2LY8A

The budding yeast chaperone scm3 recognizes the partially unfolded dimer of the centromere-specific cse4/h4 histone variant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
121
structure length
121
Chain Sequence
b'LISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Budding yeast chaperone Scm3
publication title Identification of Functionally Conserved Regions in the Structure of the Chaperone/CenH3/H4 Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 34
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2ly8A00
3B6FB 1P3ID 4DRAA 5DNND 3B6GC 4YM6A 3KWQC 5GSUC 4XZQD 5GT3C 3NQJB 1KX3A 5DNMA 1KX4D 1HQ3A 4HGAB 3MNNB 1S32C 3AFAA 3MGSD 3AYWA 1P3AA 1P3GA 3X1TC 3MGPC 4E44A 5CPIB 5B24A 2F8NK 4J8UB 3X1TB 1P3MD 2PYOD 3AZKD 3UTBD 1ID3B 5AV8A 3RELA 1KX5C 1P3PD 4CAYA 2RVQD 5CP6A 3W96D 3VH6W 1P3IC 2NQBD 5DNNC 5JRGD 5B2JA 5BNVB 3B0DC 2F8NA 4H9PA 4KUDD 4XZQC 5FUGA 5DNNB 3W97B 5B1MB 1P3LD 5AV9B 3W99A 1P3FD 2YFWA 1KX4C 3AZIA 4NFTA 3X1SB 3MGSC 5AY8D 3O62B 4YS3B 3KSYA 1P3MC 4WU8A 2PYOC 5JA4A 3UTBC 3AZKC 4YM6D 3W98B 1P3PC 1M18B 3NQUA 3AV2B 2RVQC 3W96C 4H9NB 1KX3D 5JRGC 5DNMD 2NQBC 2LY8A 1HQ3D 3VH5T 3UT9A 3AFAD 5B31B 5B2IA 5JRGB 3AYWD 1P3AD 1P3GD 4KUDC 3B6FA 5CPKA 1P3LC 1EQZB 5B24D 4J8WA 4G92C 5B1LB 1P3FC 1P3OB 4Z2MG 5AV8D 3WTPB 2YFVB 5AY8C 3RELD 5CP6D 5AY8B 2JSSA 3MNNA 5B2JD 1P3BB 4YM6C 3AZLA 5CPIA 4J8UA 1H3OB 3REIA 5DNMC 1KX3C 5C3IB 1ID3A 3W99D 1HQ3C 3AZID 3AFAC 4KGCB 3AYWC 1U35B 1P3AC 1P3GC 1HQ3B 5B32B 3AYWB 5B24C 5BNVA 4H9OB 4WU8D 4JJNB 5AV8C 5B24B 5B31G 3RELC 4J8VB 1KU5A 3W97A 5B1MA 1BFMA 5CP6C 3AZHB 1P34B 5AV9A 3RELB 4CAYB 5B2JC 3X1SA 5B33A 3UT9D 5B2ID 3O62A 4ZUXB 4YS3A 3B6FD 5CPKD 3W99C 3C1BB 4J8WD 3W98A 3AZIC 1M18A 3AV2A 3V9RB 3MVDB 4X23B 4H9NA 5B40B 3MNND 4WU8C 4H9RB 4Z2MH 5B31A 3LJAB 2CWEA 1F66B 3AZLD 1B67A 3VH5W 5CPID 1EQZA 4J8UD 5B1LA 3REID 1ID3D 1P3OA 3AZFB 4G91C 3WTPA 3UT9C 2YFVA 3AZGB 5B2IC 3VH6A 5AY8A 3B6FC 5CPKC 3AZJA 2HUEB 5AV6D 4J8WC 1P3BA 5CPKB 2NZDB 4WZSB 4J8WB 3MGRB 3WTPE 3W97D 5B1MD 1H3OA 4LD9B 5AV9D 4HGAC 3MNNC 3TU4A 4CSRB 4ZBJB 3X1SD 4KGCA 1U35A 4QLCB 5B33D 3AZLC 3O62D 5KDMB 4YS3D 5B32A 5CPIC 4J8UC 3AZLB 4H9OA 3REHB 3REIC 4JJNA 1ID3C 3W98D 4EO5C 4J8VA 1M18D 3REIB 3AV2D 5E5AA 3AZHA 1P34A 4EO5B 4UUZB 5AV6C 1R4VA 3X1VB 5B31D 4ZUXA 5AV6B 3W97C 5B1MC 1EQZD 5AV9C 3WA9A 3C1BA 5B1LD 4WU9B 1P3OD 3X1SC 3WTPD 3V9RA 5B33C 3MVDA 3O62C 4YS3C 4X23A 5B33B 5B0ZD 5B40A 3AZJD 5AV5A 3WKJB 4H9RA 3LJAA 1F66A 1P3BD 3W98C 1M18C 3WAAB 3AV2C 1ZLAA 5BS7A 4J8XA 3B0CT 3AZFA 3TU4D 2AROB 3AZGA 5B31C 4KGCD 1U35D 1P3KB 5B32D 1EQZC 5B1LC 4JJND 1P3OC 2NZDA 3X1UD 2BYMB 3WTPC 4J8VD 3MGRA 3B0BA 5E5AD 3AZHD 1P34D 4LD9A 5B0ZC 5BNXB 3AZJC 3AZMD 4CSRA 1F1EA 2L5AA 2HIOB 4QLCA 5B0ZB 1P3BC 3AZJB 5KDMA 4ZUXD 3REHA 4NE3A 3WA9D 5C3IC 3C1BD 3TU4C 4KGCC 1U35C 3MVDD 3TU4B 4X23D 5B32C 4UUZA 5CPJD 1M19D 5B40D 5AV5D 4JJNC 3X1VA 3X1UC 3LJAD 1F66D 3VH5A 5AV6A 4J8VC 3X1UB 5E5AC 1ZLAD 3REJD 3AZHC 1P34C 3REKB 3AZMC 4WV4B 4J8XD 4WU9A 5E5AB 3AZFD 3AZGD 5AVBB 3AZMB 3AN2B 4ZUXC 1TZYB 4R8PB 3WKJA 3WA9C 4Z5TA 4NE5A 5G49B 3C1BC 4DRBA 5AVCB 2NZDD 3WA9B 3WAAA 3MVDC 3MGRD 4X23C 5CPJC 4LD9D 3A6NB 1M19C 5B40C 5AV5C 2AROA 5BO0B 5CPJB 3LJAC 1F66C 4QLCD 1HTAA 1P3KA 1M19B 3B0CW 2CV5B 5AV5B 1ZLAC 5BS7C 3LZ0B 3REJC 3REHD 4J8XC 1ZLAB 3REJB 3AZFC 2BYMA 3R45B 3AZGC 4J8XB 5BNXA 2HUEC 2HIOA 5B0ZA 3X1VD 2NZDC 4XUJA 3LZ1B 3MGRC 4LD9C 3MGQD 1N1JB 5F99B 4WU9D 4ZBJC 4QLCC 3UTAB 5CHLB 3KUYA 1M1AA 3REHC 3WKJD 4Z5TD 4E45A 3WAAD 1B6WA 3X1UA 4Z66A 5GXQB 4H9SA 3REKA 5B0YB 3KXBB 1ULYA 3X1VC 2AROD 5AVBA 3AZMA 2FJ7B 2IO5B 3AN2A 1P3KD 1TZYA 4R8PA 2F8NG 3C1CD 3MGQC 3B6GB 5G49A 3KWQB 5GSUB 4WU9C 5AVCA 3MGQB 5GT3B 4WNNB 4NE6A 3AZEA 3A6NA 1S32B 3WKJC 4Z5TC 5BO0A 2HIOD 5CPJA 1WWIA 1M19A 3MGPB 2CV5A 3WAAC 4Z5TB 4XUJD 3LZ0A 3LELA 3REJA 1KX5B 2AROC 2BYKB 3R45A 3AZNA 1P3KC 3KUYD 1P3IB 3C1CC 3B0DB 1M1AD 3AV1A 4KHAB 4XZQB 3C1CB 3LZ1A 4Z66D 3REKD 1N1JA 5F99A 1KX4B 3MGSB 2HIOC 3UTAA 5AVBD 3AN2D 4XUJC 1TZYD 4R8PD 5BT1D 1AOIA 1BH8A 4M6BA 1P3MB 2PYOB 3AZKB 4XUJB 3UTBB 1TAFB 1P3PB 5AVCD 4H9QA 5GT0A 3KUYC 3W96B 5GXQA 2F8NH 2NQBB 3AZED 1BH9B 5B0YA 3A6ND 3KUYB 1M1AC 3KXBA 4KUDB 2FJ7A 1M1AB 2CV5D 1Q9CA 1JFIB 1P3LB 4Z66C 3LZ0D 3LELD 4G92B 4H9SC 3REKC 1P3FB 3B6GA 3NQJA 5GSUA 3KWQA 4Z66B 3MGQA 5AVBC 5GT3A 3AN2C 3AZND 4WNNA 1TZYC 4R8PC 5BT1C 2F8ND 1S32A 4YM6B 3AV1D 3X1TA 3MGPA 5AVCC 3LZ1D 1A7WA 1KX3B 3AZEC 5DNMB 3A6NC 5F99D 1KX5A 3AFAB 2BYKA 3AZEB 1P3AB 1P3GB 3UTAD 2CV5C 1P3IA 5DNNA 1AOID 3LZ0C 3LELC 4KHAA 5AV8B 4XZQA 3C1CA 3LELB 3VH6T 3AZNC 5GT0D 5CP6B 5GXQD 1KX4A 5B2JB 5B0YD 3AZNB 3MGSA 2F8NB 3KXBD 4H9PB 3AV1C 5FUGB 2FJ7D 3LZ1C 3AV1B 1P3MA 2PYOA 3AZKA 3UTBA 3B6GD 3W99B 2YFWB 1TAFA 5F99C 3KWQD 5GSUD 3AZIB 1P3PA 3UTAC 3W96A 5GT3D 2NQBA 1BH9A 5JRGA 4AWLC 1AOIC 4WU8B 1S32D 5JA4B 4KUDA 5B32G 4AWLB 1AOIB 1BH8B 3X1TD 3MGPD 3NQUB 5GT0C 1P3LA 1JFIA 1WWSA 5GXQC 1P3FA 4H9QB 5B0YC 5GT0B 4G91B 3KXBC 3UT9B 1KX5D 5B2IB 2FJ7C 2IO5C
chains in the Genus database with same CATH superfamily
3B6FB 1P3ID 4DRAA 5DNND 3B6GC 1PZRA 4YM6A 3KWQC 5GSUC 4XZQD 5GT3C 3NQJB 1KX3A 5DNMA 1KX4D 1HQ3A 4HGAB 3MNNB 1S32C 3AFAA 3MGSD 3AYWA 1P3AA 1P3GA 3X1TC 3MGPC 4E44A 5CPIB 5B24A 2F8NK 4J8UB 3X1TB 1P3MD 2PYOD 3AZKD 3UTBD 1ID3B 5AV8A 3RELA 1KX5C 1P3PD 4CAYA 2RVQD 5CP6A 3AL0C 3W96D 3VH6W 1P3IC 3A1KA 2NQBD 5DNNC 5JRGD 5B2JA 2ZY4A 5BNVB 3B0DC 2F8NA 4H9PA 4KUDD 4XZQC 5FUGA 3A1IA 5DNNB 3W97B 5B1MB 1P3LD 5AV9B 2ZY2A 3W99A 1P3FD 2YFWA 1KX4C 3AZIA 4NFTA 3X1SB 3MGSC 5AY8D 3O62B 4YS3B 2Y2JA 3KSYA 1P3MC 4WU8A 2PYOC 5JA4A 3UTBC 3AZKC 2BG1A 4YM6D 3W98B 1P3PC 1M18B 3NQUA 3AV2B 2RVQC 3W96C 2XD5A 4H9NB 1KX3D 5JRGC 5DNMD 2Y2QA 2NQBC 2LY8A 1HQ3D 3VH5T 3UT9A 3AFAD 5B31B 5B2IA 5JRGB 3AYWD 1P3AD 1P3GD 4KUDC 3B6FA 5CPKA 1P3LC 1EQZB 5B24D 4J8WA 4G92C 5B1LB 1P3FC 3F6TA 1P3OB 4Z2MG 5AV8D 3WTPB 2YFVB 5AY8C 3RELD 5CP6D 5AY8B 2G5HC 2JSSA 3MNNA 5B2JD 4DQYB 4YM6C 1P3BB 3AZLA 5CPIA 4J8UA 1H3OB 3REIA 5DNMC 1KX3C 5C3IB 1ID3A 3W99D 1HQ3C 2Y2LA 3AZID 3AFAC 4KGCB 3AYWC 1U35B 1P3AC 1P3GC 1HQ3B 5B32B 3AYWB 5B24C 5BNVA 4H9OB 4WU8D 4JJNB 5AV8C 5B24B 5B31G 3RELC 4J8VB 2XD1A 1KU5A 3W97A 5B1MA 1BFMA 5CP6C 3AZHB 1P34B 5AV9A 3RELB 4CAYB 5B2JC 2ZM5A 3X1SA 2G5IC 5B33A 3UT9D 5B2ID 3O62A 4ZUXB 4YS3A 3B6FD 5CPKD 2Y2PA 3W99C 3C1BB 4J8WD 3W98A 3AZIC 1M18A 3AV2A 3V9RB 3MVDB 4X23B 2VQRA 4H9NA 5B40B 3MNND 4WU8C 4H9RB 4Z2MH 5B31A 3LJAB 2CWEA 1F66B 3EPKA 1B67A 3AZLD 3VH5W 5CPID 1EQZA 4J8UD 5B1LA 3REID 1ID3D 1P3OA 3AZFB 4G91C 3WTPA 3UT9C 2YFVA 3AZGB 5B2IC 3VH6A 5AY8A 3B6FC 5CPKC 3AZJA 2HUEB 5AV6D 4J8WC 1P3BA 5CPKB 2NZDB 4WZSB 4J8WB 3MGRB 3WTPE 3W97D 5B1MD 1H3OA 4LD9B 2JE5A 5AV9D 4HGAC 3MNNC 3TU4A 4CSRB 4ZBJB 2Y2OA 3X1SD 1U35A 4QLCB 5B33D 4KGCA 3AZLC 3EPJA 3O62D 5KDMB 4YS3D 5B32A 5CPIC 4J8UC 2Y2KA 3EPLA 3AZLB 4H9OA 3REHB 3REIC 4JJNA 1ID3C 3W98D 4EO5C 4J8VA 1M18D 3REIB 3AV2D 5E5AA 3AZHA 1P34A 4EO5B 4UUZB 5AV6C 1R4VA 3X1VB 5B31D 4ZUXA 5AV6B 3KFUG 3W97C 5B1MC 1EQZD 5AV9C 3WA9A 3C1BA 5B1LD 4WU9B 1P3OD 3X1SC 3EPHA 1Z2CB 3V9RA 3WTPD 5B33C 3MVDA 3O62C 4YS3C 4X23A 5B33B 5B0ZD 3H0LC 5B40A 3AZJD 5AV5A 3WKJB 4H9RA 3LJAA 1F66A 1P3BD 3W98C 1M18C 3WAAB 3AV2C 1ZLAA 5BS7A 2FFFB 3H0RC 4J8XA 3B0CT 3AZFA 3TU4D 4WJ3C 2AROB 2J8PA 5B31C 3AZGA 1U35D 4KGCD 1P3KB 5B32D 1EQZC 5B1LC 4JJND 1P3OC 2NZDA 3X1UD 2BYMB 3WTPC 4J8VD 3MGRA 3B0BA 5E5AD 3AZHD 1P34D 4LD9A 5B0ZC 5BNXB 3AZJC 3AZMD 4CSRA 1F1EA 2L5AA 2HIOB 4QLCA 5B0ZB 1P3BC 4UPKA 3AZJB 5KDMA 4ZUXD 2F2AC 3REHA 4NE3A 3WA9D 5C3IC 3C1BD 3TU4C 3IP4C 4KGCC 1U35C 3MVDD 3TU4B 4X23D 5B32C 4UUZA 5CPJD 2Y2HA 1M19D 5B40D 5AV5D 4JJNC 3X1VA 2DQNC 3X1UC 3LJAD 1F66D 3VH5A 5AV6A 4J8VC 3X1UB 5E5AC 1ZLAD 3REJD 3AZHC 1P34C 3REKB 3AZMC 4WV4B 4J8XD 4WU9A 5E5AB 1W2EA 3AZFD 3AZGD 5AVBB 3AZMB 3AN2B 4ZUXC 1TZYB 4R8PB 3WKJA 3WA9C 4Z5TA 4NE5A 5G49B 3C1BC 4DRBA 5AVCB 3EG5B 2NZDD 3WA9B 3WAAA 3MVDC 3MGRD 4X23C 5CPJC 4LD9D 3A6NB 1M19C 5B40C 5AV5C 2AROA 5BO0B 5CPJB 3LJAC 1F66C 4QLCD 1HTAA 1P3KA 1M19B 3B0CW 2CV5B 5AV5B 1ZLAC 5BS7C 3LZ0B 3REJC 3REHD 4J8XC 1ZLAB 3REJB 3AZFC 2BYMA 3R45B 3AZGC 4J8XB 3H0MC 5BNXA 2HUEC 2HIOA 5B0ZA 3X1VD 2NZDC 4XUJA 3LZ1B 3MGRC 4LD9C 3MGQD 1N1JB 5F99B 4WU9D 4ZBJC 4QLCC 3UTAB 5CHLB 3KUYA 1M1AA 3REHC 3WKJD 4Z5TD 4E45A 3WAAD 1B6WA 3X1UA 4Z66A 5GXQB 4H9SA 3REKA 5B0YB 3KXBB 1ULYA 3X1VC 2AROD 5AVBA 3AZMA 2FJ7B 2IO5B 3AN2A 1P3KD 1TZYA 4R8PA 2F8NG 3C1CD 3MGQC 3B6GB 5G49A 3KWQB 2ZY5A 5GSUB 4WU9C 5AVCA 3MGQB 2Y2MA 5GT3B 4WNNB 4NE6A 3AZEA 3A6NA 1S32B 3WKJC 4Z5TC 5BO0A 2HIOD 5CPJA 1WWIA 1M19A 2UWXA 3MGPB 2CV5A 3WAAC 4Z5TB 4XUJD 3LZ0A 3LELA 3REJA 1KX5B 2AROC 2BYKB 3R45A 3AZNA 1P3KC 3KUYD 1P3IB 3C1CC 3B0DB 1M1AD 3AV1A 4KHAB 4XZQB 3C1CB 3LZ1A 4Z66D 3REKD 1N1JA 5F99A 1KX4B 3MGSB 2HIOC 3UTAA 5AVBD 3AN2D 4XUJC 1TZYD 4R8PD 5BT1D 1AOIA 2Y2NA 1BH8A 4M6BA 1P3MB 2PYOB 3AZKB 4XUJB 3UTBB 1TAFB 1P3PB 5AVCD 3FDDA 4H9QA 5GT0A 3KUYC 3W96B 5GXQA 2F8NH 2NQBB 3AZED 1BH9B 5B0YA 3A6ND 3KUYB 2Y2GA 1M1AC 3KXBA 4KUDB 2FJ7A 1M1AB 2CV5D 1Q9CA 1JFIB 1P3LB 4Z66C 3LZ0D 3P5JB 3LELD 4G92B 4H9SC 3REKC 1P3FB 3B6GA 3NQJA 5GSUA 3KWQA 4Z66B 2RIQA 3MGQA 5AVBC 5GT3A 3AN2C 3AZND 4WNNA 1TZYC 4R8PC 5BT1C 2F8ND 1S32A 2ZY3A 4YM6B 3AV1D 3X1TA 3MGPA 5AVCC 3LZ1D 1A7WA 1KX3B 3AZEC 5DNMB 3A6NC 5F99D 1KX5A 3AFAB 2BYKA 3AZEB 1P3AB 1P3GB 3UTAD 2CV5C 1P3IA 1T3UA 5DNNA 1AOID 3LZ0C 2DF4C 3LELC 4KHAA 5AV8B 4XZQA 3C1CA 3LELB 3VH6T 2JCHA 3AZNC 5GT0D 5CP6B 5GXQD 1KX4A 5B2JB 5B0YD 3AZNB 3MGSA 2Y2IA 2F8NB 3KXBD 4H9PB 3AV1C 5FUGB 2FJ7D 3LZ1C 3AV1B 1P3MA 2PYOA 3AZKA 3UTBA 3B6GD 3W99B 2YFWB 1TAFA 5F99C 3KWQD 5GSUD 3AZIB 1P3PA 3UTAC 3W96A 5GT3D 2NQBA 1BH9A 5JRGA 4AWLC 1AOIC 2W8SA 4WU8B 1S32D 5JA4B 4KUDA 5B32G 4AWLB 1AOIB 1BH8B 3X1TD 3MGPD 3NQUB 5GT0C 1P3LA 1JFIA 1WWSA 5GXQC 1P3FA 4H9QB 5B0YC 5GT0B 4G91B 3KXBC 3UT9B 1KX5D 5B2IB 2FJ7C 2IO5C
chains in the Genus database with same CATH topology
3B6FB 1P3ID 4DRAA 5DNND 3B6GC 1PZRA 4YM6A 3KWQC 5GSUC 4XZQD 5GT3C 3NQJB 1KX3A 5DNMA 1KX4D 1HQ3A 4HGAB 3MNNB 1S32C 3AFAA 3MGSD 3AYWA 1P3AA 1P3GA 3X1TC 3MGPC 4E44A 5CPIB 5B24A 2F8NK 4J8UB 3X1TB 1P3MD 2PYOD 3AZKD 3UTBD 1ID3B 5AV8A 3RELA 1KX5C 1P3PD 4CAYA 2RVQD 5CP6A 3AL0C 3W96D 3VH6W 1P3IC 3A1KA 2NQBD 5DNNC 5JRGD 5B2JA 2ZY4A 5BNVB 3B0DC 2F8NA 4H9PA 4KUDD 4XZQC 5FUGA 3A1IA 5DNNB 3W97B 5B1MB 1P3LD 5AV9B 2ZY2A 3W99A 1P3FD 2YFWA 1KX4C 3AZIA 4NFTA 3X1SB 3MGSC 5AY8D 3O62B 4YS3B 2Y2JA 3KSYA 1P3MC 4WU8A 2PYOC 5JA4A 3UTBC 3AZKC 2BG1A 4YM6D 3W98B 1P3PC 1M18B 3NQUA 3AV2B 2RVQC 3W96C 2XD5A 4H9NB 1KX3D 5JRGC 5DNMD 2Y2QA 2NQBC 2LY8A 1HQ3D 3VH5T 3UT9A 3AFAD 5B31B 5B2IA 5JRGB 3AYWD 1P3AD 1P3GD 4KUDC 3B6FA 5CPKA 1P3LC 1EQZB 5B24D 4J8WA 4G92C 5B1LB 1P3FC 3F6TA 1P3OB 4Z2MG 5AV8D 3WTPB 2YFVB 5AY8C 3RELD 5CP6D 5AY8B 2G5HC 2JSSA 3MNNA 5B2JD 4DQYB 4YM6C 1P3BB 3AZLA 5CPIA 4J8UA 1H3OB 3REIA 5DNMC 1KX3C 5C3IB 1ID3A 3W99D 1HQ3C 2Y2LA 3AZID 3AFAC 4KGCB 3AYWC 1U35B 1P3AC 1P3GC 1HQ3B 5B32B 3AYWB 5B24C 5BNVA 4H9OB 4WU8D 4JJNB 5AV8C 5B24B 5B31G 3RELC 4J8VB 2XD1A 1KU5A 3W97A 5B1MA 1BFMA 5CP6C 3AZHB 1P34B 5AV9A 3RELB 4CAYB 5B2JC 2ZM5A 3X1SA 2G5IC 5B33A 3UT9D 5B2ID 3O62A 4ZUXB 4YS3A 3B6FD 5CPKD 2Y2PA 3W99C 3C1BB 4J8WD 3W98A 3AZIC 1M18A 3AV2A 3V9RB 3MVDB 4X23B 2VQRA 4H9NA 5B40B 3MNND 4WU8C 4H9RB 4Z2MH 5B31A 3LJAB 2CWEA 1F66B 3EPKA 1B67A 3AZLD 3VH5W 5CPID 1EQZA 4J8UD 5B1LA 3REID 1ID3D 1P3OA 3AZFB 4G91C 3WTPA 3UT9C 2YFVA 3AZGB 5B2IC 3VH6A 5AY8A 3B6FC 5CPKC 3AZJA 2HUEB 5AV6D 4J8WC 1P3BA 5CPKB 2NZDB 4WZSB 4J8WB 3MGRB 3WTPE 3W97D 5B1MD 1H3OA 4LD9B 2JE5A 5AV9D 4HGAC 3MNNC 3TU4A 4CSRB 4ZBJB 2Y2OA 3X1SD 1U35A 4QLCB 5B33D 4KGCA 3AZLC 3EPJA 3O62D 5KDMB 4YS3D 5B32A 5CPIC 4J8UC 2Y2KA 3EPLA 3AZLB 4H9OA 3REHB 3REIC 4JJNA 1ID3C 3W98D 4EO5C 4J8VA 1M18D 3REIB 3AV2D 5E5AA 3AZHA 1P34A 4EO5B 4UUZB 5AV6C 1R4VA 3X1VB 5B31D 4ZUXA 5AV6B 3KFUG 3W97C 5B1MC 1EQZD 5AV9C 3WA9A 3C1BA 5B1LD 4WU9B 1P3OD 3X1SC 3EPHA 1Z2CB 3V9RA 3WTPD 5B33C 3MVDA 3O62C 4YS3C 4X23A 5B33B 5B0ZD 3H0LC 5B40A 3AZJD 5AV5A 3WKJB 4H9RA 3LJAA 1F66A 1P3BD 3W98C 1M18C 3WAAB 3AV2C 1ZLAA 5BS7A 2FFFB 3H0RC 4J8XA 3B0CT 3AZFA 3TU4D 4WJ3C 2AROB 2J8PA 5B31C 3AZGA 1U35D 4KGCD 1P3KB 5B32D 1EQZC 5B1LC 4JJND 1P3OC 2NZDA 3X1UD 2BYMB 3WTPC 4J8VD 3MGRA 3B0BA 5E5AD 3AZHD 1P34D 4LD9A 5B0ZC 5BNXB 3AZJC 3AZMD 4CSRA 1F1EA 2L5AA 2HIOB 4QLCA 5B0ZB 1P3BC 4UPKA 3AZJB 5KDMA 4ZUXD 2F2AC 3REHA 4NE3A 3WA9D 5C3IC 3C1BD 3TU4C 3IP4C 4KGCC 1U35C 3MVDD 3TU4B 4X23D 5B32C 4UUZA 5CPJD 2Y2HA 1M19D 5B40D 5AV5D 4JJNC 3X1VA 2DQNC 3X1UC 3LJAD 1F66D 3VH5A 5AV6A 4J8VC 3X1UB 5E5AC 1ZLAD 3REJD 3AZHC 1P34C 3REKB 3AZMC 4WV4B 4J8XD 4WU9A 5E5AB 1W2EA 3AZFD 3AZGD 5AVBB 3AZMB 3AN2B 4ZUXC 1TZYB 4R8PB 3WKJA 3WA9C 4Z5TA 4NE5A 5G49B 3C1BC 4DRBA 5AVCB 3EG5B 2NZDD 3WA9B 3WAAA 3MVDC 3MGRD 4X23C 5CPJC 4LD9D 3A6NB 1M19C 5B40C 5AV5C 2AROA 5BO0B 5CPJB 3LJAC 1F66C 4QLCD 1HTAA 1P3KA 1M19B 3B0CW 2CV5B 5AV5B 1ZLAC 5BS7C 3LZ0B 3REJC 3REHD 4J8XC 1ZLAB 3REJB 3AZFC 2BYMA 3R45B 3AZGC 4J8XB 3H0MC 5BNXA 2HUEC 2HIOA 5B0ZA 3X1VD 2NZDC 4XUJA 3LZ1B 3MGRC 4LD9C 3MGQD 1N1JB 5F99B 4WU9D 4ZBJC 4QLCC 3UTAB 5CHLB 3KUYA 1M1AA 3REHC 3WKJD 4Z5TD 4E45A 3WAAD 1B6WA 3X1UA 4Z66A 5GXQB 4H9SA 3REKA 5B0YB 3KXBB 1ULYA 3X1VC 2AROD 5AVBA 3AZMA 2FJ7B 2IO5B 3AN2A 1P3KD 1TZYA 4R8PA 2F8NG 3C1CD 3MGQC 3B6GB 5G49A 3KWQB 2ZY5A 5GSUB 4WU9C 5AVCA 3MGQB 2Y2MA 5GT3B 4WNNB 4NE6A 3AZEA 3A6NA 1S32B 3WKJC 4Z5TC 5BO0A 2HIOD 5CPJA 1WWIA 1M19A 2UWXA 3MGPB 2CV5A 3WAAC 4Z5TB 4XUJD 3LZ0A 3LELA 3REJA 1KX5B 2AROC 2BYKB 3R45A 3AZNA 1P3KC 3KUYD 1P3IB 3C1CC 3B0DB 1M1AD 3AV1A 4KHAB 4XZQB 3C1CB 3LZ1A 4Z66D 3REKD 1N1JA 5F99A 1KX4B 3MGSB 2HIOC 3UTAA 5AVBD 3AN2D 4XUJC 1TZYD 4R8PD 5BT1D 1AOIA 2Y2NA 1BH8A 4M6BA 1P3MB 2PYOB 3AZKB 4XUJB 3UTBB 1TAFB 1P3PB 5AVCD 3FDDA 4H9QA 5GT0A 3KUYC 3W96B 5GXQA 2F8NH 2NQBB 3AZED 1BH9B 5B0YA 3A6ND 3KUYB 2Y2GA 1M1AC 3KXBA 4KUDB 2FJ7A 1M1AB 2CV5D 1Q9CA 1JFIB 1P3LB 4Z66C 3LZ0D 3P5JB 3LELD 4G92B 4H9SC 3REKC 1P3FB 3B6GA 3NQJA 5GSUA 3KWQA 4Z66B 2RIQA 3MGQA 5AVBC 5GT3A 3AN2C 3AZND 4WNNA 1TZYC 4R8PC 5BT1C 2F8ND 1S32A 2ZY3A 4YM6B 3AV1D 3X1TA 3MGPA 5AVCC 3LZ1D 1A7WA 1KX3B 3AZEC 5DNMB 3A6NC 5F99D 1KX5A 3AFAB 2BYKA 3AZEB 1P3AB 1P3GB 3UTAD 2CV5C 1P3IA 1T3UA 5DNNA 1AOID 3LZ0C 2DF4C 3LELC 4KHAA 5AV8B 4XZQA 3C1CA 3LELB 3VH6T 2JCHA 3AZNC 5GT0D 5CP6B 5GXQD 1KX4A 5B2JB 5B0YD 3AZNB 3MGSA 2Y2IA 2F8NB 3KXBD 4H9PB 3AV1C 5FUGB 2FJ7D 3LZ1C 3AV1B 1P3MA 2PYOA 3AZKA 3UTBA 3B6GD 3W99B 2YFWB 1TAFA 5F99C 3KWQD 5GSUD 3AZIB 1P3PA 3UTAC 3W96A 5GT3D 2NQBA 1BH9A 5JRGA 4AWLC 1AOIC 2W8SA 4WU8B 1S32D 5JA4B 4KUDA 5B32G 4AWLB 1AOIB 1BH8B 3X1TD 3MGPD 3NQUB 5GT0C 1P3LA 1JFIA 1WWSA 5GXQC 1P3FA 4H9QB 5B0YC 5GT0B 4G91B 3KXBC 3UT9B 1KX5D 5B2IB 2FJ7C 2IO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6F B;  1P3I D;  4DRA A;  5DNN D;  3B6G C;  4YM6 A;  3KWQ C;  5GSU C;  4XZQ D;  5GT3 C;  3NQJ B;  1KX3 A;  5DNM A;  1KX4 D;  1HQ3 A;  4HGA B;  3MNN B;  1S32 C;  3AFA A;  3MGS D;  3AYW A;  1P3A A;  1P3G A;  3X1T C;  3MGP C;  4E44 A;  5CPI B;  5B24 A;  2F8N K;  4J8U B;  3X1T B;  1P3M D;  2PYO D;  3AZK D;  3UTB D;  1ID3 B;  5AV8 A;  3REL A;  1KX5 C;  1P3P D;  4CAY A;  2RVQ D;  5CP6 A;  3W96 D;  3VH6 W;  1P3I C;  2NQB D;  5DNN C;  5JRG D;  5B2J A;  5BNV B;  3B0D C;  2F8N A;  4H9P A;  4KUD D;  4XZQ C;  5FUG A;  5DNN B;  3W97 B;  5B1M B;  1P3L D;  5AV9 B;  3W99 A;  1P3F D;  2YFW A;  1KX4 C;  3AZI A;  4NFT A;  3X1S B;  3MGS C;  5AY8 D;  3O62 B;  4YS3 B;  3KSY A;  1P3M C;  4WU8 A;  2PYO C;  5JA4 A;  3UTB C;  3AZK C;  4YM6 D;  3W98 B;  1P3P C;  1M18 B;  3NQU A;  3AV2 B;  2RVQ C;  3W96 C;  4H9N B;  1KX3 D;  5JRG C;  5DNM D;  2NQB C;  2LY8 A;  1HQ3 D;  3VH5 T;  3UT9 A;  3AFA D;  5B31 B;  5B2I A;  5JRG B;  3AYW D;  1P3A D;  1P3G D;  4KUD C;  3B6F A;  5CPK A;  1P3L C;  1EQZ B;  5B24 D;  4J8W A;  4G92 C;  5B1L B;  1P3F C;  1P3O B;  4Z2M G;  5AV8 D;  3WTP B;  2YFV B;  5AY8 C;  3REL D;  5CP6 D;  5AY8 B;  2JSS A;  3MNN A;  5B2J D;  1P3B B;  4YM6 C;  3AZL A;  5CPI A;  4J8U A;  1H3O B;  3REI A;  5DNM C;  1KX3 C;  5C3I B;  1ID3 A;  3W99 D;  1HQ3 C;  3AZI D;  3AFA C;  4KGC B;  3AYW C;  1U35 B;  1P3A C;  1P3G C;  1HQ3 B;  5B32 B;  3AYW B;  5B24 C;  5BNV A;  4H9O B;  4WU8 D;  4JJN B;  5AV8 C;  5B24 B;  5B31 G;  3REL C;  4J8V B;  1KU5 A;  3W97 A;  5B1M A;  1BFM A;  5CP6 C;  3AZH B;  1P34 B;  5AV9 A;  3REL B;  4CAY B;  5B2J C;  3X1S A;  5B33 A;  3UT9 D;  5B2I D;  3O62 A;  4ZUX B;  4YS3 A;  3B6F D;  5CPK D;  3W99 C;  3C1B B;  4J8W D;  3W98 A;  3AZI C;  1M18 A;  3AV2 A;  3V9R B;  3MVD B;  4X23 B;  4H9N A;  5B40 B;  3MNN D;  4WU8 C;  4H9R B;  4Z2M H;  5B31 A;  3LJA B;  2CWE A;  1F66 B;  3AZL D;  1B67 A;  3VH5 W;  5CPI D;  1EQZ A;  4J8U D;  5B1L A;  3REI D;  1ID3 D;  1P3O A;  3AZF B;  4G91 C;  3WTP A;  3UT9 C;  2YFV A;  3AZG B;  5B2I C;  3VH6 A;  5AY8 A;  3B6F C;  5CPK C;  3AZJ A;  2HUE B;  5AV6 D;  4J8W C;  1P3B A;  5CPK B;  2NZD B;  4WZS B;  4J8W B;  3MGR B;  3WTP E;  3W97 D;  5B1M D;  1H3O A;  4LD9 B;  5AV9 D;  4HGA C;  3MNN C;  3TU4 A;  4CSR B;  4ZBJ B;  3X1S D;  4KGC A;  1U35 A;  4QLC B;  5B33 D;  3AZL C;  3O62 D;  5KDM B;  4YS3 D;  5B32 A;  5CPI C;  4J8U C;  3AZL B;  4H9O A;  3REH B;  3REI C;  4JJN A;  1ID3 C;  3W98 D;  4EO5 C;  4J8V A;  1M18 D;  3REI B;  3AV2 D;  5E5A A;  3AZH A;  1P34 A;  4EO5 B;  4UUZ B;  5AV6 C;  1R4V A;  3X1V B;  5B31 D;  4ZUX A;  5AV6 B;  3W97 C;  5B1M C;  1EQZ D;  5AV9 C;  3WA9 A;  3C1B A;  5B1L D;  4WU9 B;  1P3O D;  3X1S C;  3WTP D;  3V9R A;  5B33 C;  3MVD A;  3O62 C;  4YS3 C;  4X23 A;  5B33 B;  5B0Z D;  5B40 A;  3AZJ D;  5AV5 A;  3WKJ B;  4H9R A;  3LJA A;  1F66 A;  1P3B D;  3W98 C;  1M18 C;  3WAA B;  3AV2 C;  1ZLA A;  5BS7 A;  4J8X A;  3B0C T;  3AZF A;  3TU4 D;  2ARO B;  3AZG A;  5B31 C;  4KGC D;  1U35 D;  1P3K B;  5B32 D;  1EQZ C;  5B1L C;  4JJN D;  1P3O C;  2NZD A;  3X1U D;  2BYM B;  3WTP C;  4J8V D;  3MGR A;  3B0B A;  5E5A D;  3AZH D;  1P34 D;  4LD9 A;  5B0Z C;  5BNX B;  3AZJ C;  3AZM D;  4CSR A;  1F1E A;  2L5A A;  2HIO B;  4QLC A;  5B0Z B;  1P3B C;  3AZJ B;  5KDM A;  4ZUX D;  3REH A;  4NE3 A;  3WA9 D;  5C3I C;  3C1B D;  3TU4 C;  4KGC C;  1U35 C;  3MVD D;  3TU4 B;  4X23 D;  5B32 C;  4UUZ A;  5CPJ D;  1M19 D;  5B40 D;  5AV5 D;  4JJN C;  3X1V A;  3X1U C;  3LJA D;  1F66 D;  3VH5 A;  5AV6 A;  4J8V C;  3X1U B;  5E5A C;  1ZLA D;  3REJ D;  3AZH C;  1P34 C;  3REK B;  3AZM C;  4WV4 B;  4J8X D;  4WU9 A;  5E5A B;  3AZF D;  3AZG D;  5AVB B;  3AZM B;  3AN2 B;  4ZUX C;  1TZY B;  4R8P B;  3WKJ A;  3WA9 C;  4Z5T A;  4NE5 A;  5G49 B;  3C1B C;  4DRB A;  5AVC B;  2NZD D;  3WA9 B;  3WAA A;  3MVD C;  3MGR D;  4X23 C;  5CPJ C;  4LD9 D;  3A6N B;  1M19 C;  5B40 C;  5AV5 C;  2ARO A;  5BO0 B;  5CPJ B;  3LJA C;  1F66 C;  4QLC D;  1HTA A;  1P3K A;  1M19 B;  3B0C W;  2CV5 B;  5AV5 B;  1ZLA C;  5BS7 C;  3LZ0 B;  3REJ C;  3REH D;  4J8X C;  1ZLA B;  3REJ B;  3AZF C;  2BYM A;  3R45 B;  3AZG C;  4J8X B;  5BNX A;  2HUE C;  2HIO A;  5B0Z A;  3X1V D;  2NZD C;  4XUJ A;  3LZ1 B;  3MGR C;  4LD9 C;  3MGQ D;  1N1J B;  5F99 B;  4WU9 D;  4ZBJ C;  4QLC C;  3UTA B;  5CHL B;  3KUY A;  1M1A A;  3REH C;  3WKJ D;  4Z5T D;  4E45 A;  3WAA D;  1B6W A;  3X1U A;  4Z66 A;  5GXQ B;  4H9S A;  3REK A;  5B0Y B;  3KXB B;  1ULY A;  3X1V C;  2ARO D;  5AVB A;  3AZM A;  2FJ7 B;  2IO5 B;  3AN2 A;  1P3K D;  1TZY A;  4R8P A;  2F8N G;  3C1C D;  3MGQ C;  3B6G B;  5G49 A;  3KWQ B;  5GSU B;  4WU9 C;  5AVC A;  3MGQ B;  5GT3 B;  4WNN B;  4NE6 A;  3AZE A;  3A6N A;  1S32 B;  3WKJ C;  4Z5T C;  5BO0 A;  2HIO D;  5CPJ A;  1WWI A;  1M19 A;  3MGP B;  2CV5 A;  3WAA C;  4Z5T B;  4XUJ D;  3LZ0 A;  3LEL A;  3REJ A;  1KX5 B;  2ARO C;  2BYK B;  3R45 A;  3AZN A;  1P3K C;  3KUY D;  1P3I B;  3C1C C;  3B0D B;  1M1A D;  3AV1 A;  4KHA B;  4XZQ B;  3C1C B;  3LZ1 A;  4Z66 D;  3REK D;  1N1J A;  5F99 A;  1KX4 B;  3MGS B;  2HIO C;  3UTA A;  5AVB D;  3AN2 D;  4XUJ C;  1TZY D;  4R8P D;  5BT1 D;  1AOI A;  1BH8 A;  4M6B A;  1P3M B;  2PYO B;  3AZK B;  4XUJ B;  3UTB B;  1TAF B;  1P3P B;  5AVC D;  4H9Q A;  5GT0 A;  3KUY C;  3W96 B;  5GXQ A;  2F8N H;  2NQB B;  3AZE D;  1BH9 B;  5B0Y A;  3A6N D;  3KUY B;  1M1A C;  3KXB A;  4KUD B;  2FJ7 A;  1M1A B;  2CV5 D;  1Q9C A;  1JFI B;  1P3L B;  4Z66 C;  3LZ0 D;  3LEL D;  4G92 B;  4H9S C;  3REK C;  1P3F B;  3B6G A;  3NQJ A;  5GSU A;  3KWQ A;  4Z66 B;  3MGQ A;  5AVB C;  5GT3 A;  3AN2 C;  3AZN D;  4WNN A;  1TZY C;  4R8P C;  5BT1 C;  2F8N D;  1S32 A;  4YM6 B;  3AV1 D;  3X1T A;  3MGP A;  5AVC C;  3LZ1 D;  1A7W A;  1KX3 B;  3AZE C;  5DNM B;  3A6N C;  5F99 D;  1KX5 A;  3AFA B;  2BYK A;  3AZE B;  1P3A B;  1P3G B;  3UTA D;  2CV5 C;  1P3I A;  5DNN A;  1AOI D;  3LZ0 C;  3LEL C;  4KHA A;  5AV8 B;  4XZQ A;  3C1C A;  3LEL B;  3VH6 T;  3AZN C;  5GT0 D;  5CP6 B;  5GXQ D;  1KX4 A;  5B2J B;  5B0Y D;  3AZN B;  3MGS A;  2F8N B;  3KXB D;  4H9P B;  3AV1 C;  5FUG B;  2FJ7 D;  3LZ1 C;  3AV1 B;  1P3M A;  2PYO A;  3AZK A;  3UTB A;  3B6G D;  3W99 B;  2YFW B;  1TAF A;  5F99 C;  3KWQ D;  5GSU D;  3AZI B;  1P3P A;  3UTA C;  3W96 A;  5GT3 D;  2NQB A;  1BH9 A;  5JRG A;  4AWL C;  1AOI C;  4WU8 B;  1S32 D;  5JA4 B;  4KUD A;  5B32 G;  4AWL B;  1AOI B;  1BH8 B;  3X1T D;  3MGP D;  3NQU B;  5GT0 C;  1P3L A;  1JFI A;  1WWS A;  5GXQ C;  1P3F A;  4H9Q B;  5B0Y C;  5GT0 B;  4G91 B;  3KXB C;  3UT9 B;  1KX5 D;  5B2I B;  2FJ7 C;  2IO5 C; 
#chains in the Genus database with same CATH topology
 3B6F B;  1P3I D;  4DRA A;  5DNN D;  3B6G C;  1PZR A;  4YM6 A;  3KWQ C;  5GSU C;  4XZQ D;  5GT3 C;  3NQJ B;  1KX3 A;  5DNM A;  1KX4 D;  1HQ3 A;  4HGA B;  3MNN B;  1S32 C;  3AFA A;  3MGS D;  3AYW A;  1P3A A;  1P3G A;  3X1T C;  3MGP C;  4E44 A;  5CPI B;  5B24 A;  2F8N K;  4J8U B;  3X1T B;  1P3M D;  2PYO D;  3AZK D;  3UTB D;  1ID3 B;  5AV8 A;  3REL A;  1KX5 C;  1P3P D;  4CAY A;  2RVQ D;  5CP6 A;  3AL0 C;  3W96 D;  3VH6 W;  1P3I C;  3A1K A;  2NQB D;  5DNN C;  5JRG D;  5B2J A;  2ZY4 A;  5BNV B;  3B0D C;  2F8N A;  4H9P A;  4KUD D;  4XZQ C;  5FUG A;  3A1I A;  5DNN B;  3W97 B;  5B1M B;  1P3L D;  5AV9 B;  2ZY2 A;  3W99 A;  1P3F D;  2YFW A;  1KX4 C;  3AZI A;  4NFT A;  3X1S B;  3MGS C;  5AY8 D;  3O62 B;  4YS3 B;  2Y2J A;  3KSY A;  1P3M C;  4WU8 A;  2PYO C;  5JA4 A;  3UTB C;  3AZK C;  2BG1 A;  4YM6 D;  3W98 B;  1P3P C;  1M18 B;  3NQU A;  3AV2 B;  2RVQ C;  3W96 C;  2XD5 A;  4H9N B;  1KX3 D;  5JRG C;  5DNM D;  2Y2Q A;  2NQB C;  2LY8 A;  1HQ3 D;  3VH5 T;  3UT9 A;  3AFA D;  5B31 B;  5B2I A;  5JRG B;  3AYW D;  1P3A D;  1P3G D;  4KUD C;  3B6F A;  5CPK A;  1P3L C;  1EQZ B;  5B24 D;  4J8W A;  4G92 C;  5B1L B;  1P3F C;  3F6T A;  1P3O B;  4Z2M G;  5AV8 D;  3WTP B;  2YFV B;  5AY8 C;  3REL D;  5CP6 D;  5AY8 B;  2G5H C;  2JSS A;  3MNN A;  5B2J D;  4DQY B;  4YM6 C;  1P3B B;  3AZL A;  5CPI A;  4J8U A;  1H3O B;  3REI A;  5DNM C;  1KX3 C;  5C3I B;  1ID3 A;  3W99 D;  1HQ3 C;  2Y2L A;  3AZI D;  3AFA C;  4KGC B;  3AYW C;  1U35 B;  1P3A C;  1P3G C;  1HQ3 B;  5B32 B;  3AYW B;  5B24 C;  5BNV A;  4H9O B;  4WU8 D;  4JJN B;  5AV8 C;  5B24 B;  5B31 G;  3REL C;  4J8V B;  2XD1 A;  1KU5 A;  3W97 A;  5B1M A;  1BFM A;  5CP6 C;  3AZH B;  1P34 B;  5AV9 A;  3REL B;  4CAY B;  5B2J C;  2ZM5 A;  3X1S A;  2G5I C;  5B33 A;  3UT9 D;  5B2I D;  3O62 A;  4ZUX B;  4YS3 A;  3B6F D;  5CPK D;  2Y2P A;  3W99 C;  3C1B B;  4J8W D;  3W98 A;  3AZI C;  1M18 A;  3AV2 A;  3V9R B;  3MVD B;  4X23 B;  2VQR A;  4H9N A;  5B40 B;  3MNN D;  4WU8 C;  4H9R B;  4Z2M H;  5B31 A;  3LJA B;  2CWE A;  1F66 B;  3EPK A;  1B67 A;  3AZL D;  3VH5 W;  5CPI D;  1EQZ A;  4J8U D;  5B1L A;  3REI D;  1ID3 D;  1P3O A;  3AZF B;  4G91 C;  3WTP A;  3UT9 C;  2YFV A;  3AZG B;  5B2I C;  3VH6 A;  5AY8 A;  3B6F C;  5CPK C;  3AZJ A;  2HUE B;  5AV6 D;  4J8W C;  1P3B A;  5CPK B;  2NZD B;  4WZS B;  4J8W B;  3MGR B;  3WTP E;  3W97 D;  5B1M D;  1H3O A;  4LD9 B;  2JE5 A;  5AV9 D;  4HGA C;  3MNN C;  3TU4 A;  4CSR B;  4ZBJ B;  2Y2O A;  3X1S D;  1U35 A;  4QLC B;  5B33 D;  4KGC A;  3AZL C;  3EPJ A;  3O62 D;  5KDM B;  4YS3 D;  5B32 A;  5CPI C;  4J8U C;  2Y2K A;  3EPL A;  3AZL B;  4H9O A;  3REH B;  3REI C;  4JJN A;  1ID3 C;  3W98 D;  4EO5 C;  4J8V A;  1M18 D;  3REI B;  3AV2 D;  5E5A A;  3AZH A;  1P34 A;  4EO5 B;  4UUZ B;  5AV6 C;  1R4V A;  3X1V B;  5B31 D;  4ZUX A;  5AV6 B;  3KFU G;  3W97 C;  5B1M C;  1EQZ D;  5AV9 C;  3WA9 A;  3C1B A;  5B1L D;  4WU9 B;  1P3O D;  3X1S C;  3EPH A;  1Z2C B;  3V9R A;  3WTP D;  5B33 C;  3MVD A;  3O62 C;  4YS3 C;  4X23 A;  5B33 B;  5B0Z D;  3H0L C;  5B40 A;  3AZJ D;  5AV5 A;  3WKJ B;  4H9R A;  3LJA A;  1F66 A;  1P3B D;  3W98 C;  1M18 C;  3WAA B;  3AV2 C;  1ZLA A;  5BS7 A;  2FFF B;  3H0R C;  4J8X A;  3B0C T;  3AZF A;  3TU4 D;  4WJ3 C;  2ARO B;  2J8P A;  5B31 C;  3AZG A;  1U35 D;  4KGC D;  1P3K B;  5B32 D;  1EQZ C;  5B1L C;  4JJN D;  1P3O C;  2NZD A;  3X1U D;  2BYM B;  3WTP C;  4J8V D;  3MGR A;  3B0B A;  5E5A D;  3AZH D;  1P34 D;  4LD9 A;  5B0Z C;  5BNX B;  3AZJ C;  3AZM D;  4CSR A;  1F1E A;  2L5A A;  2HIO B;  4QLC A;  5B0Z B;  1P3B C;  4UPK A;  3AZJ B;  5KDM A;  4ZUX D;  2F2A C;  3REH A;  4NE3 A;  3WA9 D;  5C3I C;  3C1B D;  3TU4 C;  3IP4 C;  4KGC C;  1U35 C;  3MVD D;  3TU4 B;  4X23 D;  5B32 C;  4UUZ A;  5CPJ D;  2Y2H A;  1M19 D;  5B40 D;  5AV5 D;  4JJN C;  3X1V A;  2DQN C;  3X1U C;  3LJA D;  1F66 D;  3VH5 A;  5AV6 A;  4J8V C;  3X1U B;  5E5A C;  1ZLA D;  3REJ D;  3AZH C;  1P34 C;  3REK B;  3AZM C;  4WV4 B;  4J8X D;  4WU9 A;  5E5A B;  1W2E A;  3AZF D;  3AZG D;  5AVB B;  3AZM B;  3AN2 B;  4ZUX C;  1TZY B;  4R8P B;  3WKJ A;  3WA9 C;  4Z5T A;  4NE5 A;  5G49 B;  3C1B C;  4DRB A;  5AVC B;  3EG5 B;  2NZD D;  3WA9 B;  3WAA A;  3MVD C;  3MGR D;  4X23 C;  5CPJ C;  4LD9 D;  3A6N B;  1M19 C;  5B40 C;  5AV5 C;  2ARO A;  5BO0 B;  5CPJ B;  3LJA C;  1F66 C;  4QLC D;  1HTA A;  1P3K A;  1M19 B;  3B0C W;  2CV5 B;  5AV5 B;  1ZLA C;  5BS7 C;  3LZ0 B;  3REJ C;  3REH D;  4J8X C;  1ZLA B;  3REJ B;  3AZF C;  2BYM A;  3R45 B;  3AZG C;  4J8X B;  3H0M C;  5BNX A;  2HUE C;  2HIO A;  5B0Z A;  3X1V D;  2NZD C;  4XUJ A;  3LZ1 B;  3MGR C;  4LD9 C;  3MGQ D;  1N1J B;  5F99 B;  4WU9 D;  4ZBJ C;  4QLC C;  3UTA B;  5CHL B;  3KUY A;  1M1A A;  3REH C;  3WKJ D;  4Z5T D;  4E45 A;  3WAA D;  1B6W A;  3X1U A;  4Z66 A;  5GXQ B;  4H9S A;  3REK A;  5B0Y B;  3KXB B;  1ULY A;  3X1V C;  2ARO D;  5AVB A;  3AZM A;  2FJ7 B;  2IO5 B;  3AN2 A;  1P3K D;  1TZY A;  4R8P A;  2F8N G;  3C1C D;  3MGQ C;  3B6G B;  5G49 A;  3KWQ B;  2ZY5 A;  5GSU B;  4WU9 C;  5AVC A;  3MGQ B;  2Y2M A;  5GT3 B;  4WNN B;  4NE6 A;  3AZE A;  3A6N A;  1S32 B;  3WKJ C;  4Z5T C;  5BO0 A;  2HIO D;  5CPJ A;  1WWI A;  1M19 A;  2UWX A;  3MGP B;  2CV5 A;  3WAA C;  4Z5T B;  4XUJ D;  3LZ0 A;  3LEL A;  3REJ A;  1KX5 B;  2ARO C;  2BYK B;  3R45 A;  3AZN A;  1P3K C;  3KUY D;  1P3I B;  3C1C C;  3B0D B;  1M1A D;  3AV1 A;  4KHA B;  4XZQ B;  3C1C B;  3LZ1 A;  4Z66 D;  3REK D;  1N1J A;  5F99 A;  1KX4 B;  3MGS B;  2HIO C;  3UTA A;  5AVB D;  3AN2 D;  4XUJ C;  1TZY D;  4R8P D;  5BT1 D;  1AOI A;  2Y2N A;  1BH8 A;  4M6B A;  1P3M B;  2PYO B;  3AZK B;  4XUJ B;  3UTB B;  1TAF B;  1P3P B;  5AVC D;  3FDD A;  4H9Q A;  5GT0 A;  3KUY C;  3W96 B;  5GXQ A;  2F8N H;  2NQB B;  3AZE D;  1BH9 B;  5B0Y A;  3A6N D;  3KUY B;  2Y2G A;  1M1A C;  3KXB A;  4KUD B;  2FJ7 A;  1M1A B;  2CV5 D;  1Q9C A;  1JFI B;  1P3L B;  4Z66 C;  3LZ0 D;  3P5J B;  3LEL D;  4G92 B;  4H9S C;  3REK C;  1P3F B;  3B6G A;  3NQJ A;  5GSU A;  3KWQ A;  4Z66 B;  2RIQ A;  3MGQ A;  5AVB C;  5GT3 A;  3AN2 C;  3AZN D;  4WNN A;  1TZY C;  4R8P C;  5BT1 C;  2F8N D;  1S32 A;  2ZY3 A;  4YM6 B;  3AV1 D;  3X1T A;  3MGP A;  5AVC C;  3LZ1 D;  1A7W A;  1KX3 B;  3AZE C;  5DNM B;  3A6N C;  5F99 D;  1KX5 A;  3AFA B;  2BYK A;  3AZE B;  1P3A B;  1P3G B;  3UTA D;  2CV5 C;  1P3I A;  1T3U A;  5DNN A;  1AOI D;  3LZ0 C;  2DF4 C;  3LEL C;  4KHA A;  5AV8 B;  4XZQ A;  3C1C A;  3LEL B;  3VH6 T;  2JCH A;  3AZN C;  5GT0 D;  5CP6 B;  5GXQ D;  1KX4 A;  5B2J B;  5B0Y D;  3AZN B;  3MGS A;  2Y2I A;  2F8N B;  3KXB D;  4H9P B;  3AV1 C;  5FUG B;  2FJ7 D;  3LZ1 C;  3AV1 B;  1P3M A;  2PYO A;  3AZK A;  3UTB A;  3B6G D;  3W99 B;  2YFW B;  1TAF A;  5F99 C;  3KWQ D;  5GSU D;  3AZI B;  1P3P A;  3UTA C;  3W96 A;  5GT3 D;  2NQB A;  1BH9 A;  5JRG A;  4AWL C;  1AOI C;  2W8S A;  4WU8 B;  1S32 D;  5JA4 B;  4KUD A;  5B32 G;  4AWL B;  1AOI B;  1BH8 B;  3X1T D;  3MGP D;  3NQU B;  5GT0 C;  1P3L A;  1JFI A;  1WWS A;  5GXQ C;  1P3F A;  4H9Q B;  5B0Y C;  5GT0 B;  4G91 B;  3KXB C;  3UT9 B;  1KX5 D;  5B2I B;  2FJ7 C;  2IO5 C; 
#chains in the Genus database with same CATH homology
 3B6F B;  1P3I D;  4DRA A;  5DNN D;  3B6G C;  1PZR A;  4YM6 A;  3KWQ C;  5GSU C;  4XZQ D;  5GT3 C;  3NQJ B;  1KX3 A;  5DNM A;  1KX4 D;  1HQ3 A;  4HGA B;  3MNN B;  1S32 C;  3AFA A;  3MGS D;  3AYW A;  1P3A A;  1P3G A;  3X1T C;  3MGP C;  4E44 A;  5CPI B;  5B24 A;  2F8N K;  4J8U B;  3X1T B;  1P3M D;  2PYO D;  3AZK D;  3UTB D;  1ID3 B;  5AV8 A;  3REL A;  1KX5 C;  1P3P D;  4CAY A;  2RVQ D;  5CP6 A;  3AL0 C;  3W96 D;  3VH6 W;  1P3I C;  3A1K A;  2NQB D;  5DNN C;  5JRG D;  5B2J A;  2ZY4 A;  5BNV B;  3B0D C;  2F8N A;  4H9P A;  4KUD D;  4XZQ C;  5FUG A;  3A1I A;  5DNN B;  3W97 B;  5B1M B;  1P3L D;  5AV9 B;  2ZY2 A;  3W99 A;  1P3F D;  2YFW A;  1KX4 C;  3AZI A;  4NFT A;  3X1S B;  3MGS C;  5AY8 D;  3O62 B;  4YS3 B;  2Y2J A;  3KSY A;  1P3M C;  4WU8 A;  2PYO C;  5JA4 A;  3UTB C;  3AZK C;  2BG1 A;  4YM6 D;  3W98 B;  1P3P C;  1M18 B;  3NQU A;  3AV2 B;  2RVQ C;  3W96 C;  2XD5 A;  4H9N B;  1KX3 D;  5JRG C;  5DNM D;  2Y2Q A;  2NQB C;  2LY8 A;  1HQ3 D;  3VH5 T;  3UT9 A;  3AFA D;  5B31 B;  5B2I A;  5JRG B;  3AYW D;  1P3A D;  1P3G D;  4KUD C;  3B6F A;  5CPK A;  1P3L C;  1EQZ B;  5B24 D;  4J8W A;  4G92 C;  5B1L B;  1P3F C;  3F6T A;  1P3O B;  4Z2M G;  5AV8 D;  3WTP B;  2YFV B;  5AY8 C;  3REL D;  5CP6 D;  5AY8 B;  2G5H C;  2JSS A;  3MNN A;  5B2J D;  4DQY B;  4YM6 C;  1P3B B;  3AZL A;  5CPI A;  4J8U A;  1H3O B;  3REI A;  5DNM C;  1KX3 C;  5C3I B;  1ID3 A;  3W99 D;  1HQ3 C;  2Y2L A;  3AZI D;  3AFA C;  4KGC B;  3AYW C;  1U35 B;  1P3A C;  1P3G C;  1HQ3 B;  5B32 B;  3AYW B;  5B24 C;  5BNV A;  4H9O B;  4WU8 D;  4JJN B;  5AV8 C;  5B24 B;  5B31 G;  3REL C;  4J8V B;  2XD1 A;  1KU5 A;  3W97 A;  5B1M A;  1BFM A;  5CP6 C;  3AZH B;  1P34 B;  5AV9 A;  3REL B;  4CAY B;  5B2J C;  2ZM5 A;  3X1S A;  2G5I C;  5B33 A;  3UT9 D;  5B2I D;  3O62 A;  4ZUX B;  4YS3 A;  3B6F D;  5CPK D;  2Y2P A;  3W99 C;  3C1B B;  4J8W D;  3W98 A;  3AZI C;  1M18 A;  3AV2 A;  3V9R B;  3MVD B;  4X23 B;  2VQR A;  4H9N A;  5B40 B;  3MNN D;  4WU8 C;  4H9R B;  4Z2M H;  5B31 A;  3LJA B;  2CWE A;  1F66 B;  3EPK A;  1B67 A;  3AZL D;  3VH5 W;  5CPI D;  1EQZ A;  4J8U D;  5B1L A;  3REI D;  1ID3 D;  1P3O A;  3AZF B;  4G91 C;  3WTP A;  3UT9 C;  2YFV A;  3AZG B;  5B2I C;  3VH6 A;  5AY8 A;  3B6F C;  5CPK C;  3AZJ A;  2HUE B;  5AV6 D;  4J8W C;  1P3B A;  5CPK B;  2NZD B;  4WZS B;  4J8W B;  3MGR B;  3WTP E;  3W97 D;  5B1M D;  1H3O A;  4LD9 B;  2JE5 A;  5AV9 D;  4HGA C;  3MNN C;  3TU4 A;  4CSR B;  4ZBJ B;  2Y2O A;  3X1S D;  1U35 A;  4QLC B;  5B33 D;  4KGC A;  3AZL C;  3EPJ A;  3O62 D;  5KDM B;  4YS3 D;  5B32 A;  5CPI C;  4J8U C;  2Y2K A;  3EPL A;  3AZL B;  4H9O A;  3REH B;  3REI C;  4JJN A;  1ID3 C;  3W98 D;  4EO5 C;  4J8V A;  1M18 D;  3REI B;  3AV2 D;  5E5A A;  3AZH A;  1P34 A;  4EO5 B;  4UUZ B;  5AV6 C;  1R4V A;  3X1V B;  5B31 D;  4ZUX A;  5AV6 B;  3KFU G;  3W97 C;  5B1M C;  1EQZ D;  5AV9 C;  3WA9 A;  3C1B A;  5B1L D;  4WU9 B;  1P3O D;  3X1S C;  3EPH A;  1Z2C B;  3V9R A;  3WTP D;  5B33 C;  3MVD A;  3O62 C;  4YS3 C;  4X23 A;  5B33 B;  5B0Z D;  3H0L C;  5B40 A;  3AZJ D;  5AV5 A;  3WKJ B;  4H9R A;  3LJA A;  1F66 A;  1P3B D;  3W98 C;  1M18 C;  3WAA B;  3AV2 C;  1ZLA A;  5BS7 A;  2FFF B;  3H0R C;  4J8X A;  3B0C T;  3AZF A;  3TU4 D;  4WJ3 C;  2ARO B;  2J8P A;  5B31 C;  3AZG A;  1U35 D;  4KGC D;  1P3K B;  5B32 D;  1EQZ C;  5B1L C;  4JJN D;  1P3O C;  2NZD A;  3X1U D;  2BYM B;  3WTP C;  4J8V D;  3MGR A;  3B0B A;  5E5A D;  3AZH D;  1P34 D;  4LD9 A;  5B0Z C;  5BNX B;  3AZJ C;  3AZM D;  4CSR A;  1F1E A;  2L5A A;  2HIO B;  4QLC A;  5B0Z B;  1P3B C;  4UPK A;  3AZJ B;  5KDM A;  4ZUX D;  2F2A C;  3REH A;  4NE3 A;  3WA9 D;  5C3I C;  3C1B D;  3TU4 C;  3IP4 C;  4KGC C;  1U35 C;  3MVD D;  3TU4 B;  4X23 D;  5B32 C;  4UUZ A;  5CPJ D;  2Y2H A;  1M19 D;  5B40 D;  5AV5 D;  4JJN C;  3X1V A;  2DQN C;  3X1U C;  3LJA D;  1F66 D;  3VH5 A;  5AV6 A;  4J8V C;  3X1U B;  5E5A C;  1ZLA D;  3REJ D;  3AZH C;  1P34 C;  3REK B;  3AZM C;  4WV4 B;  4J8X D;  4WU9 A;  5E5A B;  1W2E A;  3AZF D;  3AZG D;  5AVB B;  3AZM B;  3AN2 B;  4ZUX C;  1TZY B;  4R8P B;  3WKJ A;  3WA9 C;  4Z5T A;  4NE5 A;  5G49 B;  3C1B C;  4DRB A;  5AVC B;  3EG5 B;  2NZD D;  3WA9 B;  3WAA A;  3MVD C;  3MGR D;  4X23 C;  5CPJ C;  4LD9 D;  3A6N B;  1M19 C;  5B40 C;  5AV5 C;  2ARO A;  5BO0 B;  5CPJ B;  3LJA C;  1F66 C;  4QLC D;  1HTA A;  1P3K A;  1M19 B;  3B0C W;  2CV5 B;  5AV5 B;  1ZLA C;  5BS7 C;  3LZ0 B;  3REJ C;  3REH D;  4J8X C;  1ZLA B;  3REJ B;  3AZF C;  2BYM A;  3R45 B;  3AZG C;  4J8X B;  3H0M C;  5BNX A;  2HUE C;  2HIO A;  5B0Z A;  3X1V D;  2NZD C;  4XUJ A;  3LZ1 B;  3MGR C;  4LD9 C;  3MGQ D;  1N1J B;  5F99 B;  4WU9 D;  4ZBJ C;  4QLC C;  3UTA B;  5CHL B;  3KUY A;  1M1A A;  3REH C;  3WKJ D;  4Z5T D;  4E45 A;  3WAA D;  1B6W A;  3X1U A;  4Z66 A;  5GXQ B;  4H9S A;  3REK A;  5B0Y B;  3KXB B;  1ULY A;  3X1V C;  2ARO D;  5AVB A;  3AZM A;  2FJ7 B;  2IO5 B;  3AN2 A;  1P3K D;  1TZY A;  4R8P A;  2F8N G;  3C1C D;  3MGQ C;  3B6G B;  5G49 A;  3KWQ B;  2ZY5 A;  5GSU B;  4WU9 C;  5AVC A;  3MGQ B;  2Y2M A;  5GT3 B;  4WNN B;  4NE6 A;  3AZE A;  3A6N A;  1S32 B;  3WKJ C;  4Z5T C;  5BO0 A;  2HIO D;  5CPJ A;  1WWI A;  1M19 A;  2UWX A;  3MGP B;  2CV5 A;  3WAA C;  4Z5T B;  4XUJ D;  3LZ0 A;  3LEL A;  3REJ A;  1KX5 B;  2ARO C;  2BYK B;  3R45 A;  3AZN A;  1P3K C;  3KUY D;  1P3I B;  3C1C C;  3B0D B;  1M1A D;  3AV1 A;  4KHA B;  4XZQ B;  3C1C B;  3LZ1 A;  4Z66 D;  3REK D;  1N1J A;  5F99 A;  1KX4 B;  3MGS B;  2HIO C;  3UTA A;  5AVB D;  3AN2 D;  4XUJ C;  1TZY D;  4R8P D;  5BT1 D;  1AOI A;  2Y2N A;  1BH8 A;  4M6B A;  1P3M B;  2PYO B;  3AZK B;  4XUJ B;  3UTB B;  1TAF B;  1P3P B;  5AVC D;  3FDD A;  4H9Q A;  5GT0 A;  3KUY C;  3W96 B;  5GXQ A;  2F8N H;  2NQB B;  3AZE D;  1BH9 B;  5B0Y A;  3A6N D;  3KUY B;  2Y2G A;  1M1A C;  3KXB A;  4KUD B;  2FJ7 A;  1M1A B;  2CV5 D;  1Q9C A;  1JFI B;  1P3L B;  4Z66 C;  3LZ0 D;  3P5J B;  3LEL D;  4G92 B;  4H9S C;  3REK C;  1P3F B;  3B6G A;  3NQJ A;  5GSU A;  3KWQ A;  4Z66 B;  2RIQ A;  3MGQ A;  5AVB C;  5GT3 A;  3AN2 C;  3AZN D;  4WNN A;  1TZY C;  4R8P C;  5BT1 C;  2F8N D;  1S32 A;  2ZY3 A;  4YM6 B;  3AV1 D;  3X1T A;  3MGP A;  5AVC C;  3LZ1 D;  1A7W A;  1KX3 B;  3AZE C;  5DNM B;  3A6N C;  5F99 D;  1KX5 A;  3AFA B;  2BYK A;  3AZE B;  1P3A B;  1P3G B;  3UTA D;  2CV5 C;  1P3I A;  1T3U A;  5DNN A;  1AOI D;  3LZ0 C;  2DF4 C;  3LEL C;  4KHA A;  5AV8 B;  4XZQ A;  3C1C A;  3LEL B;  3VH6 T;  2JCH A;  3AZN C;  5GT0 D;  5CP6 B;  5GXQ D;  1KX4 A;  5B2J B;  5B0Y D;  3AZN B;  3MGS A;  2Y2I A;  2F8N B;  3KXB D;  4H9P B;  3AV1 C;  5FUG B;  2FJ7 D;  3LZ1 C;  3AV1 B;  1P3M A;  2PYO A;  3AZK A;  3UTB A;  3B6G D;  3W99 B;  2YFW B;  1TAF A;  5F99 C;  3KWQ D;  5GSU D;  3AZI B;  1P3P A;  3UTA C;  3W96 A;  5GT3 D;  2NQB A;  1BH9 A;  5JRG A;  4AWL C;  1AOI C;  2W8S A;  4WU8 B;  1S32 D;  5JA4 B;  4KUD A;  5B32 G;  4AWL B;  1AOI B;  1BH8 B;  3X1T D;  3MGP D;  3NQU B;  5GT0 C;  1P3L A;  1JFI A;  1WWS A;  5GXQ C;  1P3F A;  4H9Q B;  5B0Y C;  5GT0 B;  4G91 B;  3KXB C;  3UT9 B;  1KX5 D;  5B2I B;  2FJ7 C;  2IO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...