1P3OA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3oA00
5BNVB 5CPKB 5B33D 1KX4A 4LD9A 2HUEB 4QLCA 3B0CW 5GXQB 4J8XA 4R8PD 1P3AA 3REJA 4H9OA 3LZ0D 2PYOD 4UUZB 3B6GA 2F8NH 3LELB 3UT9D 5JA4A 4X23A 4H9PA 3RELC 2HIOB 3KWQA 4WU8B 3MGQD 1U35D 3WTPD 3AZNB 1BH9B 3AZGA 4KGCC 4WZSB 5GT3C 1P3OD 5GXQD 3W96C 3X1SC 1P3MA 5DNMD 1P3BA 1P3PC 5B40A 4EO5C 1KX3A 1M19A 2NQBA 4XUJC 2JSSA 4YS3A 5BT1C 3C1BA 1WWIA 3B6FD 3AZND 3MGPC 3RELB 3AZFA 3LZ1C 5CPKA 1P3LA 3VH6W 4KGCB 4H9NB 5B0YB 3MGSA 5GT3B 3AZKA 3B0DC 3W96B 3X1SB 4UUZA 5F99A 3X1UB 1P3PB 3LELA 4ZUXD 4WNNB 4XUJB 3WA9D 2HIOA 1P34C 4NE6A 4WU8A 3AZNA 2F8ND 4DRBA 4H9RB 5FUGB 3MGPB 5CPJC 3W99A 3LZ1B 4KGCD 3KUYB 5B0YD 5GT3D 1F66C 4XZQD 2BYKB 4KUDC 3AV1C 1F1EA 3X1UD 1P3FB 2CV5B 5B1MD 5B1LA 3MNNB 4XUJD 3VH5T 1AOIC 2RVQD 5JRGB 2BYMA 3RELA 1P34B 5AV6C 3MGPD 4KGCA 3KUYD 5B33C 5CPJB 1TAFB 5GT0D 5GT3A 5B24B 4R8PC 3AZLC 3W96A 1P3FD 3X1SA 2CV5D 3LZ0C 3AV1B 1P3PA 4WNNA 3MNND 3VH5A 3UT9C 4J8WB 4NE3A 4XUJA 3KXBA 5B2JD 5JRGD 3X1VB 5GSUD 5BO0A 1AOIB 4KHAA 3MGQC 4Z2MH 3WTPC 3MGPA 5B31D 3LZ1A 4CAYB 3C1CD 5B24D 2YFVB 5GXQC 5B33B 5AV5D 1P3OC 3A6ND 4H9QA 5DNMC 4R8PB 3O62C 3AZLB 1JFIB 4Z5TC 1N1JB 3LZ0B 4J8WD 3AV2D 3X1VD 1P3KC 1AOID 1R4VA 1P34A 3B6FC 5AVCD 1HQ3C 3WTPB 3AZID 5CPJA 1TAFA 1ULYA 3WAAD 1P3OB 1F66A 3TU4B 3UTBC 3AZLD 4KUDA 3AZMC 3AV1A 3V9RA 3O62B 5DNMB 4ZUXC 1KU5A 4Z5TB 3X1TA 3VH5W 3WA9C 1AOIA 4G92B 1P3KB 3WKJD 5AV6A 3B6FB 1BH8B 5CP6D 1HQ3B 4J8UB 4CAYA 5B33A 5B0YC 4XZQC 3TU4D 4R8PA 3AZLA 3X1UC 4HGAC 3O62D 1N1JA 3UTBB 1P3GB 3LZ0A 5B1MC 1A7WA 3AZMB 2PYOA 5CPID 4Z5TD 4WU9C 3UT9A 4ZUXB 1P3KD 2RVQC 4ZBJC 3WA9B 4YM6D 3MGQA 1HQ3D 5DNNC 1U35A 3WTPA 4J8UD 3AZHD 2F8NB 5BNVA 4E44A 3KUYC 3W97D 5GT0C 1P3OA 5GXQA 1S32D 3AZJD 3MVDD 5BNXB 4XZQB 5BS7C 1P3FC 3UTBD 2CV5C 1P3GD 5DNMA 3O62A 3AZMD 4HGAB 3REID 5CHLB 3NQJB 3MNNC 3AFAC 1H3OB 3UTAC 5B1MB 3REHD 1P3ID 4WU9B 5B2JC 5JRGC 5GSUC 5B2ID 3REKB 3B6FA 1BH9A 4ZBJB 1WWSA 5B31C 5DNNB 3C1CC 5B24C 2NZDD 4H9SC 5AV5C 3A6NC 5GT0B 4E45A 5E5AD 3AYWB 1M1AD 4J8VB 3AZMA 1TZYD 5KDMB 4J8WC 5AV9D 4WU9D 3AV2C 4ZUXA 3X1VC 2AROB 3AFAB 3UTAB 3AN2D 3B0BA 3WA9A 5B2JB 5AVCC 3REKD 5GSUB 2F8NA 3NQUB 3LJAB 2F8NG 5DNND 3AZIC 5B31B 4H9NA 1BFMA 5B0YA 1M18D 3WAAC 3C1CB 4XZQA 3B0CT 5AV5B 3AYWD 3A6NB 4J8VD 1EQZB 5AY8D 3X1UA 3KSYA 5AVBB 3NQJA 1ZLAB 4WV4B 5B1MA 2AROD 3AFAD 3UTAD 3AZEC 3AV2B 1ID3D 3W98C 3WKJC 3LJAD 4H9RA 5AV8D 5AVCB 5FUGA 5C3IC 5CP6C 3MGRC 5DNNA 3AZGC 1B6WA 5B0ZB 3KUYA 3AZIB 5GT0A 3TU4C 2BYKA 1EQZD 3WAAB 5BS7A 5AVBD 1P3FA 2CV5A 4JJNC 1P3AB 1ZLAD 5CPIC 2FJ7D 2NQBC 3MNNA 3B6GB 4G92C 1KX5D 5B2JA 3AZEB 5JRGA 1HTAA 5GSUA 3VH6A 3NQUA 4YM6C 3W98B 3WKJB 4J8UC 3AZHC 5B31A 5B0ZD 5B31G 4Z66D 3MGRB 5C3IB 5CP6B 3W97C 3AZGB 3C1CA 5B24A 4LD9D 4H9SA 1S32C 4NE5A 5AV5A 3AZJC 3A6NA 3MVDC 4DRAA 4J8XD 1P3GC 1P3AD 3REIC 1P3IC 4JJNB 3B6GD 3REHC 4J8WA 5B40B 5CPIB 1Q9CA 3AV2A 1M19B 3AZED 3X1VA 2NQBB 4X23D 5B2IC 4YS3B 3W98D 5AVCA 3KWQD 4YM6B 3MGRD 3AZGD 3AZIA 3AZHB 2NZDC 2YFVA 1P3LB 3W97B 3WAAA 5E5AC 3MGSB 3AZJB 1S32B 3MVDB 1M1AC 3AZKB 1JFIA 1P3MD 1TZYC 1P3BD 4JJND 5AV9C 5B1LC 5B40D 5F99B 1KX3D 1M19D 3REIB 2CWEA 3AN2C 2NQBD 1P3IB 3AZEA 3REHB 4YS3D 5B32C 3REKC 3C1BD 2F8NK 3W98A 5B2IB 3WKJA 3MGRA 3AZFD 5CP6A 5CPKD 1P3LD 3W99B 1M18C 4M6BA 2NZDB 3MGSD 3TU4A 4Z2MG 3AYWC 4J8VC 3AZKD 5AY8C 5E5AB 1M1AB 4JJNA 5F99D 5CPIA 4Z5TA 2AROC 1TZYB 3LELD 5AV9B 5B1LB 4AWLC 3KXBC 1ID3C 3AN2B 1P3KA 2HIOD 3LJAC 4WU8D 2BYMB 5B32B 5AV8C 1BH8A 4YM6A 1HQ3A 4J8UA 3AZHA 3W99D 3W97A 1S32A 3AZJA 1M18B 4CSRB 3MVDA 1EQZC 5AVBC 3UTBA 1P3GA 1ZLAC 5AY8B 3WTPE 2FJ7C 3REIA 1P3IA 5B1LD 3REHA 4EO5B 1KX5C 5G49B 4AWLB 3KXBB 5B2IA 1ID3B 5B32D 5BO0B 3RELD 4KHAB 5B0ZC 5AV8B 4Z66C 1KX4C 4LD9C 2NZDA 4QLCC 5BNXA 3R45B 4J8XC 4H9QB 2YFWB 5E5AA 1P3AC 3W96D 1M1AA 3X1SD 3REJC 3B0DB 1TZYA 1P3PD 1H3OA 3B6GC 5AV9A 4WU9A 3X1TC 2FJ7B 3AN2A 4X23C 3KXBD 1KX5B 5BT1D 5B32A 3REKA 3KWQC 5B32G 3LZ1D 2LY8A 4Z66B 1M18A 4CSRA 1KX4B 4LD9B 3AYWA 4QLCB 4J8VA 1P3MC 1F66B 5AY8A 4J8XB 1P3BC 5KDMA 2PYOC 2IO5C 4KUDB 3V9RB 5B40C 3REJB 4H9OB 1M19C 1KX3C 2AROA 3AFAA 3UTAA 5G49A 4YS3C 3X1TB 1ID3A 5JA4B 4X23B 3C1BC 4H9PB 1P34D 3LJAA 4G91C 1U35C 5AV8A 3KWQB 3AZFC 5CPKC 5AV6B 1P3LC 5CPJD 2HUEC 1KX4D 3VH6T 3R45A 3MGSC 4QLCD 2YFWA 3AZKC 1EQZA 1F66D 5AVBA 4KUDD 3AV1D 1ZLAA 5F99C 3REJD 1P3MB 1P3BB 2FJ7A 4NFTA 3LELC 2PYOB 2IO5B 2L5AA 3X1TD 1B67A 1KX3B 1KX5A 3UT9B 2HIOC 4WU8C 3C1BB 3AZNC 5AV6D 4G91B 3MGQB 5B0ZA 1U35B 3W99C 4Z66A 3AZFB
chains in the Genus database with same CATH superfamily
5BNVB 5CPKB 5B33D 1KX4A 4LD9A 2HUEB 4QLCA 3B0CW 5GXQB 4J8XA 4R8PD 1P3AA 3REJA 4H9OA 3LZ0D 2PYOD 4UUZB 3B6GA 2F8NH 3LELB 3UT9D 5JA4A 4X23A 4H9PA 2Y2LA 3RELC 2HIOB 3KWQA 4WU8B 3MGQD 1U35D 3WTPD 3AZNB 1BH9B 3AZGA 4KGCC 4WZSB 5GT3C 1P3OD 5GXQD 3F6TA 3W96C 3X1SC 1P3MA 5DNMD 1P3BA 1P3PC 5B40A 4EO5C 1KX3A 1M19A 2NQBA 4XUJC 2JSSA 4YS3A 5BT1C 3C1BA 1WWIA 3B6FD 3AZND 3MGPC 3RELB 3AZFA 3LZ1C 3EPKA 5CPKA 1P3LA 3VH6W 4KGCB 4H9NB 2FFFB 5B0YB 3MGSA 2DF4C 5GT3B 3AZKA 3B0DC 3W96B 3X1SB 4UUZA 5F99A 3X1UB 2XD1A 1P3PB 3LELA 4ZUXD 3IP4C 4WNNB 2ZY2A 4XUJB 3WA9D 2HIOA 1P34C 4NE6A 4WU8A 3AZNA 2F8ND 4DRBA 4H9RB 5FUGB 3MGPB 5CPJC 3W99A 3LZ1B 4KGCD 3KUYB 5B0YD 2DQNC 5GT3D 1F66C 4XZQD 2BYKB 4KUDC 3AV1C 1F1EA 3X1UD 1P3FB 2CV5B 5B1MD 5B1LA 3MNNB 4DQYB 4XUJD 3VH5T 1AOIC 5JRGB 2RVQD 2BYMA 2G5HC 3KFUG 3RELA 1P34B 5AV6C 3MGPD 2ZM5A 4KGCA 3KUYD 5B33C 5CPJB 1TAFB 5GT0D 5GT3A 5B24B 4R8PC 3AZLC 3W96A 1P3FD 3X1SA 2CV5D 3LZ0C 3AV1B 1P3PA 4WNNA 3MNND 3VH5A 3UT9C 4J8WB 4NE3A 4XUJA 3KXBA 5B2JD 5JRGD 3X1VB 5GSUD 5BO0A 1AOIB 4KHAA 3MGQC 2G5IC 4Z2MH 3WTPC 3MGPA 5B31D 3LZ1A 4CAYB 3C1CD 5B24D 2YFVB 5GXQC 5B33B 5AV5D 1P3OC 3A6ND 4H9QA 5DNMC 4R8PB 3A1IA 3O62C 3AZLB 1JFIB 4Z5TC 1N1JB 2BG1A 3LZ0B 4J8WD 1W2EA 3AV2D 3X1VD 1P3KC 3EPLA 1AOID 1R4VA 1P34A 4Z66A 5AVCD 3B6FC 1HQ3C 3WTPB 3AZID 5CPJA 1TAFA 2Y2MA 1ULYA 3WAAD 1P3OB 1F66A 3TU4B 3UTBC 3AZLD 4KUDA 3AZMC 3AV1A 3V9RA 3O62B 5DNMB 4ZUXC 1KU5A 4Z5TB 3X1TA 3VH5W 3WA9C 1AOIA 4G92B 1P3KB 3WKJD 5AV6A 3B6FB 1BH8B 5CP6D 1HQ3B 2Y2OA 4J8UB 4CAYA 5B33A 5B0YC 4XZQC 3TU4D 4R8PA 3AZLA 3X1UC 4HGAC 3H0RC 3O62D 1N1JA 3UTBB 1P3GB 3LZ0A 5B1MC 1A7WA 3AZMB 2PYOA 5CPID 4Z5TD 4WU9C 3UT9A 4ZUXB 1P3KD 2RVQC 3EPHA 4ZBJC 3WA9B 4YM6D 3MGQA 1HQ3D 5DNNC 1U35A 3WTPA 1PZRA 4J8UD 3AZHD 2F8NB 5BNVA 4E44A 3KUYC 3W97D 5GT0C 2Y2PA 1P3OA 5GXQA 1S32D 3AZJD 3MVDD 5BNXB 2Y2JA 4XZQB 5BS7C 1P3FC 3UTBD 2CV5C 1P3GD 5DNMA 3O62A 3AZMD 4HGAB 3REID 5CHLB 3NQJB 3MNNC 3AFAC 1H3OB 3UTAC 5B1MB 3REHD 1P3ID 4WU9B 5B2JC 5JRGC 5GSUC 5B2ID 3REKB 3B6FA 1BH9A 4ZBJB 1WWSA 5B31C 2XD5A 5DNNB 3C1CC 5B24C 2NZDD 4H9SC 5AV5C 3A6NC 5GT0B 4E45A 5E5AD 3AYWB 1M1AD 4J8VB 3AZMA 1TZYD 5KDMB 4J8WC 5AV9D 4WU9D 3AV2C 4ZUXA 3X1VC 2AROB 3AFAB 3UTAB 3AN2D 3B0BA 2RIQA 3WA9A 5B2JB 5AVCC 3REKD 5GSUB 2F8NA 3NQUB 3LJAB 2F8NG 5DNND 3AZIC 5B31B 4H9NA 1BFMA 5B0YA 1M18D 3WAAC 3C1CB 3FDDA 4XZQA 3B0CT 5AV5B 3AYWD 3A6NB 4J8VD 1EQZB 5AY8D 3X1UA 3KSYA 5AVBB 3NQJA 1ZLAB 4WV4B 5B1MA 2AROD 3AFAD 3UTAD 3AZEC 3AV2B 1ID3D 2Y2NA 2W8SA 3W98C 3WKJC 2Y2IA 3LJAD 4H9RA 5AV8D 5AVCB 5FUGA 5C3IC 5CP6C 3MGRC 5DNNA 3AZGC 2ZY5A 1B6WA 4WJ3C 5B0ZB 3KUYA 3AZIB 5GT0A 3TU4C 2BYKA 1EQZD 3WAAB 5BS7A 5AVBD 1P3FA 2CV5A 4JJNC 1P3AB 1ZLAD 5CPIC 2FJ7D 2NQBC 3MNNA 3B6GB 4G92C 1KX5D 5B2JA 3AZEB 5JRGA 1HTAA 2UWXA 5GSUA 3NQUA 4YM6C 3W98B 2JCHA 3WKJB 2Y2GA 4J8UC 3AZHC 5B31A 5B0ZD 5B31G 4Z66D 3MGRB 5C3IB 2Y2HA 5CP6B 3W97C 3AZGB 3C1CA 5B24A 4LD9D 4H9SA 1S32C 4NE5A 5AV5A 3AZJC 3A6NA 3MVDC 4DRAA 4J8XD 1P3GC 1P3AD 4UPKA 3REIC 1P3IC 4JJNB 3B6GD 3REHC 4J8WA 5B40B 5CPIB 1Q9CA 3AV2A 1M19B 3AZED 3X1VA 2NQBB 4X23D 5B2IC 4YS3B 3W98D 5AVCA 3KWQD 4YM6B 3MGRD 3AZGD 3AZIA 3AZHB 2NZDC 2YFVA 2VQRA 1P3LB 3W97B 2Y2KA 3WAAA 2JE5A 5E5AC 3MGSB 3AZJB 1S32B 3A1KA 3MVDB 1M1AC 3AZKB 1JFIA 3H0MC 1P3MD 1TZYC 1P3BD 4JJND 5AV9C 5B1LC 5B40D 5F99B 1KX3D 1M19D 3REIB 2CWEA 3AN2C 2NQBD 1P3IB 3AZEA 3REHB 4YS3D 5B32C 3REKC 3C1BD 2F8NK 3W98A 5B2IB 3WKJA 3MGRA 3AZFD 5CP6A 5CPKD 1P3LD 3W99B 1M18C 4M6BA 2NZDB 3MGSD 3TU4A 4Z2MG 3AYWC 4J8VC 3AZKD 5AY8C 5E5AB 1M1AB 4JJNA 5F99D 5CPIA 4Z5TA 2AROC 1TZYB 3LELD 5AV9B 5B1LB 4AWLC 3KXBC 1ID3C 3AN2B 1P3KA 2HIOD 3LJAC 4WU8D 2BYMB 5B32B 5AV8C 1BH8A 4YM6A 1HQ3A 4J8UA 3AZHA 1Z2CB 3H0LC 3W99D 3W97A 3P5JB 1S32A 3AZJA 1M18B 4CSRB 3MVDA 1EQZC 5AVBC 3UTBA 1P3GA 1ZLAC 5AY8B 3WTPE 2ZY4A 2FJ7C 3REIA 2J8PA 1P3IA 5B1LD 3REHA 4EO5B 1KX5C 5G49B 4AWLB 3KXBB 5B2IA 1ID3B 5B32D 5BO0B 3RELD 4KHAB 5B0ZC 5AV8B 4Z66C 1KX4C 4LD9C 2NZDA 4QLCC 5BNXA 3R45B 4J8XC 4H9QB 2YFWB 5E5AA 1P3AC 3W96D 1M1AA 3X1SD 3REJC 3B0DB 1TZYA 1P3PD 1H3OA 3B6GC 5AV9A 4WU9A 3X1TC 2FJ7B 3AN2A 4X23C 3KXBD 1KX5B 5BT1D 5B32A 3REKA 3KWQC 5B32G 3LZ1D 2LY8A 4Z66B 2ZY3A 3EG5B 1M18A 4CSRA 1KX4B 2F2AC 4LD9B 1T3UA 4QLCB 3AYWA 4J8VA 1P3MC 1F66B 5AY8A 4J8XB 1P3BC 5KDMA 2PYOC 2IO5C 2Y2QA 3V9RB 5B40C 3REJB 4KUDB 4H9OB 1M19C 1KX3C 3AL0C 2AROA 3AFAA 3UTAA 5G49A 4YS3C 3X1TB 1ID3A 5JA4B 4X23B 3C1BC 4H9PB 1P34D 3LJAA 4G91C 1U35C 5AV8A 3KWQB 3AZFC 5CPKC 5AV6B 1P3LC 5CPJD 2HUEC 1KX4D 3VH6T 3R45A 3MGSC 4QLCD 2YFWA 3AZKC 3EPJA 1EQZA 1F66D 5AVBA 4KUDD 3AV1D 1ZLAA 5F99C 3REJD 1P3MB 1P3BB 2FJ7A 4NFTA 3LELC 2PYOB 2IO5B 2L5AA 3X1TD 1B67A 1KX3B 1KX5A 3UT9B 2HIOC 4WU8C 3C1BB 3AZNC 5AV6D 4G91B 3MGQB 5B0ZA 1U35B 3W99C 3VH6A 3AZFB
chains in the Genus database with same CATH topology
5BNVB 5CPKB 5B33D 1KX4A 4LD9A 2HUEB 4QLCA 3B0CW 5GXQB 4J8XA 4R8PD 1P3AA 3REJA 4H9OA 3LZ0D 2PYOD 4UUZB 3B6GA 2F8NH 3LELB 3UT9D 5JA4A 4X23A 4H9PA 2Y2LA 3RELC 2HIOB 3KWQA 4WU8B 3MGQD 1U35D 3WTPD 3AZNB 1BH9B 3AZGA 4KGCC 4WZSB 5GT3C 1P3OD 5GXQD 3F6TA 3W96C 3X1SC 1P3MA 5DNMD 1P3BA 1P3PC 5B40A 4EO5C 1KX3A 1M19A 2NQBA 4XUJC 2JSSA 4YS3A 5BT1C 3C1BA 1WWIA 3B6FD 3AZND 3MGPC 3RELB 3AZFA 3LZ1C 3EPKA 5CPKA 1P3LA 3VH6W 4KGCB 4H9NB 2FFFB 5B0YB 3MGSA 2DF4C 5GT3B 3AZKA 3B0DC 3W96B 3X1SB 4UUZA 5F99A 3X1UB 2XD1A 1P3PB 3LELA 4ZUXD 3IP4C 4WNNB 2ZY2A 4XUJB 3WA9D 2HIOA 1P34C 4NE6A 4WU8A 3AZNA 2F8ND 4DRBA 4H9RB 5FUGB 3MGPB 5CPJC 3W99A 3LZ1B 4KGCD 3KUYB 5B0YD 2DQNC 5GT3D 1F66C 4XZQD 2BYKB 4KUDC 3AV1C 1F1EA 3X1UD 1P3FB 2CV5B 5B1MD 5B1LA 3MNNB 4DQYB 4XUJD 3VH5T 1AOIC 5JRGB 2RVQD 2BYMA 2G5HC 3KFUG 3RELA 1P34B 5AV6C 3MGPD 2ZM5A 4KGCA 3KUYD 5B33C 5CPJB 1TAFB 5GT0D 5GT3A 5B24B 4R8PC 3AZLC 3W96A 1P3FD 3X1SA 2CV5D 3LZ0C 3AV1B 1P3PA 4WNNA 3MNND 3VH5A 3UT9C 4J8WB 4NE3A 4XUJA 3KXBA 5B2JD 5JRGD 3X1VB 5GSUD 5BO0A 1AOIB 4KHAA 3MGQC 2G5IC 4Z2MH 3WTPC 3MGPA 5B31D 3LZ1A 4CAYB 3C1CD 5B24D 2YFVB 5GXQC 5B33B 5AV5D 1P3OC 3A6ND 4H9QA 5DNMC 4R8PB 3A1IA 3O62C 3AZLB 1JFIB 4Z5TC 1N1JB 2BG1A 3LZ0B 4J8WD 1W2EA 3AV2D 3X1VD 1P3KC 3EPLA 1AOID 1R4VA 1P34A 4Z66A 5AVCD 3B6FC 1HQ3C 3WTPB 3AZID 5CPJA 1TAFA 2Y2MA 1ULYA 3WAAD 1P3OB 1F66A 3TU4B 3UTBC 3AZLD 4KUDA 3AZMC 3AV1A 3V9RA 3O62B 5DNMB 4ZUXC 1KU5A 4Z5TB 3X1TA 3VH5W 3WA9C 1AOIA 4G92B 1P3KB 3WKJD 5AV6A 3B6FB 1BH8B 5CP6D 1HQ3B 2Y2OA 4J8UB 4CAYA 5B33A 5B0YC 4XZQC 3TU4D 4R8PA 3AZLA 3X1UC 4HGAC 3H0RC 3O62D 1N1JA 3UTBB 1P3GB 3LZ0A 5B1MC 1A7WA 3AZMB 2PYOA 5CPID 4Z5TD 4WU9C 3UT9A 4ZUXB 1P3KD 2RVQC 3EPHA 4ZBJC 3WA9B 4YM6D 3MGQA 1HQ3D 5DNNC 1U35A 3WTPA 1PZRA 4J8UD 3AZHD 2F8NB 5BNVA 4E44A 3KUYC 3W97D 5GT0C 2Y2PA 1P3OA 5GXQA 1S32D 3AZJD 3MVDD 5BNXB 2Y2JA 4XZQB 5BS7C 1P3FC 3UTBD 2CV5C 1P3GD 5DNMA 3O62A 3AZMD 4HGAB 3REID 5CHLB 3NQJB 3MNNC 3AFAC 1H3OB 3UTAC 5B1MB 3REHD 1P3ID 4WU9B 5B2JC 5JRGC 5GSUC 5B2ID 3REKB 3B6FA 1BH9A 4ZBJB 1WWSA 5B31C 2XD5A 5DNNB 3C1CC 5B24C 2NZDD 4H9SC 5AV5C 3A6NC 5GT0B 4E45A 5E5AD 3AYWB 1M1AD 4J8VB 3AZMA 1TZYD 5KDMB 4J8WC 5AV9D 4WU9D 3AV2C 4ZUXA 3X1VC 2AROB 3AFAB 3UTAB 3AN2D 3B0BA 2RIQA 3WA9A 5B2JB 5AVCC 3REKD 5GSUB 2F8NA 3NQUB 3LJAB 2F8NG 5DNND 3AZIC 5B31B 4H9NA 1BFMA 5B0YA 1M18D 3WAAC 3C1CB 3FDDA 4XZQA 3B0CT 5AV5B 3AYWD 3A6NB 4J8VD 1EQZB 5AY8D 3X1UA 3KSYA 5AVBB 3NQJA 1ZLAB 4WV4B 5B1MA 2AROD 3AFAD 3UTAD 3AZEC 3AV2B 1ID3D 2Y2NA 2W8SA 3W98C 3WKJC 2Y2IA 3LJAD 4H9RA 5AV8D 5AVCB 5FUGA 5C3IC 5CP6C 3MGRC 5DNNA 3AZGC 2ZY5A 1B6WA 4WJ3C 5B0ZB 3KUYA 3AZIB 5GT0A 3TU4C 2BYKA 1EQZD 3WAAB 5BS7A 5AVBD 1P3FA 2CV5A 4JJNC 1P3AB 1ZLAD 5CPIC 2FJ7D 2NQBC 3MNNA 3B6GB 4G92C 1KX5D 5B2JA 3AZEB 5JRGA 1HTAA 2UWXA 5GSUA 3NQUA 4YM6C 3W98B 2JCHA 3WKJB 2Y2GA 4J8UC 3AZHC 5B31A 5B0ZD 5B31G 4Z66D 3MGRB 5C3IB 2Y2HA 5CP6B 3W97C 3AZGB 3C1CA 5B24A 4LD9D 4H9SA 1S32C 4NE5A 5AV5A 3AZJC 3A6NA 3MVDC 4DRAA 4J8XD 1P3GC 1P3AD 4UPKA 3REIC 1P3IC 4JJNB 3B6GD 3REHC 4J8WA 5B40B 5CPIB 1Q9CA 3AV2A 1M19B 3AZED 3X1VA 2NQBB 4X23D 5B2IC 4YS3B 3W98D 5AVCA 3KWQD 4YM6B 3MGRD 3AZGD 3AZIA 3AZHB 2NZDC 2YFVA 2VQRA 1P3LB 3W97B 2Y2KA 3WAAA 2JE5A 5E5AC 3MGSB 3AZJB 1S32B 3A1KA 3MVDB 1M1AC 3AZKB 1JFIA 3H0MC 1P3MD 1TZYC 1P3BD 4JJND 5AV9C 5B1LC 5B40D 5F99B 1KX3D 1M19D 3REIB 2CWEA 3AN2C 2NQBD 1P3IB 3AZEA 3REHB 4YS3D 5B32C 3REKC 3C1BD 2F8NK 3W98A 5B2IB 3WKJA 3MGRA 3AZFD 5CP6A 5CPKD 1P3LD 3W99B 1M18C 4M6BA 2NZDB 3MGSD 3TU4A 4Z2MG 3AYWC 4J8VC 3AZKD 5AY8C 5E5AB 1M1AB 4JJNA 5F99D 5CPIA 4Z5TA 2AROC 1TZYB 3LELD 5AV9B 5B1LB 4AWLC 3KXBC 1ID3C 3AN2B 1P3KA 2HIOD 3LJAC 4WU8D 2BYMB 5B32B 5AV8C 1BH8A 4YM6A 1HQ3A 4J8UA 3AZHA 1Z2CB 3H0LC 3W99D 3W97A 3P5JB 1S32A 3AZJA 1M18B 4CSRB 3MVDA 1EQZC 5AVBC 3UTBA 1P3GA 1ZLAC 5AY8B 3WTPE 2ZY4A 2FJ7C 3REIA 2J8PA 1P3IA 5B1LD 3REHA 4EO5B 1KX5C 5G49B 4AWLB 3KXBB 5B2IA 1ID3B 5B32D 5BO0B 3RELD 4KHAB 5B0ZC 5AV8B 4Z66C 1KX4C 4LD9C 2NZDA 4QLCC 5BNXA 3R45B 4J8XC 4H9QB 2YFWB 5E5AA 1P3AC 3W96D 1M1AA 3X1SD 3REJC 3B0DB 1TZYA 1P3PD 1H3OA 3B6GC 5AV9A 4WU9A 3X1TC 2FJ7B 3AN2A 4X23C 3KXBD 1KX5B 5BT1D 5B32A 3REKA 3KWQC 5B32G 3LZ1D 2LY8A 4Z66B 2ZY3A 3EG5B 1M18A 4CSRA 1KX4B 2F2AC 4LD9B 1T3UA 4QLCB 3AYWA 4J8VA 1P3MC 1F66B 5AY8A 4J8XB 1P3BC 5KDMA 2PYOC 2IO5C 2Y2QA 3V9RB 5B40C 3REJB 4KUDB 4H9OB 1M19C 1KX3C 3AL0C 2AROA 3AFAA 3UTAA 5G49A 4YS3C 3X1TB 1ID3A 5JA4B 4X23B 3C1BC 4H9PB 1P34D 3LJAA 4G91C 1U35C 5AV8A 3KWQB 3AZFC 5CPKC 5AV6B 1P3LC 5CPJD 2HUEC 1KX4D 3VH6T 3R45A 3MGSC 4QLCD 2YFWA 3AZKC 3EPJA 1EQZA 1F66D 5AVBA 4KUDD 3AV1D 1ZLAA 5F99C 3REJD 1P3MB 1P3BB 2FJ7A 4NFTA 3LELC 2PYOB 2IO5B 2L5AA 3X1TD 1B67A 1KX3B 1KX5A 3UT9B 2HIOC 4WU8C 3C1BB 3AZNC 5AV6D 4G91B 3MGQB 5B0ZA 1U35B 3W99C 3VH6A 3AZFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNV B;  5CPK B;  5B33 D;  1KX4 A;  4LD9 A;  2HUE B;  4QLC A;  3B0C W;  5GXQ B;  4J8X A;  4R8P D;  1P3A A;  3REJ A;  4H9O A;  3LZ0 D;  2PYO D;  4UUZ B;  3B6G A;  2F8N H;  3LEL B;  3UT9 D;  5JA4 A;  4X23 A;  4H9P A;  3REL C;  2HIO B;  3KWQ A;  4WU8 B;  3MGQ D;  1U35 D;  3WTP D;  3AZN B;  1BH9 B;  3AZG A;  4KGC C;  4WZS B;  5GT3 C;  1P3O D;  5GXQ D;  3W96 C;  3X1S C;  1P3M A;  5DNM D;  1P3B A;  1P3P C;  5B40 A;  4EO5 C;  1KX3 A;  1M19 A;  2NQB A;  4XUJ C;  2JSS A;  4YS3 A;  5BT1 C;  3C1B A;  1WWI A;  3B6F D;  3AZN D;  3MGP C;  3REL B;  3AZF A;  3LZ1 C;  5CPK A;  1P3L A;  3VH6 W;  4KGC B;  4H9N B;  5B0Y B;  3MGS A;  5GT3 B;  3AZK A;  3B0D C;  3W96 B;  3X1S B;  4UUZ A;  5F99 A;  3X1U B;  1P3P B;  3LEL A;  4ZUX D;  4WNN B;  4XUJ B;  3WA9 D;  2HIO A;  1P34 C;  4NE6 A;  4WU8 A;  3AZN A;  2F8N D;  4DRB A;  4H9R B;  5FUG B;  3MGP B;  5CPJ C;  3W99 A;  3LZ1 B;  4KGC D;  3KUY B;  5B0Y D;  5GT3 D;  1F66 C;  4XZQ D;  2BYK B;  4KUD C;  3AV1 C;  1F1E A;  3X1U D;  1P3F B;  2CV5 B;  5B1M D;  5B1L A;  3MNN B;  4XUJ D;  3VH5 T;  1AOI C;  2RVQ D;  5JRG B;  2BYM A;  3REL A;  1P34 B;  5AV6 C;  3MGP D;  4KGC A;  3KUY D;  5B33 C;  5CPJ B;  1TAF B;  5GT0 D;  5GT3 A;  5B24 B;  4R8P C;  3AZL C;  3W96 A;  1P3F D;  3X1S A;  2CV5 D;  3LZ0 C;  3AV1 B;  1P3P A;  4WNN A;  3MNN D;  3VH5 A;  3UT9 C;  4J8W B;  4NE3 A;  4XUJ A;  3KXB A;  5B2J D;  5JRG D;  3X1V B;  5GSU D;  5BO0 A;  1AOI B;  4KHA A;  3MGQ C;  4Z2M H;  3WTP C;  3MGP A;  5B31 D;  3LZ1 A;  4CAY B;  3C1C D;  5B24 D;  2YFV B;  5GXQ C;  5B33 B;  5AV5 D;  1P3O C;  3A6N D;  4H9Q A;  5DNM C;  4R8P B;  3O62 C;  3AZL B;  1JFI B;  4Z5T C;  1N1J B;  3LZ0 B;  4J8W D;  3AV2 D;  3X1V D;  1P3K C;  1AOI D;  1R4V A;  1P34 A;  3B6F C;  5AVC D;  1HQ3 C;  3WTP B;  3AZI D;  5CPJ A;  1TAF A;  1ULY A;  3WAA D;  1P3O B;  1F66 A;  3TU4 B;  3UTB C;  3AZL D;  4KUD A;  3AZM C;  3AV1 A;  3V9R A;  3O62 B;  5DNM B;  4ZUX C;  1KU5 A;  4Z5T B;  3X1T A;  3VH5 W;  3WA9 C;  1AOI A;  4G92 B;  1P3K B;  3WKJ D;  5AV6 A;  3B6F B;  1BH8 B;  5CP6 D;  1HQ3 B;  4J8U B;  4CAY A;  5B33 A;  5B0Y C;  4XZQ C;  3TU4 D;  4R8P A;  3AZL A;  3X1U C;  4HGA C;  3O62 D;  1N1J A;  3UTB B;  1P3G B;  3LZ0 A;  5B1M C;  1A7W A;  3AZM B;  2PYO A;  5CPI D;  4Z5T D;  4WU9 C;  3UT9 A;  4ZUX B;  1P3K D;  2RVQ C;  4ZBJ C;  3WA9 B;  4YM6 D;  3MGQ A;  1HQ3 D;  5DNN C;  1U35 A;  3WTP A;  4J8U D;  3AZH D;  2F8N B;  5BNV A;  4E44 A;  3KUY C;  3W97 D;  5GT0 C;  1P3O A;  5GXQ A;  1S32 D;  3AZJ D;  3MVD D;  5BNX B;  4XZQ B;  5BS7 C;  1P3F C;  3UTB D;  2CV5 C;  1P3G D;  5DNM A;  3O62 A;  3AZM D;  4HGA B;  3REI D;  5CHL B;  3NQJ B;  3MNN C;  3AFA C;  1H3O B;  3UTA C;  5B1M B;  3REH D;  1P3I D;  4WU9 B;  5B2J C;  5JRG C;  5GSU C;  5B2I D;  3REK B;  3B6F A;  1BH9 A;  4ZBJ B;  1WWS A;  5B31 C;  5DNN B;  3C1C C;  5B24 C;  2NZD D;  4H9S C;  5AV5 C;  3A6N C;  5GT0 B;  4E45 A;  5E5A D;  3AYW B;  1M1A D;  4J8V B;  3AZM A;  1TZY D;  5KDM B;  4J8W C;  5AV9 D;  4WU9 D;  3AV2 C;  4ZUX A;  3X1V C;  2ARO B;  3AFA B;  3UTA B;  3AN2 D;  3B0B A;  3WA9 A;  5B2J B;  5AVC C;  3REK D;  5GSU B;  2F8N A;  3NQU B;  3LJA B;  2F8N G;  5DNN D;  3AZI C;  5B31 B;  4H9N A;  1BFM A;  5B0Y A;  1M18 D;  3WAA C;  3C1C B;  4XZQ A;  3B0C T;  5AV5 B;  3AYW D;  3A6N B;  4J8V D;  1EQZ B;  5AY8 D;  3X1U A;  3KSY A;  5AVB B;  3NQJ A;  1ZLA B;  4WV4 B;  5B1M A;  2ARO D;  3AFA D;  3UTA D;  3AZE C;  3AV2 B;  1ID3 D;  3W98 C;  3WKJ C;  3LJA D;  4H9R A;  5AV8 D;  5AVC B;  5FUG A;  5C3I C;  5CP6 C;  3MGR C;  5DNN A;  3AZG C;  1B6W A;  5B0Z B;  3KUY A;  3AZI B;  5GT0 A;  3TU4 C;  2BYK A;  1EQZ D;  3WAA B;  5BS7 A;  5AVB D;  1P3F A;  2CV5 A;  4JJN C;  1P3A B;  1ZLA D;  5CPI C;  2FJ7 D;  2NQB C;  3MNN A;  3B6G B;  4G92 C;  1KX5 D;  5B2J A;  3AZE B;  5JRG A;  1HTA A;  5GSU A;  3VH6 A;  3NQU A;  4YM6 C;  3W98 B;  3WKJ B;  4J8U C;  3AZH C;  5B31 A;  5B0Z D;  5B31 G;  4Z66 D;  3MGR B;  5C3I B;  5CP6 B;  3W97 C;  3AZG B;  3C1C A;  5B24 A;  4LD9 D;  4H9S A;  1S32 C;  4NE5 A;  5AV5 A;  3AZJ C;  3A6N A;  3MVD C;  4DRA A;  4J8X D;  1P3G C;  1P3A D;  3REI C;  1P3I C;  4JJN B;  3B6G D;  3REH C;  4J8W A;  5B40 B;  5CPI B;  1Q9C A;  3AV2 A;  1M19 B;  3AZE D;  3X1V A;  2NQB B;  4X23 D;  5B2I C;  4YS3 B;  3W98 D;  5AVC A;  3KWQ D;  4YM6 B;  3MGR D;  3AZG D;  3AZI A;  3AZH B;  2NZD C;  2YFV A;  1P3L B;  3W97 B;  3WAA A;  5E5A C;  3MGS B;  3AZJ B;  1S32 B;  3MVD B;  1M1A C;  3AZK B;  1JFI A;  1P3M D;  1TZY C;  1P3B D;  4JJN D;  5AV9 C;  5B1L C;  5B40 D;  5F99 B;  1KX3 D;  1M19 D;  3REI B;  2CWE A;  3AN2 C;  2NQB D;  1P3I B;  3AZE A;  3REH B;  4YS3 D;  5B32 C;  3REK C;  3C1B D;  2F8N K;  3W98 A;  5B2I B;  3WKJ A;  3MGR A;  3AZF D;  5CP6 A;  5CPK D;  1P3L D;  3W99 B;  1M18 C;  4M6B A;  2NZD B;  3MGS D;  3TU4 A;  4Z2M G;  3AYW C;  4J8V C;  3AZK D;  5AY8 C;  5E5A B;  1M1A B;  4JJN A;  5F99 D;  5CPI A;  4Z5T A;  2ARO C;  1TZY B;  3LEL D;  5AV9 B;  5B1L B;  4AWL C;  3KXB C;  1ID3 C;  3AN2 B;  1P3K A;  2HIO D;  3LJA C;  4WU8 D;  2BYM B;  5B32 B;  5AV8 C;  1BH8 A;  4YM6 A;  1HQ3 A;  4J8U A;  3AZH A;  3W99 D;  3W97 A;  1S32 A;  3AZJ A;  1M18 B;  4CSR B;  3MVD A;  1EQZ C;  5AVB C;  3UTB A;  1P3G A;  1ZLA C;  5AY8 B;  3WTP E;  2FJ7 C;  3REI A;  1P3I A;  5B1L D;  3REH A;  4EO5 B;  1KX5 C;  5G49 B;  4AWL B;  3KXB B;  5B2I A;  1ID3 B;  5B32 D;  5BO0 B;  3REL D;  4KHA B;  5B0Z C;  5AV8 B;  4Z66 C;  1KX4 C;  4LD9 C;  2NZD A;  4QLC C;  5BNX A;  3R45 B;  4J8X C;  4H9Q B;  2YFW B;  5E5A A;  1P3A C;  3W96 D;  1M1A A;  3X1S D;  3REJ C;  3B0D B;  1TZY A;  1P3P D;  1H3O A;  3B6G C;  5AV9 A;  4WU9 A;  3X1T C;  2FJ7 B;  3AN2 A;  4X23 C;  3KXB D;  1KX5 B;  5BT1 D;  5B32 A;  3REK A;  3KWQ C;  5B32 G;  3LZ1 D;  2LY8 A;  4Z66 B;  1M18 A;  4CSR A;  1KX4 B;  4LD9 B;  3AYW A;  4QLC B;  4J8V A;  1P3M C;  1F66 B;  5AY8 A;  4J8X B;  1P3B C;  5KDM A;  2PYO C;  2IO5 C;  4KUD B;  3V9R B;  5B40 C;  3REJ B;  4H9O B;  1M19 C;  1KX3 C;  2ARO A;  3AFA A;  3UTA A;  5G49 A;  4YS3 C;  3X1T B;  1ID3 A;  5JA4 B;  4X23 B;  3C1B C;  4H9P B;  1P34 D;  3LJA A;  4G91 C;  1U35 C;  5AV8 A;  3KWQ B;  3AZF C;  5CPK C;  5AV6 B;  1P3L C;  5CPJ D;  2HUE C;  1KX4 D;  3VH6 T;  3R45 A;  3MGS C;  4QLC D;  2YFW A;  3AZK C;  1EQZ A;  1F66 D;  5AVB A;  4KUD D;  3AV1 D;  1ZLA A;  5F99 C;  3REJ D;  1P3M B;  1P3B B;  2FJ7 A;  4NFT A;  3LEL C;  2PYO B;  2IO5 B;  2L5A A;  3X1T D;  1B67 A;  1KX3 B;  1KX5 A;  3UT9 B;  2HIO C;  4WU8 C;  3C1B B;  3AZN C;  5AV6 D;  4G91 B;  3MGQ B;  5B0Z A;  1U35 B;  3W99 C;  4Z66 A;  3AZF B; 
#chains in the Genus database with same CATH topology
 5BNV B;  5CPK B;  5B33 D;  1KX4 A;  4LD9 A;  2HUE B;  4QLC A;  3B0C W;  5GXQ B;  4J8X A;  4R8P D;  1P3A A;  3REJ A;  4H9O A;  3LZ0 D;  2PYO D;  4UUZ B;  3B6G A;  2F8N H;  3LEL B;  3UT9 D;  5JA4 A;  4X23 A;  4H9P A;  2Y2L A;  3REL C;  2HIO B;  3KWQ A;  4WU8 B;  3MGQ D;  1U35 D;  3WTP D;  3AZN B;  1BH9 B;  3AZG A;  4KGC C;  4WZS B;  5GT3 C;  1P3O D;  5GXQ D;  3F6T A;  3W96 C;  3X1S C;  1P3M A;  5DNM D;  1P3B A;  1P3P C;  5B40 A;  4EO5 C;  1KX3 A;  1M19 A;  2NQB A;  4XUJ C;  2JSS A;  4YS3 A;  5BT1 C;  3C1B A;  1WWI A;  3B6F D;  3AZN D;  3MGP C;  3REL B;  3AZF A;  3LZ1 C;  3EPK A;  5CPK A;  1P3L A;  3VH6 W;  4KGC B;  4H9N B;  2FFF B;  5B0Y B;  3MGS A;  2DF4 C;  5GT3 B;  3AZK A;  3B0D C;  3W96 B;  3X1S B;  4UUZ A;  5F99 A;  3X1U B;  2XD1 A;  1P3P B;  3LEL A;  4ZUX D;  3IP4 C;  4WNN B;  2ZY2 A;  4XUJ B;  3WA9 D;  2HIO A;  1P34 C;  4NE6 A;  4WU8 A;  3AZN A;  2F8N D;  4DRB A;  4H9R B;  5FUG B;  3MGP B;  5CPJ C;  3W99 A;  3LZ1 B;  4KGC D;  3KUY B;  5B0Y D;  2DQN C;  5GT3 D;  1F66 C;  4XZQ D;  2BYK B;  4KUD C;  3AV1 C;  1F1E A;  3X1U D;  1P3F B;  2CV5 B;  5B1M D;  5B1L A;  3MNN B;  4DQY B;  4XUJ D;  3VH5 T;  1AOI C;  5JRG B;  2RVQ D;  2BYM A;  2G5H C;  3KFU G;  3REL A;  1P34 B;  5AV6 C;  3MGP D;  2ZM5 A;  4KGC A;  3KUY D;  5B33 C;  5CPJ B;  1TAF B;  5GT0 D;  5GT3 A;  5B24 B;  4R8P C;  3AZL C;  3W96 A;  1P3F D;  3X1S A;  2CV5 D;  3LZ0 C;  3AV1 B;  1P3P A;  4WNN A;  3MNN D;  3VH5 A;  3UT9 C;  4J8W B;  4NE3 A;  4XUJ A;  3KXB A;  5B2J D;  5JRG D;  3X1V B;  5GSU D;  5BO0 A;  1AOI B;  4KHA A;  3MGQ C;  2G5I C;  4Z2M H;  3WTP C;  3MGP A;  5B31 D;  3LZ1 A;  4CAY B;  3C1C D;  5B24 D;  2YFV B;  5GXQ C;  5B33 B;  5AV5 D;  1P3O C;  3A6N D;  4H9Q A;  5DNM C;  4R8P B;  3A1I A;  3O62 C;  3AZL B;  1JFI B;  4Z5T C;  1N1J B;  2BG1 A;  3LZ0 B;  4J8W D;  1W2E A;  3AV2 D;  3X1V D;  1P3K C;  3EPL A;  1AOI D;  1R4V A;  1P34 A;  4Z66 A;  5AVC D;  3B6F C;  1HQ3 C;  3WTP B;  3AZI D;  5CPJ A;  1TAF A;  2Y2M A;  1ULY A;  3WAA D;  1P3O B;  1F66 A;  3TU4 B;  3UTB C;  3AZL D;  4KUD A;  3AZM C;  3AV1 A;  3V9R A;  3O62 B;  5DNM B;  4ZUX C;  1KU5 A;  4Z5T B;  3X1T A;  3VH5 W;  3WA9 C;  1AOI A;  4G92 B;  1P3K B;  3WKJ D;  5AV6 A;  3B6F B;  1BH8 B;  5CP6 D;  1HQ3 B;  2Y2O A;  4J8U B;  4CAY A;  5B33 A;  5B0Y C;  4XZQ C;  3TU4 D;  4R8P A;  3AZL A;  3X1U C;  4HGA C;  3H0R C;  3O62 D;  1N1J A;  3UTB B;  1P3G B;  3LZ0 A;  5B1M C;  1A7W A;  3AZM B;  2PYO A;  5CPI D;  4Z5T D;  4WU9 C;  3UT9 A;  4ZUX B;  1P3K D;  2RVQ C;  3EPH A;  4ZBJ C;  3WA9 B;  4YM6 D;  3MGQ A;  1HQ3 D;  5DNN C;  1U35 A;  3WTP A;  1PZR A;  4J8U D;  3AZH D;  2F8N B;  5BNV A;  4E44 A;  3KUY C;  3W97 D;  5GT0 C;  2Y2P A;  1P3O A;  5GXQ A;  1S32 D;  3AZJ D;  3MVD D;  5BNX B;  2Y2J A;  4XZQ B;  5BS7 C;  1P3F C;  3UTB D;  2CV5 C;  1P3G D;  5DNM A;  3O62 A;  3AZM D;  4HGA B;  3REI D;  5CHL B;  3NQJ B;  3MNN C;  3AFA C;  1H3O B;  3UTA C;  5B1M B;  3REH D;  1P3I D;  4WU9 B;  5B2J C;  5JRG C;  5GSU C;  5B2I D;  3REK B;  3B6F A;  1BH9 A;  4ZBJ B;  1WWS A;  5B31 C;  2XD5 A;  5DNN B;  3C1C C;  5B24 C;  2NZD D;  4H9S C;  5AV5 C;  3A6N C;  5GT0 B;  4E45 A;  5E5A D;  3AYW B;  1M1A D;  4J8V B;  3AZM A;  1TZY D;  5KDM B;  4J8W C;  5AV9 D;  4WU9 D;  3AV2 C;  4ZUX A;  3X1V C;  2ARO B;  3AFA B;  3UTA B;  3AN2 D;  3B0B A;  2RIQ A;  3WA9 A;  5B2J B;  5AVC C;  3REK D;  5GSU B;  2F8N A;  3NQU B;  3LJA B;  2F8N G;  5DNN D;  3AZI C;  5B31 B;  4H9N A;  1BFM A;  5B0Y A;  1M18 D;  3WAA C;  3C1C B;  3FDD A;  4XZQ A;  3B0C T;  5AV5 B;  3AYW D;  3A6N B;  4J8V D;  1EQZ B;  5AY8 D;  3X1U A;  3KSY A;  5AVB B;  3NQJ A;  1ZLA B;  4WV4 B;  5B1M A;  2ARO D;  3AFA D;  3UTA D;  3AZE C;  3AV2 B;  1ID3 D;  2Y2N A;  2W8S A;  3W98 C;  3WKJ C;  2Y2I A;  3LJA D;  4H9R A;  5AV8 D;  5AVC B;  5FUG A;  5C3I C;  5CP6 C;  3MGR C;  5DNN A;  3AZG C;  2ZY5 A;  1B6W A;  4WJ3 C;  5B0Z B;  3KUY A;  3AZI B;  5GT0 A;  3TU4 C;  2BYK A;  1EQZ D;  3WAA B;  5BS7 A;  5AVB D;  1P3F A;  2CV5 A;  4JJN C;  1P3A B;  1ZLA D;  5CPI C;  2FJ7 D;  2NQB C;  3MNN A;  3B6G B;  4G92 C;  1KX5 D;  5B2J A;  3AZE B;  5JRG A;  1HTA A;  2UWX A;  5GSU A;  3NQU A;  4YM6 C;  3W98 B;  2JCH A;  3WKJ B;  2Y2G A;  4J8U C;  3AZH C;  5B31 A;  5B0Z D;  5B31 G;  4Z66 D;  3MGR B;  5C3I B;  2Y2H A;  5CP6 B;  3W97 C;  3AZG B;  3C1C A;  5B24 A;  4LD9 D;  4H9S A;  1S32 C;  4NE5 A;  5AV5 A;  3AZJ C;  3A6N A;  3MVD C;  4DRA A;  4J8X D;  1P3G C;  1P3A D;  4UPK A;  3REI C;  1P3I C;  4JJN B;  3B6G D;  3REH C;  4J8W A;  5B40 B;  5CPI B;  1Q9C A;  3AV2 A;  1M19 B;  3AZE D;  3X1V A;  2NQB B;  4X23 D;  5B2I C;  4YS3 B;  3W98 D;  5AVC A;  3KWQ D;  4YM6 B;  3MGR D;  3AZG D;  3AZI A;  3AZH B;  2NZD C;  2YFV A;  2VQR A;  1P3L B;  3W97 B;  2Y2K A;  3WAA A;  2JE5 A;  5E5A C;  3MGS B;  3AZJ B;  1S32 B;  3A1K A;  3MVD B;  1M1A C;  3AZK B;  1JFI A;  3H0M C;  1P3M D;  1TZY C;  1P3B D;  4JJN D;  5AV9 C;  5B1L C;  5B40 D;  5F99 B;  1KX3 D;  1M19 D;  3REI B;  2CWE A;  3AN2 C;  2NQB D;  1P3I B;  3AZE A;  3REH B;  4YS3 D;  5B32 C;  3REK C;  3C1B D;  2F8N K;  3W98 A;  5B2I B;  3WKJ A;  3MGR A;  3AZF D;  5CP6 A;  5CPK D;  1P3L D;  3W99 B;  1M18 C;  4M6B A;  2NZD B;  3MGS D;  3TU4 A;  4Z2M G;  3AYW C;  4J8V C;  3AZK D;  5AY8 C;  5E5A B;  1M1A B;  4JJN A;  5F99 D;  5CPI A;  4Z5T A;  2ARO C;  1TZY B;  3LEL D;  5AV9 B;  5B1L B;  4AWL C;  3KXB C;  1ID3 C;  3AN2 B;  1P3K A;  2HIO D;  3LJA C;  4WU8 D;  2BYM B;  5B32 B;  5AV8 C;  1BH8 A;  4YM6 A;  1HQ3 A;  4J8U A;  3AZH A;  1Z2C B;  3H0L C;  3W99 D;  3W97 A;  3P5J B;  1S32 A;  3AZJ A;  1M18 B;  4CSR B;  3MVD A;  1EQZ C;  5AVB C;  3UTB A;  1P3G A;  1ZLA C;  5AY8 B;  3WTP E;  2ZY4 A;  2FJ7 C;  3REI A;  2J8P A;  1P3I A;  5B1L D;  3REH A;  4EO5 B;  1KX5 C;  5G49 B;  4AWL B;  3KXB B;  5B2I A;  1ID3 B;  5B32 D;  5BO0 B;  3REL D;  4KHA B;  5B0Z C;  5AV8 B;  4Z66 C;  1KX4 C;  4LD9 C;  2NZD A;  4QLC C;  5BNX A;  3R45 B;  4J8X C;  4H9Q B;  2YFW B;  5E5A A;  1P3A C;  3W96 D;  1M1A A;  3X1S D;  3REJ C;  3B0D B;  1TZY A;  1P3P D;  1H3O A;  3B6G C;  5AV9 A;  4WU9 A;  3X1T C;  2FJ7 B;  3AN2 A;  4X23 C;  3KXB D;  1KX5 B;  5BT1 D;  5B32 A;  3REK A;  3KWQ C;  5B32 G;  3LZ1 D;  2LY8 A;  4Z66 B;  2ZY3 A;  3EG5 B;  1M18 A;  4CSR A;  1KX4 B;  2F2A C;  4LD9 B;  1T3U A;  4QLC B;  3AYW A;  4J8V A;  1P3M C;  1F66 B;  5AY8 A;  4J8X B;  1P3B C;  5KDM A;  2PYO C;  2IO5 C;  2Y2Q A;  3V9R B;  5B40 C;  3REJ B;  4KUD B;  4H9O B;  1M19 C;  1KX3 C;  3AL0 C;  2ARO A;  3AFA A;  3UTA A;  5G49 A;  4YS3 C;  3X1T B;  1ID3 A;  5JA4 B;  4X23 B;  3C1B C;  4H9P B;  1P34 D;  3LJA A;  4G91 C;  1U35 C;  5AV8 A;  3KWQ B;  3AZF C;  5CPK C;  5AV6 B;  1P3L C;  5CPJ D;  2HUE C;  1KX4 D;  3VH6 T;  3R45 A;  3MGS C;  4QLC D;  2YFW A;  3AZK C;  3EPJ A;  1EQZ A;  1F66 D;  5AVB A;  4KUD D;  3AV1 D;  1ZLA A;  5F99 C;  3REJ D;  1P3M B;  1P3B B;  2FJ7 A;  4NFT A;  3LEL C;  2PYO B;  2IO5 B;  2L5A A;  3X1T D;  1B67 A;  1KX3 B;  1KX5 A;  3UT9 B;  2HIO C;  4WU8 C;  3C1B B;  3AZN C;  5AV6 D;  4G91 B;  3MGQ B;  5B0Z A;  1U35 B;  3W99 C;  3VH6 A;  3AZF B; 
#chains in the Genus database with same CATH homology
 5BNV B;  5CPK B;  5B33 D;  1KX4 A;  4LD9 A;  2HUE B;  4QLC A;  3B0C W;  5GXQ B;  4J8X A;  4R8P D;  1P3A A;  3REJ A;  4H9O A;  3LZ0 D;  2PYO D;  4UUZ B;  3B6G A;  2F8N H;  3LEL B;  3UT9 D;  5JA4 A;  4X23 A;  4H9P A;  2Y2L A;  3REL C;  2HIO B;  3KWQ A;  4WU8 B;  3MGQ D;  1U35 D;  3WTP D;  3AZN B;  1BH9 B;  3AZG A;  4KGC C;  4WZS B;  5GT3 C;  1P3O D;  5GXQ D;  3F6T A;  3W96 C;  3X1S C;  1P3M A;  5DNM D;  1P3B A;  1P3P C;  5B40 A;  4EO5 C;  1KX3 A;  1M19 A;  2NQB A;  4XUJ C;  2JSS A;  4YS3 A;  5BT1 C;  3C1B A;  1WWI A;  3B6F D;  3AZN D;  3MGP C;  3REL B;  3AZF A;  3LZ1 C;  3EPK A;  5CPK A;  1P3L A;  3VH6 W;  4KGC B;  4H9N B;  2FFF B;  5B0Y B;  3MGS A;  2DF4 C;  5GT3 B;  3AZK A;  3B0D C;  3W96 B;  3X1S B;  4UUZ A;  5F99 A;  3X1U B;  2XD1 A;  1P3P B;  3LEL A;  4ZUX D;  3IP4 C;  4WNN B;  2ZY2 A;  4XUJ B;  3WA9 D;  2HIO A;  1P34 C;  4NE6 A;  4WU8 A;  3AZN A;  2F8N D;  4DRB A;  4H9R B;  5FUG B;  3MGP B;  5CPJ C;  3W99 A;  3LZ1 B;  4KGC D;  3KUY B;  5B0Y D;  2DQN C;  5GT3 D;  1F66 C;  4XZQ D;  2BYK B;  4KUD C;  3AV1 C;  1F1E A;  3X1U D;  1P3F B;  2CV5 B;  5B1M D;  5B1L A;  3MNN B;  4DQY B;  4XUJ D;  3VH5 T;  1AOI C;  5JRG B;  2RVQ D;  2BYM A;  2G5H C;  3KFU G;  3REL A;  1P34 B;  5AV6 C;  3MGP D;  2ZM5 A;  4KGC A;  3KUY D;  5B33 C;  5CPJ B;  1TAF B;  5GT0 D;  5GT3 A;  5B24 B;  4R8P C;  3AZL C;  3W96 A;  1P3F D;  3X1S A;  2CV5 D;  3LZ0 C;  3AV1 B;  1P3P A;  4WNN A;  3MNN D;  3VH5 A;  3UT9 C;  4J8W B;  4NE3 A;  4XUJ A;  3KXB A;  5B2J D;  5JRG D;  3X1V B;  5GSU D;  5BO0 A;  1AOI B;  4KHA A;  3MGQ C;  2G5I C;  4Z2M H;  3WTP C;  3MGP A;  5B31 D;  3LZ1 A;  4CAY B;  3C1C D;  5B24 D;  2YFV B;  5GXQ C;  5B33 B;  5AV5 D;  1P3O C;  3A6N D;  4H9Q A;  5DNM C;  4R8P B;  3A1I A;  3O62 C;  3AZL B;  1JFI B;  4Z5T C;  1N1J B;  2BG1 A;  3LZ0 B;  4J8W D;  1W2E A;  3AV2 D;  3X1V D;  1P3K C;  3EPL A;  1AOI D;  1R4V A;  1P34 A;  4Z66 A;  5AVC D;  3B6F C;  1HQ3 C;  3WTP B;  3AZI D;  5CPJ A;  1TAF A;  2Y2M A;  1ULY A;  3WAA D;  1P3O B;  1F66 A;  3TU4 B;  3UTB C;  3AZL D;  4KUD A;  3AZM C;  3AV1 A;  3V9R A;  3O62 B;  5DNM B;  4ZUX C;  1KU5 A;  4Z5T B;  3X1T A;  3VH5 W;  3WA9 C;  1AOI A;  4G92 B;  1P3K B;  3WKJ D;  5AV6 A;  3B6F B;  1BH8 B;  5CP6 D;  1HQ3 B;  2Y2O A;  4J8U B;  4CAY A;  5B33 A;  5B0Y C;  4XZQ C;  3TU4 D;  4R8P A;  3AZL A;  3X1U C;  4HGA C;  3H0R C;  3O62 D;  1N1J A;  3UTB B;  1P3G B;  3LZ0 A;  5B1M C;  1A7W A;  3AZM B;  2PYO A;  5CPI D;  4Z5T D;  4WU9 C;  3UT9 A;  4ZUX B;  1P3K D;  2RVQ C;  3EPH A;  4ZBJ C;  3WA9 B;  4YM6 D;  3MGQ A;  1HQ3 D;  5DNN C;  1U35 A;  3WTP A;  1PZR A;  4J8U D;  3AZH D;  2F8N B;  5BNV A;  4E44 A;  3KUY C;  3W97 D;  5GT0 C;  2Y2P A;  1P3O A;  5GXQ A;  1S32 D;  3AZJ D;  3MVD D;  5BNX B;  2Y2J A;  4XZQ B;  5BS7 C;  1P3F C;  3UTB D;  2CV5 C;  1P3G D;  5DNM A;  3O62 A;  3AZM D;  4HGA B;  3REI D;  5CHL B;  3NQJ B;  3MNN C;  3AFA C;  1H3O B;  3UTA C;  5B1M B;  3REH D;  1P3I D;  4WU9 B;  5B2J C;  5JRG C;  5GSU C;  5B2I D;  3REK B;  3B6F A;  1BH9 A;  4ZBJ B;  1WWS A;  5B31 C;  2XD5 A;  5DNN B;  3C1C C;  5B24 C;  2NZD D;  4H9S C;  5AV5 C;  3A6N C;  5GT0 B;  4E45 A;  5E5A D;  3AYW B;  1M1A D;  4J8V B;  3AZM A;  1TZY D;  5KDM B;  4J8W C;  5AV9 D;  4WU9 D;  3AV2 C;  4ZUX A;  3X1V C;  2ARO B;  3AFA B;  3UTA B;  3AN2 D;  3B0B A;  2RIQ A;  3WA9 A;  5B2J B;  5AVC C;  3REK D;  5GSU B;  2F8N A;  3NQU B;  3LJA B;  2F8N G;  5DNN D;  3AZI C;  5B31 B;  4H9N A;  1BFM A;  5B0Y A;  1M18 D;  3WAA C;  3C1C B;  3FDD A;  4XZQ A;  3B0C T;  5AV5 B;  3AYW D;  3A6N B;  4J8V D;  1EQZ B;  5AY8 D;  3X1U A;  3KSY A;  5AVB B;  3NQJ A;  1ZLA B;  4WV4 B;  5B1M A;  2ARO D;  3AFA D;  3UTA D;  3AZE C;  3AV2 B;  1ID3 D;  2Y2N A;  2W8S A;  3W98 C;  3WKJ C;  2Y2I A;  3LJA D;  4H9R A;  5AV8 D;  5AVC B;  5FUG A;  5C3I C;  5CP6 C;  3MGR C;  5DNN A;  3AZG C;  2ZY5 A;  1B6W A;  4WJ3 C;  5B0Z B;  3KUY A;  3AZI B;  5GT0 A;  3TU4 C;  2BYK A;  1EQZ D;  3WAA B;  5BS7 A;  5AVB D;  1P3F A;  2CV5 A;  4JJN C;  1P3A B;  1ZLA D;  5CPI C;  2FJ7 D;  2NQB C;  3MNN A;  3B6G B;  4G92 C;  1KX5 D;  5B2J A;  3AZE B;  5JRG A;  1HTA A;  2UWX A;  5GSU A;  3NQU A;  4YM6 C;  3W98 B;  2JCH A;  3WKJ B;  2Y2G A;  4J8U C;  3AZH C;  5B31 A;  5B0Z D;  5B31 G;  4Z66 D;  3MGR B;  5C3I B;  2Y2H A;  5CP6 B;  3W97 C;  3AZG B;  3C1C A;  5B24 A;  4LD9 D;  4H9S A;  1S32 C;  4NE5 A;  5AV5 A;  3AZJ C;  3A6N A;  3MVD C;  4DRA A;  4J8X D;  1P3G C;  1P3A D;  4UPK A;  3REI C;  1P3I C;  4JJN B;  3B6G D;  3REH C;  4J8W A;  5B40 B;  5CPI B;  1Q9C A;  3AV2 A;  1M19 B;  3AZE D;  3X1V A;  2NQB B;  4X23 D;  5B2I C;  4YS3 B;  3W98 D;  5AVC A;  3KWQ D;  4YM6 B;  3MGR D;  3AZG D;  3AZI A;  3AZH B;  2NZD C;  2YFV A;  2VQR A;  1P3L B;  3W97 B;  2Y2K A;  3WAA A;  2JE5 A;  5E5A C;  3MGS B;  3AZJ B;  1S32 B;  3A1K A;  3MVD B;  1M1A C;  3AZK B;  1JFI A;  3H0M C;  1P3M D;  1TZY C;  1P3B D;  4JJN D;  5AV9 C;  5B1L C;  5B40 D;  5F99 B;  1KX3 D;  1M19 D;  3REI B;  2CWE A;  3AN2 C;  2NQB D;  1P3I B;  3AZE A;  3REH B;  4YS3 D;  5B32 C;  3REK C;  3C1B D;  2F8N K;  3W98 A;  5B2I B;  3WKJ A;  3MGR A;  3AZF D;  5CP6 A;  5CPK D;  1P3L D;  3W99 B;  1M18 C;  4M6B A;  2NZD B;  3MGS D;  3TU4 A;  4Z2M G;  3AYW C;  4J8V C;  3AZK D;  5AY8 C;  5E5A B;  1M1A B;  4JJN A;  5F99 D;  5CPI A;  4Z5T A;  2ARO C;  1TZY B;  3LEL D;  5AV9 B;  5B1L B;  4AWL C;  3KXB C;  1ID3 C;  3AN2 B;  1P3K A;  2HIO D;  3LJA C;  4WU8 D;  2BYM B;  5B32 B;  5AV8 C;  1BH8 A;  4YM6 A;  1HQ3 A;  4J8U A;  3AZH A;  1Z2C B;  3H0L C;  3W99 D;  3W97 A;  3P5J B;  1S32 A;  3AZJ A;  1M18 B;  4CSR B;  3MVD A;  1EQZ C;  5AVB C;  3UTB A;  1P3G A;  1ZLA C;  5AY8 B;  3WTP E;  2ZY4 A;  2FJ7 C;  3REI A;  2J8P A;  1P3I A;  5B1L D;  3REH A;  4EO5 B;  1KX5 C;  5G49 B;  4AWL B;  3KXB B;  5B2I A;  1ID3 B;  5B32 D;  5BO0 B;  3REL D;  4KHA B;  5B0Z C;  5AV8 B;  4Z66 C;  1KX4 C;  4LD9 C;  2NZD A;  4QLC C;  5BNX A;  3R45 B;  4J8X C;  4H9Q B;  2YFW B;  5E5A A;  1P3A C;  3W96 D;  1M1A A;  3X1S D;  3REJ C;  3B0D B;  1TZY A;  1P3P D;  1H3O A;  3B6G C;  5AV9 A;  4WU9 A;  3X1T C;  2FJ7 B;  3AN2 A;  4X23 C;  3KXB D;  1KX5 B;  5BT1 D;  5B32 A;  3REK A;  3KWQ C;  5B32 G;  3LZ1 D;  2LY8 A;  4Z66 B;  2ZY3 A;  3EG5 B;  1M18 A;  4CSR A;  1KX4 B;  2F2A C;  4LD9 B;  1T3U A;  4QLC B;  3AYW A;  4J8V A;  1P3M C;  1F66 B;  5AY8 A;  4J8X B;  1P3B C;  5KDM A;  2PYO C;  2IO5 C;  2Y2Q A;  3V9R B;  5B40 C;  3REJ B;  4KUD B;  4H9O B;  1M19 C;  1KX3 C;  3AL0 C;  2ARO A;  3AFA A;  3UTA A;  5G49 A;  4YS3 C;  3X1T B;  1ID3 A;  5JA4 B;  4X23 B;  3C1B C;  4H9P B;  1P34 D;  3LJA A;  4G91 C;  1U35 C;  5AV8 A;  3KWQ B;  3AZF C;  5CPK C;  5AV6 B;  1P3L C;  5CPJ D;  2HUE C;  1KX4 D;  3VH6 T;  3R45 A;  3MGS C;  4QLC D;  2YFW A;  3AZK C;  3EPJ A;  1EQZ A;  1F66 D;  5AVB A;  4KUD D;  3AV1 D;  1ZLA A;  5F99 C;  3REJ D;  1P3M B;  1P3B B;  2FJ7 A;  4NFT A;  3LEL C;  2PYO B;  2IO5 B;  2L5A A;  3X1T D;  1B67 A;  1KX3 B;  1KX5 A;  3UT9 B;  2HIO C;  4WU8 C;  3C1B B;  3AZN C;  5AV6 D;  4G91 B;  3MGQ B;  5B0Z A;  1U35 B;  3W99 C;  3VH6 A;  3AZF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...