4JJNC

Crystal structure of heterochromatin protein sir3 in complex with a silenced yeast nucleosome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
ASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3
publication title Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 27
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4jjnC00
4QLCA 5JRGC 5AY8D 1P3AC 1M1AC 3REKC 3MVDB 4WU9B 3NQJB 5AY8A 5B2IC 4KGCD 1TZYC 1P3BD 2FJ7D 5B1MB 5B2JC 1BH9A 4Z5TA 5CPIB 3AV2D 1HQ3B 2F8NG 3W96A 2LY8A 5AVBA 3C1CC 4KGCA 1P3BA 1S32B 5B31C 3KUYC 5AV5C 3UT9D 5B33D 3AV2A 1ID3D 2NZDC 1P3PD 3W98A 3AZKC 4J8UB 4WU8C 3AZLB 3KWQC 3UT9A 5B33A 3AFAC 1ID3A 1KX4B 1P34C 5GSUD 3LZ1B 5DNNC 1P3MB 2HUEB 2YFWA 4XZQB 3LZ0C 3AYWD 1EQZC 3REJB 3MGPD 1TAFA 4CAYA 4ZUXD 3AZGC 5CPJB 3C1BB 1P3GB 4E44A 5B24D 4WNNB 3AYWA 3X1VB 3LJAB 3AN2D 2CV5C 1M19C 1F66D 2F8NK 5B1LC 3MGPA 4ZUXA 4LD9B 4NE3A 3X1UC 5BNVA 3MNNB 4M6BA 3AN2A 2F8ND 4Z66C 4YM6D 3MGSC 5CPKD 3UTBB 2NQBD 4J8VD 2F8NA 5JRGA 1BH8A 1P3AA 3A6NC 5CPKA 5F99C 3REKA 4JJND 5GT0D 4E45A 2PYOD 3KXBD 4JJNA 3AZND 5GT0A 2PYOA 1WWIA 4QLCB 3C1CA 3KXBA 5B31A 5AVCD 1N1JA 5AV8D 3LELC 3KUYA 3AZIC 1M18C 3V9RA 3AZKA 5AY8B 4KUDC 3MVDD 5AV8A 1BH9B 4H9QA 4Z5TB 3X1SC 3X1TC 4XUJD 3REIB 3AZMC 4R8PC 5B1MD 5AVBB 3W96B 3W99C 4KGCB 1P3BB 2YFVB 3NQJA 3UTAD 1HQ3D 5CHLB 4AWLC 3AV2B 4XUJA 4H9RB 5B1MA 3W98B 5CP6C 3LZ0A 1EQZA 3UTAA 5B33B 1ZLAC 3AZLD 2HIOB 1KX4D 3WA9C 1B6WA 5DNMB 3B6FC 3LZ1D 3AZLA 3VH6W 3MGSA 1KX4A 1HTAA 5BO0A 1TAFB 5AV6C 1R4VA 5KDMA 1KX5C 1KX3C 3W97C 3RELC 5CPJD 2AROD 3C1BD 1P3GD 3MGPB 4ZUXB 3X1VD 3LJAD 3R45B 4J8WB 5BNVB 3AN2B 5CPJA 2AROA 5B0ZC 3C1BA 4ZBJB 3LJAA 3WTPC 5FUGA 3AZEC 4H9NA 1ULYA 5JRGB 1BH8B 1P3AB 1M1AB 3REKB 4H9SC 1AOIC 4J8XC 5B2JB 3O62C 4JJNB 5GT0B 4G91C 2PYOB 3AZMA 3C1CB 5B31B 1N1JB 3KUYB 5AV5B 4WV4B 2NZDB 5CP6A 3AZKB 3AZJA 4WU8B 4YS3D 1P3FD 5BT1D 3AFAB 4H9QB 5B0YC 3B6GC 1JFIA 3WAAC 5GXQC 4Z5TD 3AZHC 4YS3A 1P3FA 3WA9A 3REID 5AVBD 5DNNB 3W96D 4XUJB 1A7WA 5G49A 3LZ0B 1EQZB 3UTAB 1Q9CA 3REIA 4CSRB 3W98D 2YFVA 4X23C 1P3KC 5BS7A 1M19B 4H9RA 3B0CT 2CWEA 3REHD 1P3IC 3X1UB 2HIOD 4WZSB 5B32D 4Z66B 5DNMD 3MGSB 3AV1D 3REHA 5BO0B 5KDMB 5B31G 2HIOA 5B32A 5GT3C 5DNMA 3A6NB 1P3LC 5F99B 3AV1A 4H9SA 4J8XA 1U35C 3AZFC 2AROB 4J8WD 4H9OA 5FUGB 4H9NB 1M18B 3R45A 4J8WA 4DRBA 5AV9C 5JRGD 1P3AD 1M1AD 3REKD 1P3OC 3MGRC 4WU9C 5B2ID 1M1AA 1TZYD 3AZMB 5B2JD 3WAAA 3W99B 3B0DC 5CPIC 1HQ3C 5B2IA 3C1CD 1TZYA 5B31D 5B2JA 5CP6B 3KUYD 1S32C 5AV5D 3AZJB 2NZDD 3VH5T 3AZKD 1JFIB 4J8UC 1ZLAB 4WU8D 5AV5A 3KWQD 3AFAD 4YS3B 2NZDA 1P3FB 3WA9B 2BYKA 1P3IA 1P34D 4WU8A 3KWQA 5G49B 3AFAA 5DNND 1P3MC 2HUEC 5AV6B 1P34A 3LZ0D 4XZQC 1EQZD 1KX3B 3W97B 3RELB 3REJC 2RVQC 5DNNA 3AZGD 2IO5C 4H9PA 2CV5D 1U35A 1M19D 4UUZB 5B1LD 4CSRA 5B0ZB 3AZGA 4LD9C 3X1UD 3REHB 3MNNC 2CV5A 3WTPB 4Z66D 1M19A 5B1LA 5B32B 3MGSD 5BNXB 4EO5C 3X1UA 3UTBC 3AV1B 3MGQC 4G92C 4Z66A 3A6ND 4J8XB 5B40C 5F99D 1P3OA 3O62B 3TU4A 4NFTA 4G91B 3A6NA 4H9OB 5F99A 5E5AC 3KSYA 3TU4C 3WKJC 4QLCC 4NE6A 3LELD 3NQUA 1M18D 5JA4B 5B0YB 3B6GB 4KUDD 3LELA 5AY8C 3AZIA 1M18A 3WAAB 5GXQB 3X1TD 3AZMD 4R8PD 4NE5A 5B2IB 4KUDA 3W99D 1TZYB 4KGCC 1P3BC 2FJ7C 3X1SA 3X1TA 5B32G 3AV2C 4HGAC 4R8PA 5CP6D 3W99A 3W98C 4X23B 3AZJD 1P3KB 3UT9C 5B33C 4Z2MH 1ZLAD 2BYKB 1ID3C 1P3PC 1P3IB 3KWQB 3WA9D 3B6FD 1ZLAA 1P34B 5GSUC 5GT3B 5AV6D 1KX5D 3B6FA 5C3IC 1KX3D 3W97D 4H9PB 3RELD 3VH5A 5B40A 3AYWC 1H3OB 1U35B 5AV6A 3WTPE 1KX5A 3MGPC 3AZGB 4ZUXC 3W97A 1KX3A 3RELA 5B24C 2CV5B 1F66C 5B0ZD 2BYMA 5B1LB 3AN2C 3WTPD 4UUZA 3AZED 3WKJA 5AV9B 5B0ZA 4YM6C 1P3OB 5CPKC 3MGRB 3WTPA 3AZEA 2NQBC 1AOID 4J8XD 4J8VC 5BNXA 3O62D 4JJNC 3B0DB 5GT0C 1AOIA 2PYOC 4DRAA 3KXBC 3NQUB 3O62A 2FJ7A 1F1EA 3AZNC 3VH6T 3LELB 3AZIB 5AVCC 5AV8C 5B0YD 3B6GD 1P3PA 3WAAD 4KUDB 5JA4A 5GXQD 2JSSA 3AZHD 3MVDC 3X1SB 5B0YA 3B6GA 3X1TB 4R8PB 4XUJC 5B1MC 5GXQA 3AZHA 5GSUA 4AWLB 3UTAC 2IO5B 4X23D 4KHAB 1P3KD 1P3ID 4X23A 1P3KA 5B24A 1F66A 3AZLC 4EO5B 1KX4C 3B6FB 3LZ1C 5GT3D 3MGQB 4G92B 1P3LD 5B40B 4Z2MG 4YM6A 1KX5B 2NQBA 4J8VA 1U35D 5GT3A 1P3LA 3AZFD 2BYMB 5CPJC 2AROC 5E5AB 3C1BC 1P3GC 3X1VC 1H3OA 3LJAC 3TU4B 3WKJB 3AZFA 5AV9D 3AZNA 3AZEB 1P3OD 2F8NH 3MGRD 5AVCA 4WU9D 5AV9A 1AOIB 3B0CW 3MGRA 3MVDA 4WU9A 2FJ7B 5CPID 4HGAB 1S32D 3AZJC 5CPIA 1HQ3A 3UT9B 4J8UD 3AZID 1S32A 1WWSA 1P3PB 1ID3B 4YS3C 1P3FC 5BT1C 4J8UA 1BFMA 2YFWB 3X1SD 3B0BA 3AZHB 5GSUB 4Z5TC 1P3MD 3REIC 5C3IB 4XZQD 3W96C 5AVBC 4CAYB 3LZ1A 3VH6A 3REJD 2RVQD 5BS7C 3AYWB 1P3MA 4XZQA 2L5AA 3REJA 5B24B 1B67A 1F66B 4KHAA 4LD9D 1P3GA 3MNND 3REHC 4WNNA 3X1VA 2HIOC 5B32C 2F8NB 4LD9A 5DNMC 4YM6B 3UTBD 5CPKB 1KU5A 3MNNA 3MGQD 3AV1C 2NQBB 5B40D 4J8VB 3VH5W 1P3LB 3UTBA 3MGQA 5E5AD 3AZFB 3KXBB 3TU4D 4J8WC 3AZNB 4QLCD 3WKJD 3V9RB 5E5AA 4ZBJC 5AVCB 5AV8B
chains in the Genus database with same CATH superfamily
4QLCA 5JRGC 5AY8D 1P3AC 1M1AC 3REKC 3MVDB 4WU9B 3NQJB 2XD5A 5AY8A 5B2IC 4KGCD 4WJ3C 1TZYC 1P3BD 2FJ7D 5B1MB 5B2JC 1BH9A 4Z5TA 5CPIB 3AV2D 1HQ3B 2F8NG 3W96A 2LY8A 5AVBA 3C1CC 4KGCA 1P3BA 1S32B 2Y2PA 5B31C 3KUYC 5AV5C 3UT9D 5B33D 3H0RC 3AV2A 1ID3D 2NZDC 1P3PD 3W98A 3AZKC 4J8UB 4WU8C 3AZLB 3KWQC 3UT9A 5B33A 3AFAC 1ID3A 1KX4B 1P34C 5GSUD 3LZ1B 2ZY4A 5DNNC 1P3MB 2HUEB 2YFWA 4XZQB 3LZ0C 3AYWD 1EQZC 3REJB 3MGPD 1TAFA 4CAYA 4ZUXD 3AZGC 5CPJB 3C1BB 1P3GB 3EPHA 4E44A 5B24D 4WNNB 3AYWA 3X1VB 3LJAB 3AN2D 2CV5C 2Y2QA 1M19C 1F66D 5B1LC 2F8NK 3MGPA 4ZUXA 4LD9B 4NE3A 2ZM5A 3X1UC 5BNVA 3MNNB 4M6BA 3AN2A 2F8ND 4Z66C 4YM6D 3MGSC 5CPKD 3UTBB 2NQBD 4J8VD 2F8NA 5JRGA 1BH8A 1P3AA 3A6NC 5CPKA 5F99C 3REKA 4JJND 5GT0D 4E45A 2PYOD 3EPLA 3KXBD 4JJNA 3AZND 5GT0A 2PYOA 1WWIA 4QLCB 3C1CA 3KXBA 5B31A 5AVCD 1N1JA 5AV8D 3LELC 3KUYA 3AZIC 1M18C 3V9RA 3AZKA 5AY8B 4KUDC 3MVDD 5AV8A 1BH9B 4H9QA 4Z5TB 3X1SC 3X1TC 4XUJD 3REIB 3AZMC 4R8PC 5B1MD 5AVBB 3W96B 3W99C 1Z2CB 4KGCB 1P3BB 2YFVB 3NQJA 3UTAD 1HQ3D 5CHLB 4AWLC 3AV2B 4XUJA 4H9RB 5B1MA 3W98B 5CP6C 3LZ0A 1EQZA 3UTAA 3H0LC 5B33B 3H0MC 1ZLAC 3AZLD 1PZRA 2HIOB 1KX4D 3WA9C 1B6WA 5DNMB 3B6FC 3LZ1D 3AZLA 3FDDA 3VH6W 3MGSA 1KX4A 1HTAA 5BO0A 1TAFB 5AV6C 1R4VA 5KDMA 1KX5C 1KX3C 3W97C 3RELC 3A1KA 5CPJD 2AROD 3C1BD 1P3GD 3MGPB 4ZUXB 3X1VD 3LJAD 3R45B 4UPKA 5BNVB 4J8WB 3AN2B 5CPJA 2AROA 5B0ZC 3C1BA 4ZBJB 3LJAA 3WTPC 5FUGA 3AZEC 4H9NA 1ULYA 5JRGB 1BH8B 1P3AB 1M1AB 3REKB 4H9SC 1AOIC 4J8XC 5B2JB 3O62C 4JJNB 5GT0B 4G91C 2PYOB 3AZMA 3C1CB 5B31B 1N1JB 3KUYB 5AV5B 4WV4B 2NZDB 5CP6A 3AZKB 3AZJA 4WU8B 4YS3D 1P3FD 5BT1D 3AFAB 4H9QB 5B0YC 3B6GC 1JFIA 3WAAC 5GXQC 4Z5TD 3AZHC 4YS3A 1P3FA 3WA9A 3REID 5AVBD 5DNNB 3W96D 4XUJB 1A7WA 5G49A 3LZ0B 1EQZB 3UTAB 1Q9CA 3REIA 4CSRB 3W98D 2YFVA 4X23C 1P3KC 5BS7A 1M19B 2J8PA 4H9RA 3B0CT 2CWEA 3REHD 1P3IC 3X1UB 2HIOD 4WZSB 5B32D 4Z66B 5DNMD 3MGSB 3AV1D 3REHA 5BO0B 5KDMB 5B31G 2HIOA 5B32A 5GT3C 5DNMA 3A6NB 1P3LC 5F99B 3AV1A 4H9SA 4J8XA 1U35C 3AZFC 2AROB 4J8WD 1T3UA 4H9OA 5FUGB 4H9NB 1M18B 3R45A 4J8WA 4DRBA 3EPKA 5AV9C 5JRGD 1P3AD 1M1AD 3REKD 1P3OC 3MGRC 4WU9C 5B2ID 1M1AA 1TZYD 3AZMB 5B2JD 3WAAA 3W99B 2G5HC 3B0DC 5CPIC 1HQ3C 5B2IA 3C1CD 1TZYA 2VQRA 5B31D 5B2JA 5CP6B 3KUYD 1S32C 5AV5D 3AL0C 3AZJB 2NZDD 3VH5T 3AZKD 1JFIB 4J8UC 1ZLAB 4WU8D 5AV5A 3KWQD 3AFAD 4YS3B 2NZDA 1P3FB 3WA9B 2BYKA 1P3IA 1P34D 4WU8A 3KWQA 5G49B 3AFAA 5DNND 1P3MC 2HUEC 5AV6B 1P34A 2F2AC 4XZQC 3LZ0D 1EQZD 1KX3B 3W97B 3RELB 3REJC 2RVQC 5DNNA 3AZGD 2IO5C 4H9PA 2CV5D 1U35A 1M19D 4UUZB 5B1LD 4CSRA 5B0ZB 3AZGA 2Y2JA 4LD9C 3X1UD 2ZY3A 3REHB 3MNNC 2CV5A 3WTPB 4Z66D 1M19A 5B1LA 5B32B 3MGSD 2Y2IA 5BNXB 4EO5C 3X1UA 3UTBC 3AV1B 3MGQC 4G92C 4Z66A 3A1IA 3A6ND 4J8XB 5B40C 5F99D 1P3OA 3O62B 3TU4A 4NFTA 4G91B 3A6NA 4H9OB 5F99A 5E5AC 3KSYA 2G5IC 3TU4C 3WKJC 4QLCC 4NE6A 3LELD 3NQUA 1M18D 5JA4B 2FFFB 5B0YB 3B6GB 3EG5B 4KUDD 3LELA 5AY8C 3AZIA 1M18A 3WAAB 5GXQB 3X1TD 3AZMD 4R8PD 4NE5A 5B2IB 4KUDA 3W99D 1TZYB 4KGCC 1P3BC 2FJ7C 3X1SA 3X1TA 5B32G 3AV2C 4HGAC 4R8PA 5CP6D 3W99A 3W98C 4X23B 4DQYB 3AZJD 1P3KB 3UT9C 5B33C 4Z2MH 1ZLAD 2BYKB 1ID3C 1P3PC 1P3IB 3KWQB 3WA9D 3B6FD 1ZLAA 1P34B 5GSUC 5GT3B 3EPJA 5AV6D 1KX5D 3B6FA 5C3IC 1KX3D 3W97D 4H9PB 3RELD 3KFUG 3VH5A 5B40A 3AYWC 1H3OB 1U35B 5AV6A 3WTPE 1KX5A 3MGPC 3AZGB 4ZUXC 3W97A 1KX3A 3RELA 5B24C 2CV5B 1F66C 5B0ZD 2BYMA 5B1LB 3AN2C 2Y2KA 3WTPD 4UUZA 3AZED 3WKJA 5AV9B 5B0ZA 4YM6C 1P3OB 5CPKC 2Y2MA 2Y2OA 3WTPA 3MGRB 3AZEA 2NQBC 1AOID 4J8XD 4J8VC 5BNXA 3O62D 2Y2GA 4JJNC 3B0DB 5GT0C 1AOIA 2JCHA 2PYOC 4DRAA 3KXBC 3NQUB 3O62A 2FJ7A 1F1EA 3AZNC 3VH6T 3LELB 3AZIB 5AVCC 5AV8C 5B0YD 3B6GD 1P3PA 3WAAD 4KUDB 5JA4A 5GXQD 2JSSA 3AZHD 3MVDC 3X1SB 5B0YA 3B6GA 3X1TB 4R8PB 4XUJC 2Y2HA 5B1MC 5GXQA 3AZHA 5GSUA 4AWLB 3UTAC 3P5JB 2IO5B 4X23D 4KHAB 1P3KD 1P3ID 4X23A 1P3KA 2RIQA 5B24A 1W2EA 3AZLC 1F66A 2ZY5A 4EO5B 1KX4C 3B6FB 3LZ1C 5GT3D 3MGQB 4G92B 1P3LD 5B40B 4Z2MG 4YM6A 1KX5B 2NQBA 4J8VA 1U35D 5GT3A 1P3LA 3AZFD 2BYMB 5CPJC 2AROC 5E5AB 3C1BC 1P3GC 3F6TA 3X1VC 2BG1A 1H3OA 3LJAC 3TU4B 3WKJB 2JE5A 3AZFA 5AV9D 3AZNA 3AZEB 2Y2NA 1P3OD 2F8NH 3IP4C 3MGRD 5AVCA 2Y2LA 4WU9D 5AV9A 1AOIB 3B0CW 3MGRA 3MVDA 4WU9A 2FJ7B 5CPID 4HGAB 1S32D 3AZJC 5CPIA 1HQ3A 3UT9B 4J8UD 3AZID 1S32A 1WWSA 1P3PB 1ID3B 4YS3C 1P3FC 5BT1C 4J8UA 1BFMA 2XD1A 2YFWB 3X1SD 3B0BA 3AZHB 5GSUB 4Z5TC 1P3MD 3REIC 5C3IB 4XZQD 3W96C 5AVBC 4CAYB 3LZ1A 3VH6A 3REJD 2RVQD 5BS7C 2ZY2A 3AYWB 1P3MA 4XZQA 2L5AA 3REJA 5B24B 1B67A 1F66B 4KHAA 4LD9D 2UWXA 1P3GA 3MNND 2W8SA 3REHC 4WNNA 3X1VA 2HIOC 5B32C 2F8NB 4LD9A 5DNMC 4YM6B 3UTBD 5CPKB 1KU5A 3MNNA 3MGQD 3AV1C 2NQBB 5B40D 4J8VB 3VH5W 1P3LB 3UTBA 3MGQA 2DQNC 5E5AD 3AZFB 2DF4C 3KXBB 3TU4D 4J8WC 3AZNB 4QLCD 3WKJD 3V9RB 5E5AA 4ZBJC 5AVCB 5AV8B
chains in the Genus database with same CATH topology
4QLCA 5JRGC 5AY8D 1P3AC 1M1AC 3REKC 3MVDB 4WU9B 3NQJB 2XD5A 5AY8A 5B2IC 4KGCD 4WJ3C 1TZYC 1P3BD 2FJ7D 5B1MB 5B2JC 1BH9A 4Z5TA 5CPIB 3AV2D 1HQ3B 2F8NG 3W96A 2LY8A 5AVBA 3C1CC 4KGCA 1P3BA 1S32B 2Y2PA 5B31C 3KUYC 5AV5C 3UT9D 5B33D 3H0RC 3AV2A 1ID3D 2NZDC 1P3PD 3W98A 3AZKC 4J8UB 4WU8C 3AZLB 3KWQC 3UT9A 5B33A 3AFAC 1ID3A 1KX4B 1P34C 5GSUD 3LZ1B 2ZY4A 5DNNC 1P3MB 2HUEB 2YFWA 4XZQB 3LZ0C 3AYWD 1EQZC 3REJB 3MGPD 1TAFA 4CAYA 4ZUXD 3AZGC 5CPJB 3C1BB 1P3GB 3EPHA 4E44A 5B24D 4WNNB 3AYWA 3X1VB 3LJAB 3AN2D 2CV5C 2Y2QA 1M19C 1F66D 5B1LC 2F8NK 3MGPA 4ZUXA 4LD9B 4NE3A 2ZM5A 3X1UC 5BNVA 3MNNB 4M6BA 3AN2A 2F8ND 4Z66C 4YM6D 3MGSC 5CPKD 3UTBB 2NQBD 4J8VD 2F8NA 5JRGA 1BH8A 1P3AA 3A6NC 5CPKA 5F99C 3REKA 4JJND 5GT0D 4E45A 2PYOD 3EPLA 3KXBD 4JJNA 3AZND 5GT0A 2PYOA 1WWIA 4QLCB 3C1CA 3KXBA 5B31A 5AVCD 1N1JA 5AV8D 3LELC 3KUYA 3AZIC 1M18C 3V9RA 3AZKA 5AY8B 4KUDC 3MVDD 5AV8A 1BH9B 4H9QA 4Z5TB 3X1SC 3X1TC 4XUJD 3REIB 3AZMC 4R8PC 5B1MD 5AVBB 3W96B 3W99C 1Z2CB 4KGCB 1P3BB 2YFVB 3NQJA 3UTAD 1HQ3D 5CHLB 4AWLC 3AV2B 4XUJA 4H9RB 5B1MA 3W98B 5CP6C 3LZ0A 1EQZA 3UTAA 3H0LC 5B33B 3H0MC 1ZLAC 3AZLD 1PZRA 2HIOB 1KX4D 3WA9C 1B6WA 5DNMB 3B6FC 3LZ1D 3AZLA 3FDDA 3VH6W 3MGSA 1KX4A 1HTAA 5BO0A 1TAFB 5AV6C 1R4VA 5KDMA 1KX5C 1KX3C 3W97C 3RELC 3A1KA 5CPJD 2AROD 3C1BD 1P3GD 3MGPB 4ZUXB 3X1VD 3LJAD 3R45B 4UPKA 5BNVB 4J8WB 3AN2B 5CPJA 2AROA 5B0ZC 3C1BA 4ZBJB 3LJAA 3WTPC 5FUGA 3AZEC 4H9NA 1ULYA 5JRGB 1BH8B 1P3AB 1M1AB 3REKB 4H9SC 1AOIC 4J8XC 5B2JB 3O62C 4JJNB 5GT0B 4G91C 2PYOB 3AZMA 3C1CB 5B31B 1N1JB 3KUYB 5AV5B 4WV4B 2NZDB 5CP6A 3AZKB 3AZJA 4WU8B 4YS3D 1P3FD 5BT1D 3AFAB 4H9QB 5B0YC 3B6GC 1JFIA 3WAAC 5GXQC 4Z5TD 3AZHC 4YS3A 1P3FA 3WA9A 3REID 5AVBD 5DNNB 3W96D 4XUJB 1A7WA 5G49A 3LZ0B 1EQZB 3UTAB 1Q9CA 3REIA 4CSRB 3W98D 2YFVA 4X23C 1P3KC 5BS7A 1M19B 2J8PA 4H9RA 3B0CT 2CWEA 3REHD 1P3IC 3X1UB 2HIOD 4WZSB 5B32D 4Z66B 5DNMD 3MGSB 3AV1D 3REHA 5BO0B 5KDMB 5B31G 2HIOA 5B32A 5GT3C 5DNMA 3A6NB 1P3LC 5F99B 3AV1A 4H9SA 4J8XA 1U35C 3AZFC 2AROB 4J8WD 1T3UA 4H9OA 5FUGB 4H9NB 1M18B 3R45A 4J8WA 4DRBA 3EPKA 5AV9C 5JRGD 1P3AD 1M1AD 3REKD 1P3OC 3MGRC 4WU9C 5B2ID 1M1AA 1TZYD 3AZMB 5B2JD 3WAAA 3W99B 2G5HC 3B0DC 5CPIC 1HQ3C 5B2IA 3C1CD 1TZYA 2VQRA 5B31D 5B2JA 5CP6B 3KUYD 1S32C 5AV5D 3AL0C 3AZJB 2NZDD 3VH5T 3AZKD 1JFIB 4J8UC 1ZLAB 4WU8D 5AV5A 3KWQD 3AFAD 4YS3B 2NZDA 1P3FB 3WA9B 2BYKA 1P3IA 1P34D 4WU8A 3KWQA 5G49B 3AFAA 5DNND 1P3MC 2HUEC 5AV6B 1P34A 2F2AC 4XZQC 3LZ0D 1EQZD 1KX3B 3W97B 3RELB 3REJC 2RVQC 5DNNA 3AZGD 2IO5C 4H9PA 2CV5D 1U35A 1M19D 4UUZB 5B1LD 4CSRA 5B0ZB 3AZGA 2Y2JA 4LD9C 3X1UD 2ZY3A 3REHB 3MNNC 2CV5A 3WTPB 4Z66D 1M19A 5B1LA 5B32B 3MGSD 2Y2IA 5BNXB 4EO5C 3X1UA 3UTBC 3AV1B 3MGQC 4G92C 4Z66A 3A1IA 3A6ND 4J8XB 5B40C 5F99D 1P3OA 3O62B 3TU4A 4NFTA 4G91B 3A6NA 4H9OB 5F99A 5E5AC 3KSYA 2G5IC 3TU4C 3WKJC 4QLCC 4NE6A 3LELD 3NQUA 1M18D 5JA4B 2FFFB 5B0YB 3B6GB 3EG5B 4KUDD 3LELA 5AY8C 3AZIA 1M18A 3WAAB 5GXQB 3X1TD 3AZMD 4R8PD 4NE5A 5B2IB 4KUDA 3W99D 1TZYB 4KGCC 1P3BC 2FJ7C 3X1SA 3X1TA 5B32G 3AV2C 4HGAC 4R8PA 5CP6D 3W99A 3W98C 4X23B 4DQYB 3AZJD 1P3KB 3UT9C 5B33C 4Z2MH 1ZLAD 2BYKB 1ID3C 1P3PC 1P3IB 3KWQB 3WA9D 3B6FD 1ZLAA 1P34B 5GSUC 5GT3B 3EPJA 5AV6D 1KX5D 3B6FA 5C3IC 1KX3D 3W97D 4H9PB 3RELD 3KFUG 3VH5A 5B40A 3AYWC 1H3OB 1U35B 5AV6A 3WTPE 1KX5A 3MGPC 3AZGB 4ZUXC 3W97A 1KX3A 3RELA 5B24C 2CV5B 1F66C 5B0ZD 2BYMA 5B1LB 3AN2C 2Y2KA 3WTPD 4UUZA 3AZED 3WKJA 5AV9B 5B0ZA 4YM6C 1P3OB 5CPKC 2Y2MA 2Y2OA 3WTPA 3MGRB 3AZEA 2NQBC 1AOID 4J8XD 4J8VC 5BNXA 3O62D 2Y2GA 4JJNC 3B0DB 5GT0C 1AOIA 2JCHA 2PYOC 4DRAA 3KXBC 3NQUB 3O62A 2FJ7A 1F1EA 3AZNC 3VH6T 3LELB 3AZIB 5AVCC 5AV8C 5B0YD 3B6GD 1P3PA 3WAAD 4KUDB 5JA4A 5GXQD 2JSSA 3AZHD 3MVDC 3X1SB 5B0YA 3B6GA 3X1TB 4R8PB 4XUJC 2Y2HA 5B1MC 5GXQA 3AZHA 5GSUA 4AWLB 3UTAC 3P5JB 2IO5B 4X23D 4KHAB 1P3KD 1P3ID 4X23A 1P3KA 2RIQA 5B24A 1W2EA 3AZLC 1F66A 2ZY5A 4EO5B 1KX4C 3B6FB 3LZ1C 5GT3D 3MGQB 4G92B 1P3LD 5B40B 4Z2MG 4YM6A 1KX5B 2NQBA 4J8VA 1U35D 5GT3A 1P3LA 3AZFD 2BYMB 5CPJC 2AROC 5E5AB 3C1BC 1P3GC 3F6TA 3X1VC 2BG1A 1H3OA 3LJAC 3TU4B 3WKJB 2JE5A 3AZFA 5AV9D 3AZNA 3AZEB 2Y2NA 1P3OD 2F8NH 3IP4C 3MGRD 5AVCA 2Y2LA 4WU9D 5AV9A 1AOIB 3B0CW 3MGRA 3MVDA 4WU9A 2FJ7B 5CPID 4HGAB 1S32D 3AZJC 5CPIA 1HQ3A 3UT9B 4J8UD 3AZID 1S32A 1WWSA 1P3PB 1ID3B 4YS3C 1P3FC 5BT1C 4J8UA 1BFMA 2XD1A 2YFWB 3X1SD 3B0BA 3AZHB 5GSUB 4Z5TC 1P3MD 3REIC 5C3IB 4XZQD 3W96C 5AVBC 4CAYB 3LZ1A 3VH6A 3REJD 2RVQD 5BS7C 2ZY2A 3AYWB 1P3MA 4XZQA 2L5AA 3REJA 5B24B 1B67A 1F66B 4KHAA 4LD9D 2UWXA 1P3GA 3MNND 2W8SA 3REHC 4WNNA 3X1VA 2HIOC 5B32C 2F8NB 4LD9A 5DNMC 4YM6B 3UTBD 5CPKB 1KU5A 3MNNA 3MGQD 3AV1C 2NQBB 5B40D 4J8VB 3VH5W 1P3LB 3UTBA 3MGQA 2DQNC 5E5AD 3AZFB 2DF4C 3KXBB 3TU4D 4J8WC 3AZNB 4QLCD 3WKJD 3V9RB 5E5AA 4ZBJC 5AVCB 5AV8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QLC A;  5JRG C;  5AY8 D;  1P3A C;  1M1A C;  3REK C;  3MVD B;  4WU9 B;  3NQJ B;  5AY8 A;  5B2I C;  4KGC D;  1TZY C;  1P3B D;  2FJ7 D;  5B1M B;  5B2J C;  1BH9 A;  4Z5T A;  5CPI B;  3AV2 D;  1HQ3 B;  2F8N G;  3W96 A;  2LY8 A;  5AVB A;  3C1C C;  4KGC A;  1P3B A;  1S32 B;  5B31 C;  3KUY C;  5AV5 C;  3UT9 D;  5B33 D;  3AV2 A;  1ID3 D;  2NZD C;  1P3P D;  3W98 A;  3AZK C;  4J8U B;  4WU8 C;  3AZL B;  3KWQ C;  3UT9 A;  5B33 A;  3AFA C;  1ID3 A;  1KX4 B;  1P34 C;  5GSU D;  3LZ1 B;  5DNN C;  1P3M B;  2HUE B;  2YFW A;  4XZQ B;  3LZ0 C;  3AYW D;  1EQZ C;  3REJ B;  3MGP D;  1TAF A;  4CAY A;  4ZUX D;  3AZG C;  5CPJ B;  3C1B B;  1P3G B;  4E44 A;  5B24 D;  4WNN B;  3AYW A;  3X1V B;  3LJA B;  3AN2 D;  2CV5 C;  1M19 C;  1F66 D;  2F8N K;  5B1L C;  3MGP A;  4ZUX A;  4LD9 B;  4NE3 A;  3X1U C;  5BNV A;  3MNN B;  4M6B A;  3AN2 A;  2F8N D;  4Z66 C;  4YM6 D;  3MGS C;  5CPK D;  3UTB B;  2NQB D;  4J8V D;  2F8N A;  5JRG A;  1BH8 A;  1P3A A;  3A6N C;  5CPK A;  5F99 C;  3REK A;  4JJN D;  5GT0 D;  4E45 A;  2PYO D;  3KXB D;  4JJN A;  3AZN D;  5GT0 A;  2PYO A;  1WWI A;  4QLC B;  3C1C A;  3KXB A;  5B31 A;  5AVC D;  1N1J A;  5AV8 D;  3LEL C;  3KUY A;  3AZI C;  1M18 C;  3V9R A;  3AZK A;  5AY8 B;  4KUD C;  3MVD D;  5AV8 A;  1BH9 B;  4H9Q A;  4Z5T B;  3X1S C;  3X1T C;  4XUJ D;  3REI B;  3AZM C;  4R8P C;  5B1M D;  5AVB B;  3W96 B;  3W99 C;  4KGC B;  1P3B B;  2YFV B;  3NQJ A;  3UTA D;  1HQ3 D;  5CHL B;  4AWL C;  3AV2 B;  4XUJ A;  4H9R B;  5B1M A;  3W98 B;  5CP6 C;  3LZ0 A;  1EQZ A;  3UTA A;  5B33 B;  1ZLA C;  3AZL D;  2HIO B;  1KX4 D;  3WA9 C;  1B6W A;  5DNM B;  3B6F C;  3LZ1 D;  3AZL A;  3VH6 W;  3MGS A;  1KX4 A;  1HTA A;  5BO0 A;  1TAF B;  5AV6 C;  1R4V A;  5KDM A;  1KX5 C;  1KX3 C;  3W97 C;  3REL C;  5CPJ D;  2ARO D;  3C1B D;  1P3G D;  3MGP B;  4ZUX B;  3X1V D;  3LJA D;  3R45 B;  4J8W B;  5BNV B;  3AN2 B;  5CPJ A;  2ARO A;  5B0Z C;  3C1B A;  4ZBJ B;  3LJA A;  3WTP C;  5FUG A;  3AZE C;  4H9N A;  1ULY A;  5JRG B;  1BH8 B;  1P3A B;  1M1A B;  3REK B;  4H9S C;  1AOI C;  4J8X C;  5B2J B;  3O62 C;  4JJN B;  5GT0 B;  4G91 C;  2PYO B;  3AZM A;  3C1C B;  5B31 B;  1N1J B;  3KUY B;  5AV5 B;  4WV4 B;  2NZD B;  5CP6 A;  3AZK B;  3AZJ A;  4WU8 B;  4YS3 D;  1P3F D;  5BT1 D;  3AFA B;  4H9Q B;  5B0Y C;  3B6G C;  1JFI A;  3WAA C;  5GXQ C;  4Z5T D;  3AZH C;  4YS3 A;  1P3F A;  3WA9 A;  3REI D;  5AVB D;  5DNN B;  3W96 D;  4XUJ B;  1A7W A;  5G49 A;  3LZ0 B;  1EQZ B;  3UTA B;  1Q9C A;  3REI A;  4CSR B;  3W98 D;  2YFV A;  4X23 C;  1P3K C;  5BS7 A;  1M19 B;  4H9R A;  3B0C T;  2CWE A;  3REH D;  1P3I C;  3X1U B;  2HIO D;  4WZS B;  5B32 D;  4Z66 B;  5DNM D;  3MGS B;  3AV1 D;  3REH A;  5BO0 B;  5KDM B;  5B31 G;  2HIO A;  5B32 A;  5GT3 C;  5DNM A;  3A6N B;  1P3L C;  5F99 B;  3AV1 A;  4H9S A;  4J8X A;  1U35 C;  3AZF C;  2ARO B;  4J8W D;  4H9O A;  5FUG B;  4H9N B;  1M18 B;  3R45 A;  4J8W A;  4DRB A;  5AV9 C;  5JRG D;  1P3A D;  1M1A D;  3REK D;  1P3O C;  3MGR C;  4WU9 C;  5B2I D;  1M1A A;  1TZY D;  3AZM B;  5B2J D;  3WAA A;  3W99 B;  3B0D C;  5CPI C;  1HQ3 C;  5B2I A;  3C1C D;  1TZY A;  5B31 D;  5B2J A;  5CP6 B;  3KUY D;  1S32 C;  5AV5 D;  3AZJ B;  2NZD D;  3VH5 T;  3AZK D;  1JFI B;  4J8U C;  1ZLA B;  4WU8 D;  5AV5 A;  3KWQ D;  3AFA D;  4YS3 B;  2NZD A;  1P3F B;  3WA9 B;  2BYK A;  1P3I A;  1P34 D;  4WU8 A;  3KWQ A;  5G49 B;  3AFA A;  5DNN D;  1P3M C;  2HUE C;  5AV6 B;  1P34 A;  3LZ0 D;  4XZQ C;  1EQZ D;  1KX3 B;  3W97 B;  3REL B;  3REJ C;  2RVQ C;  5DNN A;  3AZG D;  2IO5 C;  4H9P A;  2CV5 D;  1U35 A;  1M19 D;  4UUZ B;  5B1L D;  4CSR A;  5B0Z B;  3AZG A;  4LD9 C;  3X1U D;  3REH B;  3MNN C;  2CV5 A;  3WTP B;  4Z66 D;  1M19 A;  5B1L A;  5B32 B;  3MGS D;  5BNX B;  4EO5 C;  3X1U A;  3UTB C;  3AV1 B;  3MGQ C;  4G92 C;  4Z66 A;  3A6N D;  4J8X B;  5B40 C;  5F99 D;  1P3O A;  3O62 B;  3TU4 A;  4NFT A;  4G91 B;  3A6N A;  4H9O B;  5F99 A;  5E5A C;  3KSY A;  3TU4 C;  3WKJ C;  4QLC C;  4NE6 A;  3LEL D;  3NQU A;  1M18 D;  5JA4 B;  5B0Y B;  3B6G B;  4KUD D;  3LEL A;  5AY8 C;  3AZI A;  1M18 A;  3WAA B;  5GXQ B;  3X1T D;  3AZM D;  4R8P D;  4NE5 A;  5B2I B;  4KUD A;  3W99 D;  1TZY B;  4KGC C;  1P3B C;  2FJ7 C;  3X1S A;  3X1T A;  5B32 G;  3AV2 C;  4HGA C;  4R8P A;  5CP6 D;  3W99 A;  3W98 C;  4X23 B;  3AZJ D;  1P3K B;  3UT9 C;  5B33 C;  4Z2M H;  1ZLA D;  2BYK B;  1ID3 C;  1P3P C;  1P3I B;  3KWQ B;  3WA9 D;  3B6F D;  1ZLA A;  1P34 B;  5GSU C;  5GT3 B;  5AV6 D;  1KX5 D;  3B6F A;  5C3I C;  1KX3 D;  3W97 D;  4H9P B;  3REL D;  3VH5 A;  5B40 A;  3AYW C;  1H3O B;  1U35 B;  5AV6 A;  3WTP E;  1KX5 A;  3MGP C;  3AZG B;  4ZUX C;  3W97 A;  1KX3 A;  3REL A;  5B24 C;  2CV5 B;  1F66 C;  5B0Z D;  2BYM A;  5B1L B;  3AN2 C;  3WTP D;  4UUZ A;  3AZE D;  3WKJ A;  5AV9 B;  5B0Z A;  4YM6 C;  1P3O B;  5CPK C;  3MGR B;  3WTP A;  3AZE A;  2NQB C;  1AOI D;  4J8X D;  4J8V C;  5BNX A;  3O62 D;  4JJN C;  3B0D B;  5GT0 C;  1AOI A;  2PYO C;  4DRA A;  3KXB C;  3NQU B;  3O62 A;  2FJ7 A;  1F1E A;  3AZN C;  3VH6 T;  3LEL B;  3AZI B;  5AVC C;  5AV8 C;  5B0Y D;  3B6G D;  1P3P A;  3WAA D;  4KUD B;  5JA4 A;  5GXQ D;  2JSS A;  3AZH D;  3MVD C;  3X1S B;  5B0Y A;  3B6G A;  3X1T B;  4R8P B;  4XUJ C;  5B1M C;  5GXQ A;  3AZH A;  5GSU A;  4AWL B;  3UTA C;  2IO5 B;  4X23 D;  4KHA B;  1P3K D;  1P3I D;  4X23 A;  1P3K A;  5B24 A;  1F66 A;  3AZL C;  4EO5 B;  1KX4 C;  3B6F B;  3LZ1 C;  5GT3 D;  3MGQ B;  4G92 B;  1P3L D;  5B40 B;  4Z2M G;  4YM6 A;  1KX5 B;  2NQB A;  4J8V A;  1U35 D;  5GT3 A;  1P3L A;  3AZF D;  2BYM B;  5CPJ C;  2ARO C;  5E5A B;  3C1B C;  1P3G C;  3X1V C;  1H3O A;  3LJA C;  3TU4 B;  3WKJ B;  3AZF A;  5AV9 D;  3AZN A;  3AZE B;  1P3O D;  2F8N H;  3MGR D;  5AVC A;  4WU9 D;  5AV9 A;  1AOI B;  3B0C W;  3MGR A;  3MVD A;  4WU9 A;  2FJ7 B;  5CPI D;  4HGA B;  1S32 D;  3AZJ C;  5CPI A;  1HQ3 A;  3UT9 B;  4J8U D;  3AZI D;  1S32 A;  1WWS A;  1P3P B;  1ID3 B;  4YS3 C;  1P3F C;  5BT1 C;  4J8U A;  1BFM A;  2YFW B;  3X1S D;  3B0B A;  3AZH B;  5GSU B;  4Z5T C;  1P3M D;  3REI C;  5C3I B;  4XZQ D;  3W96 C;  5AVB C;  4CAY B;  3LZ1 A;  3VH6 A;  3REJ D;  2RVQ D;  5BS7 C;  3AYW B;  1P3M A;  4XZQ A;  2L5A A;  3REJ A;  5B24 B;  1B67 A;  1F66 B;  4KHA A;  4LD9 D;  1P3G A;  3MNN D;  3REH C;  4WNN A;  3X1V A;  2HIO C;  5B32 C;  2F8N B;  4LD9 A;  5DNM C;  4YM6 B;  3UTB D;  5CPK B;  1KU5 A;  3MNN A;  3MGQ D;  3AV1 C;  2NQB B;  5B40 D;  4J8V B;  3VH5 W;  1P3L B;  3UTB A;  3MGQ A;  5E5A D;  3AZF B;  3KXB B;  3TU4 D;  4J8W C;  3AZN B;  4QLC D;  3WKJ D;  3V9R B;  5E5A A;  4ZBJ C;  5AVC B;  5AV8 B; 
#chains in the Genus database with same CATH topology
 4QLC A;  5JRG C;  5AY8 D;  1P3A C;  1M1A C;  3REK C;  3MVD B;  4WU9 B;  3NQJ B;  2XD5 A;  5AY8 A;  5B2I C;  4KGC D;  4WJ3 C;  1TZY C;  1P3B D;  2FJ7 D;  5B1M B;  5B2J C;  1BH9 A;  4Z5T A;  5CPI B;  3AV2 D;  1HQ3 B;  2F8N G;  3W96 A;  2LY8 A;  5AVB A;  3C1C C;  4KGC A;  1P3B A;  1S32 B;  2Y2P A;  5B31 C;  3KUY C;  5AV5 C;  3UT9 D;  5B33 D;  3H0R C;  3AV2 A;  1ID3 D;  2NZD C;  1P3P D;  3W98 A;  3AZK C;  4J8U B;  4WU8 C;  3AZL B;  3KWQ C;  3UT9 A;  5B33 A;  3AFA C;  1ID3 A;  1KX4 B;  1P34 C;  5GSU D;  3LZ1 B;  2ZY4 A;  5DNN C;  1P3M B;  2HUE B;  2YFW A;  4XZQ B;  3LZ0 C;  3AYW D;  1EQZ C;  3REJ B;  3MGP D;  1TAF A;  4CAY A;  4ZUX D;  3AZG C;  5CPJ B;  3C1B B;  1P3G B;  3EPH A;  4E44 A;  5B24 D;  4WNN B;  3AYW A;  3X1V B;  3LJA B;  3AN2 D;  2CV5 C;  2Y2Q A;  1M19 C;  1F66 D;  5B1L C;  2F8N K;  3MGP A;  4ZUX A;  4LD9 B;  4NE3 A;  2ZM5 A;  3X1U C;  5BNV A;  3MNN B;  4M6B A;  3AN2 A;  2F8N D;  4Z66 C;  4YM6 D;  3MGS C;  5CPK D;  3UTB B;  2NQB D;  4J8V D;  2F8N A;  5JRG A;  1BH8 A;  1P3A A;  3A6N C;  5CPK A;  5F99 C;  3REK A;  4JJN D;  5GT0 D;  4E45 A;  2PYO D;  3EPL A;  3KXB D;  4JJN A;  3AZN D;  5GT0 A;  2PYO A;  1WWI A;  4QLC B;  3C1C A;  3KXB A;  5B31 A;  5AVC D;  1N1J A;  5AV8 D;  3LEL C;  3KUY A;  3AZI C;  1M18 C;  3V9R A;  3AZK A;  5AY8 B;  4KUD C;  3MVD D;  5AV8 A;  1BH9 B;  4H9Q A;  4Z5T B;  3X1S C;  3X1T C;  4XUJ D;  3REI B;  3AZM C;  4R8P C;  5B1M D;  5AVB B;  3W96 B;  3W99 C;  1Z2C B;  4KGC B;  1P3B B;  2YFV B;  3NQJ A;  3UTA D;  1HQ3 D;  5CHL B;  4AWL C;  3AV2 B;  4XUJ A;  4H9R B;  5B1M A;  3W98 B;  5CP6 C;  3LZ0 A;  1EQZ A;  3UTA A;  3H0L C;  5B33 B;  3H0M C;  1ZLA C;  3AZL D;  1PZR A;  2HIO B;  1KX4 D;  3WA9 C;  1B6W A;  5DNM B;  3B6F C;  3LZ1 D;  3AZL A;  3FDD A;  3VH6 W;  3MGS A;  1KX4 A;  1HTA A;  5BO0 A;  1TAF B;  5AV6 C;  1R4V A;  5KDM A;  1KX5 C;  1KX3 C;  3W97 C;  3REL C;  3A1K A;  5CPJ D;  2ARO D;  3C1B D;  1P3G D;  3MGP B;  4ZUX B;  3X1V D;  3LJA D;  3R45 B;  4UPK A;  5BNV B;  4J8W B;  3AN2 B;  5CPJ A;  2ARO A;  5B0Z C;  3C1B A;  4ZBJ B;  3LJA A;  3WTP C;  5FUG A;  3AZE C;  4H9N A;  1ULY A;  5JRG B;  1BH8 B;  1P3A B;  1M1A B;  3REK B;  4H9S C;  1AOI C;  4J8X C;  5B2J B;  3O62 C;  4JJN B;  5GT0 B;  4G91 C;  2PYO B;  3AZM A;  3C1C B;  5B31 B;  1N1J B;  3KUY B;  5AV5 B;  4WV4 B;  2NZD B;  5CP6 A;  3AZK B;  3AZJ A;  4WU8 B;  4YS3 D;  1P3F D;  5BT1 D;  3AFA B;  4H9Q B;  5B0Y C;  3B6G C;  1JFI A;  3WAA C;  5GXQ C;  4Z5T D;  3AZH C;  4YS3 A;  1P3F A;  3WA9 A;  3REI D;  5AVB D;  5DNN B;  3W96 D;  4XUJ B;  1A7W A;  5G49 A;  3LZ0 B;  1EQZ B;  3UTA B;  1Q9C A;  3REI A;  4CSR B;  3W98 D;  2YFV A;  4X23 C;  1P3K C;  5BS7 A;  1M19 B;  2J8P A;  4H9R A;  3B0C T;  2CWE A;  3REH D;  1P3I C;  3X1U B;  2HIO D;  4WZS B;  5B32 D;  4Z66 B;  5DNM D;  3MGS B;  3AV1 D;  3REH A;  5BO0 B;  5KDM B;  5B31 G;  2HIO A;  5B32 A;  5GT3 C;  5DNM A;  3A6N B;  1P3L C;  5F99 B;  3AV1 A;  4H9S A;  4J8X A;  1U35 C;  3AZF C;  2ARO B;  4J8W D;  1T3U A;  4H9O A;  5FUG B;  4H9N B;  1M18 B;  3R45 A;  4J8W A;  4DRB A;  3EPK A;  5AV9 C;  5JRG D;  1P3A D;  1M1A D;  3REK D;  1P3O C;  3MGR C;  4WU9 C;  5B2I D;  1M1A A;  1TZY D;  3AZM B;  5B2J D;  3WAA A;  3W99 B;  2G5H C;  3B0D C;  5CPI C;  1HQ3 C;  5B2I A;  3C1C D;  1TZY A;  2VQR A;  5B31 D;  5B2J A;  5CP6 B;  3KUY D;  1S32 C;  5AV5 D;  3AL0 C;  3AZJ B;  2NZD D;  3VH5 T;  3AZK D;  1JFI B;  4J8U C;  1ZLA B;  4WU8 D;  5AV5 A;  3KWQ D;  3AFA D;  4YS3 B;  2NZD A;  1P3F B;  3WA9 B;  2BYK A;  1P3I A;  1P34 D;  4WU8 A;  3KWQ A;  5G49 B;  3AFA A;  5DNN D;  1P3M C;  2HUE C;  5AV6 B;  1P34 A;  2F2A C;  4XZQ C;  3LZ0 D;  1EQZ D;  1KX3 B;  3W97 B;  3REL B;  3REJ C;  2RVQ C;  5DNN A;  3AZG D;  2IO5 C;  4H9P A;  2CV5 D;  1U35 A;  1M19 D;  4UUZ B;  5B1L D;  4CSR A;  5B0Z B;  3AZG A;  2Y2J A;  4LD9 C;  3X1U D;  2ZY3 A;  3REH B;  3MNN C;  2CV5 A;  3WTP B;  4Z66 D;  1M19 A;  5B1L A;  5B32 B;  3MGS D;  2Y2I A;  5BNX B;  4EO5 C;  3X1U A;  3UTB C;  3AV1 B;  3MGQ C;  4G92 C;  4Z66 A;  3A1I A;  3A6N D;  4J8X B;  5B40 C;  5F99 D;  1P3O A;  3O62 B;  3TU4 A;  4NFT A;  4G91 B;  3A6N A;  4H9O B;  5F99 A;  5E5A C;  3KSY A;  2G5I C;  3TU4 C;  3WKJ C;  4QLC C;  4NE6 A;  3LEL D;  3NQU A;  1M18 D;  5JA4 B;  2FFF B;  5B0Y B;  3B6G B;  3EG5 B;  4KUD D;  3LEL A;  5AY8 C;  3AZI A;  1M18 A;  3WAA B;  5GXQ B;  3X1T D;  3AZM D;  4R8P D;  4NE5 A;  5B2I B;  4KUD A;  3W99 D;  1TZY B;  4KGC C;  1P3B C;  2FJ7 C;  3X1S A;  3X1T A;  5B32 G;  3AV2 C;  4HGA C;  4R8P A;  5CP6 D;  3W99 A;  3W98 C;  4X23 B;  4DQY B;  3AZJ D;  1P3K B;  3UT9 C;  5B33 C;  4Z2M H;  1ZLA D;  2BYK B;  1ID3 C;  1P3P C;  1P3I B;  3KWQ B;  3WA9 D;  3B6F D;  1ZLA A;  1P34 B;  5GSU C;  5GT3 B;  3EPJ A;  5AV6 D;  1KX5 D;  3B6F A;  5C3I C;  1KX3 D;  3W97 D;  4H9P B;  3REL D;  3KFU G;  3VH5 A;  5B40 A;  3AYW C;  1H3O B;  1U35 B;  5AV6 A;  3WTP E;  1KX5 A;  3MGP C;  3AZG B;  4ZUX C;  3W97 A;  1KX3 A;  3REL A;  5B24 C;  2CV5 B;  1F66 C;  5B0Z D;  2BYM A;  5B1L B;  3AN2 C;  2Y2K A;  3WTP D;  4UUZ A;  3AZE D;  3WKJ A;  5AV9 B;  5B0Z A;  4YM6 C;  1P3O B;  5CPK C;  2Y2M A;  2Y2O A;  3WTP A;  3MGR B;  3AZE A;  2NQB C;  1AOI D;  4J8X D;  4J8V C;  5BNX A;  3O62 D;  2Y2G A;  4JJN C;  3B0D B;  5GT0 C;  1AOI A;  2JCH A;  2PYO C;  4DRA A;  3KXB C;  3NQU B;  3O62 A;  2FJ7 A;  1F1E A;  3AZN C;  3VH6 T;  3LEL B;  3AZI B;  5AVC C;  5AV8 C;  5B0Y D;  3B6G D;  1P3P A;  3WAA D;  4KUD B;  5JA4 A;  5GXQ D;  2JSS A;  3AZH D;  3MVD C;  3X1S B;  5B0Y A;  3B6G A;  3X1T B;  4R8P B;  4XUJ C;  2Y2H A;  5B1M C;  5GXQ A;  3AZH A;  5GSU A;  4AWL B;  3UTA C;  3P5J B;  2IO5 B;  4X23 D;  4KHA B;  1P3K D;  1P3I D;  4X23 A;  1P3K A;  2RIQ A;  5B24 A;  1W2E A;  3AZL C;  1F66 A;  2ZY5 A;  4EO5 B;  1KX4 C;  3B6F B;  3LZ1 C;  5GT3 D;  3MGQ B;  4G92 B;  1P3L D;  5B40 B;  4Z2M G;  4YM6 A;  1KX5 B;  2NQB A;  4J8V A;  1U35 D;  5GT3 A;  1P3L A;  3AZF D;  2BYM B;  5CPJ C;  2ARO C;  5E5A B;  3C1B C;  1P3G C;  3F6T A;  3X1V C;  2BG1 A;  1H3O A;  3LJA C;  3TU4 B;  3WKJ B;  2JE5 A;  3AZF A;  5AV9 D;  3AZN A;  3AZE B;  2Y2N A;  1P3O D;  2F8N H;  3IP4 C;  3MGR D;  5AVC A;  2Y2L A;  4WU9 D;  5AV9 A;  1AOI B;  3B0C W;  3MGR A;  3MVD A;  4WU9 A;  2FJ7 B;  5CPI D;  4HGA B;  1S32 D;  3AZJ C;  5CPI A;  1HQ3 A;  3UT9 B;  4J8U D;  3AZI D;  1S32 A;  1WWS A;  1P3P B;  1ID3 B;  4YS3 C;  1P3F C;  5BT1 C;  4J8U A;  1BFM A;  2XD1 A;  2YFW B;  3X1S D;  3B0B A;  3AZH B;  5GSU B;  4Z5T C;  1P3M D;  3REI C;  5C3I B;  4XZQ D;  3W96 C;  5AVB C;  4CAY B;  3LZ1 A;  3VH6 A;  3REJ D;  2RVQ D;  5BS7 C;  2ZY2 A;  3AYW B;  1P3M A;  4XZQ A;  2L5A A;  3REJ A;  5B24 B;  1B67 A;  1F66 B;  4KHA A;  4LD9 D;  2UWX A;  1P3G A;  3MNN D;  2W8S A;  3REH C;  4WNN A;  3X1V A;  2HIO C;  5B32 C;  2F8N B;  4LD9 A;  5DNM C;  4YM6 B;  3UTB D;  5CPK B;  1KU5 A;  3MNN A;  3MGQ D;  3AV1 C;  2NQB B;  5B40 D;  4J8V B;  3VH5 W;  1P3L B;  3UTB A;  3MGQ A;  2DQN C;  5E5A D;  3AZF B;  2DF4 C;  3KXB B;  3TU4 D;  4J8W C;  3AZN B;  4QLC D;  3WKJ D;  3V9R B;  5E5A A;  4ZBJ C;  5AVC B;  5AV8 B; 
#chains in the Genus database with same CATH homology
 4QLC A;  5JRG C;  5AY8 D;  1P3A C;  1M1A C;  3REK C;  3MVD B;  4WU9 B;  3NQJ B;  2XD5 A;  5AY8 A;  5B2I C;  4KGC D;  4WJ3 C;  1TZY C;  1P3B D;  2FJ7 D;  5B1M B;  5B2J C;  1BH9 A;  4Z5T A;  5CPI B;  3AV2 D;  1HQ3 B;  2F8N G;  3W96 A;  2LY8 A;  5AVB A;  3C1C C;  4KGC A;  1P3B A;  1S32 B;  2Y2P A;  5B31 C;  3KUY C;  5AV5 C;  3UT9 D;  5B33 D;  3H0R C;  3AV2 A;  1ID3 D;  2NZD C;  1P3P D;  3W98 A;  3AZK C;  4J8U B;  4WU8 C;  3AZL B;  3KWQ C;  3UT9 A;  5B33 A;  3AFA C;  1ID3 A;  1KX4 B;  1P34 C;  5GSU D;  3LZ1 B;  2ZY4 A;  5DNN C;  1P3M B;  2HUE B;  2YFW A;  4XZQ B;  3LZ0 C;  3AYW D;  1EQZ C;  3REJ B;  3MGP D;  1TAF A;  4CAY A;  4ZUX D;  3AZG C;  5CPJ B;  3C1B B;  1P3G B;  3EPH A;  4E44 A;  5B24 D;  4WNN B;  3AYW A;  3X1V B;  3LJA B;  3AN2 D;  2CV5 C;  2Y2Q A;  1M19 C;  1F66 D;  5B1L C;  2F8N K;  3MGP A;  4ZUX A;  4LD9 B;  4NE3 A;  2ZM5 A;  3X1U C;  5BNV A;  3MNN B;  4M6B A;  3AN2 A;  2F8N D;  4Z66 C;  4YM6 D;  3MGS C;  5CPK D;  3UTB B;  2NQB D;  4J8V D;  2F8N A;  5JRG A;  1BH8 A;  1P3A A;  3A6N C;  5CPK A;  5F99 C;  3REK A;  4JJN D;  5GT0 D;  4E45 A;  2PYO D;  3EPL A;  3KXB D;  4JJN A;  3AZN D;  5GT0 A;  2PYO A;  1WWI A;  4QLC B;  3C1C A;  3KXB A;  5B31 A;  5AVC D;  1N1J A;  5AV8 D;  3LEL C;  3KUY A;  3AZI C;  1M18 C;  3V9R A;  3AZK A;  5AY8 B;  4KUD C;  3MVD D;  5AV8 A;  1BH9 B;  4H9Q A;  4Z5T B;  3X1S C;  3X1T C;  4XUJ D;  3REI B;  3AZM C;  4R8P C;  5B1M D;  5AVB B;  3W96 B;  3W99 C;  1Z2C B;  4KGC B;  1P3B B;  2YFV B;  3NQJ A;  3UTA D;  1HQ3 D;  5CHL B;  4AWL C;  3AV2 B;  4XUJ A;  4H9R B;  5B1M A;  3W98 B;  5CP6 C;  3LZ0 A;  1EQZ A;  3UTA A;  3H0L C;  5B33 B;  3H0M C;  1ZLA C;  3AZL D;  1PZR A;  2HIO B;  1KX4 D;  3WA9 C;  1B6W A;  5DNM B;  3B6F C;  3LZ1 D;  3AZL A;  3FDD A;  3VH6 W;  3MGS A;  1KX4 A;  1HTA A;  5BO0 A;  1TAF B;  5AV6 C;  1R4V A;  5KDM A;  1KX5 C;  1KX3 C;  3W97 C;  3REL C;  3A1K A;  5CPJ D;  2ARO D;  3C1B D;  1P3G D;  3MGP B;  4ZUX B;  3X1V D;  3LJA D;  3R45 B;  4UPK A;  5BNV B;  4J8W B;  3AN2 B;  5CPJ A;  2ARO A;  5B0Z C;  3C1B A;  4ZBJ B;  3LJA A;  3WTP C;  5FUG A;  3AZE C;  4H9N A;  1ULY A;  5JRG B;  1BH8 B;  1P3A B;  1M1A B;  3REK B;  4H9S C;  1AOI C;  4J8X C;  5B2J B;  3O62 C;  4JJN B;  5GT0 B;  4G91 C;  2PYO B;  3AZM A;  3C1C B;  5B31 B;  1N1J B;  3KUY B;  5AV5 B;  4WV4 B;  2NZD B;  5CP6 A;  3AZK B;  3AZJ A;  4WU8 B;  4YS3 D;  1P3F D;  5BT1 D;  3AFA B;  4H9Q B;  5B0Y C;  3B6G C;  1JFI A;  3WAA C;  5GXQ C;  4Z5T D;  3AZH C;  4YS3 A;  1P3F A;  3WA9 A;  3REI D;  5AVB D;  5DNN B;  3W96 D;  4XUJ B;  1A7W A;  5G49 A;  3LZ0 B;  1EQZ B;  3UTA B;  1Q9C A;  3REI A;  4CSR B;  3W98 D;  2YFV A;  4X23 C;  1P3K C;  5BS7 A;  1M19 B;  2J8P A;  4H9R A;  3B0C T;  2CWE A;  3REH D;  1P3I C;  3X1U B;  2HIO D;  4WZS B;  5B32 D;  4Z66 B;  5DNM D;  3MGS B;  3AV1 D;  3REH A;  5BO0 B;  5KDM B;  5B31 G;  2HIO A;  5B32 A;  5GT3 C;  5DNM A;  3A6N B;  1P3L C;  5F99 B;  3AV1 A;  4H9S A;  4J8X A;  1U35 C;  3AZF C;  2ARO B;  4J8W D;  1T3U A;  4H9O A;  5FUG B;  4H9N B;  1M18 B;  3R45 A;  4J8W A;  4DRB A;  3EPK A;  5AV9 C;  5JRG D;  1P3A D;  1M1A D;  3REK D;  1P3O C;  3MGR C;  4WU9 C;  5B2I D;  1M1A A;  1TZY D;  3AZM B;  5B2J D;  3WAA A;  3W99 B;  2G5H C;  3B0D C;  5CPI C;  1HQ3 C;  5B2I A;  3C1C D;  1TZY A;  2VQR A;  5B31 D;  5B2J A;  5CP6 B;  3KUY D;  1S32 C;  5AV5 D;  3AL0 C;  3AZJ B;  2NZD D;  3VH5 T;  3AZK D;  1JFI B;  4J8U C;  1ZLA B;  4WU8 D;  5AV5 A;  3KWQ D;  3AFA D;  4YS3 B;  2NZD A;  1P3F B;  3WA9 B;  2BYK A;  1P3I A;  1P34 D;  4WU8 A;  3KWQ A;  5G49 B;  3AFA A;  5DNN D;  1P3M C;  2HUE C;  5AV6 B;  1P34 A;  2F2A C;  4XZQ C;  3LZ0 D;  1EQZ D;  1KX3 B;  3W97 B;  3REL B;  3REJ C;  2RVQ C;  5DNN A;  3AZG D;  2IO5 C;  4H9P A;  2CV5 D;  1U35 A;  1M19 D;  4UUZ B;  5B1L D;  4CSR A;  5B0Z B;  3AZG A;  2Y2J A;  4LD9 C;  3X1U D;  2ZY3 A;  3REH B;  3MNN C;  2CV5 A;  3WTP B;  4Z66 D;  1M19 A;  5B1L A;  5B32 B;  3MGS D;  2Y2I A;  5BNX B;  4EO5 C;  3X1U A;  3UTB C;  3AV1 B;  3MGQ C;  4G92 C;  4Z66 A;  3A1I A;  3A6N D;  4J8X B;  5B40 C;  5F99 D;  1P3O A;  3O62 B;  3TU4 A;  4NFT A;  4G91 B;  3A6N A;  4H9O B;  5F99 A;  5E5A C;  3KSY A;  2G5I C;  3TU4 C;  3WKJ C;  4QLC C;  4NE6 A;  3LEL D;  3NQU A;  1M18 D;  5JA4 B;  2FFF B;  5B0Y B;  3B6G B;  3EG5 B;  4KUD D;  3LEL A;  5AY8 C;  3AZI A;  1M18 A;  3WAA B;  5GXQ B;  3X1T D;  3AZM D;  4R8P D;  4NE5 A;  5B2I B;  4KUD A;  3W99 D;  1TZY B;  4KGC C;  1P3B C;  2FJ7 C;  3X1S A;  3X1T A;  5B32 G;  3AV2 C;  4HGA C;  4R8P A;  5CP6 D;  3W99 A;  3W98 C;  4X23 B;  4DQY B;  3AZJ D;  1P3K B;  3UT9 C;  5B33 C;  4Z2M H;  1ZLA D;  2BYK B;  1ID3 C;  1P3P C;  1P3I B;  3KWQ B;  3WA9 D;  3B6F D;  1ZLA A;  1P34 B;  5GSU C;  5GT3 B;  3EPJ A;  5AV6 D;  1KX5 D;  3B6F A;  5C3I C;  1KX3 D;  3W97 D;  4H9P B;  3REL D;  3KFU G;  3VH5 A;  5B40 A;  3AYW C;  1H3O B;  1U35 B;  5AV6 A;  3WTP E;  1KX5 A;  3MGP C;  3AZG B;  4ZUX C;  3W97 A;  1KX3 A;  3REL A;  5B24 C;  2CV5 B;  1F66 C;  5B0Z D;  2BYM A;  5B1L B;  3AN2 C;  2Y2K A;  3WTP D;  4UUZ A;  3AZE D;  3WKJ A;  5AV9 B;  5B0Z A;  4YM6 C;  1P3O B;  5CPK C;  2Y2M A;  2Y2O A;  3WTP A;  3MGR B;  3AZE A;  2NQB C;  1AOI D;  4J8X D;  4J8V C;  5BNX A;  3O62 D;  2Y2G A;  4JJN C;  3B0D B;  5GT0 C;  1AOI A;  2JCH A;  2PYO C;  4DRA A;  3KXB C;  3NQU B;  3O62 A;  2FJ7 A;  1F1E A;  3AZN C;  3VH6 T;  3LEL B;  3AZI B;  5AVC C;  5AV8 C;  5B0Y D;  3B6G D;  1P3P A;  3WAA D;  4KUD B;  5JA4 A;  5GXQ D;  2JSS A;  3AZH D;  3MVD C;  3X1S B;  5B0Y A;  3B6G A;  3X1T B;  4R8P B;  4XUJ C;  2Y2H A;  5B1M C;  5GXQ A;  3AZH A;  5GSU A;  4AWL B;  3UTA C;  3P5J B;  2IO5 B;  4X23 D;  4KHA B;  1P3K D;  1P3I D;  4X23 A;  1P3K A;  2RIQ A;  5B24 A;  1W2E A;  3AZL C;  1F66 A;  2ZY5 A;  4EO5 B;  1KX4 C;  3B6F B;  3LZ1 C;  5GT3 D;  3MGQ B;  4G92 B;  1P3L D;  5B40 B;  4Z2M G;  4YM6 A;  1KX5 B;  2NQB A;  4J8V A;  1U35 D;  5GT3 A;  1P3L A;  3AZF D;  2BYM B;  5CPJ C;  2ARO C;  5E5A B;  3C1B C;  1P3G C;  3F6T A;  3X1V C;  2BG1 A;  1H3O A;  3LJA C;  3TU4 B;  3WKJ B;  2JE5 A;  3AZF A;  5AV9 D;  3AZN A;  3AZE B;  2Y2N A;  1P3O D;  2F8N H;  3IP4 C;  3MGR D;  5AVC A;  2Y2L A;  4WU9 D;  5AV9 A;  1AOI B;  3B0C W;  3MGR A;  3MVD A;  4WU9 A;  2FJ7 B;  5CPI D;  4HGA B;  1S32 D;  3AZJ C;  5CPI A;  1HQ3 A;  3UT9 B;  4J8U D;  3AZI D;  1S32 A;  1WWS A;  1P3P B;  1ID3 B;  4YS3 C;  1P3F C;  5BT1 C;  4J8U A;  1BFM A;  2XD1 A;  2YFW B;  3X1S D;  3B0B A;  3AZH B;  5GSU B;  4Z5T C;  1P3M D;  3REI C;  5C3I B;  4XZQ D;  3W96 C;  5AVB C;  4CAY B;  3LZ1 A;  3VH6 A;  3REJ D;  2RVQ D;  5BS7 C;  2ZY2 A;  3AYW B;  1P3M A;  4XZQ A;  2L5A A;  3REJ A;  5B24 B;  1B67 A;  1F66 B;  4KHA A;  4LD9 D;  2UWX A;  1P3G A;  3MNN D;  2W8S A;  3REH C;  4WNN A;  3X1V A;  2HIO C;  5B32 C;  2F8N B;  4LD9 A;  5DNM C;  4YM6 B;  3UTB D;  5CPK B;  1KU5 A;  3MNN A;  3MGQ D;  3AV1 C;  2NQB B;  5B40 D;  4J8V B;  3VH5 W;  1P3L B;  3UTB A;  3MGQ A;  2DQN C;  5E5A D;  3AZF B;  2DF4 C;  3KXB B;  3TU4 D;  4J8W C;  3AZN B;  4QLC D;  3WKJ D;  3V9R B;  5E5A A;  4ZBJ C;  5AVC B;  5AV8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...