5KDMA

Crystal structure of ebv tegument protein bnrf1 in complex with histone chaperone daxx and histones h3.3-h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structural basis underlying viral hijacking of a histone chaperone complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone / dna binding protein
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5kdmA00
3X1VD 3REKB 3NQUA 5CP6D 1P3BC 4WNNA 3REIB 3WA9C 4J8VD 3O62B 1S32B 1P3OD 3UT9A 3WAAD 5AV8A 3LZ0D 4CAYA 5AV6C 5B24D 2PYOB 4H9QA 1JFIB 3A6NC 3AZKC 4R8PB 5DNMB 1F66D 3MGSC 5B2JA 3KXBB 1M1AC 2HIOD 3RELD 4QLCD 3C1CC 3MGPB 4WU9A 5B31D 2FJ7C 5GT0D 1HQ3A 5AV5C 5JA4A 1KX5D 4WU8B 3MGQC 5B1MB 3O62A 3LELA 3UTAB 3AZJB 4ZBJC 4Z5TA 3AV2B 1KX3A 1P3AD 5CPJD 1B6WA 1TAFA 3X1SD 1AOIB 3KUYD 1H3OB 5DNNA 5BNXB 5GXQB 3AFAB 4LD9A 5BS7A 1EQZB 3W96B 3AZED 4KUDD 3AYWB 3VH6T 5B0YA 3AZFB 2NZDA 4ZUXD 4H9SC 5AY8B 5GSUB 5E5AA 3LZ0B 5B24B 4WU8A 5F99B 1P3MA 3NQJB 3TU4C 5B32A 1ID3B 3REHC 5JRGC 3AZIC 1F66B 1P34D 1KX4B 2BYKA 4J8UD 1AOIA 1BH9A 5CPKC 5CPJC 5B1LD 3X1SC 3RELB 4QLCB 1P3ID 3KUYC 1P3FD 3MNNB 5AVCA 5GT0B 1P3KB 3W98B 5B40B 3C1BA 3LJAC 3X1UB 3W97D 4Z66D 3X1TB 4J8WB 5GSUA 5BNVB 3LZ1D 1P3AB 3B0CT 5B0ZB 1U35B 4YS3B 1P3LD 3VH5T 4HGAC 1M18A 3AZEB 4KUDB 2NQBB 3MNNA 1HQ3D 3AZHB 1P3FC 4ZUXB 3AZGA 4XZQA 4YM6B 1P3KA 1P3PC 3W99B 4WV4B 3MVDC 3O62D 1S32D 4Z5TD 3W97C 1P34B 2HUEB 1BH8A 3AN2A 3LZ1C 1M19C 5B0ZA 1P3IB 5CPIA 5DNMD 5AVBA 1P3LC 2AROC 3B0DB 3NQUB 4XUJA 3KWQC 4EO5C 4WNNB 3MGPD 3AV1C 5B2IA 5B0YD 2NQBA 5B33C 3UT9B 5AV8B 3B6GA 4CAYB 4WU8D 4NE5A 2JSSA 3REKC 4H9QB 4YM6A 4KGCB 2RVQC 3W99A 1TZYA 5B31G 3REIC 3AV2D 5B2JB 1P3GC 3AZNA 3UTBC 1AOID 2CV5B 3MGRA 3WKJA 4WU9B 2PYOC 4J8XA 5FUGA 5AVCD 3AFAD 1HQ3B 4R8PC 5JA4B 5DNMC 3LJAA 1EQZD 3KXBC 3W96D 2L5AA 5AV9C 2F8NG 3AYWD 3LELB 3MGPC 3AZFD 5AY8D 4Z5TB 5GSUD 1KX3B 1TAFB 2YFVA 5F99D 4KGCA 1ID3D 5DNNB 3VH6A 1M18D 4CSRA 5B1MC 3UTAC 3WTPC 3AZJC 1KX4D 3AV2C 4LD9B 4NE3A 2CV5A 3AZMA 4X23C 3MNND 5B0YB 2NZDB 5E5AB 4XZQD 5GXQC 5BT1D 3X1VC 4G91B 3AFAC 3AZLA 1P3KD 3W98D 1P3MB 5B40D 1EQZC 5CP6C 3X1UD 3W96C 5GT3B 5B32B 3X1TD 4AWLB 3AYWC 1B67A 4J8WD 4J8VC 3REJB 1P3OC 5C3IB 3AZFC 3WAAC 5AY8C 3B6FB 2BYKB 1HTAA 1BH9B 3LZ0C 5B24C 4H9NA 5B0ZD 1U35D 4YS3D 5AVBD 4DRAA 5AVCB 1P3BB 1ZLAA 1F66C 1KX4C 2IO5B 3C1BB 2NQBD 2HIOC 3AZHD 3RELC 4QLCC 3VH5A 1Q9CA 4JJNC 5B31C 3WKJC 4H9RA 4YM6D 5GT0C 4DRBA 3W99D 1TZYD 5BT1C 1KX5C 1P3GA 4E44A 5GT3A 3X1UC 1M18B 3AZND 2FJ7B 5BO0A 3REJA 3X1TC 4Z2MG 3B6FA 3MGRD 4JJNA 1P3AC 4J8XD 4YS3C 1P3BA 3AZGB 5AV9A 3WA9A 4XZQB 5AV6A 4WZSB 3UT9D 3B0BA 1R4VA 5AV8D 3AZEC 4KUDC 3A6NA 3AZHC 3AZKA 1BH8B 4ZUXC 4KGCD 4E45A 3B0CW 3MGSA 3AN2B 1M1AA 5CPIB 3VH5W 5AVBB 4G92C 5B2JD 5G49B 3C1CA 2FJ7A 1WWIA 4XUJB 2CV5D 1P34C 2HUEC 4WU9D 1F1EA 5AV5A 4J8UC 4KHAA 5B2IB 3MGQA 5B1LC 4M6BA 1P3IC 3B6GB 3TU4B 3B0DC 5JRGB 1TZYB 3LELD 5CPKB 1KX3D 3AZNB 1BFMA 4Z66C 2F8NB 3WTPE 3MGRB 3WKJB 4J8XB 5DNND 5FUGB 5G49A 4LD9D 3LJAB 2HIOA 5B2JC 4H9PA 5B31A 4H9OA 4H9SA 4WU9C 5KDMA 2NZDD 5E5AD 1HQ3C 3TU4A 2YFVB 1P3MD 4HGAB 3REHA 5JRGA 3AZIA 5GT3D 5B32D 4CSRB 4UUZB 5CPKA 3O62C 3LELC 3REJD 3X1SA 5CPJA 1S32C 3B6FD 4Z5TC 3KUYA 1KX3C 2F8NA 3AZMB 2LY8A 1WWSA 1P3PB 1P3BD 5DNNC 3MVDB 3AZLB 5BS7C 3C1BD 5AV6D 1KU5A 2F8NH 2BYMB 3A6ND 3R45A 5B0YC 3AZKD 5E5AC 4G91C 4H9NB 4WU8C 1M1AD 2AROB 1P3MC 3KWQB 4UUZA 3C1CD 5B32C 2FJ7D 1ZLAB 4AWLC 5B1LA 1AOIC 1P3FA 3MGQD 3V9RA 1P3PA 3AZGD 3MVDA 4H9RB 5AVCC 1P3GB 3W97A 4Z66A 3KSYA 2IO5C 3UTBB 1N1JA 2BYMA 4NFTA 3C1BC 1M19A 3LZ1A 5BO0B 5GSUC 4JJNB 3AN2D 5CPID 5F99C 2AROA 1P3LA 3KWQA 3AV1A 1ID3C 5AV9B 4XUJD 3WA9B 1M18C 5B33A 5B2ID 5AV6B 3VH6W 3B6GD 3REKA 3A6NB 3MNNC 3TU4D 3AZKB 3AZGC 3REHD 3REIA 5JRGD 4XZQC 3MGSB 3AZID 1S32A 1P3KC 3WTPB 1M1AB 3W98C 1ULYA 3UTBA 5B40C 5CPKD 3C1CB 4X23B 1JFIA 2PYOA 2F8ND 4J8WC 4Z2MH 3WKJD 5AV5B 4R8PA 5DNMA 4KHAB 3AN2C 3X1VB 5B0ZC 3KXBA 3MGQB 5CPIC 1U35C 5CP6B 5AVBC 3LJAD 3MGPA 4ZBJB 4XUJC 4J8VB 1P3OB 3WAAB 5B2IC 2NQBC 3B6GC 5B1MA 4YM6C 3UTAA 3WTPA 3AZJA 3W99C 1TZYC 3AV2A 4X23A 2HIOB 4H9PB 3AZNC 3AZMD 1H3OA 5B31B 4H9OB 5BNXA 5GXQA 3MGRC 3X1VA 2YFWB 5KDMB 2CWEA 5B32G 3AFAA 4J8XC 1P3PD 1KX5B 3MVDD 1EQZA 5CP6A 3AZLD 3W96A 5CHLB 3REHB 3AYWA 3AZIB 4J8VA 1P3OA 3AZFA 3WAAA 5AY8A 3LZ0A 1M19D 5B24A 3X1SB 3UT9C 5CPJB 5AV8C 5F99A 3KUYB 3NQJA 4NE6A 2AROD 1ID3A 4KGCC 3KWQD 1F66A 3AV1D 1ZLAD 1KX4A 5B33D 3RELA 4QLCA 2CV5C 3REKD 3AZMC 5GT0A 2YFWA 2RVQD 3R45B 1KX5A 3REID 3W98A 5B40A 4G92B 3AZLC 1P3GD 3X1UA 3UTBD 3X1TA 4J8WA 2F8NK 5BNVA 2PYOD 1P3AA 4J8UB 4JJND 5B1LB 4R8PD 1U35A 4YS3A 1P3FB 3KXBD 3V9RB 5AV9D 3WA9D 1ZLAC 3AZEA 4KUDA 4LD9C 3W97B 3AZHA 4Z66B 1N1JB 4ZUXA 1M19B 3LZ1B 2NZDC 3MGSD 5B1MD 3UTAD 3WTPD 3AZJD 1P3LB 1P34A 4EO5B 5GT3C 4X23D 3AV1B 1A7WA 4J8UA 3REJC 5B33B 1P3IA 5C3IC 5AV5D 3B6FC 5GXQD
chains in the Genus database with same CATH superfamily
2RIQA 3X1VD 3REKB 3NQUA 5CP6D 1P3BC 4WNNA 3REIB 3WA9C 4J8VD 3O62B 1S32B 1P3OD 3UT9A 3WAAD 5AV8A 3LZ0D 3KFUG 4CAYA 5AV6C 5B24D 2PYOB 4H9QA 1JFIB 3A6NC 3AZKC 4R8PB 5DNMB 1F66D 3MGSC 5B2JA 3KXBB 1M1AC 2HIOD 3P5JB 3RELD 4QLCD 3C1CC 3MGPB 4WU9A 5B31D 2FJ7C 5GT0D 1HQ3A 5AV5C 5JA4A 1KX5D 4WU8B 3MGQC 5B1MB 3O62A 3LELA 3UTAB 3AZJB 4ZBJC 3H0RC 4Z5TA 3AV2B 1KX3A 1P3AD 5CPJD 1B6WA 1TAFA 3X1SD 1AOIB 3KUYD 2BG1A 1H3OB 5DNNA 5BNXB 5GXQB 3AFAB 2Y2HA 5BS7A 1EQZB 4LD9A 3W96B 3AZED 4KUDD 3AYWB 3VH6T 5B0YA 3AZFB 2NZDA 4ZUXD 4H9SC 5AY8B 5GSUB 5E5AA 3LZ0B 5B24B 4WU8A 5F99B 1P3MA 3NQJB 3TU4C 5B32A 1ID3B 3REHC 5JRGC 3AZIC 1F66B 1P34D 1KX4B 2BYKA 4J8UD 1AOIA 1BH9A 5CPKC 5CPJC 5B1LD 3X1SC 3RELB 4QLCB 1P3ID 3AL0C 3KUYC 1P3FD 3MNNB 5AVCA 5GT0B 1P3KB 3W98B 5B40B 3C1BA 3LJAC 3X1UB 3W97D 4Z66D 3X1TB 4J8WB 5GSUA 5BNVB 3LZ1D 1P3AB 3B0CT 5B0ZB 1U35B 4YS3B 1P3LD 3VH5T 4HGAC 1M18A 3AZEB 4KUDB 2NQBB 3MNNA 1HQ3D 3AZHB 1P3FC 4ZUXB 3AZGA 4UPKA 4XZQA 4YM6B 1P3KA 1P3PC 3W99B 4WV4B 3MVDC 3O62D 1S32D 4Z5TD 3W97C 3EPKA 1P34B 2HUEB 1BH8A 2ZM5A 3AN2A 3LZ1C 1M19C 5B0ZA 1P3IB 5CPIA 5DNMD 5AVBA 1P3LC 2AROC 3B0DB 3NQUB 4XUJA 3KWQC 4EO5C 4WNNB 3MGPD 3AV1C 5B2IA 5B0YD 2NQBA 5B33C 3UT9B 5AV8B 2F2AC 3B6GA 4CAYB 4WU8D 4NE5A 2JSSA 3REKC 4H9QB 4YM6A 4KGCB 2RVQC 3W99A 1TZYA 5B31G 3REIC 3AV2D 5B2JB 1P3GC 3AZNA 3UTBC 1AOID 2CV5B 3MGRA 3WKJA 4WU9B 2PYOC 4J8XA 5FUGA 5AVCD 3AFAD 1HQ3B 4R8PC 5JA4B 5DNMC 3LJAA 1EQZD 3KXBC 3W96D 2L5AA 5AV9C 2F8NG 3AYWD 3LELB 3MGPC 3AZFD 5AY8D 4Z5TB 5GSUD 1KX3B 1TAFB 2YFVA 5F99D 4KGCA 1ID3D 5DNNB 3VH6A 1M18D 4CSRA 5B1MC 4DQYB 3UTAC 3WTPC 3AZJC 1KX4D 3AV2C 4LD9B 4NE3A 2CV5A 3EG5B 3AZMA 2UWXA 4X23C 3MNND 5B0YB 2NZDB 2DF4C 5E5AB 4XZQD 5GXQC 5BT1D 3X1VC 4G91B 2Y2GA 3AFAC 3AZLA 1P3KD 3W98D 1P3MB 5B40D 1EQZC 5CP6C 3X1UD 3W96C 5GT3B 5B32B 3X1TD 4AWLB 3H0LC 1B67A 4J8WD 4J8VC 3REJB 3AYWC 1P3OC 5C3IB 3AZFC 3WAAC 5AY8C 3B6FB 2BYKB 1HTAA 1BH9B 3LZ0C 5B24C 4H9NA 5B0ZD 1U35D 4YS3D 5AVBD 4DRAA 5AVCB 1P3BB 1ZLAA 1F66C 2Y2MA 1KX4C 2IO5B 3C1BB 2Y2QA 2NQBD 2Y2PA 2HIOC 3AZHD 3RELC 2Y2IA 3VH5A 4QLCC 1Q9CA 4JJNC 5B31C 3WKJC 4H9RA 4YM6D 5GT0C 4DRBA 3W99D 1TZYD 5BT1C 1KX5C 1P3GA 4E44A 5GT3A 3X1UC 1M18B 3AZND 2FJ7B 5BO0A 3REJA 3X1TC 4Z2MG 3B6FA 3MGRD 4JJNA 1P3AC 4J8XD 2DQNC 4YS3C 1P3BA 3AZGB 5AV9A 3WA9A 4XZQB 1Z2CB 5AV6A 4WZSB 3UT9D 3B0BA 1R4VA 5AV8D 3AZEC 4KUDC 3A6NA 2Y2JA 3AZHC 2Y2NA 3AZKA 1BH8B 3H0MC 4ZUXC 4E45A 4KGCD 3B0CW 3MGSA 3AN2B 1M1AA 5CPIB 3VH5W 5AVBB 4G92C 5B2JD 5G49B 3C1CA 2FJ7A 1WWIA 4XUJB 2CV5D 1P34C 2HUEC 4WU9D 1F1EA 5AV5A 4J8UC 4KHAA 5B2IB 3MGQA 5B1LC 4M6BA 1P3IC 3B6GB 3TU4B 3B0DC 5JRGB 1TZYB 3LELD 2ZY5A 1W2EA 5CPKB 1KX3D 3AZNB 1BFMA 4Z66C 2F8NB 3WTPE 3MGRB 3WKJB 4J8XB 5DNND 5FUGB 5G49A 4LD9D 3LJAB 2HIOA 5B2JC 4H9PA 3EPLA 5B31A 4H9OA 4H9SA 4WU9C 5KDMA 2NZDD 5E5AD 1HQ3C 3TU4A 2YFVB 1P3MD 4HGAB 3REHA 5JRGA 3AZIA 5GT3D 5B32D 4CSRB 4UUZB 5CPKA 3O62C 3LELC 3REJD 3X1SA 5CPJA 1S32C 3B6FD 4Z5TC 3KUYA 1KX3C 2F8NA 3AZMB 3F6TA 2LY8A 1WWSA 1P3PB 2XD5A 1P3BD 5DNNC 3MVDB 3AZLB 2ZY2A 5BS7C 3C1BD 5AV6D 1KU5A 2F8NH 2BYMB 3A6ND 3R45A 5B0YC 3AZKD 5E5AC 4G91C 4H9NB 4WU8C 1M1AD 2AROB 1P3MC 3KWQB 3A1IA 4UUZA 2Y2LA 5B32C 3C1CD 1ZLAB 2FJ7D 4AWLC 5B1LA 1AOIC 1P3FA 3MGQD 3V9RA 1P3PA 3AZGD 4WJ3C 3MVDA 4H9RB 5AVCC 3A1KA 2ZY4A 1P3GB 3W97A 4Z66A 3KSYA 2IO5C 3UTBB 1N1JA 2BYMA 4NFTA 3C1BC 1M19A 3LZ1A 5BO0B 2JE5A 5GSUC 4JJNB 3AN2D 5CPID 5F99C 2AROA 1P3LA 3KWQA 3AV1A 1ID3C 5AV9B 4XUJD 3WA9B 1M18C 5B33A 5B2ID 5AV6B 3VH6W 3B6GD 3REKA 3A6NB 3MNNC 2XD1A 3TU4D 3AZKB 3AZGC 3REHD 3REIA 5JRGD 4XZQC 3MGSB 3AZID 1S32A 2ZY3A 3WTPB 1P3KC 1M1AB 3W98C 1ULYA 3UTBA 5B40C 5CPKD 3C1CB 4X23B 1JFIA 2PYOA 2F8ND 4J8WC 4Z2MH 3WKJD 5AV5B 4R8PA 5DNMA 2VQRA 3EPJA 4KHAB 3AN2C 3X1VB 5B0ZC 3KXBA 3MGQB 5CPIC 1U35C 5CP6B 5AVBC 3LJAD 3FDDA 3MGPA 4ZBJB 4XUJC 4J8VB 1P3OB 3WAAB 5B2IC 2NQBC 3B6GC 5B1MA 4YM6C 3UTAA 3WTPA 3AZJA 3W99C 1TZYC 3AV2A 4X23A 2HIOB 4H9PB 3AZNC 3AZMD 1H3OA 5B31B 4H9OB 5BNXA 5GXQA 3MGRC 3X1VA 2G5HC 2YFWB 2CWEA 5KDMB 5B32G 3AFAA 4J8XC 1P3PD 1KX5B 3MVDD 1EQZA 5CP6A 3AZLD 3W96A 5CHLB 3IP4C 3REHB 3AYWA 3AZIB 4J8VA 1P3OA 3AZFA 3WAAA 5AY8A 2G5IC 2Y2KA 3LZ0A 1M19D 5B24A 3X1SB 3UT9C 5CPJB 5AV8C 5F99A 3KUYB 3NQJA 4NE6A 2AROD 1ID3A 4KGCC 3KWQD 1F66A 3AV1D 1ZLAD 1KX4A 5B33D 3RELA 4QLCA 2CV5C 3EPHA 3REKD 3AZMC 5GT0A 2YFWA 2RVQD 3R45B 1KX5A 3REID 3W98A 5B40A 2W8SA 4G92B 3AZLC 1P3GD 3X1UA 3UTBD 3X1TA 4J8WA 2JCHA 2F8NK 5BNVA 2PYOD 1P3AA 4J8UB 2FFFB 4JJND 5B1LB 4R8PD 1U35A 4YS3A 1P3FB 3KXBD 3V9RB 5AV9D 3WA9D 1T3UA 2J8PA 1ZLAC 3AZEA 4KUDA 4LD9C 3W97B 3AZHA 4Z66B 1N1JB 2Y2OA 4ZUXA 1PZRA 1M19B 3LZ1B 2NZDC 3MGSD 5B1MD 3UTAD 3WTPD 3AZJD 1P3LB 1P34A 4EO5B 5GT3C 4X23D 3AV1B 1A7WA 4J8UA 3REJC 5B33B 1P3IA 5C3IC 5AV5D 3B6FC 5GXQD
chains in the Genus database with same CATH topology
2RIQA 3X1VD 3REKB 3NQUA 5CP6D 1P3BC 4WNNA 3REIB 3WA9C 4J8VD 3O62B 1S32B 1P3OD 3UT9A 3WAAD 5AV8A 3LZ0D 3KFUG 4CAYA 5AV6C 5B24D 2PYOB 4H9QA 1JFIB 3A6NC 3AZKC 4R8PB 5DNMB 1F66D 3MGSC 5B2JA 3KXBB 1M1AC 2HIOD 3P5JB 3RELD 4QLCD 3C1CC 3MGPB 4WU9A 5B31D 2FJ7C 5GT0D 1HQ3A 5AV5C 5JA4A 1KX5D 4WU8B 3MGQC 5B1MB 3O62A 3LELA 3UTAB 3AZJB 4ZBJC 3H0RC 4Z5TA 3AV2B 1KX3A 1P3AD 5CPJD 1B6WA 1TAFA 3X1SD 1AOIB 3KUYD 2BG1A 1H3OB 5DNNA 5BNXB 5GXQB 3AFAB 2Y2HA 5BS7A 1EQZB 4LD9A 3W96B 3AZED 4KUDD 3AYWB 3VH6T 5B0YA 3AZFB 2NZDA 4ZUXD 4H9SC 5AY8B 5GSUB 5E5AA 3LZ0B 5B24B 4WU8A 5F99B 1P3MA 3NQJB 3TU4C 5B32A 1ID3B 3REHC 5JRGC 3AZIC 1F66B 1P34D 1KX4B 2BYKA 4J8UD 1AOIA 1BH9A 5CPKC 5CPJC 5B1LD 3X1SC 3RELB 4QLCB 1P3ID 3AL0C 3KUYC 1P3FD 3MNNB 5AVCA 5GT0B 1P3KB 3W98B 5B40B 3C1BA 3LJAC 3X1UB 3W97D 4Z66D 3X1TB 4J8WB 5GSUA 5BNVB 3LZ1D 1P3AB 3B0CT 5B0ZB 1U35B 4YS3B 1P3LD 3VH5T 4HGAC 1M18A 3AZEB 4KUDB 2NQBB 3MNNA 1HQ3D 3AZHB 1P3FC 4ZUXB 3AZGA 4UPKA 4XZQA 4YM6B 1P3KA 1P3PC 3W99B 4WV4B 3MVDC 3O62D 1S32D 4Z5TD 3W97C 3EPKA 1P34B 2HUEB 1BH8A 2ZM5A 3AN2A 3LZ1C 1M19C 5B0ZA 1P3IB 5CPIA 5DNMD 5AVBA 1P3LC 2AROC 3B0DB 3NQUB 4XUJA 3KWQC 4EO5C 4WNNB 3MGPD 3AV1C 5B2IA 5B0YD 2NQBA 5B33C 3UT9B 5AV8B 2F2AC 3B6GA 4CAYB 4WU8D 4NE5A 2JSSA 3REKC 4H9QB 4YM6A 4KGCB 2RVQC 3W99A 1TZYA 5B31G 3REIC 3AV2D 5B2JB 1P3GC 3AZNA 3UTBC 1AOID 2CV5B 3MGRA 3WKJA 4WU9B 2PYOC 4J8XA 5FUGA 5AVCD 3AFAD 1HQ3B 4R8PC 5JA4B 5DNMC 3LJAA 1EQZD 3KXBC 3W96D 2L5AA 5AV9C 2F8NG 3AYWD 3LELB 3MGPC 3AZFD 5AY8D 4Z5TB 5GSUD 1KX3B 1TAFB 2YFVA 5F99D 4KGCA 1ID3D 5DNNB 3VH6A 1M18D 4CSRA 5B1MC 4DQYB 3UTAC 3WTPC 3AZJC 1KX4D 3AV2C 4LD9B 4NE3A 2CV5A 3EG5B 3AZMA 2UWXA 4X23C 3MNND 5B0YB 2NZDB 2DF4C 5E5AB 4XZQD 5GXQC 5BT1D 3X1VC 4G91B 2Y2GA 3AFAC 3AZLA 1P3KD 3W98D 1P3MB 5B40D 1EQZC 5CP6C 3X1UD 3W96C 5GT3B 5B32B 3X1TD 4AWLB 3H0LC 1B67A 4J8WD 4J8VC 3REJB 3AYWC 1P3OC 5C3IB 3AZFC 3WAAC 5AY8C 3B6FB 2BYKB 1HTAA 1BH9B 3LZ0C 5B24C 4H9NA 5B0ZD 1U35D 4YS3D 5AVBD 4DRAA 5AVCB 1P3BB 1ZLAA 1F66C 2Y2MA 1KX4C 2IO5B 3C1BB 2Y2QA 2NQBD 2Y2PA 2HIOC 3AZHD 3RELC 2Y2IA 3VH5A 4QLCC 1Q9CA 4JJNC 5B31C 3WKJC 4H9RA 4YM6D 5GT0C 4DRBA 3W99D 1TZYD 5BT1C 1KX5C 1P3GA 4E44A 5GT3A 3X1UC 1M18B 3AZND 2FJ7B 5BO0A 3REJA 3X1TC 4Z2MG 3B6FA 3MGRD 4JJNA 1P3AC 4J8XD 2DQNC 4YS3C 1P3BA 3AZGB 5AV9A 3WA9A 4XZQB 1Z2CB 5AV6A 4WZSB 3UT9D 3B0BA 1R4VA 5AV8D 3AZEC 4KUDC 3A6NA 2Y2JA 3AZHC 2Y2NA 3AZKA 1BH8B 3H0MC 4ZUXC 4E45A 4KGCD 3B0CW 3MGSA 3AN2B 1M1AA 5CPIB 3VH5W 5AVBB 4G92C 5B2JD 5G49B 3C1CA 2FJ7A 1WWIA 4XUJB 2CV5D 1P34C 2HUEC 4WU9D 1F1EA 5AV5A 4J8UC 4KHAA 5B2IB 3MGQA 5B1LC 4M6BA 1P3IC 3B6GB 3TU4B 3B0DC 5JRGB 1TZYB 3LELD 2ZY5A 1W2EA 5CPKB 1KX3D 3AZNB 1BFMA 4Z66C 2F8NB 3WTPE 3MGRB 3WKJB 4J8XB 5DNND 5FUGB 5G49A 4LD9D 3LJAB 2HIOA 5B2JC 4H9PA 3EPLA 5B31A 4H9OA 4H9SA 4WU9C 5KDMA 2NZDD 5E5AD 1HQ3C 3TU4A 2YFVB 1P3MD 4HGAB 3REHA 5JRGA 3AZIA 5GT3D 5B32D 4CSRB 4UUZB 5CPKA 3O62C 3LELC 3REJD 3X1SA 5CPJA 1S32C 3B6FD 4Z5TC 3KUYA 1KX3C 2F8NA 3AZMB 3F6TA 2LY8A 1WWSA 1P3PB 2XD5A 1P3BD 5DNNC 3MVDB 3AZLB 2ZY2A 5BS7C 3C1BD 5AV6D 1KU5A 2F8NH 2BYMB 3A6ND 3R45A 5B0YC 3AZKD 5E5AC 4G91C 4H9NB 4WU8C 1M1AD 2AROB 1P3MC 3KWQB 3A1IA 4UUZA 2Y2LA 5B32C 3C1CD 1ZLAB 2FJ7D 4AWLC 5B1LA 1AOIC 1P3FA 3MGQD 3V9RA 1P3PA 3AZGD 4WJ3C 3MVDA 4H9RB 5AVCC 3A1KA 2ZY4A 1P3GB 3W97A 4Z66A 3KSYA 2IO5C 3UTBB 1N1JA 2BYMA 4NFTA 3C1BC 1M19A 3LZ1A 5BO0B 2JE5A 5GSUC 4JJNB 3AN2D 5CPID 5F99C 2AROA 1P3LA 3KWQA 3AV1A 1ID3C 5AV9B 4XUJD 3WA9B 1M18C 5B33A 5B2ID 5AV6B 3VH6W 3B6GD 3REKA 3A6NB 3MNNC 2XD1A 3TU4D 3AZKB 3AZGC 3REHD 3REIA 5JRGD 4XZQC 3MGSB 3AZID 1S32A 2ZY3A 3WTPB 1P3KC 1M1AB 3W98C 1ULYA 3UTBA 5B40C 5CPKD 3C1CB 4X23B 1JFIA 2PYOA 2F8ND 4J8WC 4Z2MH 3WKJD 5AV5B 4R8PA 5DNMA 2VQRA 3EPJA 4KHAB 3AN2C 3X1VB 5B0ZC 3KXBA 3MGQB 5CPIC 1U35C 5CP6B 5AVBC 3LJAD 3FDDA 3MGPA 4ZBJB 4XUJC 4J8VB 1P3OB 3WAAB 5B2IC 2NQBC 3B6GC 5B1MA 4YM6C 3UTAA 3WTPA 3AZJA 3W99C 1TZYC 3AV2A 4X23A 2HIOB 4H9PB 3AZNC 3AZMD 1H3OA 5B31B 4H9OB 5BNXA 5GXQA 3MGRC 3X1VA 2G5HC 2YFWB 2CWEA 5KDMB 5B32G 3AFAA 4J8XC 1P3PD 1KX5B 3MVDD 1EQZA 5CP6A 3AZLD 3W96A 5CHLB 3IP4C 3REHB 3AYWA 3AZIB 4J8VA 1P3OA 3AZFA 3WAAA 5AY8A 2G5IC 2Y2KA 3LZ0A 1M19D 5B24A 3X1SB 3UT9C 5CPJB 5AV8C 5F99A 3KUYB 3NQJA 4NE6A 2AROD 1ID3A 4KGCC 3KWQD 1F66A 3AV1D 1ZLAD 1KX4A 5B33D 3RELA 4QLCA 2CV5C 3EPHA 3REKD 3AZMC 5GT0A 2YFWA 2RVQD 3R45B 1KX5A 3REID 3W98A 5B40A 2W8SA 4G92B 3AZLC 1P3GD 3X1UA 3UTBD 3X1TA 4J8WA 2JCHA 2F8NK 5BNVA 2PYOD 1P3AA 4J8UB 2FFFB 4JJND 5B1LB 4R8PD 1U35A 4YS3A 1P3FB 3KXBD 3V9RB 5AV9D 3WA9D 1T3UA 2J8PA 1ZLAC 3AZEA 4KUDA 4LD9C 3W97B 3AZHA 4Z66B 1N1JB 2Y2OA 4ZUXA 1PZRA 1M19B 3LZ1B 2NZDC 3MGSD 5B1MD 3UTAD 3WTPD 3AZJD 1P3LB 1P34A 4EO5B 5GT3C 4X23D 3AV1B 1A7WA 4J8UA 3REJC 5B33B 1P3IA 5C3IC 5AV5D 3B6FC 5GXQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1V D;  3REK B;  3NQU A;  5CP6 D;  1P3B C;  4WNN A;  3REI B;  3WA9 C;  4J8V D;  3O62 B;  1S32 B;  1P3O D;  3UT9 A;  3WAA D;  5AV8 A;  3LZ0 D;  4CAY A;  5AV6 C;  5B24 D;  2PYO B;  4H9Q A;  1JFI B;  3A6N C;  3AZK C;  4R8P B;  5DNM B;  1F66 D;  3MGS C;  5B2J A;  3KXB B;  1M1A C;  2HIO D;  3REL D;  4QLC D;  3C1C C;  3MGP B;  4WU9 A;  5B31 D;  2FJ7 C;  5GT0 D;  1HQ3 A;  5AV5 C;  5JA4 A;  1KX5 D;  4WU8 B;  3MGQ C;  5B1M B;  3O62 A;  3LEL A;  3UTA B;  3AZJ B;  4ZBJ C;  4Z5T A;  3AV2 B;  1KX3 A;  1P3A D;  5CPJ D;  1B6W A;  1TAF A;  3X1S D;  1AOI B;  3KUY D;  1H3O B;  5DNN A;  5BNX B;  5GXQ B;  3AFA B;  4LD9 A;  5BS7 A;  1EQZ B;  3W96 B;  3AZE D;  4KUD D;  3AYW B;  3VH6 T;  5B0Y A;  3AZF B;  2NZD A;  4ZUX D;  4H9S C;  5AY8 B;  5GSU B;  5E5A A;  3LZ0 B;  5B24 B;  4WU8 A;  5F99 B;  1P3M A;  3NQJ B;  3TU4 C;  5B32 A;  1ID3 B;  3REH C;  5JRG C;  3AZI C;  1F66 B;  1P34 D;  1KX4 B;  2BYK A;  4J8U D;  1AOI A;  1BH9 A;  5CPK C;  5CPJ C;  5B1L D;  3X1S C;  3REL B;  4QLC B;  1P3I D;  3KUY C;  1P3F D;  3MNN B;  5AVC A;  5GT0 B;  1P3K B;  3W98 B;  5B40 B;  3C1B A;  3LJA C;  3X1U B;  3W97 D;  4Z66 D;  3X1T B;  4J8W B;  5GSU A;  5BNV B;  3LZ1 D;  1P3A B;  3B0C T;  5B0Z B;  1U35 B;  4YS3 B;  1P3L D;  3VH5 T;  4HGA C;  1M18 A;  3AZE B;  4KUD B;  2NQB B;  3MNN A;  1HQ3 D;  3AZH B;  1P3F C;  4ZUX B;  3AZG A;  4XZQ A;  4YM6 B;  1P3K A;  1P3P C;  3W99 B;  4WV4 B;  3MVD C;  3O62 D;  1S32 D;  4Z5T D;  3W97 C;  1P34 B;  2HUE B;  1BH8 A;  3AN2 A;  3LZ1 C;  1M19 C;  5B0Z A;  1P3I B;  5CPI A;  5DNM D;  5AVB A;  1P3L C;  2ARO C;  3B0D B;  3NQU B;  4XUJ A;  3KWQ C;  4EO5 C;  4WNN B;  3MGP D;  3AV1 C;  5B2I A;  5B0Y D;  2NQB A;  5B33 C;  3UT9 B;  5AV8 B;  3B6G A;  4CAY B;  4WU8 D;  4NE5 A;  2JSS A;  3REK C;  4H9Q B;  4YM6 A;  4KGC B;  2RVQ C;  3W99 A;  1TZY A;  5B31 G;  3REI C;  3AV2 D;  5B2J B;  1P3G C;  3AZN A;  3UTB C;  1AOI D;  2CV5 B;  3MGR A;  3WKJ A;  4WU9 B;  2PYO C;  4J8X A;  5FUG A;  5AVC D;  3AFA D;  1HQ3 B;  4R8P C;  5JA4 B;  5DNM C;  3LJA A;  1EQZ D;  3KXB C;  3W96 D;  2L5A A;  5AV9 C;  2F8N G;  3AYW D;  3LEL B;  3MGP C;  3AZF D;  5AY8 D;  4Z5T B;  5GSU D;  1KX3 B;  1TAF B;  2YFV A;  5F99 D;  4KGC A;  1ID3 D;  5DNN B;  3VH6 A;  1M18 D;  4CSR A;  5B1M C;  3UTA C;  3WTP C;  3AZJ C;  1KX4 D;  3AV2 C;  4LD9 B;  4NE3 A;  2CV5 A;  3AZM A;  4X23 C;  3MNN D;  5B0Y B;  2NZD B;  5E5A B;  4XZQ D;  5GXQ C;  5BT1 D;  3X1V C;  4G91 B;  3AFA C;  3AZL A;  1P3K D;  3W98 D;  1P3M B;  5B40 D;  1EQZ C;  5CP6 C;  3X1U D;  3W96 C;  5GT3 B;  5B32 B;  3X1T D;  4AWL B;  3AYW C;  1B67 A;  4J8W D;  4J8V C;  3REJ B;  1P3O C;  5C3I B;  3AZF C;  3WAA C;  5AY8 C;  3B6F B;  2BYK B;  1HTA A;  1BH9 B;  3LZ0 C;  5B24 C;  4H9N A;  5B0Z D;  1U35 D;  4YS3 D;  5AVB D;  4DRA A;  5AVC B;  1P3B B;  1ZLA A;  1F66 C;  1KX4 C;  2IO5 B;  3C1B B;  2NQB D;  2HIO C;  3AZH D;  3REL C;  4QLC C;  3VH5 A;  1Q9C A;  4JJN C;  5B31 C;  3WKJ C;  4H9R A;  4YM6 D;  5GT0 C;  4DRB A;  3W99 D;  1TZY D;  5BT1 C;  1KX5 C;  1P3G A;  4E44 A;  5GT3 A;  3X1U C;  1M18 B;  3AZN D;  2FJ7 B;  5BO0 A;  3REJ A;  3X1T C;  4Z2M G;  3B6F A;  3MGR D;  4JJN A;  1P3A C;  4J8X D;  4YS3 C;  1P3B A;  3AZG B;  5AV9 A;  3WA9 A;  4XZQ B;  5AV6 A;  4WZS B;  3UT9 D;  3B0B A;  1R4V A;  5AV8 D;  3AZE C;  4KUD C;  3A6N A;  3AZH C;  3AZK A;  1BH8 B;  4ZUX C;  4KGC D;  4E45 A;  3B0C W;  3MGS A;  3AN2 B;  1M1A A;  5CPI B;  3VH5 W;  5AVB B;  4G92 C;  5B2J D;  5G49 B;  3C1C A;  2FJ7 A;  1WWI A;  4XUJ B;  2CV5 D;  1P34 C;  2HUE C;  4WU9 D;  1F1E A;  5AV5 A;  4J8U C;  4KHA A;  5B2I B;  3MGQ A;  5B1L C;  4M6B A;  1P3I C;  3B6G B;  3TU4 B;  3B0D C;  5JRG B;  1TZY B;  3LEL D;  5CPK B;  1KX3 D;  3AZN B;  1BFM A;  4Z66 C;  2F8N B;  3WTP E;  3MGR B;  3WKJ B;  4J8X B;  5DNN D;  5FUG B;  5G49 A;  4LD9 D;  3LJA B;  2HIO A;  5B2J C;  4H9P A;  5B31 A;  4H9O A;  4H9S A;  4WU9 C;  5KDM A;  2NZD D;  5E5A D;  1HQ3 C;  3TU4 A;  2YFV B;  1P3M D;  4HGA B;  3REH A;  5JRG A;  3AZI A;  5GT3 D;  5B32 D;  4CSR B;  4UUZ B;  5CPK A;  3O62 C;  3LEL C;  3REJ D;  3X1S A;  5CPJ A;  1S32 C;  3B6F D;  4Z5T C;  3KUY A;  1KX3 C;  2F8N A;  3AZM B;  2LY8 A;  1WWS A;  1P3P B;  1P3B D;  5DNN C;  3MVD B;  3AZL B;  5BS7 C;  3C1B D;  5AV6 D;  1KU5 A;  2F8N H;  2BYM B;  3A6N D;  3R45 A;  5B0Y C;  3AZK D;  5E5A C;  4G91 C;  4H9N B;  4WU8 C;  1M1A D;  2ARO B;  1P3M C;  3KWQ B;  4UUZ A;  3C1C D;  5B32 C;  2FJ7 D;  1ZLA B;  4AWL C;  5B1L A;  1AOI C;  1P3F A;  3MGQ D;  3V9R A;  1P3P A;  3AZG D;  3MVD A;  4H9R B;  5AVC C;  1P3G B;  3W97 A;  4Z66 A;  3KSY A;  2IO5 C;  3UTB B;  1N1J A;  2BYM A;  4NFT A;  3C1B C;  1M19 A;  3LZ1 A;  5BO0 B;  5GSU C;  4JJN B;  3AN2 D;  5CPI D;  5F99 C;  2ARO A;  1P3L A;  3KWQ A;  3AV1 A;  1ID3 C;  5AV9 B;  4XUJ D;  3WA9 B;  1M18 C;  5B33 A;  5B2I D;  5AV6 B;  3VH6 W;  3B6G D;  3REK A;  3A6N B;  3MNN C;  3TU4 D;  3AZK B;  3AZG C;  3REH D;  3REI A;  5JRG D;  4XZQ C;  3MGS B;  3AZI D;  1S32 A;  1P3K C;  3WTP B;  1M1A B;  3W98 C;  1ULY A;  3UTB A;  5B40 C;  5CPK D;  3C1C B;  4X23 B;  1JFI A;  2PYO A;  2F8N D;  4J8W C;  4Z2M H;  3WKJ D;  5AV5 B;  4R8P A;  5DNM A;  4KHA B;  3AN2 C;  3X1V B;  5B0Z C;  3KXB A;  3MGQ B;  5CPI C;  1U35 C;  5CP6 B;  5AVB C;  3LJA D;  3MGP A;  4ZBJ B;  4XUJ C;  4J8V B;  1P3O B;  3WAA B;  5B2I C;  2NQB C;  3B6G C;  5B1M A;  4YM6 C;  3UTA A;  3WTP A;  3AZJ A;  3W99 C;  1TZY C;  3AV2 A;  4X23 A;  2HIO B;  4H9P B;  3AZN C;  3AZM D;  1H3O A;  5B31 B;  4H9O B;  5BNX A;  5GXQ A;  3MGR C;  3X1V A;  2YFW B;  5KDM B;  2CWE A;  5B32 G;  3AFA A;  4J8X C;  1P3P D;  1KX5 B;  3MVD D;  1EQZ A;  5CP6 A;  3AZL D;  3W96 A;  5CHL B;  3REH B;  3AYW A;  3AZI B;  4J8V A;  1P3O A;  3AZF A;  3WAA A;  5AY8 A;  3LZ0 A;  1M19 D;  5B24 A;  3X1S B;  3UT9 C;  5CPJ B;  5AV8 C;  5F99 A;  3KUY B;  3NQJ A;  4NE6 A;  2ARO D;  1ID3 A;  4KGC C;  3KWQ D;  1F66 A;  3AV1 D;  1ZLA D;  1KX4 A;  5B33 D;  3REL A;  4QLC A;  2CV5 C;  3REK D;  3AZM C;  5GT0 A;  2YFW A;  2RVQ D;  3R45 B;  1KX5 A;  3REI D;  3W98 A;  5B40 A;  4G92 B;  3AZL C;  1P3G D;  3X1U A;  3UTB D;  3X1T A;  4J8W A;  2F8N K;  5BNV A;  2PYO D;  1P3A A;  4J8U B;  4JJN D;  5B1L B;  4R8P D;  1U35 A;  4YS3 A;  1P3F B;  3KXB D;  3V9R B;  5AV9 D;  3WA9 D;  1ZLA C;  3AZE A;  4KUD A;  4LD9 C;  3W97 B;  3AZH A;  4Z66 B;  1N1J B;  4ZUX A;  1M19 B;  3LZ1 B;  2NZD C;  3MGS D;  5B1M D;  3UTA D;  3WTP D;  3AZJ D;  1P3L B;  1P34 A;  4EO5 B;  5GT3 C;  4X23 D;  3AV1 B;  1A7W A;  4J8U A;  3REJ C;  5B33 B;  1P3I A;  5C3I C;  5AV5 D;  3B6F C;  5GXQ D; 
#chains in the Genus database with same CATH topology
 2RIQ A;  3X1V D;  3REK B;  3NQU A;  5CP6 D;  1P3B C;  4WNN A;  3REI B;  3WA9 C;  4J8V D;  3O62 B;  1S32 B;  1P3O D;  3UT9 A;  3WAA D;  5AV8 A;  3LZ0 D;  3KFU G;  4CAY A;  5AV6 C;  5B24 D;  2PYO B;  4H9Q A;  1JFI B;  3A6N C;  3AZK C;  4R8P B;  5DNM B;  1F66 D;  3MGS C;  5B2J A;  3KXB B;  1M1A C;  2HIO D;  3P5J B;  3REL D;  4QLC D;  3C1C C;  3MGP B;  4WU9 A;  5B31 D;  2FJ7 C;  5GT0 D;  1HQ3 A;  5AV5 C;  5JA4 A;  1KX5 D;  4WU8 B;  3MGQ C;  5B1M B;  3O62 A;  3LEL A;  3UTA B;  3AZJ B;  4ZBJ C;  3H0R C;  4Z5T A;  3AV2 B;  1KX3 A;  1P3A D;  5CPJ D;  1B6W A;  1TAF A;  3X1S D;  1AOI B;  3KUY D;  2BG1 A;  1H3O B;  5DNN A;  5BNX B;  5GXQ B;  3AFA B;  2Y2H A;  5BS7 A;  1EQZ B;  4LD9 A;  3W96 B;  3AZE D;  4KUD D;  3AYW B;  3VH6 T;  5B0Y A;  3AZF B;  2NZD A;  4ZUX D;  4H9S C;  5AY8 B;  5GSU B;  5E5A A;  3LZ0 B;  5B24 B;  4WU8 A;  5F99 B;  1P3M A;  3NQJ B;  3TU4 C;  5B32 A;  1ID3 B;  3REH C;  5JRG C;  3AZI C;  1F66 B;  1P34 D;  1KX4 B;  2BYK A;  4J8U D;  1AOI A;  1BH9 A;  5CPK C;  5CPJ C;  5B1L D;  3X1S C;  3REL B;  4QLC B;  1P3I D;  3AL0 C;  3KUY C;  1P3F D;  3MNN B;  5AVC A;  5GT0 B;  1P3K B;  3W98 B;  5B40 B;  3C1B A;  3LJA C;  3X1U B;  3W97 D;  4Z66 D;  3X1T B;  4J8W B;  5GSU A;  5BNV B;  3LZ1 D;  1P3A B;  3B0C T;  5B0Z B;  1U35 B;  4YS3 B;  1P3L D;  3VH5 T;  4HGA C;  1M18 A;  3AZE B;  4KUD B;  2NQB B;  3MNN A;  1HQ3 D;  3AZH B;  1P3F C;  4ZUX B;  3AZG A;  4UPK A;  4XZQ A;  4YM6 B;  1P3K A;  1P3P C;  3W99 B;  4WV4 B;  3MVD C;  3O62 D;  1S32 D;  4Z5T D;  3W97 C;  3EPK A;  1P34 B;  2HUE B;  1BH8 A;  2ZM5 A;  3AN2 A;  3LZ1 C;  1M19 C;  5B0Z A;  1P3I B;  5CPI A;  5DNM D;  5AVB A;  1P3L C;  2ARO C;  3B0D B;  3NQU B;  4XUJ A;  3KWQ C;  4EO5 C;  4WNN B;  3MGP D;  3AV1 C;  5B2I A;  5B0Y D;  2NQB A;  5B33 C;  3UT9 B;  5AV8 B;  2F2A C;  3B6G A;  4CAY B;  4WU8 D;  4NE5 A;  2JSS A;  3REK C;  4H9Q B;  4YM6 A;  4KGC B;  2RVQ C;  3W99 A;  1TZY A;  5B31 G;  3REI C;  3AV2 D;  5B2J B;  1P3G C;  3AZN A;  3UTB C;  1AOI D;  2CV5 B;  3MGR A;  3WKJ A;  4WU9 B;  2PYO C;  4J8X A;  5FUG A;  5AVC D;  3AFA D;  1HQ3 B;  4R8P C;  5JA4 B;  5DNM C;  3LJA A;  1EQZ D;  3KXB C;  3W96 D;  2L5A A;  5AV9 C;  2F8N G;  3AYW D;  3LEL B;  3MGP C;  3AZF D;  5AY8 D;  4Z5T B;  5GSU D;  1KX3 B;  1TAF B;  2YFV A;  5F99 D;  4KGC A;  1ID3 D;  5DNN B;  3VH6 A;  1M18 D;  4CSR A;  5B1M C;  4DQY B;  3UTA C;  3WTP C;  3AZJ C;  1KX4 D;  3AV2 C;  4LD9 B;  4NE3 A;  2CV5 A;  3EG5 B;  3AZM A;  2UWX A;  4X23 C;  3MNN D;  5B0Y B;  2NZD B;  2DF4 C;  5E5A B;  4XZQ D;  5GXQ C;  5BT1 D;  3X1V C;  4G91 B;  2Y2G A;  3AFA C;  3AZL A;  1P3K D;  3W98 D;  1P3M B;  5B40 D;  1EQZ C;  5CP6 C;  3X1U D;  3W96 C;  5GT3 B;  5B32 B;  3X1T D;  4AWL B;  3H0L C;  1B67 A;  4J8W D;  4J8V C;  3REJ B;  3AYW C;  1P3O C;  5C3I B;  3AZF C;  3WAA C;  5AY8 C;  3B6F B;  2BYK B;  1HTA A;  1BH9 B;  3LZ0 C;  5B24 C;  4H9N A;  5B0Z D;  1U35 D;  4YS3 D;  5AVB D;  4DRA A;  5AVC B;  1P3B B;  1ZLA A;  1F66 C;  2Y2M A;  1KX4 C;  2IO5 B;  3C1B B;  2Y2Q A;  2NQB D;  2Y2P A;  2HIO C;  3AZH D;  3REL C;  2Y2I A;  3VH5 A;  4QLC C;  1Q9C A;  4JJN C;  5B31 C;  3WKJ C;  4H9R A;  4YM6 D;  5GT0 C;  4DRB A;  3W99 D;  1TZY D;  5BT1 C;  1KX5 C;  1P3G A;  4E44 A;  5GT3 A;  3X1U C;  1M18 B;  3AZN D;  2FJ7 B;  5BO0 A;  3REJ A;  3X1T C;  4Z2M G;  3B6F A;  3MGR D;  4JJN A;  1P3A C;  4J8X D;  2DQN C;  4YS3 C;  1P3B A;  3AZG B;  5AV9 A;  3WA9 A;  4XZQ B;  1Z2C B;  5AV6 A;  4WZS B;  3UT9 D;  3B0B A;  1R4V A;  5AV8 D;  3AZE C;  4KUD C;  3A6N A;  2Y2J A;  3AZH C;  2Y2N A;  3AZK A;  1BH8 B;  3H0M C;  4ZUX C;  4E45 A;  4KGC D;  3B0C W;  3MGS A;  3AN2 B;  1M1A A;  5CPI B;  3VH5 W;  5AVB B;  4G92 C;  5B2J D;  5G49 B;  3C1C A;  2FJ7 A;  1WWI A;  4XUJ B;  2CV5 D;  1P34 C;  2HUE C;  4WU9 D;  1F1E A;  5AV5 A;  4J8U C;  4KHA A;  5B2I B;  3MGQ A;  5B1L C;  4M6B A;  1P3I C;  3B6G B;  3TU4 B;  3B0D C;  5JRG B;  1TZY B;  3LEL D;  2ZY5 A;  1W2E A;  5CPK B;  1KX3 D;  3AZN B;  1BFM A;  4Z66 C;  2F8N B;  3WTP E;  3MGR B;  3WKJ B;  4J8X B;  5DNN D;  5FUG B;  5G49 A;  4LD9 D;  3LJA B;  2HIO A;  5B2J C;  4H9P A;  3EPL A;  5B31 A;  4H9O A;  4H9S A;  4WU9 C;  5KDM A;  2NZD D;  5E5A D;  1HQ3 C;  3TU4 A;  2YFV B;  1P3M D;  4HGA B;  3REH A;  5JRG A;  3AZI A;  5GT3 D;  5B32 D;  4CSR B;  4UUZ B;  5CPK A;  3O62 C;  3LEL C;  3REJ D;  3X1S A;  5CPJ A;  1S32 C;  3B6F D;  4Z5T C;  3KUY A;  1KX3 C;  2F8N A;  3AZM B;  3F6T A;  2LY8 A;  1WWS A;  1P3P B;  2XD5 A;  1P3B D;  5DNN C;  3MVD B;  3AZL B;  2ZY2 A;  5BS7 C;  3C1B D;  5AV6 D;  1KU5 A;  2F8N H;  2BYM B;  3A6N D;  3R45 A;  5B0Y C;  3AZK D;  5E5A C;  4G91 C;  4H9N B;  4WU8 C;  1M1A D;  2ARO B;  1P3M C;  3KWQ B;  3A1I A;  4UUZ A;  2Y2L A;  5B32 C;  3C1C D;  1ZLA B;  2FJ7 D;  4AWL C;  5B1L A;  1AOI C;  1P3F A;  3MGQ D;  3V9R A;  1P3P A;  3AZG D;  4WJ3 C;  3MVD A;  4H9R B;  5AVC C;  3A1K A;  2ZY4 A;  1P3G B;  3W97 A;  4Z66 A;  3KSY A;  2IO5 C;  3UTB B;  1N1J A;  2BYM A;  4NFT A;  3C1B C;  1M19 A;  3LZ1 A;  5BO0 B;  2JE5 A;  5GSU C;  4JJN B;  3AN2 D;  5CPI D;  5F99 C;  2ARO A;  1P3L A;  3KWQ A;  3AV1 A;  1ID3 C;  5AV9 B;  4XUJ D;  3WA9 B;  1M18 C;  5B33 A;  5B2I D;  5AV6 B;  3VH6 W;  3B6G D;  3REK A;  3A6N B;  3MNN C;  2XD1 A;  3TU4 D;  3AZK B;  3AZG C;  3REH D;  3REI A;  5JRG D;  4XZQ C;  3MGS B;  3AZI D;  1S32 A;  2ZY3 A;  3WTP B;  1P3K C;  1M1A B;  3W98 C;  1ULY A;  3UTB A;  5B40 C;  5CPK D;  3C1C B;  4X23 B;  1JFI A;  2PYO A;  2F8N D;  4J8W C;  4Z2M H;  3WKJ D;  5AV5 B;  4R8P A;  5DNM A;  2VQR A;  3EPJ A;  4KHA B;  3AN2 C;  3X1V B;  5B0Z C;  3KXB A;  3MGQ B;  5CPI C;  1U35 C;  5CP6 B;  5AVB C;  3LJA D;  3FDD A;  3MGP A;  4ZBJ B;  4XUJ C;  4J8V B;  1P3O B;  3WAA B;  5B2I C;  2NQB C;  3B6G C;  5B1M A;  4YM6 C;  3UTA A;  3WTP A;  3AZJ A;  3W99 C;  1TZY C;  3AV2 A;  4X23 A;  2HIO B;  4H9P B;  3AZN C;  3AZM D;  1H3O A;  5B31 B;  4H9O B;  5BNX A;  5GXQ A;  3MGR C;  3X1V A;  2G5H C;  2YFW B;  2CWE A;  5KDM B;  5B32 G;  3AFA A;  4J8X C;  1P3P D;  1KX5 B;  3MVD D;  1EQZ A;  5CP6 A;  3AZL D;  3W96 A;  5CHL B;  3IP4 C;  3REH B;  3AYW A;  3AZI B;  4J8V A;  1P3O A;  3AZF A;  3WAA A;  5AY8 A;  2G5I C;  2Y2K A;  3LZ0 A;  1M19 D;  5B24 A;  3X1S B;  3UT9 C;  5CPJ B;  5AV8 C;  5F99 A;  3KUY B;  3NQJ A;  4NE6 A;  2ARO D;  1ID3 A;  4KGC C;  3KWQ D;  1F66 A;  3AV1 D;  1ZLA D;  1KX4 A;  5B33 D;  3REL A;  4QLC A;  2CV5 C;  3EPH A;  3REK D;  3AZM C;  5GT0 A;  2YFW A;  2RVQ D;  3R45 B;  1KX5 A;  3REI D;  3W98 A;  5B40 A;  2W8S A;  4G92 B;  3AZL C;  1P3G D;  3X1U A;  3UTB D;  3X1T A;  4J8W A;  2JCH A;  2F8N K;  5BNV A;  2PYO D;  1P3A A;  4J8U B;  2FFF B;  4JJN D;  5B1L B;  4R8P D;  1U35 A;  4YS3 A;  1P3F B;  3KXB D;  3V9R B;  5AV9 D;  3WA9 D;  1T3U A;  2J8P A;  1ZLA C;  3AZE A;  4KUD A;  4LD9 C;  3W97 B;  3AZH A;  4Z66 B;  1N1J B;  2Y2O A;  4ZUX A;  1PZR A;  1M19 B;  3LZ1 B;  2NZD C;  3MGS D;  5B1M D;  3UTA D;  3WTP D;  3AZJ D;  1P3L B;  1P34 A;  4EO5 B;  5GT3 C;  4X23 D;  3AV1 B;  1A7W A;  4J8U A;  3REJ C;  5B33 B;  1P3I A;  5C3I C;  5AV5 D;  3B6F C;  5GXQ D; 
#chains in the Genus database with same CATH homology
 2RIQ A;  3X1V D;  3REK B;  3NQU A;  5CP6 D;  1P3B C;  4WNN A;  3REI B;  3WA9 C;  4J8V D;  3O62 B;  1S32 B;  1P3O D;  3UT9 A;  3WAA D;  5AV8 A;  3LZ0 D;  3KFU G;  4CAY A;  5AV6 C;  5B24 D;  2PYO B;  4H9Q A;  1JFI B;  3A6N C;  3AZK C;  4R8P B;  5DNM B;  1F66 D;  3MGS C;  5B2J A;  3KXB B;  1M1A C;  2HIO D;  3P5J B;  3REL D;  4QLC D;  3C1C C;  3MGP B;  4WU9 A;  5B31 D;  2FJ7 C;  5GT0 D;  1HQ3 A;  5AV5 C;  5JA4 A;  1KX5 D;  4WU8 B;  3MGQ C;  5B1M B;  3O62 A;  3LEL A;  3UTA B;  3AZJ B;  4ZBJ C;  3H0R C;  4Z5T A;  3AV2 B;  1KX3 A;  1P3A D;  5CPJ D;  1B6W A;  1TAF A;  3X1S D;  1AOI B;  3KUY D;  2BG1 A;  1H3O B;  5DNN A;  5BNX B;  5GXQ B;  3AFA B;  2Y2H A;  5BS7 A;  1EQZ B;  4LD9 A;  3W96 B;  3AZE D;  4KUD D;  3AYW B;  3VH6 T;  5B0Y A;  3AZF B;  2NZD A;  4ZUX D;  4H9S C;  5AY8 B;  5GSU B;  5E5A A;  3LZ0 B;  5B24 B;  4WU8 A;  5F99 B;  1P3M A;  3NQJ B;  3TU4 C;  5B32 A;  1ID3 B;  3REH C;  5JRG C;  3AZI C;  1F66 B;  1P34 D;  1KX4 B;  2BYK A;  4J8U D;  1AOI A;  1BH9 A;  5CPK C;  5CPJ C;  5B1L D;  3X1S C;  3REL B;  4QLC B;  1P3I D;  3AL0 C;  3KUY C;  1P3F D;  3MNN B;  5AVC A;  5GT0 B;  1P3K B;  3W98 B;  5B40 B;  3C1B A;  3LJA C;  3X1U B;  3W97 D;  4Z66 D;  3X1T B;  4J8W B;  5GSU A;  5BNV B;  3LZ1 D;  1P3A B;  3B0C T;  5B0Z B;  1U35 B;  4YS3 B;  1P3L D;  3VH5 T;  4HGA C;  1M18 A;  3AZE B;  4KUD B;  2NQB B;  3MNN A;  1HQ3 D;  3AZH B;  1P3F C;  4ZUX B;  3AZG A;  4UPK A;  4XZQ A;  4YM6 B;  1P3K A;  1P3P C;  3W99 B;  4WV4 B;  3MVD C;  3O62 D;  1S32 D;  4Z5T D;  3W97 C;  3EPK A;  1P34 B;  2HUE B;  1BH8 A;  2ZM5 A;  3AN2 A;  3LZ1 C;  1M19 C;  5B0Z A;  1P3I B;  5CPI A;  5DNM D;  5AVB A;  1P3L C;  2ARO C;  3B0D B;  3NQU B;  4XUJ A;  3KWQ C;  4EO5 C;  4WNN B;  3MGP D;  3AV1 C;  5B2I A;  5B0Y D;  2NQB A;  5B33 C;  3UT9 B;  5AV8 B;  2F2A C;  3B6G A;  4CAY B;  4WU8 D;  4NE5 A;  2JSS A;  3REK C;  4H9Q B;  4YM6 A;  4KGC B;  2RVQ C;  3W99 A;  1TZY A;  5B31 G;  3REI C;  3AV2 D;  5B2J B;  1P3G C;  3AZN A;  3UTB C;  1AOI D;  2CV5 B;  3MGR A;  3WKJ A;  4WU9 B;  2PYO C;  4J8X A;  5FUG A;  5AVC D;  3AFA D;  1HQ3 B;  4R8P C;  5JA4 B;  5DNM C;  3LJA A;  1EQZ D;  3KXB C;  3W96 D;  2L5A A;  5AV9 C;  2F8N G;  3AYW D;  3LEL B;  3MGP C;  3AZF D;  5AY8 D;  4Z5T B;  5GSU D;  1KX3 B;  1TAF B;  2YFV A;  5F99 D;  4KGC A;  1ID3 D;  5DNN B;  3VH6 A;  1M18 D;  4CSR A;  5B1M C;  4DQY B;  3UTA C;  3WTP C;  3AZJ C;  1KX4 D;  3AV2 C;  4LD9 B;  4NE3 A;  2CV5 A;  3EG5 B;  3AZM A;  2UWX A;  4X23 C;  3MNN D;  5B0Y B;  2NZD B;  2DF4 C;  5E5A B;  4XZQ D;  5GXQ C;  5BT1 D;  3X1V C;  4G91 B;  2Y2G A;  3AFA C;  3AZL A;  1P3K D;  3W98 D;  1P3M B;  5B40 D;  1EQZ C;  5CP6 C;  3X1U D;  3W96 C;  5GT3 B;  5B32 B;  3X1T D;  4AWL B;  3H0L C;  1B67 A;  4J8W D;  4J8V C;  3REJ B;  3AYW C;  1P3O C;  5C3I B;  3AZF C;  3WAA C;  5AY8 C;  3B6F B;  2BYK B;  1HTA A;  1BH9 B;  3LZ0 C;  5B24 C;  4H9N A;  5B0Z D;  1U35 D;  4YS3 D;  5AVB D;  4DRA A;  5AVC B;  1P3B B;  1ZLA A;  1F66 C;  2Y2M A;  1KX4 C;  2IO5 B;  3C1B B;  2Y2Q A;  2NQB D;  2Y2P A;  2HIO C;  3AZH D;  3REL C;  2Y2I A;  3VH5 A;  4QLC C;  1Q9C A;  4JJN C;  5B31 C;  3WKJ C;  4H9R A;  4YM6 D;  5GT0 C;  4DRB A;  3W99 D;  1TZY D;  5BT1 C;  1KX5 C;  1P3G A;  4E44 A;  5GT3 A;  3X1U C;  1M18 B;  3AZN D;  2FJ7 B;  5BO0 A;  3REJ A;  3X1T C;  4Z2M G;  3B6F A;  3MGR D;  4JJN A;  1P3A C;  4J8X D;  2DQN C;  4YS3 C;  1P3B A;  3AZG B;  5AV9 A;  3WA9 A;  4XZQ B;  1Z2C B;  5AV6 A;  4WZS B;  3UT9 D;  3B0B A;  1R4V A;  5AV8 D;  3AZE C;  4KUD C;  3A6N A;  2Y2J A;  3AZH C;  2Y2N A;  3AZK A;  1BH8 B;  3H0M C;  4ZUX C;  4E45 A;  4KGC D;  3B0C W;  3MGS A;  3AN2 B;  1M1A A;  5CPI B;  3VH5 W;  5AVB B;  4G92 C;  5B2J D;  5G49 B;  3C1C A;  2FJ7 A;  1WWI A;  4XUJ B;  2CV5 D;  1P34 C;  2HUE C;  4WU9 D;  1F1E A;  5AV5 A;  4J8U C;  4KHA A;  5B2I B;  3MGQ A;  5B1L C;  4M6B A;  1P3I C;  3B6G B;  3TU4 B;  3B0D C;  5JRG B;  1TZY B;  3LEL D;  2ZY5 A;  1W2E A;  5CPK B;  1KX3 D;  3AZN B;  1BFM A;  4Z66 C;  2F8N B;  3WTP E;  3MGR B;  3WKJ B;  4J8X B;  5DNN D;  5FUG B;  5G49 A;  4LD9 D;  3LJA B;  2HIO A;  5B2J C;  4H9P A;  3EPL A;  5B31 A;  4H9O A;  4H9S A;  4WU9 C;  5KDM A;  2NZD D;  5E5A D;  1HQ3 C;  3TU4 A;  2YFV B;  1P3M D;  4HGA B;  3REH A;  5JRG A;  3AZI A;  5GT3 D;  5B32 D;  4CSR B;  4UUZ B;  5CPK A;  3O62 C;  3LEL C;  3REJ D;  3X1S A;  5CPJ A;  1S32 C;  3B6F D;  4Z5T C;  3KUY A;  1KX3 C;  2F8N A;  3AZM B;  3F6T A;  2LY8 A;  1WWS A;  1P3P B;  2XD5 A;  1P3B D;  5DNN C;  3MVD B;  3AZL B;  2ZY2 A;  5BS7 C;  3C1B D;  5AV6 D;  1KU5 A;  2F8N H;  2BYM B;  3A6N D;  3R45 A;  5B0Y C;  3AZK D;  5E5A C;  4G91 C;  4H9N B;  4WU8 C;  1M1A D;  2ARO B;  1P3M C;  3KWQ B;  3A1I A;  4UUZ A;  2Y2L A;  5B32 C;  3C1C D;  1ZLA B;  2FJ7 D;  4AWL C;  5B1L A;  1AOI C;  1P3F A;  3MGQ D;  3V9R A;  1P3P A;  3AZG D;  4WJ3 C;  3MVD A;  4H9R B;  5AVC C;  3A1K A;  2ZY4 A;  1P3G B;  3W97 A;  4Z66 A;  3KSY A;  2IO5 C;  3UTB B;  1N1J A;  2BYM A;  4NFT A;  3C1B C;  1M19 A;  3LZ1 A;  5BO0 B;  2JE5 A;  5GSU C;  4JJN B;  3AN2 D;  5CPI D;  5F99 C;  2ARO A;  1P3L A;  3KWQ A;  3AV1 A;  1ID3 C;  5AV9 B;  4XUJ D;  3WA9 B;  1M18 C;  5B33 A;  5B2I D;  5AV6 B;  3VH6 W;  3B6G D;  3REK A;  3A6N B;  3MNN C;  2XD1 A;  3TU4 D;  3AZK B;  3AZG C;  3REH D;  3REI A;  5JRG D;  4XZQ C;  3MGS B;  3AZI D;  1S32 A;  2ZY3 A;  3WTP B;  1P3K C;  1M1A B;  3W98 C;  1ULY A;  3UTB A;  5B40 C;  5CPK D;  3C1C B;  4X23 B;  1JFI A;  2PYO A;  2F8N D;  4J8W C;  4Z2M H;  3WKJ D;  5AV5 B;  4R8P A;  5DNM A;  2VQR A;  3EPJ A;  4KHA B;  3AN2 C;  3X1V B;  5B0Z C;  3KXB A;  3MGQ B;  5CPI C;  1U35 C;  5CP6 B;  5AVB C;  3LJA D;  3FDD A;  3MGP A;  4ZBJ B;  4XUJ C;  4J8V B;  1P3O B;  3WAA B;  5B2I C;  2NQB C;  3B6G C;  5B1M A;  4YM6 C;  3UTA A;  3WTP A;  3AZJ A;  3W99 C;  1TZY C;  3AV2 A;  4X23 A;  2HIO B;  4H9P B;  3AZN C;  3AZM D;  1H3O A;  5B31 B;  4H9O B;  5BNX A;  5GXQ A;  3MGR C;  3X1V A;  2G5H C;  2YFW B;  2CWE A;  5KDM B;  5B32 G;  3AFA A;  4J8X C;  1P3P D;  1KX5 B;  3MVD D;  1EQZ A;  5CP6 A;  3AZL D;  3W96 A;  5CHL B;  3IP4 C;  3REH B;  3AYW A;  3AZI B;  4J8V A;  1P3O A;  3AZF A;  3WAA A;  5AY8 A;  2G5I C;  2Y2K A;  3LZ0 A;  1M19 D;  5B24 A;  3X1S B;  3UT9 C;  5CPJ B;  5AV8 C;  5F99 A;  3KUY B;  3NQJ A;  4NE6 A;  2ARO D;  1ID3 A;  4KGC C;  3KWQ D;  1F66 A;  3AV1 D;  1ZLA D;  1KX4 A;  5B33 D;  3REL A;  4QLC A;  2CV5 C;  3EPH A;  3REK D;  3AZM C;  5GT0 A;  2YFW A;  2RVQ D;  3R45 B;  1KX5 A;  3REI D;  3W98 A;  5B40 A;  2W8S A;  4G92 B;  3AZL C;  1P3G D;  3X1U A;  3UTB D;  3X1T A;  4J8W A;  2JCH A;  2F8N K;  5BNV A;  2PYO D;  1P3A A;  4J8U B;  2FFF B;  4JJN D;  5B1L B;  4R8P D;  1U35 A;  4YS3 A;  1P3F B;  3KXB D;  3V9R B;  5AV9 D;  3WA9 D;  1T3U A;  2J8P A;  1ZLA C;  3AZE A;  4KUD A;  4LD9 C;  3W97 B;  3AZH A;  4Z66 B;  1N1J B;  2Y2O A;  4ZUX A;  1PZR A;  1M19 B;  3LZ1 B;  2NZD C;  3MGS D;  5B1M D;  3UTA D;  3WTP D;  3AZJ D;  1P3L B;  1P34 A;  4EO5 B;  5GT3 C;  4X23 D;  3AV1 B;  1A7W A;  4J8U A;  3REJ C;  5B33 B;  1P3I A;  5C3I C;  5AV5 D;  3B6F C;  5GXQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...