;  1P3F C;  3FDD A;  2F8N H;  2CV5 C;  3F6T A;  5AV8 A;  3AZG D;  3AZF A;  5F99 B;  2Y2N A;  3MNN A;  4J8X C;  3AZL B;  3AZN B;  5AV8 C;  4YS3 A;  3MVD A;  3AZF C;  5JRG C;  5GSU B;  3MNN C;  3X1U D;  4AWL B;  5BNV A;  3KWQ D;  4YS3 C;  3EPL A;  5B32 B;  3EG5 B;  4Z66 C;  3MVD C;  2FFF B;  4Z2M H;  5B2I C;  2RIQ A;  3EPJ A;  1R4V A;  3C1C D;  3REI D;  5B31 B;  5CPJ C;  1N1J B;  4E45 A;  3AZE B;  1M1A B;  5GT3 A;  5AVC A;  1S32 D;  2ZY4 A;  5AVB B;  1P3I D;  3LZ0 B;  3C1B D;  1P3L B;  3H0M C;  5GT3 C;  3O62 D;  1TAF A;  5AVC C;  5B1L B;  3MGR D;  3NQJ A;  5AV9 D;  3AV2 B;  3WTP D;  5B0Z A;  1AOI B;  5C3I B;  1Q9C A;  1M19 A;  1M18 D;  3W99 B;  1HTA A;  4R8P D;  3TU4 C;  3AZK C;  3W97 D;  3IP4 C;  3H0L C;  5AV6 A;  3R45 A;  3KXB D;  3WA9 A;  1M19 C;  5CP6 B;  1ULY A;  4R8P A;  2HIO A;  5AV6 C;  3WA9 C;  3AZJ D;  3UTB D;  4EO5 B;  5BS7 C;  3AZI B;  1ZLA B;  5B24 B;  2BYK B;  3UTA C;  2HIO C;  1P3P A;  4KUD A;  3AZJ A;  5AY8 C;  2F8N B;  3X1S B;  4QLC B;  3REJ B;  2F8N K;  2FJ7 D;  4KUD C;  3UT9 B;  5B2J D;  3LEL D;  3B6G B;  4XUJ B;  3W98 B;  2ARO B;  3AZL D;  1P3F B;  3WAA D;  5F99 A;  1P34 D;  5AV5 B;  3AZN A;  3AZL A;  5B0Y C;  2NZD B;  1TZY C;  2Y2H A;  5GSU A;  3A1K A;  3REK D;  4J8X B;  5B33 C;  5JRG B;  5B32 A;  5B31 D;  4XZQ D;  3X1V C;  5GT0 D;  3VH6 T;  1P3G D;  5B31 A;  4Z66 B;  1N1J A;  5B32 C;  3AZE A;  1M1A A;  2NQB B;  5B2I B;  3EPH A;  5AVB A;  3LZ0 A;  2J8P A;  5CPJ B;  1KX3 D;  2Y2L A;  3WTP E;  3AZE C;  1P3L A;  1P3O D;  3P5J B;  1M1A C;  5B1L A;  5AVB C;  3LZ0 C;  5DNN D;  1T3U A;  4ZUX B;  3MGP D;  1P3M D;  3AV2 A;  4KHA B;  1AOI A;  1BH8 B;  5B1L C;  3W99 A;  3W96 D;  3AV2 C;  3LJA D;  5C3I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...