4WNNA

Spt16-h2a-h2b fact histone complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H2A.1
publication title FACT Disrupts Nucleosome Structure by Binding H2A-H2B with Conserved Peptide Motifs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 86
sequence length 86
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wnnA00
1ULYA 4J8VB 3REKA 3X1SB 3W99C 3WAAD 4CAYB 5B2JD 1U35C 4XUJB 3X1TC 2F8NH 4X23C 1KX4A 5DNMD 3VH5A 4XZQA 5AV5B 4J8UB 3REHD 4R8PD 1ZLAD 1P3PA 2YFVA 1HQ3C 3KXBB 4YM6C 4Z5TA 3MGSD 1P3KD 3AN2A 4H9OA 1KX5A 5BS7C 5CPIC 4JJNA 1R4VA 1KX3B 5B31C 3AZMD 3AZIC 5BO0A 4H9QA 3MVDA 1TZYB 5AVBB 2CV5D 3UTAC 1H3OB 3TU4B 1ID3A 1M1AC 3W96C 3UTBB 3AZKB 2F8NK 4M6BA 4KGCA 3LELD 4CSRA 3AV2A 1EQZB 4H9RB 3RELA 3LJAB 5BNVA 3AZFC 5B0ZD 3B6FB 4WU8B 3V9RA 3B6GC 4UUZA 3KWQD 3W97B 3W99A 1A7WA 5CPJD 5AVCC 4J8VD 3X1SD 3MNNC 5B31G 5DNNB 3X1UB 3A6NC 4XUJD 2YFWA 3AZGB 5GXQA 2NZDB 4WU9B 1P34B 5AV5D 5B0YC 4E45A 4J8UD 3KXBD 4ZUXA 5BS7A 1M18C 3AV1C 5CPIA 1P3IC 1P3MB 2HIOB 1BH9B 5CPKA 5B31A 1AOIB 5F99C 2AROC 3AZIA 5C3IC 1TAFA 1KX3D 3NQUA 5BNXA 5CP6B 3REJC 3UTAA 4EO5B 3WTPB 1TZYD 1F66C 2F8NB 3VH5W 5AVBD 3W96A 1M1AA 3B0CW 5B32C 3X1VC 3TU4D 5GT3B 3KSYA 3O62C 5B40C 3KUYB 2BYKA 3AZKD 3UTBD 1P3AB 1S32B 3AZNC 3B6GA 1EQZD 5AV9B 3W98B 3LJAD 3B6FD 4WU8D 3AZJB 3W97D 3REIC 5GSUB 3MNNA 1N1JA 3MGRC 3A6NA 2RVQD 5BT1C 2HUEC 5E5AB 5B0YA 4J8WA 5DNND 3X1UD 1P3GB 3AZGD 1JFIB 2NZDD 4WU9D 1P34D 5B1LC 5CHLB 1WWSA 5JRGB 4J8XB 3AZHC 1M18A 3REKB 3AV1A 5B24C 5B32G 1P3IA 4NFTA 5GT0C 1F1EA 3WA9C 1P3MD 5F99A 4XZQB 3MGQB 4QLCC 2AROA 2HIOD 2PYOC 1P3PB 1AOID 5B1MA 3REJA 4Z5TB 5B2IB 3C1CB 3AN2B 3LZ0A 3AZEC 5CP6D 5B32A 3WTPD 3X1VA 4JJNB 3O62A 2F8ND 4WV4B 5GT3D 2BYMA 5KDMA 3KUYD 5B2JC 4WNNA 4H9QB 3MVDB 5DNMC 1P3AD 1S32D 3REHC 1ZLAC 4H9SA 4ZBJC 5AV9D 3REIA 3W98D 1ID3B 3MGSC 5AV8C 3AZJD 5GSUD 4KGCB 3MGPB 4CSRB 5E5AD 3AV2B 3RELB 5BNVB 3AZHA 1P3GD 5B24A 3W99B 3AZMC 4J8XD 5GT0A 3WA9A 3REKD 4H9PA 1M19C 4QLCA 2YFWB 5GXQB 5G49A 4XZQD 3MGQD 1P3LC 4KHAA 1P3PD 3WKJA 3AZEA 4NE5A 4ZUXB 4Z5TD 5B2ID 3C1CD 3AN2D 5CPIB 1Q9CA 3KWQC 1P3OB 4JJND 5CPKB 5B31B 5CPJC 5B2JA 3X1SC 3AZIB 3VH6A 5BNXB 5DNMA 3UTAB 1ZLAA 3LZ1A 3MVDD 2FJ7B 5AV5C 4E44A 1M1AB 2CWEA 4J8UC 3MGSA 5AV8A 3W96B 2IO5B 3KXBC 1ID3D 1P3FA 4KGCD 3MGPD 4Z66A 3AV2D 3UT9B 3RELD 3AZMA 3B0DB 1U35A 4Z2MG 3X1TA 1KX3C 3W99D 3MNNB 1N1JB 4X23A 1M19A 3R45B 3A6NB 5AVBC 5JA4A 1HQ3A 4J8WB 1P3LA 4YM6A 5GXQD 3AFAB 3AZKC 1M18B 4YS3C 1P3IB 2NQBC 4ZUXD 3KWQA 1EQZC 5CPID 5F99B 5CPJA 3B6FC 3X1SA 1P3OD 3W97C 5C3IB 5CPKD 5B31D 5B1MB 2RVQC 3AZID 3LZ0B 5AV5A 3X1UC 4J8UA 3UTAD 3AZGC 5B32B 2NZDC 3X1VB 4WU9C 1B6WA 3O62B 2FJ7D 5B33C 1M1AD 3W96D 2BYMB 3AZFA 1P3MC 4KUDC 5AVCA 2HIOC 5AV6C 3AZLB 1P3BB 1KX3A 1AOIC 3UT9D 3AYWC 3VH6W 5FUGA 3MNND 1H3OA 4EO5C 3WTPC 3A6ND 4J8WD 4G92B 4LD9B 4YS3A 5GT3C 5AY8C 3AFAD 3KUYC 4AWLB 2NQBA 5GT0B 4H9PB 1EQZA 4H9RA 3NQJA 1P3ID 4HGAC 1P3AC 1S32C 1KX4B 3B6FA 4QLCB 5AV9C 2YFVB 5G49B 3AZJC 4KHAB 3WKJB 4H9OB 5B1MD 1KX5B 1F66A 3AZGA 3C1BC 2NZDA 3LZ0D 5B40A 5B33A 5B32D 4NE3A 3O62D 3WAAC 3WTPE 4J8XC 2F8NG 3REKC 3AZNA 4DRBA 5BO0B 4KUDA 2LY8A 5AV6A 4R8PC 4ZBJB 3LZ1B 3MGQC 3MGRA 5AV8B 3AZLD 3AYWA 1P3BD 1P3KC 1P3PC 1P3FB 4Z5TC 5B2IC 3C1CC 3AN2C 2F8NA 4G91B 5B1LA 4Z66B 3V9RB 5GT3A 4UUZB 1BH8A 4JJNC 5AY8A 4H9NA 3KUYA 4WZSB 1HTAA 4LD9D 5JRGD 1U35B 3X1TB 4X23B 1S32A 1M19B 5GT0D 2CV5C 5AV9A 2PYOA 1KX4D 1HQ3B 4QLCD 3AZJA 1P3LB 4YM6B 3LELC 3C1BA 3WKJD 4KGCC 1KX5D 5B0ZC 3MGPC 3AV2C 1JFIA 3RELC 3WAAA 1BFMA 4J8VC 1TAFB 3NQUB 4XUJC 3REHA 4R8PA 3MGQA 4NE6A 5GXQC 1P3KA 3LZ1D 2BYKB 5B2IA 5AV8D 3C1CA 4ZUXC 1P3FD 3AZFB 3B6GB 4DRAA 5AVCB 1P3OC 4Z66D 5CPKC 2CV5A 1U35D 3X1TD 5FUGB 1TZYC 4X23D 1M19D 5B0YB 3TU4C 2FJ7C 1HQ3D 1P3LD 3UTBC 4YS3B 4YM6D 3LELA 3AV1B 2IO5C 2NQBB 5B0ZA 3MGPA 3NQJB 3LJAC 4WU8C 4J8VA 2AROB 3UT9C 3B0DC 4CAYA 3REJB 4XUJA 1F66B 5DNNC 1P34C 5B40B 4J8WC 5B33B 3KXBA 3AFAC 5KDMB 3AZNB 4WNNB 4KUDB 3AZFD 2L5AA 1P3OA 3B6GD 5AV6B 3REIB 3MGRB 5AVCD 3AYWB 2HUEB 1TZYA 5B1MC 4Z2MH 5CP6C 5AVBA 3TU4A 3LZ0C 2FJ7A 1B67A 5B1LB 5B0YD 3AZKA 3UTBA 3AZHB 1BH8B 5B24B 5AY8B 4H9NB 4YS3D 1M18D 3AV1D 3WA9B 4HGAB 3LJAA 2NQBD 4WU8A 3W97A 3UT9A 2PYOB 1KU5A 3W98C 5F99D 3AZLC 4H9SC 1P3BC 2AROD 5GSUC 3AZEB 3R45A 5DNNA 3X1UA 3REJD 3C1BB 5E5AC 4WU9A 1P34A 1F66D 1P3GC 3X1VD 3AFAA 5B40D 3WAAB 5B33D 4G92C 4LD9C 5JRGC 5B2JB 4AWLC 1P3MA 5DNMB 3REHB 2HIOA 4R8PB 1BH9A 3AZND 1ZLAB 1AOIA 2JSSA 1KX4C 4KUDD 4XZQC 5AV6D 3MGSB 1P3KB 3REID 1WWIA 3MGRD 5CP6A 3WTPA 5BT1D 3AYWD 3WKJC 3B0BA 3VH5T 1KX5C 3B0CT 5B1LD 3AZMB 3AZHD 5B24D 5AY8D 1P3AA 5CPJB 2CV5B 3WA9D 3MVDC 3W98A 5JA4B 3AZLA 1P3BA 3LZ1C 2PYOD 5GSUA 1ID3C 3VH6T 3LELB 5E5AA 3AZED 1P3FC 1P3GA 5B0ZB 3C1BD 3KWQB 4G91C 4LD9A 4J8XA 5JRGA 4Z66C
chains in the Genus database with same CATH superfamily
1ULYA 4J8VB 3REKA 3X1SB 3H0RC 3W99C 3WAAD 2XD5A 4CAYB 5B2JD 1U35C 4XUJB 3X1TC 3FDDA 2F8NH 4X23C 1KX4A 5DNMD 3VH5A 4XZQA 5AV5B 4J8UB 3REHD 4R8PD 1ZLAD 1P3PA 2YFVA 1HQ3C 3KXBB 4YM6C 4Z5TA 3MGSD 1P3KD 3AN2A 4H9OA 1KX5A 5BS7C 5CPIC 4JJNA 1R4VA 1KX3B 5B31C 3AZMD 3AZIC 5BO0A 4H9QA 3MVDA 1TZYB 2F2AC 5AVBB 2CV5D 3UTAC 1H3OB 3EPKA 2ZM5A 3TU4B 1ID3A 1M1AC 3W96C 3UTBB 3AZKB 2F8NK 4M6BA 4KGCA 3LELD 4CSRA 3AV2A 1EQZB 4H9RB 3RELA 3LJAB 5BNVA 3AZFC 5B0ZD 3B6FB 4WU8B 3V9RA 3B6GC 4UUZA 3KWQD 3W97B 3W99A 1A7WA 1W2EA 5CPJD 5AVCC 4J8VD 3X1SD 3MNNC 5B31G 5DNNB 3X1UB 3A6NC 4XUJD 2YFWA 3AZGB 5GXQA 2NZDB 4WU9B 1P34B 2VQRA 5AV5D 2Y2PA 5B0YC 4E45A 4J8UD 3KFUG 2ZY3A 3KXBD 4ZUXA 5BS7A 1M18C 3AV1C 5CPIA 1P3IC 1P3MB 2HIOB 1BH9B 5CPKA 5B31A 1AOIB 5F99C 3H0LC 2AROC 3AZIA 5C3IC 1TAFA 1KX3D 3NQUA 5BNXA 5CP6B 3REJC 3UTAA 4EO5B 3WTPB 1TZYD 1F66C 2F8NB 3VH5W 5AVBD 3W96A 1M1AA 3B0CW 5B32C 2ZY2A 3X1VC 3TU4D 5GT3B 3KSYA 3O62C 5B40C 3KUYB 2BYKA 3AZKD 3UTBD 1P3AB 1S32B 3AZNC 3B6GA 1EQZD 2UWXA 5AV9B 3W98B 3LJAD 3B6FD 4WU8D 3AZJB 3IP4C 3W97D 3A1KA 5GSUB 3REIC 3MNNA 1N1JA 3MGRC 3A6NA 2RVQD 5BT1C 2HUEC 5E5AB 5B0YA 4J8WA 5DNND 3X1UD 1P3GB 3AZGD 1JFIB 2NZDD 4WU9D 1P34D 5B1LC 5CHLB 1WWSA 5JRGB 4J8XB 3AZHC 1M18A 3REKB 3AV1A 5B24C 5B32G 1P3IA 4NFTA 5GT0C 1F1EA 3WA9C 1T3UA 1P3MD 5F99A 4XZQB 3MGQB 4QLCC 2AROA 2HIOD 2PYOC 1P3PB 1AOID 5B1MA 3REJA 4Z5TB 5B2IB 3C1CB 3AN2B 3LZ0A 3AZEC 3EPJA 5CP6D 5B32A 3WTPD 3X1VA 3AL0C 4JJNB 3O62A 2F8ND 4WV4B 5GT3D 2BYMA 5KDMA 3KUYD 5B2JC 4WNNA 4H9QB 3MVDB 5DNMC 1P3AD 1S32D 3REHC 2ZY4A 1ZLAC 2FFFB 4H9SA 4ZBJC 5AV9D 3REIA 3W98D 1ID3B 2Y2LA 3MGSC 5AV8C 3AZJD 5GSUD 4KGCB 3MGPB 4CSRB 5E5AD 3AV2B 3RELB 5BNVB 3AZHA 1P3GD 2RIQA 5B24A 3W99B 3AZMC 4J8XD 5GT0A 3WA9A 3REKD 4H9PA 1M19C 4QLCA 2YFWB 5GXQB 5G49A 4XZQD 3MGQD 1P3LC 4KHAA 1P3PD 3WKJA 3AZEA 4NE5A 4ZUXB 4Z5TD 5B2ID 3C1CD 3AN2D 5CPIB 1Q9CA 3KWQC 1P3OB 4JJND 5CPKB 5B31B 5CPJC 1Z2CB 5B2JA 3X1SC 3AZIB 4UPKA 3VH6A 5BNXB 5DNMA 3UTAB 1ZLAA 3LZ1A 3F6TA 3MVDD 2FJ7B 5AV5C 2XD1A 4E44A 1M1AB 2CWEA 4J8UC 3MGSA 5AV8A 3W96B 2IO5B 3KXBC 1ID3D 1P3FA 4KGCD 3MGPD 4Z66A 3AV2D 3UT9B 3RELD 3AZMA 3B0DB 1U35A 4Z2MG 3X1TA 1KX3C 3W99D 3MNNB 1N1JB 4X23A 1M19A 3R45B 3A6NB 5AVBC 5JA4A 1HQ3A 4J8WB 1P3LA 4YM6A 5GXQD 3AFAB 3AZKC 1M18B 4YS3C 1P3IB 2NQBC 4ZUXD 3KWQA 1EQZC 5CPID 5F99B 5CPJA 3B6FC 3X1SA 1P3OD 3W97C 5C3IB 2G5HC 5CPKD 5B31D 5B1MB 2Y2OA 2RVQC 3AZID 3LZ0B 5AV5A 3X1UC 4J8UA 3UTAD 3AZGC 5B32B 2NZDC 3X1VB 4WU9C 1B6WA 3O62B 2FJ7D 5B33C 1M1AD 3W96D 2BYMB 2Y2IA 3AZFA 1P3MC 4KUDC 5AVCA 2HIOC 5AV6C 3AZLB 1P3BB 1KX3A 1AOIC 3UT9D 3AYWC 3VH6W 5FUGA 3MNND 1H3OA 4EO5C 3WTPC 3A6ND 4J8WD 4G92B 4LD9B 4YS3A 5GT3C 5AY8C 3AFAD 3KUYC 4AWLB 2NQBA 5GT0B 4H9PB 1EQZA 4H9RA 3NQJA 1P3ID 4HGAC 1P3AC 1S32C 1KX4B 2Y2KA 3B6FA 4QLCB 5AV9C 2YFVB 5G49B 3EPHA 1PZRA 3AZJC 4KHAB 3WKJB 3H0MC 4H9OB 5B1MD 1KX5B 1F66A 3AZGA 3C1BC 2NZDA 3LZ0D 5B40A 5B33A 5B32D 4NE3A 3O62D 3WAAC 3WTPE 4J8XC 2F8NG 3REKC 3AZNA 2DQNC 4DRBA 5BO0B 4KUDA 3P5JB 2LY8A 5AV6A 4R8PC 4ZBJB 3LZ1B 3MGQC 3MGRA 5AV8B 3AZLD 3AYWA 2Y2QA 1P3BD 1P3KC 1P3PC 1P3FB 4Z5TC 5B2IC 3C1CC 3AN2C 2F8NA 4G91B 5B1LA 4Z66B 3V9RB 5GT3A 4UUZB 1BH8A 4JJNC 4DQYB 5AY8A 4H9NA 3KUYA 4WZSB 1HTAA 4LD9D 5JRGD 1U35B 3X1TB 4X23B 1S32A 1M19B 5GT0D 2CV5C 5AV9A 2PYOA 1KX4D 1HQ3B 4QLCD 3AZJA 1P3LB 4YM6B 3A1IA 3LELC 3C1BA 3WKJD 4KGCC 1KX5D 2Y2HA 5B0ZC 3MGPC 3AV2C 1JFIA 3RELC 3WAAA 2DF4C 1BFMA 4J8VC 1TAFB 3NQUB 4XUJC 3REHA 4R8PA 3MGQA 4NE6A 5GXQC 1P3KA 3LZ1D 2BYKB 5B2IA 5AV8D 3C1CA 2J8PA 4ZUXC 1P3FD 3AZFB 3B6GB 4DRAA 5AVCB 1P3OC 4Z66D 5CPKC 2G5IC 2CV5A 2JE5A 1U35D 3X1TD 5FUGB 1TZYC 4X23D 1M19D 5B0YB 3TU4C 2FJ7C 1HQ3D 1P3LD 3UTBC 4YS3B 4YM6D 3LELA 3AV1B 2IO5C 2NQBB 5B0ZA 3MGPA 2JCHA 3NQJB 3LJAC 4WU8C 4J8VA 2AROB 4WJ3C 3UT9C 3B0DC 4CAYA 3REJB 4XUJA 1F66B 5DNNC 1P34C 5B40B 4J8WC 5B33B 3KXBA 3EG5B 3AFAC 5KDMB 3AZNB 4WNNB 4KUDB 3AZFD 2L5AA 1P3OA 3B6GD 5AV6B 3REIB 3MGRB 5AVCD 3AYWB 2HUEB 1TZYA 5B1MC 4Z2MH 5CP6C 5AVBA 3TU4A 3LZ0C 2FJ7A 1B67A 5B1LB 5B0YD 3AZKA 3UTBA 3AZHB 1BH8B 5B24B 5AY8B 4H9NB 4YS3D 1M18D 3AV1D 3WA9B 4HGAB 3LJAA 2NQBD 4WU8A 3W97A 3UT9A 2PYOB 1KU5A 3W98C 5F99D 3AZLC 4H9SC 1P3BC 2AROD 5GSUC 3AZEB 3R45A 5DNNA 3X1UA 3REJD 3C1BB 5E5AC 4WU9A 1P34A 1F66D 1P3GC 2Y2NA 3EPLA 3AFAA 3X1VD 5B40D 3WAAB 5B33D 4G92C 4LD9C 5JRGC 5B2JB 4AWLC 1P3MA 5DNMB 3REHB 2HIOA 4R8PB 1BH9A 3AZND 1ZLAB 1AOIA 2JSSA 1KX4C 4KUDD 4XZQC 2Y2JA 5AV6D 3MGSB 1P3KB 3REID 2Y2MA 1WWIA 3MGRD 5CP6A 3WTPA 5BT1D 3AYWD 2W8SA 3WKJC 3B0BA 3VH5T 1KX5C 3B0CT 5B1LD 3AZMB 3AZHD 5B24D 5AY8D 2Y2GA 1P3AA 5CPJB 2CV5B 3WA9D 3MVDC 3W98A 2BG1A 5JA4B 3AZLA 1P3BA 3LZ1C 2PYOD 5GSUA 2ZY5A 1ID3C 3VH6T 3LELB 5E5AA 3AZED 1P3FC 1P3GA 5B0ZB 3C1BD 3KWQB 4G91C 4LD9A 4J8XA 5JRGA 4Z66C
chains in the Genus database with same CATH topology
1ULYA 4J8VB 3REKA 3X1SB 3H0RC 3W99C 3WAAD 2XD5A 4CAYB 5B2JD 1U35C 4XUJB 3X1TC 3FDDA 2F8NH 4X23C 1KX4A 5DNMD 3VH5A 4XZQA 5AV5B 4J8UB 3REHD 4R8PD 1ZLAD 1P3PA 2YFVA 1HQ3C 3KXBB 4YM6C 4Z5TA 3MGSD 1P3KD 3AN2A 4H9OA 1KX5A 5BS7C 5CPIC 4JJNA 1R4VA 1KX3B 5B31C 3AZMD 3AZIC 5BO0A 4H9QA 3MVDA 1TZYB 2F2AC 5AVBB 2CV5D 3UTAC 1H3OB 3EPKA 2ZM5A 3TU4B 1ID3A 1M1AC 3W96C 3UTBB 3AZKB 2F8NK 4M6BA 4KGCA 3LELD 4CSRA 3AV2A 1EQZB 4H9RB 3RELA 3LJAB 5BNVA 3AZFC 5B0ZD 3B6FB 4WU8B 3V9RA 3B6GC 4UUZA 3KWQD 3W97B 3W99A 1A7WA 1W2EA 5CPJD 5AVCC 4J8VD 3X1SD 3MNNC 5B31G 5DNNB 3X1UB 3A6NC 4XUJD 2YFWA 3AZGB 5GXQA 2NZDB 4WU9B 1P34B 2VQRA 5AV5D 2Y2PA 5B0YC 4E45A 4J8UD 3KFUG 2ZY3A 3KXBD 4ZUXA 5BS7A 1M18C 3AV1C 5CPIA 1P3IC 1P3MB 2HIOB 1BH9B 5CPKA 5B31A 1AOIB 5F99C 3H0LC 2AROC 3AZIA 5C3IC 1TAFA 1KX3D 3NQUA 5BNXA 5CP6B 3REJC 3UTAA 4EO5B 3WTPB 1TZYD 1F66C 2F8NB 3VH5W 5AVBD 3W96A 1M1AA 3B0CW 5B32C 2ZY2A 3X1VC 3TU4D 5GT3B 3KSYA 3O62C 5B40C 3KUYB 2BYKA 3AZKD 3UTBD 1P3AB 1S32B 3AZNC 3B6GA 1EQZD 2UWXA 5AV9B 3W98B 3LJAD 3B6FD 4WU8D 3AZJB 3IP4C 3W97D 3A1KA 5GSUB 3REIC 3MNNA 1N1JA 3MGRC 3A6NA 2RVQD 5BT1C 2HUEC 5E5AB 5B0YA 4J8WA 5DNND 3X1UD 1P3GB 3AZGD 1JFIB 2NZDD 4WU9D 1P34D 5B1LC 5CHLB 1WWSA 5JRGB 4J8XB 3AZHC 1M18A 3REKB 3AV1A 5B24C 5B32G 1P3IA 4NFTA 5GT0C 1F1EA 3WA9C 1T3UA 1P3MD 5F99A 4XZQB 3MGQB 4QLCC 2AROA 2HIOD 2PYOC 1P3PB 1AOID 5B1MA 3REJA 4Z5TB 5B2IB 3C1CB 3AN2B 3LZ0A 3AZEC 3EPJA 5CP6D 5B32A 3WTPD 3X1VA 3AL0C 4JJNB 3O62A 2F8ND 4WV4B 5GT3D 2BYMA 5KDMA 3KUYD 5B2JC 4WNNA 4H9QB 3MVDB 5DNMC 1P3AD 1S32D 3REHC 2ZY4A 1ZLAC 2FFFB 4H9SA 4ZBJC 5AV9D 3REIA 3W98D 1ID3B 2Y2LA 3MGSC 5AV8C 3AZJD 5GSUD 4KGCB 3MGPB 4CSRB 5E5AD 3AV2B 3RELB 5BNVB 3AZHA 1P3GD 2RIQA 5B24A 3W99B 3AZMC 4J8XD 5GT0A 3WA9A 3REKD 4H9PA 1M19C 4QLCA 2YFWB 5GXQB 5G49A 4XZQD 3MGQD 1P3LC 4KHAA 1P3PD 3WKJA 3AZEA 4NE5A 4ZUXB 4Z5TD 5B2ID 3C1CD 3AN2D 5CPIB 1Q9CA 3KWQC 1P3OB 4JJND 5CPKB 5B31B 5CPJC 1Z2CB 5B2JA 3X1SC 3AZIB 4UPKA 3VH6A 5BNXB 5DNMA 3UTAB 1ZLAA 3LZ1A 3F6TA 3MVDD 2FJ7B 5AV5C 2XD1A 4E44A 1M1AB 2CWEA 4J8UC 3MGSA 5AV8A 3W96B 2IO5B 3KXBC 1ID3D 1P3FA 4KGCD 3MGPD 4Z66A 3AV2D 3UT9B 3RELD 3AZMA 3B0DB 1U35A 4Z2MG 3X1TA 1KX3C 3W99D 3MNNB 1N1JB 4X23A 1M19A 3R45B 3A6NB 5AVBC 5JA4A 1HQ3A 4J8WB 1P3LA 4YM6A 5GXQD 3AFAB 3AZKC 1M18B 4YS3C 1P3IB 2NQBC 4ZUXD 3KWQA 1EQZC 5CPID 5F99B 5CPJA 3B6FC 3X1SA 1P3OD 3W97C 5C3IB 2G5HC 5CPKD 5B31D 5B1MB 2Y2OA 2RVQC 3AZID 3LZ0B 5AV5A 3X1UC 4J8UA 3UTAD 3AZGC 5B32B 2NZDC 3X1VB 4WU9C 1B6WA 3O62B 2FJ7D 5B33C 1M1AD 3W96D 2BYMB 2Y2IA 3AZFA 1P3MC 4KUDC 5AVCA 2HIOC 5AV6C 3AZLB 1P3BB 1KX3A 1AOIC 3UT9D 3AYWC 3VH6W 5FUGA 3MNND 1H3OA 4EO5C 3WTPC 3A6ND 4J8WD 4G92B 4LD9B 4YS3A 5GT3C 5AY8C 3AFAD 3KUYC 4AWLB 2NQBA 5GT0B 4H9PB 1EQZA 4H9RA 3NQJA 1P3ID 4HGAC 1P3AC 1S32C 1KX4B 2Y2KA 3B6FA 4QLCB 5AV9C 2YFVB 5G49B 3EPHA 1PZRA 3AZJC 4KHAB 3WKJB 3H0MC 4H9OB 5B1MD 1KX5B 1F66A 3AZGA 3C1BC 2NZDA 3LZ0D 5B40A 5B33A 5B32D 4NE3A 3O62D 3WAAC 3WTPE 4J8XC 2F8NG 3REKC 3AZNA 2DQNC 4DRBA 5BO0B 4KUDA 3P5JB 2LY8A 5AV6A 4R8PC 4ZBJB 3LZ1B 3MGQC 3MGRA 5AV8B 3AZLD 3AYWA 2Y2QA 1P3BD 1P3KC 1P3PC 1P3FB 4Z5TC 5B2IC 3C1CC 3AN2C 2F8NA 4G91B 5B1LA 4Z66B 3V9RB 5GT3A 4UUZB 1BH8A 4JJNC 4DQYB 5AY8A 4H9NA 3KUYA 4WZSB 1HTAA 4LD9D 5JRGD 1U35B 3X1TB 4X23B 1S32A 1M19B 5GT0D 2CV5C 5AV9A 2PYOA 1KX4D 1HQ3B 4QLCD 3AZJA 1P3LB 4YM6B 3A1IA 3LELC 3C1BA 3WKJD 4KGCC 1KX5D 2Y2HA 5B0ZC 3MGPC 3AV2C 1JFIA 3RELC 3WAAA 2DF4C 1BFMA 4J8VC 1TAFB 3NQUB 4XUJC 3REHA 4R8PA 3MGQA 4NE6A 5GXQC 1P3KA 3LZ1D 2BYKB 5B2IA 5AV8D 3C1CA 2J8PA 4ZUXC 1P3FD 3AZFB 3B6GB 4DRAA 5AVCB 1P3OC 4Z66D 5CPKC 2G5IC 2CV5A 2JE5A 1U35D 3X1TD 5FUGB 1TZYC 4X23D 1M19D 5B0YB 3TU4C 2FJ7C 1HQ3D 1P3LD 3UTBC 4YS3B 4YM6D 3LELA 3AV1B 2IO5C 2NQBB 5B0ZA 3MGPA 2JCHA 3NQJB 3LJAC 4WU8C 4J8VA 2AROB 4WJ3C 3UT9C 3B0DC 4CAYA 3REJB 4XUJA 1F66B 5DNNC 1P34C 5B40B 4J8WC 5B33B 3KXBA 3EG5B 3AFAC 5KDMB 3AZNB 4WNNB 4KUDB 3AZFD 2L5AA 1P3OA 3B6GD 5AV6B 3REIB 3MGRB 5AVCD 3AYWB 2HUEB 1TZYA 5B1MC 4Z2MH 5CP6C 5AVBA 3TU4A 3LZ0C 2FJ7A 1B67A 5B1LB 5B0YD 3AZKA 3UTBA 3AZHB 1BH8B 5B24B 5AY8B 4H9NB 4YS3D 1M18D 3AV1D 3WA9B 4HGAB 3LJAA 2NQBD 4WU8A 3W97A 3UT9A 2PYOB 1KU5A 3W98C 5F99D 3AZLC 4H9SC 1P3BC 2AROD 5GSUC 3AZEB 3R45A 5DNNA 3X1UA 3REJD 3C1BB 5E5AC 4WU9A 1P34A 1F66D 1P3GC 2Y2NA 3EPLA 3AFAA 3X1VD 5B40D 3WAAB 5B33D 4G92C 4LD9C 5JRGC 5B2JB 4AWLC 1P3MA 5DNMB 3REHB 2HIOA 4R8PB 1BH9A 3AZND 1ZLAB 1AOIA 2JSSA 1KX4C 4KUDD 4XZQC 2Y2JA 5AV6D 3MGSB 1P3KB 3REID 2Y2MA 1WWIA 3MGRD 5CP6A 3WTPA 5BT1D 3AYWD 2W8SA 3WKJC 3B0BA 3VH5T 1KX5C 3B0CT 5B1LD 3AZMB 3AZHD 5B24D 5AY8D 2Y2GA 1P3AA 5CPJB 2CV5B 3WA9D 3MVDC 3W98A 2BG1A 5JA4B 3AZLA 1P3BA 3LZ1C 2PYOD 5GSUA 2ZY5A 1ID3C 3VH6T 3LELB 5E5AA 3AZED 1P3FC 1P3GA 5B0ZB 3C1BD 3KWQB 4G91C 4LD9A 4J8XA 5JRGA 4Z66C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULY A;  4J8V B;  3REK A;  3X1S B;  3W99 C;  3WAA D;  4CAY B;  5B2J D;  1U35 C;  4XUJ B;  3X1T C;  2F8N H;  4X23 C;  1KX4 A;  5DNM D;  3VH5 A;  4XZQ A;  5AV5 B;  4J8U B;  3REH D;  4R8P D;  1ZLA D;  1P3P A;  2YFV A;  1HQ3 C;  3KXB B;  4YM6 C;  4Z5T A;  3MGS D;  1P3K D;  3AN2 A;  4H9O A;  1KX5 A;  5BS7 C;  5CPI C;  4JJN A;  1R4V A;  1KX3 B;  5B31 C;  3AZM D;  3AZI C;  5BO0 A;  4H9Q A;  3MVD A;  1TZY B;  5AVB B;  2CV5 D;  3UTA C;  1H3O B;  3TU4 B;  1ID3 A;  1M1A C;  3W96 C;  3UTB B;  3AZK B;  2F8N K;  4M6B A;  4KGC A;  3LEL D;  4CSR A;  3AV2 A;  1EQZ B;  4H9R B;  3REL A;  3LJA B;  5BNV A;  3AZF C;  5B0Z D;  3B6F B;  4WU8 B;  3V9R A;  3B6G C;  4UUZ A;  3KWQ D;  3W97 B;  3W99 A;  1A7W A;  5CPJ D;  5AVC C;  4J8V D;  3X1S D;  3MNN C;  5B31 G;  5DNN B;  3X1U B;  3A6N C;  4XUJ D;  2YFW A;  3AZG B;  5GXQ A;  2NZD B;  4WU9 B;  1P34 B;  5AV5 D;  5B0Y C;  4E45 A;  4J8U D;  3KXB D;  4ZUX A;  5BS7 A;  1M18 C;  3AV1 C;  5CPI A;  1P3I C;  1P3M B;  2HIO B;  1BH9 B;  5CPK A;  5B31 A;  1AOI B;  5F99 C;  2ARO C;  3AZI A;  5C3I C;  1TAF A;  1KX3 D;  3NQU A;  5BNX A;  5CP6 B;  3REJ C;  3UTA A;  4EO5 B;  3WTP B;  1TZY D;  1F66 C;  2F8N B;  3VH5 W;  5AVB D;  3W96 A;  1M1A A;  3B0C W;  5B32 C;  3X1V C;  3TU4 D;  5GT3 B;  3KSY A;  3O62 C;  5B40 C;  3KUY B;  2BYK A;  3AZK D;  3UTB D;  1P3A B;  1S32 B;  3AZN C;  3B6G A;  1EQZ D;  5AV9 B;  3W98 B;  3LJA D;  3B6F D;  4WU8 D;  3AZJ B;  3W97 D;  3REI C;  5GSU B;  3MNN A;  1N1J A;  3MGR C;  3A6N A;  2RVQ D;  5BT1 C;  2HUE C;  5E5A B;  5B0Y A;  4J8W A;  5DNN D;  3X1U D;  1P3G B;  3AZG D;  1JFI B;  2NZD D;  4WU9 D;  1P34 D;  5B1L C;  5CHL B;  1WWS A;  5JRG B;  4J8X B;  3AZH C;  1M18 A;  3REK B;  3AV1 A;  5B24 C;  5B32 G;  1P3I A;  4NFT A;  5GT0 C;  1F1E A;  3WA9 C;  1P3M D;  5F99 A;  4XZQ B;  3MGQ B;  4QLC C;  2ARO A;  2HIO D;  2PYO C;  1P3P B;  1AOI D;  5B1M A;  3REJ A;  4Z5T B;  5B2I B;  3C1C B;  3AN2 B;  3LZ0 A;  3AZE C;  5CP6 D;  5B32 A;  3WTP D;  3X1V A;  4JJN B;  3O62 A;  2F8N D;  4WV4 B;  5GT3 D;  2BYM A;  5KDM A;  3KUY D;  5B2J C;  4WNN A;  4H9Q B;  3MVD B;  5DNM C;  1P3A D;  1S32 D;  3REH C;  1ZLA C;  4H9S A;  4ZBJ C;  5AV9 D;  3REI A;  3W98 D;  1ID3 B;  3MGS C;  5AV8 C;  3AZJ D;  5GSU D;  4KGC B;  3MGP B;  4CSR B;  5E5A D;  3AV2 B;  3REL B;  5BNV B;  3AZH A;  1P3G D;  5B24 A;  3W99 B;  3AZM C;  4J8X D;  5GT0 A;  3WA9 A;  3REK D;  4H9P A;  1M19 C;  4QLC A;  2YFW B;  5GXQ B;  5G49 A;  4XZQ D;  3MGQ D;  1P3L C;  4KHA A;  1P3P D;  3WKJ A;  3AZE A;  4NE5 A;  4ZUX B;  4Z5T D;  5B2I D;  3C1C D;  3AN2 D;  5CPI B;  1Q9C A;  3KWQ C;  1P3O B;  4JJN D;  5CPK B;  5B31 B;  5CPJ C;  5B2J A;  3X1S C;  3AZI B;  3VH6 A;  5BNX B;  5DNM A;  3UTA B;  1ZLA A;  3LZ1 A;  3MVD D;  2FJ7 B;  5AV5 C;  4E44 A;  1M1A B;  2CWE A;  4J8U C;  3MGS A;  5AV8 A;  3W96 B;  2IO5 B;  3KXB C;  1ID3 D;  1P3F A;  4KGC D;  3MGP D;  4Z66 A;  3AV2 D;  3UT9 B;  3REL D;  3AZM A;  3B0D B;  1U35 A;  4Z2M G;  3X1T A;  1KX3 C;  3W99 D;  3MNN B;  1N1J B;  4X23 A;  1M19 A;  3R45 B;  3A6N B;  5AVB C;  5JA4 A;  1HQ3 A;  4J8W B;  1P3L A;  4YM6 A;  5GXQ D;  3AFA B;  3AZK C;  1M18 B;  4YS3 C;  1P3I B;  2NQB C;  4ZUX D;  3KWQ A;  1EQZ C;  5CPI D;  5F99 B;  5CPJ A;  3B6F C;  3X1S A;  1P3O D;  3W97 C;  5C3I B;  5CPK D;  5B31 D;  5B1M B;  2RVQ C;  3AZI D;  3LZ0 B;  5AV5 A;  3X1U C;  4J8U A;  3UTA D;  3AZG C;  5B32 B;  2NZD C;  3X1V B;  4WU9 C;  1B6W A;  3O62 B;  2FJ7 D;  5B33 C;  1M1A D;  3W96 D;  2BYM B;  3AZF A;  1P3M C;  4KUD C;  5AVC A;  2HIO C;  5AV6 C;  3AZL B;  1P3B B;  1KX3 A;  1AOI C;  3UT9 D;  3AYW C;  3VH6 W;  5FUG A;  3MNN D;  1H3O A;  4EO5 C;  3WTP C;  3A6N D;  4J8W D;  4G92 B;  4LD9 B;  4YS3 A;  5GT3 C;  5AY8 C;  3AFA D;  3KUY C;  4AWL B;  2NQB A;  5GT0 B;  4H9P B;  1EQZ A;  4H9R A;  3NQJ A;  1P3I D;  4HGA C;  1P3A C;  1S32 C;  1KX4 B;  3B6F A;  4QLC B;  5AV9 C;  2YFV B;  5G49 B;  3AZJ C;  4KHA B;  3WKJ B;  4H9O B;  5B1M D;  1KX5 B;  1F66 A;  3AZG A;  3C1B C;  2NZD A;  3LZ0 D;  5B40 A;  5B33 A;  5B32 D;  4NE3 A;  3O62 D;  3WAA C;  3WTP E;  4J8X C;  2F8N G;  3REK C;  3AZN A;  4DRB A;  5BO0 B;  4KUD A;  2LY8 A;  5AV6 A;  4R8P C;  4ZBJ B;  3LZ1 B;  3MGQ C;  3MGR A;  5AV8 B;  3AZL D;  3AYW A;  1P3B D;  1P3K C;  1P3P C;  1P3F B;  4Z5T C;  5B2I C;  3C1C C;  3AN2 C;  2F8N A;  4G91 B;  5B1L A;  4Z66 B;  3V9R B;  5GT3 A;  4UUZ B;  1BH8 A;  4JJN C;  5AY8 A;  4H9N A;  3KUY A;  4WZS B;  1HTA A;  4LD9 D;  5JRG D;  1U35 B;  3X1T B;  4X23 B;  1S32 A;  1M19 B;  5GT0 D;  2CV5 C;  5AV9 A;  2PYO A;  1KX4 D;  1HQ3 B;  4QLC D;  3AZJ A;  1P3L B;  4YM6 B;  3LEL C;  3C1B A;  3WKJ D;  4KGC C;  1KX5 D;  5B0Z C;  3MGP C;  3AV2 C;  1JFI A;  3REL C;  3WAA A;  1BFM A;  4J8V C;  1TAF B;  3NQU B;  4XUJ C;  3REH A;  4R8P A;  3MGQ A;  4NE6 A;  5GXQ C;  1P3K A;  3LZ1 D;  2BYK B;  5B2I A;  5AV8 D;  3C1C A;  4ZUX C;  1P3F D;  3AZF B;  3B6G B;  4DRA A;  5AVC B;  1P3O C;  4Z66 D;  5CPK C;  2CV5 A;  1U35 D;  3X1T D;  5FUG B;  1TZY C;  4X23 D;  1M19 D;  5B0Y B;  3TU4 C;  2FJ7 C;  1HQ3 D;  1P3L D;  3UTB C;  4YS3 B;  4YM6 D;  3LEL A;  3AV1 B;  2IO5 C;  2NQB B;  5B0Z A;  3MGP A;  3NQJ B;  3LJA C;  4WU8 C;  4J8V A;  2ARO B;  3UT9 C;  3B0D C;  4CAY A;  3REJ B;  4XUJ A;  1F66 B;  5DNN C;  1P34 C;  5B40 B;  4J8W C;  5B33 B;  3KXB A;  3AFA C;  5KDM B;  3AZN B;  4WNN B;  4KUD B;  3AZF D;  2L5A A;  1P3O A;  3B6G D;  5AV6 B;  3REI B;  3MGR B;  5AVC D;  3AYW B;  2HUE B;  1TZY A;  5B1M C;  4Z2M H;  5CP6 C;  5AVB A;  3TU4 A;  3LZ0 C;  2FJ7 A;  1B67 A;  5B1L B;  5B0Y D;  3AZK A;  3UTB A;  3AZH B;  1BH8 B;  5B24 B;  5AY8 B;  4H9N B;  4YS3 D;  1M18 D;  3AV1 D;  3WA9 B;  4HGA B;  3LJA A;  2NQB D;  4WU8 A;  3W97 A;  3UT9 A;  2PYO B;  1KU5 A;  3W98 C;  5F99 D;  3AZL C;  4H9S C;  1P3B C;  2ARO D;  5GSU C;  3AZE B;  3R45 A;  5DNN A;  3X1U A;  3REJ D;  3C1B B;  5E5A C;  4WU9 A;  1P34 A;  1F66 D;  1P3G C;  3X1V D;  3AFA A;  5B40 D;  3WAA B;  5B33 D;  4G92 C;  4LD9 C;  5JRG C;  5B2J B;  4AWL C;  1P3M A;  5DNM B;  3REH B;  2HIO A;  4R8P B;  1BH9 A;  3AZN D;  1ZLA B;  1AOI A;  2JSS A;  1KX4 C;  4KUD D;  4XZQ C;  5AV6 D;  3MGS B;  1P3K B;  3REI D;  1WWI A;  3MGR D;  5CP6 A;  3WTP A;  5BT1 D;  3AYW D;  3WKJ C;  3B0B A;  3VH5 T;  1KX5 C;  3B0C T;  5B1L D;  3AZM B;  3AZH D;  5B24 D;  5AY8 D;  1P3A A;  5CPJ B;  2CV5 B;  3WA9 D;  3MVD C;  3W98 A;  5JA4 B;  3AZL A;  1P3B A;  3LZ1 C;  2PYO D;  5GSU A;  1ID3 C;  3VH6 T;  3LEL B;  5E5A A;  3AZE D;  1P3F C;  1P3G A;  5B0Z B;  3C1B D;  3KWQ B;  4G91 C;  4LD9 A;  4J8X A;  5JRG A;  4Z66 C; 
#chains in the Genus database with same CATH topology
 1ULY A;  4J8V B;  3REK A;  3X1S B;  3H0R C;  3W99 C;  3WAA D;  2XD5 A;  4CAY B;  5B2J D;  1U35 C;  4XUJ B;  3X1T C;  3FDD A;  2F8N H;  4X23 C;  1KX4 A;  5DNM D;  3VH5 A;  4XZQ A;  5AV5 B;  4J8U B;  3REH D;  4R8P D;  1ZLA D;  1P3P A;  2YFV A;  1HQ3 C;  3KXB B;  4YM6 C;  4Z5T A;  3MGS D;  1P3K D;  3AN2 A;  4H9O A;  1KX5 A;  5BS7 C;  5CPI C;  4JJN A;  1R4V A;  1KX3 B;  5B31 C;  3AZM D;  3AZI C;  5BO0 A;  4H9Q A;  3MVD A;  1TZY B;  2F2A C;  5AVB B;  2CV5 D;  3UTA C;  1H3O B;  3EPK A;  2ZM5 A;  3TU4 B;  1ID3 A;  1M1A C;  3W96 C;  3UTB B;  3AZK B;  2F8N K;  4M6B A;  4KGC A;  3LEL D;  4CSR A;  3AV2 A;  1EQZ B;  4H9R B;  3REL A;  3LJA B;  5BNV A;  3AZF C;  5B0Z D;  3B6F B;  4WU8 B;  3V9R A;  3B6G C;  4UUZ A;  3KWQ D;  3W97 B;  3W99 A;  1A7W A;  1W2E A;  5CPJ D;  5AVC C;  4J8V D;  3X1S D;  3MNN C;  5B31 G;  5DNN B;  3X1U B;  3A6N C;  4XUJ D;  2YFW A;  3AZG B;  5GXQ A;  2NZD B;  4WU9 B;  1P34 B;  2VQR A;  5AV5 D;  2Y2P A;  5B0Y C;  4E45 A;  4J8U D;  3KFU G;  2ZY3 A;  3KXB D;  4ZUX A;  5BS7 A;  1M18 C;  3AV1 C;  5CPI A;  1P3I C;  1P3M B;  2HIO B;  1BH9 B;  5CPK A;  5B31 A;  1AOI B;  5F99 C;  3H0L C;  2ARO C;  3AZI A;  5C3I C;  1TAF A;  1KX3 D;  3NQU A;  5BNX A;  5CP6 B;  3REJ C;  3UTA A;  4EO5 B;  3WTP B;  1TZY D;  1F66 C;  2F8N B;  3VH5 W;  5AVB D;  3W96 A;  1M1A A;  3B0C W;  5B32 C;  2ZY2 A;  3X1V C;  3TU4 D;  5GT3 B;  3KSY A;  3O62 C;  5B40 C;  3KUY B;  2BYK A;  3AZK D;  3UTB D;  1P3A B;  1S32 B;  3AZN C;  3B6G A;  1EQZ D;  2UWX A;  5AV9 B;  3W98 B;  3LJA D;  3B6F D;  4WU8 D;  3AZJ B;  3IP4 C;  3W97 D;  3A1K A;  5GSU B;  3REI C;  3MNN A;  1N1J A;  3MGR C;  3A6N A;  2RVQ D;  5BT1 C;  2HUE C;  5E5A B;  5B0Y A;  4J8W A;  5DNN D;  3X1U D;  1P3G B;  3AZG D;  1JFI B;  2NZD D;  4WU9 D;  1P34 D;  5B1L C;  5CHL B;  1WWS A;  5JRG B;  4J8X B;  3AZH C;  1M18 A;  3REK B;  3AV1 A;  5B24 C;  5B32 G;  1P3I A;  4NFT A;  5GT0 C;  1F1E A;  3WA9 C;  1T3U A;  1P3M D;  5F99 A;  4XZQ B;  3MGQ B;  4QLC C;  2ARO A;  2HIO D;  2PYO C;  1P3P B;  1AOI D;  5B1M A;  3REJ A;  4Z5T B;  5B2I B;  3C1C B;  3AN2 B;  3LZ0 A;  3AZE C;  3EPJ A;  5CP6 D;  5B32 A;  3WTP D;  3X1V A;  3AL0 C;  4JJN B;  3O62 A;  2F8N D;  4WV4 B;  5GT3 D;  2BYM A;  5KDM A;  3KUY D;  5B2J C;  4WNN A;  4H9Q B;  3MVD B;  5DNM C;  1P3A D;  1S32 D;  3REH C;  2ZY4 A;  1ZLA C;  2FFF B;  4H9S A;  4ZBJ C;  5AV9 D;  3REI A;  3W98 D;  1ID3 B;  2Y2L A;  3MGS C;  5AV8 C;  3AZJ D;  5GSU D;  4KGC B;  3MGP B;  4CSR B;  5E5A D;  3AV2 B;  3REL B;  5BNV B;  3AZH A;  1P3G D;  2RIQ A;  5B24 A;  3W99 B;  3AZM C;  4J8X D;  5GT0 A;  3WA9 A;  3REK D;  4H9P A;  1M19 C;  4QLC A;  2YFW B;  5GXQ B;  5G49 A;  4XZQ D;  3MGQ D;  1P3L C;  4KHA A;  1P3P D;  3WKJ A;  3AZE A;  4NE5 A;  4ZUX B;  4Z5T D;  5B2I D;  3C1C D;  3AN2 D;  5CPI B;  1Q9C A;  3KWQ C;  1P3O B;  4JJN D;  5CPK B;  5B31 B;  5CPJ C;  1Z2C B;  5B2J A;  3X1S C;  3AZI B;  4UPK A;  3VH6 A;  5BNX B;  5DNM A;  3UTA B;  1ZLA A;  3LZ1 A;  3F6T A;  3MVD D;  2FJ7 B;  5AV5 C;  2XD1 A;  4E44 A;  1M1A B;  2CWE A;  4J8U C;  3MGS A;  5AV8 A;  3W96 B;  2IO5 B;  3KXB C;  1ID3 D;  1P3F A;  4KGC D;  3MGP D;  4Z66 A;  3AV2 D;  3UT9 B;  3REL D;  3AZM A;  3B0D B;  1U35 A;  4Z2M G;  3X1T A;  1KX3 C;  3W99 D;  3MNN B;  1N1J B;  4X23 A;  1M19 A;  3R45 B;  3A6N B;  5AVB C;  5JA4 A;  1HQ3 A;  4J8W B;  1P3L A;  4YM6 A;  5GXQ D;  3AFA B;  3AZK C;  1M18 B;  4YS3 C;  1P3I B;  2NQB C;  4ZUX D;  3KWQ A;  1EQZ C;  5CPI D;  5F99 B;  5CPJ A;  3B6F C;  3X1S A;  1P3O D;  3W97 C;  5C3I B;  2G5H C;  5CPK D;  5B31 D;  5B1M B;  2Y2O A;  2RVQ C;  3AZI D;  3LZ0 B;  5AV5 A;  3X1U C;  4J8U A;  3UTA D;  3AZG C;  5B32 B;  2NZD C;  3X1V B;  4WU9 C;  1B6W A;  3O62 B;  2FJ7 D;  5B33 C;  1M1A D;  3W96 D;  2BYM B;  2Y2I A;  3AZF A;  1P3M C;  4KUD C;  5AVC A;  2HIO C;  5AV6 C;  3AZL B;  1P3B B;  1KX3 A;  1AOI C;  3UT9 D;  3AYW C;  3VH6 W;  5FUG A;  3MNN D;  1H3O A;  4EO5 C;  3WTP C;  3A6N D;  4J8W D;  4G92 B;  4LD9 B;  4YS3 A;  5GT3 C;  5AY8 C;  3AFA D;  3KUY C;  4AWL B;  2NQB A;  5GT0 B;  4H9P B;  1EQZ A;  4H9R A;  3NQJ A;  1P3I D;  4HGA C;  1P3A C;  1S32 C;  1KX4 B;  2Y2K A;  3B6F A;  4QLC B;  5AV9 C;  2YFV B;  5G49 B;  3EPH A;  1PZR A;  3AZJ C;  4KHA B;  3WKJ B;  3H0M C;  4H9O B;  5B1M D;  1KX5 B;  1F66 A;  3AZG A;  3C1B C;  2NZD A;  3LZ0 D;  5B40 A;  5B33 A;  5B32 D;  4NE3 A;  3O62 D;  3WAA C;  3WTP E;  4J8X C;  2F8N G;  3REK C;  3AZN A;  2DQN C;  4DRB A;  5BO0 B;  4KUD A;  3P5J B;  2LY8 A;  5AV6 A;  4R8P C;  4ZBJ B;  3LZ1 B;  3MGQ C;  3MGR A;  5AV8 B;  3AZL D;  3AYW A;  2Y2Q A;  1P3B D;  1P3K C;  1P3P C;  1P3F B;  4Z5T C;  5B2I C;  3C1C C;  3AN2 C;  2F8N A;  4G91 B;  5B1L A;  4Z66 B;  3V9R B;  5GT3 A;  4UUZ B;  1BH8 A;  4JJN C;  4DQY B;  5AY8 A;  4H9N A;  3KUY A;  4WZS B;  1HTA A;  4LD9 D;  5JRG D;  1U35 B;  3X1T B;  4X23 B;  1S32 A;  1M19 B;  5GT0 D;  2CV5 C;  5AV9 A;  2PYO A;  1KX4 D;  1HQ3 B;  4QLC D;  3AZJ A;  1P3L B;  4YM6 B;  3A1I A;  3LEL C;  3C1B A;  3WKJ D;  4KGC C;  1KX5 D;  2Y2H A;  5B0Z C;  3MGP C;  3AV2 C;  1JFI A;  3REL C;  3WAA A;  2DF4 C;  1BFM A;  4J8V C;  1TAF B;  3NQU B;  4XUJ C;  3REH A;  4R8P A;  3MGQ A;  4NE6 A;  5GXQ C;  1P3K A;  3LZ1 D;  2BYK B;  5B2I A;  5AV8 D;  3C1C A;  2J8P A;  4ZUX C;  1P3F D;  3AZF B;  3B6G B;  4DRA A;  5AVC B;  1P3O C;  4Z66 D;  5CPK C;  2G5I C;  2CV5 A;  2JE5 A;  1U35 D;  3X1T D;  5FUG B;  1TZY C;  4X23 D;  1M19 D;  5B0Y B;  3TU4 C;  2FJ7 C;  1HQ3 D;  1P3L D;  3UTB C;  4YS3 B;  4YM6 D;  3LEL A;  3AV1 B;  2IO5 C;  2NQB B;  5B0Z A;  3MGP A;  2JCH A;  3NQJ B;  3LJA C;  4WU8 C;  4J8V A;  2ARO B;  4WJ3 C;  3UT9 C;  3B0D C;  4CAY A;  3REJ B;  4XUJ A;  1F66 B;  5DNN C;  1P34 C;  5B40 B;  4J8W C;  5B33 B;  3KXB A;  3EG5 B;  3AFA C;  5KDM B;  3AZN B;  4WNN B;  4KUD B;  3AZF D;  2L5A A;  1P3O A;  3B6G D;  5AV6 B;  3REI B;  3MGR B;  5AVC D;  3AYW B;  2HUE B;  1TZY A;  5B1M C;  4Z2M H;  5CP6 C;  5AVB A;  3TU4 A;  3LZ0 C;  2FJ7 A;  1B67 A;  5B1L B;  5B0Y D;  3AZK A;  3UTB A;  3AZH B;  1BH8 B;  5B24 B;  5AY8 B;  4H9N B;  4YS3 D;  1M18 D;  3AV1 D;  3WA9 B;  4HGA B;  3LJA A;  2NQB D;  4WU8 A;  3W97 A;  3UT9 A;  2PYO B;  1KU5 A;  3W98 C;  5F99 D;  3AZL C;  4H9S C;  1P3B C;  2ARO D;  5GSU C;  3AZE B;  3R45 A;  5DNN A;  3X1U A;  3REJ D;  3C1B B;  5E5A C;  4WU9 A;  1P34 A;  1F66 D;  1P3G C;  2Y2N A;  3EPL A;  3AFA A;  3X1V D;  5B40 D;  3WAA B;  5B33 D;  4G92 C;  4LD9 C;  5JRG C;  5B2J B;  4AWL C;  1P3M A;  5DNM B;  3REH B;  2HIO A;  4R8P B;  1BH9 A;  3AZN D;  1ZLA B;  1AOI A;  2JSS A;  1KX4 C;  4KUD D;  4XZQ C;  2Y2J A;  5AV6 D;  3MGS B;  1P3K B;  3REI D;  2Y2M A;  1WWI A;  3MGR D;  5CP6 A;  3WTP A;  5BT1 D;  3AYW D;  2W8S A;  3WKJ C;  3B0B A;  3VH5 T;  1KX5 C;  3B0C T;  5B1L D;  3AZM B;  3AZH D;  5B24 D;  5AY8 D;  2Y2G A;  1P3A A;  5CPJ B;  2CV5 B;  3WA9 D;  3MVD C;  3W98 A;  2BG1 A;  5JA4 B;  3AZL A;  1P3B A;  3LZ1 C;  2PYO D;  5GSU A;  2ZY5 A;  1ID3 C;  3VH6 T;  3LEL B;  5E5A A;  3AZE D;  1P3F C;  1P3G A;  5B0Z B;  3C1B D;  3KWQ B;  4G91 C;  4LD9 A;  4J8X A;  5JRG A;  4Z66 C; 
#chains in the Genus database with same CATH homology
 1ULY A;  4J8V B;  3REK A;  3X1S B;  3H0R C;  3W99 C;  3WAA D;  2XD5 A;  4CAY B;  5B2J D;  1U35 C;  4XUJ B;  3X1T C;  3FDD A;  2F8N H;  4X23 C;  1KX4 A;  5DNM D;  3VH5 A;  4XZQ A;  5AV5 B;  4J8U B;  3REH D;  4R8P D;  1ZLA D;  1P3P A;  2YFV A;  1HQ3 C;  3KXB B;  4YM6 C;  4Z5T A;  3MGS D;  1P3K D;  3AN2 A;  4H9O A;  1KX5 A;  5BS7 C;  5CPI C;  4JJN A;  1R4V A;  1KX3 B;  5B31 C;  3AZM D;  3AZI C;  5BO0 A;  4H9Q A;  3MVD A;  1TZY B;  2F2A C;  5AVB B;  2CV5 D;  3UTA C;  1H3O B;  3EPK A;  2ZM5 A;  3TU4 B;  1ID3 A;  1M1A C;  3W96 C;  3UTB B;  3AZK B;  2F8N K;  4M6B A;  4KGC A;  3LEL D;  4CSR A;  3AV2 A;  1EQZ B;  4H9R B;  3REL A;  3LJA B;  5BNV A;  3AZF C;  5B0Z D;  3B6F B;  4WU8 B;  3V9R A;  3B6G C;  4UUZ A;  3KWQ D;  3W97 B;  3W99 A;  1A7W A;  1W2E A;  5CPJ D;  5AVC C;  4J8V D;  3X1S D;  3MNN C;  5B31 G;  5DNN B;  3X1U B;  3A6N C;  4XUJ D;  2YFW A;  3AZG B;  5GXQ A;  2NZD B;  4WU9 B;  1P34 B;  2VQR A;  5AV5 D;  2Y2P A;  5B0Y C;  4E45 A;  4J8U D;  3KFU G;  2ZY3 A;  3KXB D;  4ZUX A;  5BS7 A;  1M18 C;  3AV1 C;  5CPI A;  1P3I C;  1P3M B;  2HIO B;  1BH9 B;  5CPK A;  5B31 A;  1AOI B;  5F99 C;  3H0L C;  2ARO C;  3AZI A;  5C3I C;  1TAF A;  1KX3 D;  3NQU A;  5BNX A;  5CP6 B;  3REJ C;  3UTA A;  4EO5 B;  3WTP B;  1TZY D;  1F66 C;  2F8N B;  3VH5 W;  5AVB D;  3W96 A;  1M1A A;  3B0C W;  5B32 C;  2ZY2 A;  3X1V C;  3TU4 D;  5GT3 B;  3KSY A;  3O62 C;  5B40 C;  3KUY B;  2BYK A;  3AZK D;  3UTB D;  1P3A B;  1S32 B;  3AZN C;  3B6G A;  1EQZ D;  2UWX A;  5AV9 B;  3W98 B;  3LJA D;  3B6F D;  4WU8 D;  3AZJ B;  3IP4 C;  3W97 D;  3A1K A;  5GSU B;  3REI C;  3MNN A;  1N1J A;  3MGR C;  3A6N A;  2RVQ D;  5BT1 C;  2HUE C;  5E5A B;  5B0Y A;  4J8W A;  5DNN D;  3X1U D;  1P3G B;  3AZG D;  1JFI B;  2NZD D;  4WU9 D;  1P34 D;  5B1L C;  5CHL B;  1WWS A;  5JRG B;  4J8X B;  3AZH C;  1M18 A;  3REK B;  3AV1 A;  5B24 C;  5B32 G;  1P3I A;  4NFT A;  5GT0 C;  1F1E A;  3WA9 C;  1T3U A;  1P3M D;  5F99 A;  4XZQ B;  3MGQ B;  4QLC C;  2ARO A;  2HIO D;  2PYO C;  1P3P B;  1AOI D;  5B1M A;  3REJ A;  4Z5T B;  5B2I B;  3C1C B;  3AN2 B;  3LZ0 A;  3AZE C;  3EPJ A;  5CP6 D;  5B32 A;  3WTP D;  3X1V A;  3AL0 C;  4JJN B;  3O62 A;  2F8N D;  4WV4 B;  5GT3 D;  2BYM A;  5KDM A;  3KUY D;  5B2J C;  4WNN A;  4H9Q B;  3MVD B;  5DNM C;  1P3A D;  1S32 D;  3REH C;  2ZY4 A;  1ZLA C;  2FFF B;  4H9S A;  4ZBJ C;  5AV9 D;  3REI A;  3W98 D;  1ID3 B;  2Y2L A;  3MGS C;  5AV8 C;  3AZJ D;  5GSU D;  4KGC B;  3MGP B;  4CSR B;  5E5A D;  3AV2 B;  3REL B;  5BNV B;  3AZH A;  1P3G D;  2RIQ A;  5B24 A;  3W99 B;  3AZM C;  4J8X D;  5GT0 A;  3WA9 A;  3REK D;  4H9P A;  1M19 C;  4QLC A;  2YFW B;  5GXQ B;  5G49 A;  4XZQ D;  3MGQ D;  1P3L C;  4KHA A;  1P3P D;  3WKJ A;  3AZE A;  4NE5 A;  4ZUX B;  4Z5T D;  5B2I D;  3C1C D;  3AN2 D;  5CPI B;  1Q9C A;  3KWQ C;  1P3O B;  4JJN D;  5CPK B;  5B31 B;  5CPJ C;  1Z2C B;  5B2J A;  3X1S C;  3AZI B;  4UPK A;  3VH6 A;  5BNX B;  5DNM A;  3UTA B;  1ZLA A;  3LZ1 A;  3F6T A;  3MVD D;  2FJ7 B;  5AV5 C;  2XD1 A;  4E44 A;  1M1A B;  2CWE A;  4J8U C;  3MGS A;  5AV8 A;  3W96 B;  2IO5 B;  3KXB C;  1ID3 D;  1P3F A;  4KGC D;  3MGP D;  4Z66 A;  3AV2 D;  3UT9 B;  3REL D;  3AZM A;  3B0D B;  1U35 A;  4Z2M G;  3X1T A;  1KX3 C;  3W99 D;  3MNN B;  1N1J B;  4X23 A;  1M19 A;  3R45 B;  3A6N B;  5AVB C;  5JA4 A;  1HQ3 A;  4J8W B;  1P3L A;  4YM6 A;  5GXQ D;  3AFA B;  3AZK C;  1M18 B;  4YS3 C;  1P3I B;  2NQB C;  4ZUX D;  3KWQ A;  1EQZ C;  5CPI D;  5F99 B;  5CPJ A;  3B6F C;  3X1S A;  1P3O D;  3W97 C;  5C3I B;  2G5H C;  5CPK D;  5B31 D;  5B1M B;  2Y2O A;  2RVQ C;  3AZI D;  3LZ0 B;  5AV5 A;  3X1U C;  4J8U A;  3UTA D;  3AZG C;  5B32 B;  2NZD C;  3X1V B;  4WU9 C;  1B6W A;  3O62 B;  2FJ7 D;  5B33 C;  1M1A D;  3W96 D;  2BYM B;  2Y2I A;  3AZF A;  1P3M C;  4KUD C;  5AVC A;  2HIO C;  5AV6 C;  3AZL B;  1P3B B;  1KX3 A;  1AOI C;  3UT9 D;  3AYW C;  3VH6 W;  5FUG A;  3MNN D;  1H3O A;  4EO5 C;  3WTP C;  3A6N D;  4J8W D;  4G92 B;  4LD9 B;  4YS3 A;  5GT3 C;  5AY8 C;  3AFA D;  3KUY C;  4AWL B;  2NQB A;  5GT0 B;  4H9P B;  1EQZ A;  4H9R A;  3NQJ A;  1P3I D;  4HGA C;  1P3A C;  1S32 C;  1KX4 B;  2Y2K A;  3B6F A;  4QLC B;  5AV9 C;  2YFV B;  5G49 B;  3EPH A;  1PZR A;  3AZJ C;  4KHA B;  3WKJ B;  3H0M C;  4H9O B;  5B1M D;  1KX5 B;  1F66 A;  3AZG A;  3C1B C;  2NZD A;  3LZ0 D;  5B40 A;  5B33 A;  5B32 D;  4NE3 A;  3O62 D;  3WAA C;  3WTP E;  4J8X C;  2F8N G;  3REK C;  3AZN A;  2DQN C;  4DRB A;  5BO0 B;  4KUD A;  3P5J B;  2LY8 A;  5AV6 A;  4R8P C;  4ZBJ B;  3LZ1 B;  3MGQ C;  3MGR A;  5AV8 B;  3AZL D;  3AYW A;  2Y2Q A;  1P3B D;  1P3K C;  1P3P C;  1P3F B;  4Z5T C;  5B2I C;  3C1C C;  3AN2 C;  2F8N A;  4G91 B;  5B1L A;  4Z66 B;  3V9R B;  5GT3 A;  4UUZ B;  1BH8 A;  4JJN C;  4DQY B;  5AY8 A;  4H9N A;  3KUY A;  4WZS B;  1HTA A;  4LD9 D;  5JRG D;  1U35 B;  3X1T B;  4X23 B;  1S32 A;  1M19 B;  5GT0 D;  2CV5 C;  5AV9 A;  2PYO A;  1KX4 D;  1HQ3 B;  4QLC D;  3AZJ A;  1P3L B;  4YM6 B;  3A1I A;  3LEL C;  3C1B A;  3WKJ D;  4KGC C;  1KX5 D;  2Y2H A;  5B0Z C;  3MGP C;  3AV2 C;  1JFI A;  3REL C;  3WAA A;  2DF4 C;  1BFM A;  4J8V C;  1TAF B;  3NQU B;  4XUJ C;  3REH A;  4R8P A;  3MGQ A;  4NE6 A;  5GXQ C;  1P3K A;  3LZ1 D;  2BYK B;  5B2I A;  5AV8 D;  3C1C A;  2J8P A;  4ZUX C;  1P3F D;  3AZF B;  3B6G B;  4DRA A;  5AVC B;  1P3O C;  4Z66 D;  5CPK C;  2G5I C;  2CV5 A;  2JE5 A;  1U35 D;  3X1T D;  5FUG B;  1TZY C;  4X23 D;  1M19 D;  5B0Y B;  3TU4 C;  2FJ7 C;  1HQ3 D;  1P3L D;  3UTB C;  4YS3 B;  4YM6 D;  3LEL A;  3AV1 B;  2IO5 C;  2NQB B;  5B0Z A;  3MGP A;  2JCH A;  3NQJ B;  3LJA C;  4WU8 C;  4J8V A;  2ARO B;  4WJ3 C;  3UT9 C;  3B0D C;  4CAY A;  3REJ B;  4XUJ A;  1F66 B;  5DNN C;  1P34 C;  5B40 B;  4J8W C;  5B33 B;  3KXB A;  3EG5 B;  3AFA C;  5KDM B;  3AZN B;  4WNN B;  4KUD B;  3AZF D;  2L5A A;  1P3O A;  3B6G D;  5AV6 B;  3REI B;  3MGR B;  5AVC D;  3AYW B;  2HUE B;  1TZY A;  5B1M C;  4Z2M H;  5CP6 C;  5AVB A;  3TU4 A;  3LZ0 C;  2FJ7 A;  1B67 A;  5B1L B;  5B0Y D;  3AZK A;  3UTB A;  3AZH B;  1BH8 B;  5B24 B;  5AY8 B;  4H9N B;  4YS3 D;  1M18 D;  3AV1 D;  3WA9 B;  4HGA B;  3LJA A;  2NQB D;  4WU8 A;  3W97 A;  3UT9 A;  2PYO B;  1KU5 A;  3W98 C;  5F99 D;  3AZL C;  4H9S C;  1P3B C;  2ARO D;  5GSU C;  3AZE B;  3R45 A;  5DNN A;  3X1U A;  3REJ D;  3C1B B;  5E5A C;  4WU9 A;  1P34 A;  1F66 D;  1P3G C;  2Y2N A;  3EPL A;  3AFA A;  3X1V D;  5B40 D;  3WAA B;  5B33 D;  4G92 C;  4LD9 C;  5JRG C;  5B2J B;  4AWL C;  1P3M A;  5DNM B;  3REH B;  2HIO A;  4R8P B;  1BH9 A;  3AZN D;  1ZLA B;  1AOI A;  2JSS A;  1KX4 C;  4KUD D;  4XZQ C;  2Y2J A;  5AV6 D;  3MGS B;  1P3K B;  3REI D;  2Y2M A;  1WWI A;  3MGR D;  5CP6 A;  3WTP A;  5BT1 D;  3AYW D;  2W8S A;  3WKJ C;  3B0B A;  3VH5 T;  1KX5 C;  3B0C T;  5B1L D;  3AZM B;  3AZH D;  5B24 D;  5AY8 D;  2Y2G A;  1P3A A;  5CPJ B;  2CV5 B;  3WA9 D;  3MVD C;  3W98 A;  2BG1 A;  5JA4 B;  3AZL A;  1P3B A;  3LZ1 C;  2PYO D;  5GSU A;  2ZY5 A;  1ID3 C;  3VH6 T;  3LEL B;  5E5A A;  3AZE D;  1P3F C;  1P3G A;  5B0Z B;  3C1B D;  3KWQ B;  4G91 C;  4LD9 A;  4J8X A;  5JRG A;  4Z66 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...