2LY8A

The budding yeast chaperone scm3 recognizes the partially unfolded dimer of the centromere-specific cse4/h4 histone variant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
121
structure length
121
Chain Sequence
LISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Budding yeast chaperone Scm3
publication title Identification of Functionally Conserved Regions in the Structure of the Chaperone/CenH3/H4 Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 34
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2ly8A00
3C1CB 3VH6W 3AZID 3B0DC 4XUJA 1M18D 2RVQC 3KSYA 4E45A 3AZKC 5AV5D 5AVCC 3AZGA 3AZHD 5GT3D 3VH6A 5GSUD 1S32B 3MNNA 3MGQC 3AZFC 1P3GC 3KUYD 2HIOB 1KX4B 1F66B 1M19A 3W99C 3LELD 4QLCA 1Q9CA 5DNNB 3B0CT 5B40D 3MGSA 5B1MA 2CV5B 3UT9C 4J8XB 1KX5C 3AV2C 3KXBB 5BNVA 5F99A 3WTPC 4J8UB 2F8NA 1ZLAB 2BYKA 3AZKA 4JJNB 3RELD 5AVCA 3UTAB 3REIC 5JRGD 5G49A 5GXQB 1H3OB 5GT0B 5BO0B 4J8WA 3AZMB 3MGRC 5E5AB 3VH6T 5DNMC 3X1SB 3MGQA 2L5AA 3WA9B 3AZJA 3LJAB 1KX5B 3AZFA 3W98B 4ZUXB 1WWIA 1P3GA 3NQUB 5AVBC 3C1CD 1P3OB 2PYOD 1P3MB 3W99A 3MVDB 2YFVA 4R8PB 3AV2A 3X1UD 1TZYA 3UTBB 3TU4D 3AZEB 5B2ID 2FJ7A 3KWQA 1P3AD 4WU8C 3AN2B 2NQBB 3REIA 4EO5B 4WNNA 3AFAD 5AV9B 3X1TA 5B0YC 1U35C 4YM6C 1ID3B 1TAFA 3MGRA 4XZQC 5DNMA 1P3KC 1F66D 5DNND 1EQZD 3B6GB 4WU9D 5CPIB 3REJD 5AVBA 1P3LC 4X23D 5C3IC 3VH5W 1M18C 3X1VD 1ZLAD 5AV6B 1B67A 1M1AC 2IO5B 5AV5C 5B0YB 3AZHC 3AZLD 5GXQD 5B33B 3AZMD 5BT1C 1F1EA 5CP6C 3AZND 1P3BB 1KU5A 4WU8A 3REKB 3X1SD 3WA9D 2HUEC 3LJAD 3A6ND 3C1BB 4J8VD 4YM6A 3AZIB 4H9QA 1AOIC 3KUYC 4XZQA 5AV5B 3MVDD 3AZHB 1ULYA 5B40C 4R8PD 2YFWA 4LD9C 5GT3B 5GSUB 1P3LA 1M18A 1M1AA 3O62D 5JRGC 4H9SC 5B2JB 1P3FD 3W96B 5CP6A 4Z5TA 3WAAD 1ID3D 4G92C 3LELB 3VH5T 3AYWD 1KX3C 1JFIB 3LZ0C 1AOIA 3KUYA 3C1CC 2PYOC 4E44A 3RELB 3LZ1D 5B40A 4LD9A 1P34A 3W97B 1P3ID 1BH9A 1S32C 3REKD 5JRGA 4H9SA 4Z2MH 3AV1B 2PYOB 5B32D 5B24D 2HIOC 1KX4C 1F66C 3V9RB 1KX3A 2CV5C 5DNNC 1EQZC 3X1UB 4J8XC 3LZ0A 3TU4B 5B2IB 3KXBC 2F8NH 2AROD 3C1CA 1P3AB 4KUDB 4J8UC 3X1VC 1ZLAC 3AFAB 4ZBJC 4JJNC 2JSSA 3UTAC 4CSRB 3AZGB 3WKJD 2BYMB 5B2JD 3W96D 5B31B 5GT0C 5GXQC 3AZMC 1R4VA 1S32A 5E5AC 3MNNB 3X1SC 4WU9B 3WA9C 5CPJB 3LJAC 3W98C 3A6NC 4ZUXC 3REJB 4X23B 1A7WA 3X1VB 2HIOA 1P3OC 3MGPB 4ZBJB 1KX4A 5BNXB 1P3MC 2CV5A 5DNNA 1EQZA 3MVDC 4J8XA 4R8PC 3AZLB 3AZNB 4KHAB 3KXBA 3W97D 3UTBC 4J8UA 3AZEC 3A6NB 4JJNA 3REHB 3AN2C 4J8VB 3UTAA 2NQBC 1HQ3D 5CPKD 4EO5C 4H9RA 5AV8D 5AV9C 5GT0A 5GXQA 1H3OA 3AV1D 5BO0A 3AZMA 1P3FC 1ID3C 5E5AA 3UT9A 1KX5A 3W98A 5JA4B 4ZUXA 3B6GC 1N1JB 4H9PB 3NQUA 5CPIC 4M6BA 3WTPA 1P3PD 1P3OA 4KUDD 1P3MA 4KGCB 4XUJD 3O62B 3MVDA 5AV6C 2IO5C 4R8PA 1P3FB 3AZGD 3WAAB 5B31D 5B33C 3UTBA 1TZYB 3AZEA 3AYWB 1P3BC 3AN2A 3REKC 4CAYB 3MNND 3KWQB 2NQBA 5CPJD 3C1BC 5AV9A 1HTAA 5BS7C 4H9OB 3AZIC 3X1TB 5FUGB 1ID3A 3MGPD 3LZ1B 3B6GA 1M19D 4QLCD 3MGSD 5CPIA 5B1MD 5GT3C 3VH5A 5GSUC 3NQJB 1P3IB 5B1LB 3WTPE 5AY8B 5F99D 5AV6A 2RVQD 2F8ND 3REHD 4H9NB 5B0YA 1U35A 5B2JC 3W96C 5B33A 5B32B 4Z66B 5B24B 4J8WD 1P3KA 1P3BA 3LELC 1BFMA 3MGQD 3C1BA 3AZJD 5BS7A 3AZFD 2AROB 4YS3B 3AZIA 4UUZB 5AV5A 5KDMB 3RELC 4KGCD 3AZHA 3W99D 3R45B 3WKJB 5GT3A 5GSUA 3AV2D 3W97C 3B6FB 1TZYD 2FJ7D 3KWQD 4HGAB 3REID 5B2JA 3W96A 3AV1C 3X1TD 4Z5TB 3LELA 5DNMD 3X1UC 5B31G 3TU4C 5B2IC 5B0ZB 5AVBD 5B1LD 1P3AC 3RELA 4KUDC 5AY8D 1HQ3B 5CPKB 2NZDB 5AV8B 3AFAC 1BH8B 3AZGC 4G91B 5B31C 4Z66D 4NE3A 1B6WA 4AWLB 4WU8D 3MNNC 4WU9C 5CPJC 3REJC 3AV1A 1P3PB 4YS3D 2PYOA 4X23C 4XUJB 3MGPC 4XZQD 1EQZB 3V9RA 3X1UA 3AZLC 3TU4A 3AZNC 5B2IA 3B6FD 1P3AA 4KUDA 5F99C 4NFTA 3AFAA 3REHC 4J8VC 1M1AD 4CSRA 2BYMA 5B31A 5BT1D 5CP6D 4Z5TD 4J8WC 1F66A 1M19B 4WU9A 5CPJA 4QLCB 3MGSB 5B1MB 3AZJC 3REJA 2CWEA 4X23A 5BNVB 3B0DB 5B0ZD 5F99B 4WZSB 3X1VA 1AOID 3MGPA 1ZLAA 2F8NB 5BNXA 2BYKB 3AZKB 4KGCC 5AVCB 3O62C 2NZDD 3AZLA 4LD9D 5G49B 3WAAC 4KHAA 4J8WB 3AZNA 1P34D 3X1SA 3WA9A 4DRBA 1TZYC 3LJAA 3MGQB 3AYWC 3A6NA 3REHA 3AZJB 2FJ7C 3KWQC 4J8VA 3AZFB 1P3GB 4H9RB 3X1TC 3LZ1C 3W99B 5JA4A 2YFVB 3UT9B 1KX3D 1N1JA 4H9PA 3AV2B 5B32G 1P3IC 3LZ0D 3WTPB 2FJ7B 5B1LC 4KGCA 5AY8C 3O62A 3REIB 1P3FA 4WNNB 3WAAA 4NE5A 5B32C 1TAFB 5B24C 4Z66C 3MGRB 5DNMB 3AYWA 1S32D 4CAYA 5AVBB 2AROC 4H9OA 4YS3C 5FUGA 3LZ1A 2HIOD 3AZKD 1KX4D 5AVCD 2CV5D 3WKJC 4J8XD 1P3IA 3NQJA 5B1LA 1WWSA 3KXBD 3REKA 3B6FC 4WU8B 5AY8A 4J8UD 4H9NA 4HGAC 4JJND 3UTAD 1P3GD 1U35B 4YM6B 5B32A 4H9QB 4NE6A 5B24A 4Z66A 5GT0D 4XZQB 5CHLB 4Z5TC 1P3KB 5E5AD 3UT9D 1KX5D 3W98D 2YFWB 4ZUXD 2AROA 4YS3A 1P3LB 5C3IB 1M18B 5B0ZC 3WTPD 1P3OD 4UUZA 5KDMA 1M1AB 1P3MD 1HQ3C 5CPKC 3R45A 3WKJA 2NZDC 5AV8C 5CP6B 4G91C 3B6FA 3MGRD 1P34C 3UTBD 2HUEB 3AZED 4AWLC 2NQBD 3AN2D 1JFIA 4WV4B 5AV9D 1AOIB 1P3PC 2LY8A 3KUYB 2F8NK 4XUJC 5B40B 4LD9B 3B6GD 3W97A 3B0BA 1P34B 4DRAA 5CPID 4Z2MG 5B0ZA 1BH9B 3B0CW 1HQ3A 5CPKA 2NZDA 5AV8A 5AV6D 5JRGB 1BH8A 5B0YD 1U35D 4YM6D 4G92B 5B33D 2F8NG 1P3KD 1P3BD 1M19C 1KX3B 4QLCC 3MGSC 5B1MC 3C1BD 3LZ0B 1P3PA 1P3LD
chains in the Genus database with same CATH superfamily
3C1CB 3VH6W 3AZID 3B0DC 4XUJA 1M18D 2RVQC 2Y2OA 3KSYA 2ZY4A 4E45A 3AZKC 5AV5D 5AVCC 3AZGA 3AZHD 3H0MC 5GT3D 3VH6A 5GSUD 1S32B 3MNNA 3MGQC 2ZY2A 3AZFC 1P3GC 3KUYD 2HIOB 1KX4B 1F66B 1M19A 3W99C 3LELD 4QLCA 1Q9CA 5DNNB 3B0CT 5B40D 3MGSA 5B1MA 2CV5B 3UT9C 4J8XB 1KX5C 3AV2C 3KXBB 5BNVA 5F99A 2G5HC 3WTPC 4J8UB 1ZLAB 2F8NA 2Y2MA 2BYKA 3AZKA 4JJNB 3RELD 5AVCA 3UTAB 3REIC 5JRGD 5G49A 5GXQB 1H3OB 5GT0B 5BO0B 4J8WA 3AZMB 3MGRC 5E5AB 3VH6T 5DNMC 3X1SB 3MGQA 2L5AA 3WA9B 3AZJA 3LJAB 1KX5B 3AZFA 3W98B 4ZUXB 1WWIA 2UWXA 1P3GA 3NQUB 5AVBC 3C1CD 1P3OB 2PYOD 1P3MB 3W99A 3MVDB 2YFVA 4R8PB 2Y2LA 3AV2A 3X1UD 1TZYA 3UTBB 3TU4D 3AZEB 5B2ID 2FJ7A 3FDDA 3KWQA 1P3AD 4WU8C 3AN2B 2NQBB 3REIA 4EO5B 4WNNA 3AFAD 5AV9B 3X1TA 5B0YC 1U35C 4YM6C 1ID3B 1TAFA 3MGRA 4XZQC 5DNMA 1P3KC 1F66D 5DNND 1EQZD 3B6GB 4WU9D 5CPIB 3REJD 2DF4C 5AVBA 1P3LC 4X23D 5C3IC 3VH5W 1M18C 3X1VD 1ZLAD 5AV6B 1B67A 1M1AC 2F2AC 2IO5B 5AV5C 5B0YB 3AZHC 3AZLD 5GXQD 5B33B 3AZMD 5BT1C 1F1EA 5CP6C 3AZND 1P3BB 1KU5A 4WU8A 3REKB 3X1SD 3WA9D 2HUEC 3LJAD 3A6ND 3C1BB 4J8VD 3A1IA 2G5IC 4YM6A 3AZIB 4H9QA 1AOIC 3KUYC 4XZQA 5AV5B 3MVDD 3AZHB 1ULYA 5B40C 4R8PD 2YFWA 4LD9C 5GT3B 5GSUB 1P3LA 1M18A 1M1AA 3O62D 5JRGC 4H9SC 5B2JB 1P3FD 3W96B 5CP6A 4Z5TA 3WAAD 1ID3D 2JCHA 4G92C 3LELB 3VH5T 3AYWD 1KX3C 1JFIB 2XD5A 3LZ0C 1AOIA 3KUYA 3C1CC 2PYOC 4E44A 3RELB 2VQRA 3IP4C 3LZ1D 5B40A 4LD9A 1P34A 3W97B 1P3ID 1BH9A 2BG1A 3REKD 1S32C 5JRGA 4H9SA 4Z2MH 3AV1B 2PYOB 5B32D 5B24D 2HIOC 1KX4C 1F66C 3V9RB 1KX3A 2CV5C 5DNNC 1EQZC 3X1UB 4J8XC 3LZ0A 3TU4B 5B2IB 3KXBC 2F8NH 2AROD 3C1CA 1P3AB 4KUDB 4J8UC 3X1VC 1ZLAC 3AFAB 4ZBJC 4JJNC 2JSSA 3UTAC 4CSRB 3AZGB 3WKJD 2BYMB 5B2JD 3W96D 5B31B 5GT0C 5GXQC 3AZMC 1R4VA 1S32A 5E5AC 3MNNB 3X1SC 4WU9B 3WA9C 5CPJB 3LJAC 3W98C 3A6NC 4ZUXC 3REJB 2Y2NA 4X23B 1A7WA 4DQYB 3X1VB 1P3PA 2HIOA 1P3OC 3MGPB 4ZBJB 1KX4A 5BNXB 1P3MC 2CV5A 5DNNA 1EQZA 3MVDC 4J8XA 4R8PC 3AZLB 2Y2JA 3AZNB 4KHAB 3KXBA 3W97D 3UTBC 4J8UA 3AZEC 3A6NB 4JJNA 3REHB 3AN2C 4J8VB 3UTAA 2NQBC 1HQ3D 5CPKD 4EO5C 4H9RA 5AV8D 5AV9C 5GT0A 5GXQA 1H3OA 3AV1D 5BO0A 3AZMA 1P3FC 1ID3C 5E5AA 1PZRA 3UT9A 1KX5A 3W98A 5JA4B 4ZUXA 3B6GC 1N1JB 4H9PB 3NQUA 5CPIC 4M6BA 3WTPA 1P3PD 1P3OA 4KUDD 1P3MA 4KGCB 4XUJD 3O62B 3H0RC 5AV6C 3MVDA 2IO5C 4UPKA 4R8PA 1P3FB 3AZGD 3WAAB 5B31D 5B33C 3UTBA 1TZYB 3AZEA 3AYWB 1P3BC 3AN2A 3REKC 4CAYB 3MNND 3KWQB 2NQBA 5CPJD 3C1BC 5AV9A 1HTAA 5BS7C 4H9OB 3AZIC 3X1TB 3F6TA 5FUGB 1ID3A 4WJ3C 3MGPD 3LZ1B 3B6GA 1M19D 4QLCD 3MGSD 5CPIA 5B1MD 5GT3C 3VH5A 5GSUC 3NQJB 1P3IB 5B1LB 3WTPE 5AY8B 5F99D 5AV6A 2RVQD 2F8ND 3REHD 4H9NB 5B0YA 1U35A 5B2JC 3W96C 5B33A 5B32B 4Z66B 5B24B 4J8WD 1P3KA 1P3BA 3LELC 1BFMA 3MGQD 3C1BA 3AZJD 5BS7A 3AZFD 2AROB 4YS3B 3AZIA 4UUZB 5AV5A 5KDMB 2Y2KA 3RELC 4KGCD 3AZHA 3W99D 3R45B 3WKJB 5GT3A 5GSUA 2Y2PA 3AV2D 3W97C 3B6FB 1TZYD 2FJ7D 3KWQD 4HGAB 3REID 5B2JA 3W96A 3AV1C 3X1TD 3EG5B 4Z5TB 3LELA 5DNMD 3X1UC 5B31G 3TU4C 5B2IC 5B0ZB 5AVBD 5B1LD 1P3AC 3RELA 4KUDC 5AY8D 1HQ3B 5CPKB 2NZDB 5AV8B 3AFAC 1BH8B 3A1KA 3AZGC 4G91B 5B31C 4Z66D 4NE3A 1B6WA 4AWLB 4WU8D 3MNNC 4WU9C 5CPJC 3REJC 3AV1A 2Y2GA 1P3PB 4YS3D 2PYOA 4X23C 4XUJB 3MGPC 4XZQD 1EQZB 3V9RA 1T3UA 3X1UA 3AZLC 3TU4A 3AZNC 5B2IA 2ZY3A 3B6FD 1P3AA 2W8SA 4KUDA 5F99C 4NFTA 3AFAA 3REHC 3EPHA 4J8VC 1M1AD 4CSRA 2BYMA 5B31A 5BT1D 5CP6D 4Z5TD 4J8WC 1F66A 1M19B 4WU9A 5CPJA 4QLCB 3MGSB 5B1MB 3AZJC 3REJA 2CWEA 4X23A 3EPJA 5BNVB 3B0DB 5B0ZD 5F99B 4WZSB 3X1VA 1AOID 3MGPA 1ZLAA 2F8NB 5BNXA 2BYKB 3AZKB 4KGCC 5AVCB 3O62C 3EPLA 2NZDD 3AZLA 4LD9D 5G49B 2JE5A 4KHAA 3WAAC 4J8WB 3AZNA 1P34D 3X1SA 3WA9A 4DRBA 3P5JB 1TZYC 3LJAA 3MGQB 3AYWC 3A6NA 3REHA 3AZJB 2FJ7C 3KWQC 4J8VA 3AZFB 1P3GB 4H9RB 3X1TC 3LZ1C 3W99B 5JA4A 2YFVB 3UT9B 1KX3D 1N1JA 4H9PA 3AV2B 5B32G 1P3IC 3LZ0D 3WTPB 2FJ7B 5B1LC 4KGCA 5AY8C 3AL0C 3O62A 1Z2CB 3REIB 1P3FA 4WNNB 2ZM5A 3WAAA 4NE5A 5B32C 1TAFB 5B24C 4Z66C 3MGRB 5DNMB 3AYWA 1S32D 4CAYA 5AVBB 2AROC 4H9OA 4YS3C 5FUGA 3LZ1A 2HIOD 3AZKD 1KX4D 5AVCD 2CV5D 3WKJC 4J8XD 1P3IA 3NQJA 5B1LA 1WWSA 3KXBD 3REKA 3B6FC 4WU8B 5AY8A 4J8UD 2RIQA 4H9NA 4HGAC 4JJND 2DQNC 3UTAD 1P3GD 1U35B 4YM6B 5B32A 4H9QB 4NE6A 5B24A 4Z66A 5GT0D 4XZQB 5CHLB 4Z5TC 1P3KB 2XD1A 5E5AD 3UT9D 1KX5D 3W98D 2YFWB 3EPKA 4ZUXD 2AROA 4YS3A 1P3LB 2FFFB 5C3IB 1M18B 5B0ZC 3WTPD 1P3OD 4UUZA 5KDMA 1M1AB 1P3MD 1HQ3C 5CPKC 3R45A 3WKJA 2NZDC 5AV8C 2Y2IA 5CP6B 4G91C 3B6FA 3MGRD 1P34C 2Y2QA 3UTBD 2HUEB 3AZED 4AWLC 2NQBD 3AN2D 2J8PA 1JFIA 4WV4B 5AV9D 1AOIB 1P3PC 2LY8A 3KUYB 2F8NK 4XUJC 5B40B 3KFUG 4LD9B 3B6GD 3W97A 3B0BA 2ZY5A 1P34B 4DRAA 5CPID 4Z2MG 5B0ZA 3H0LC 1BH9B 3B0CW 1HQ3A 5CPKA 2NZDA 5AV8A 5AV6D 5JRGB 1BH8A 5B0YD 1U35D 4YM6D 4G92B 5B33D 2F8NG 1P3KD 1P3BD 1M19C 1KX3B 4QLCC 3MGSC 5B1MC 3C1BD 1W2EA 3LZ0B 2Y2HA 1P3LD
chains in the Genus database with same CATH topology
3C1CB 3VH6W 3AZID 3B0DC 4XUJA 1M18D 2RVQC 2Y2OA 3KSYA 2ZY4A 4E45A 3AZKC 5AV5D 5AVCC 3AZGA 3AZHD 3H0MC 5GT3D 3VH6A 5GSUD 1S32B 3MNNA 3MGQC 2ZY2A 3AZFC 1P3GC 3KUYD 2HIOB 1KX4B 1F66B 1M19A 3W99C 3LELD 4QLCA 1Q9CA 5DNNB 3B0CT 5B40D 3MGSA 5B1MA 2CV5B 3UT9C 4J8XB 1KX5C 3AV2C 3KXBB 5BNVA 5F99A 2G5HC 3WTPC 4J8UB 1ZLAB 2F8NA 2Y2MA 2BYKA 3AZKA 4JJNB 3RELD 5AVCA 3UTAB 3REIC 5JRGD 5G49A 5GXQB 1H3OB 5GT0B 5BO0B 4J8WA 3AZMB 3MGRC 5E5AB 3VH6T 5DNMC 3X1SB 3MGQA 2L5AA 3WA9B 3AZJA 3LJAB 1KX5B 3AZFA 3W98B 4ZUXB 1WWIA 2UWXA 1P3GA 3NQUB 5AVBC 3C1CD 1P3OB 2PYOD 1P3MB 3W99A 3MVDB 2YFVA 4R8PB 2Y2LA 3AV2A 3X1UD 1TZYA 3UTBB 3TU4D 3AZEB 5B2ID 2FJ7A 3FDDA 3KWQA 1P3AD 4WU8C 3AN2B 2NQBB 3REIA 4EO5B 4WNNA 3AFAD 5AV9B 3X1TA 5B0YC 1U35C 4YM6C 1ID3B 1TAFA 3MGRA 4XZQC 5DNMA 1P3KC 1F66D 5DNND 1EQZD 3B6GB 4WU9D 5CPIB 3REJD 2DF4C 5AVBA 1P3LC 4X23D 5C3IC 3VH5W 1M18C 3X1VD 1ZLAD 5AV6B 1B67A 1M1AC 2F2AC 2IO5B 5AV5C 5B0YB 3AZHC 3AZLD 5GXQD 5B33B 3AZMD 5BT1C 1F1EA 5CP6C 3AZND 1P3BB 1KU5A 4WU8A 3REKB 3X1SD 3WA9D 2HUEC 3LJAD 3A6ND 3C1BB 4J8VD 3A1IA 2G5IC 4YM6A 3AZIB 4H9QA 1AOIC 3KUYC 4XZQA 5AV5B 3MVDD 3AZHB 1ULYA 5B40C 4R8PD 2YFWA 4LD9C 5GT3B 5GSUB 1P3LA 1M18A 1M1AA 3O62D 5JRGC 4H9SC 5B2JB 1P3FD 3W96B 5CP6A 4Z5TA 3WAAD 1ID3D 2JCHA 4G92C 3LELB 3VH5T 3AYWD 1KX3C 1JFIB 2XD5A 3LZ0C 1AOIA 3KUYA 3C1CC 2PYOC 4E44A 3RELB 2VQRA 3IP4C 3LZ1D 5B40A 4LD9A 1P34A 3W97B 1P3ID 1BH9A 2BG1A 3REKD 1S32C 5JRGA 4H9SA 4Z2MH 3AV1B 2PYOB 5B32D 5B24D 2HIOC 1KX4C 1F66C 3V9RB 1KX3A 2CV5C 5DNNC 1EQZC 3X1UB 4J8XC 3LZ0A 3TU4B 5B2IB 3KXBC 2F8NH 2AROD 3C1CA 1P3AB 4KUDB 4J8UC 3X1VC 1ZLAC 3AFAB 4ZBJC 4JJNC 2JSSA 3UTAC 4CSRB 3AZGB 3WKJD 2BYMB 5B2JD 3W96D 5B31B 5GT0C 5GXQC 3AZMC 1R4VA 1S32A 5E5AC 3MNNB 3X1SC 4WU9B 3WA9C 5CPJB 3LJAC 3W98C 3A6NC 4ZUXC 3REJB 2Y2NA 4X23B 1A7WA 4DQYB 3X1VB 1P3PA 2HIOA 1P3OC 3MGPB 4ZBJB 1KX4A 5BNXB 1P3MC 2CV5A 5DNNA 1EQZA 3MVDC 4J8XA 4R8PC 3AZLB 2Y2JA 3AZNB 4KHAB 3KXBA 3W97D 3UTBC 4J8UA 3AZEC 3A6NB 4JJNA 3REHB 3AN2C 4J8VB 3UTAA 2NQBC 1HQ3D 5CPKD 4EO5C 4H9RA 5AV8D 5AV9C 5GT0A 5GXQA 1H3OA 3AV1D 5BO0A 3AZMA 1P3FC 1ID3C 5E5AA 1PZRA 3UT9A 1KX5A 3W98A 5JA4B 4ZUXA 3B6GC 1N1JB 4H9PB 3NQUA 5CPIC 4M6BA 3WTPA 1P3PD 1P3OA 4KUDD 1P3MA 4KGCB 4XUJD 3O62B 3H0RC 5AV6C 3MVDA 2IO5C 4UPKA 4R8PA 1P3FB 3AZGD 3WAAB 5B31D 5B33C 3UTBA 1TZYB 3AZEA 3AYWB 1P3BC 3AN2A 3REKC 4CAYB 3MNND 3KWQB 2NQBA 5CPJD 3C1BC 5AV9A 1HTAA 5BS7C 4H9OB 3AZIC 3X1TB 3F6TA 5FUGB 1ID3A 4WJ3C 3MGPD 3LZ1B 3B6GA 1M19D 4QLCD 3MGSD 5CPIA 5B1MD 5GT3C 3VH5A 5GSUC 3NQJB 1P3IB 5B1LB 3WTPE 5AY8B 5F99D 5AV6A 2RVQD 2F8ND 3REHD 4H9NB 5B0YA 1U35A 5B2JC 3W96C 5B33A 5B32B 4Z66B 5B24B 4J8WD 1P3KA 1P3BA 3LELC 1BFMA 3MGQD 3C1BA 3AZJD 5BS7A 3AZFD 2AROB 4YS3B 3AZIA 4UUZB 5AV5A 5KDMB 2Y2KA 3RELC 4KGCD 3AZHA 3W99D 3R45B 3WKJB 5GT3A 5GSUA 2Y2PA 3AV2D 3W97C 3B6FB 1TZYD 2FJ7D 3KWQD 4HGAB 3REID 5B2JA 3W96A 3AV1C 3X1TD 3EG5B 4Z5TB 3LELA 5DNMD 3X1UC 5B31G 3TU4C 5B2IC 5B0ZB 5AVBD 5B1LD 1P3AC 3RELA 4KUDC 5AY8D 1HQ3B 5CPKB 2NZDB 5AV8B 3AFAC 1BH8B 3A1KA 3AZGC 4G91B 5B31C 4Z66D 4NE3A 1B6WA 4AWLB 4WU8D 3MNNC 4WU9C 5CPJC 3REJC 3AV1A 2Y2GA 1P3PB 4YS3D 2PYOA 4X23C 4XUJB 3MGPC 4XZQD 1EQZB 3V9RA 1T3UA 3X1UA 3AZLC 3TU4A 3AZNC 5B2IA 2ZY3A 3B6FD 1P3AA 2W8SA 4KUDA 5F99C 4NFTA 3AFAA 3REHC 3EPHA 4J8VC 1M1AD 4CSRA 2BYMA 5B31A 5BT1D 5CP6D 4Z5TD 4J8WC 1F66A 1M19B 4WU9A 5CPJA 4QLCB 3MGSB 5B1MB 3AZJC 3REJA 2CWEA 4X23A 3EPJA 5BNVB 3B0DB 5B0ZD 5F99B 4WZSB 3X1VA 1AOID 3MGPA 1ZLAA 2F8NB 5BNXA 2BYKB 3AZKB 4KGCC 5AVCB 3O62C 3EPLA 2NZDD 3AZLA 4LD9D 5G49B 2JE5A 4KHAA 3WAAC 4J8WB 3AZNA 1P34D 3X1SA 3WA9A 4DRBA 3P5JB 1TZYC 3LJAA 3MGQB 3AYWC 3A6NA 3REHA 3AZJB 2FJ7C 3KWQC 4J8VA 3AZFB 1P3GB 4H9RB 3X1TC 3LZ1C 3W99B 5JA4A 2YFVB 3UT9B 1KX3D 1N1JA 4H9PA 3AV2B 5B32G 1P3IC 3LZ0D 3WTPB 2FJ7B 5B1LC 4KGCA 5AY8C 3AL0C 3O62A 1Z2CB 3REIB 1P3FA 4WNNB 2ZM5A 3WAAA 4NE5A 5B32C 1TAFB 5B24C 4Z66C 3MGRB 5DNMB 3AYWA 1S32D 4CAYA 5AVBB 2AROC 4H9OA 4YS3C 5FUGA 3LZ1A 2HIOD 3AZKD 1KX4D 5AVCD 2CV5D 3WKJC 4J8XD 1P3IA 3NQJA 5B1LA 1WWSA 3KXBD 3REKA 3B6FC 4WU8B 5AY8A 4J8UD 2RIQA 4H9NA 4HGAC 4JJND 2DQNC 3UTAD 1P3GD 1U35B 4YM6B 5B32A 4H9QB 4NE6A 5B24A 4Z66A 5GT0D 4XZQB 5CHLB 4Z5TC 1P3KB 2XD1A 5E5AD 3UT9D 1KX5D 3W98D 2YFWB 3EPKA 4ZUXD 2AROA 4YS3A 1P3LB 2FFFB 5C3IB 1M18B 5B0ZC 3WTPD 1P3OD 4UUZA 5KDMA 1M1AB 1P3MD 1HQ3C 5CPKC 3R45A 3WKJA 2NZDC 5AV8C 2Y2IA 5CP6B 4G91C 3B6FA 3MGRD 1P34C 2Y2QA 3UTBD 2HUEB 3AZED 4AWLC 2NQBD 3AN2D 2J8PA 1JFIA 4WV4B 5AV9D 1AOIB 1P3PC 2LY8A 3KUYB 2F8NK 4XUJC 5B40B 3KFUG 4LD9B 3B6GD 3W97A 3B0BA 2ZY5A 1P34B 4DRAA 5CPID 4Z2MG 5B0ZA 3H0LC 1BH9B 3B0CW 1HQ3A 5CPKA 2NZDA 5AV8A 5AV6D 5JRGB 1BH8A 5B0YD 1U35D 4YM6D 4G92B 5B33D 2F8NG 1P3KD 1P3BD 1M19C 1KX3B 4QLCC 3MGSC 5B1MC 3C1BD 1W2EA 3LZ0B 2Y2HA 1P3LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1C B;  3VH6 W;  3AZI D;  3B0D C;  4XUJ A;  1M18 D;  2RVQ C;  3KSY A;  4E45 A;  3AZK C;  5AV5 D;  5AVC C;  3AZG A;  3AZH D;  5GT3 D;  3VH6 A;  5GSU D;  1S32 B;  3MNN A;  3MGQ C;  3AZF C;  1P3G C;  3KUY D;  2HIO B;  1KX4 B;  1F66 B;  1M19 A;  3W99 C;  3LEL D;  4QLC A;  1Q9C A;  5DNN B;  3B0C T;  5B40 D;  3MGS A;  5B1M A;  2CV5 B;  3UT9 C;  4J8X B;  1KX5 C;  3AV2 C;  3KXB B;  5BNV A;  5F99 A;  3WTP C;  4J8U B;  2F8N A;  1ZLA B;  2BYK A;  3AZK A;  4JJN B;  3REL D;  5AVC A;  3UTA B;  3REI C;  5JRG D;  5G49 A;  5GXQ B;  1H3O B;  5GT0 B;  5BO0 B;  4J8W A;  3AZM B;  3MGR C;  5E5A B;  3VH6 T;  5DNM C;  3X1S B;  3MGQ A;  2L5A A;  3WA9 B;  3AZJ A;  3LJA B;  1KX5 B;  3AZF A;  3W98 B;  4ZUX B;  1WWI A;  1P3G A;  3NQU B;  5AVB C;  3C1C D;  1P3O B;  2PYO D;  1P3M B;  3W99 A;  3MVD B;  2YFV A;  4R8P B;  3AV2 A;  3X1U D;  1TZY A;  3UTB B;  3TU4 D;  3AZE B;  5B2I D;  2FJ7 A;  3KWQ A;  1P3A D;  4WU8 C;  3AN2 B;  2NQB B;  3REI A;  4EO5 B;  4WNN A;  3AFA D;  5AV9 B;  3X1T A;  5B0Y C;  1U35 C;  4YM6 C;  1ID3 B;  1TAF A;  3MGR A;  4XZQ C;  5DNM A;  1P3K C;  1F66 D;  5DNN D;  1EQZ D;  3B6G B;  4WU9 D;  5CPI B;  3REJ D;  5AVB A;  1P3L C;  4X23 D;  5C3I C;  3VH5 W;  1M18 C;  3X1V D;  1ZLA D;  5AV6 B;  1B67 A;  1M1A C;  2IO5 B;  5AV5 C;  5B0Y B;  3AZH C;  3AZL D;  5GXQ D;  5B33 B;  3AZM D;  5BT1 C;  1F1E A;  5CP6 C;  3AZN D;  1P3B B;  1KU5 A;  4WU8 A;  3REK B;  3X1S D;  3WA9 D;  2HUE C;  3LJA D;  3A6N D;  3C1B B;  4J8V D;  4YM6 A;  3AZI B;  4H9Q A;  1AOI C;  3KUY C;  4XZQ A;  5AV5 B;  3MVD D;  3AZH B;  1ULY A;  5B40 C;  4R8P D;  2YFW A;  4LD9 C;  5GT3 B;  5GSU B;  1P3L A;  1M18 A;  1M1A A;  3O62 D;  5JRG C;  4H9S C;  5B2J B;  1P3F D;  3W96 B;  5CP6 A;  4Z5T A;  3WAA D;  1ID3 D;  4G92 C;  3LEL B;  3VH5 T;  3AYW D;  1KX3 C;  1JFI B;  3LZ0 C;  1AOI A;  3KUY A;  3C1C C;  2PYO C;  4E44 A;  3REL B;  3LZ1 D;  5B40 A;  4LD9 A;  1P34 A;  3W97 B;  1P3I D;  1BH9 A;  1S32 C;  3REK D;  5JRG A;  4H9S A;  4Z2M H;  3AV1 B;  2PYO B;  5B32 D;  5B24 D;  2HIO C;  1KX4 C;  1F66 C;  3V9R B;  1KX3 A;  2CV5 C;  5DNN C;  1EQZ C;  3X1U B;  4J8X C;  3LZ0 A;  3TU4 B;  5B2I B;  3KXB C;  2F8N H;  2ARO D;  3C1C A;  1P3A B;  4KUD B;  4J8U C;  3X1V C;  1ZLA C;  3AFA B;  4ZBJ C;  4JJN C;  2JSS A;  3UTA C;  4CSR B;  3AZG B;  3WKJ D;  2BYM B;  5B2J D;  3W96 D;  5B31 B;  5GT0 C;  5GXQ C;  3AZM C;  1R4V A;  1S32 A;  5E5A C;  3MNN B;  3X1S C;  4WU9 B;  3WA9 C;  5CPJ B;  3LJA C;  3W98 C;  3A6N C;  4ZUX C;  3REJ B;  4X23 B;  1A7W A;  3X1V B;  2HIO A;  1P3O C;  3MGP B;  4ZBJ B;  1KX4 A;  5BNX B;  1P3M C;  2CV5 A;  5DNN A;  1EQZ A;  3MVD C;  4J8X A;  4R8P C;  3AZL B;  3AZN B;  4KHA B;  3KXB A;  3W97 D;  3UTB C;  4J8U A;  3AZE C;  3A6N B;  4JJN A;  3REH B;  3AN2 C;  4J8V B;  3UTA A;  2NQB C;  1HQ3 D;  5CPK D;  4EO5 C;  4H9R A;  5AV8 D;  5AV9 C;  5GT0 A;  5GXQ A;  1H3O A;  3AV1 D;  5BO0 A;  3AZM A;  1P3F C;  1ID3 C;  5E5A A;  3UT9 A;  1KX5 A;  3W98 A;  5JA4 B;  4ZUX A;  3B6G C;  1N1J B;  4H9P B;  3NQU A;  5CPI C;  4M6B A;  3WTP A;  1P3P D;  1P3O A;  4KUD D;  1P3M A;  4KGC B;  4XUJ D;  3O62 B;  3MVD A;  5AV6 C;  2IO5 C;  4R8P A;  1P3F B;  3AZG D;  3WAA B;  5B31 D;  5B33 C;  3UTB A;  1TZY B;  3AZE A;  3AYW B;  1P3B C;  3AN2 A;  3REK C;  4CAY B;  3MNN D;  3KWQ B;  2NQB A;  5CPJ D;  3C1B C;  5AV9 A;  1HTA A;  5BS7 C;  4H9O B;  3AZI C;  3X1T B;  5FUG B;  1ID3 A;  3MGP D;  3LZ1 B;  3B6G A;  1M19 D;  4QLC D;  3MGS D;  5CPI A;  5B1M D;  5GT3 C;  3VH5 A;  5GSU C;  3NQJ B;  1P3I B;  5B1L B;  3WTP E;  5AY8 B;  5F99 D;  5AV6 A;  2RVQ D;  2F8N D;  3REH D;  4H9N B;  5B0Y A;  1U35 A;  5B2J C;  3W96 C;  5B33 A;  5B32 B;  4Z66 B;  5B24 B;  4J8W D;  1P3K A;  1P3B A;  3LEL C;  1BFM A;  3MGQ D;  3C1B A;  3AZJ D;  5BS7 A;  3AZF D;  2ARO B;  4YS3 B;  3AZI A;  4UUZ B;  5AV5 A;  5KDM B;  3REL C;  4KGC D;  3AZH A;  3W99 D;  3R45 B;  3WKJ B;  5GT3 A;  5GSU A;  3AV2 D;  3W97 C;  3B6F B;  1TZY D;  2FJ7 D;  3KWQ D;  4HGA B;  3REI D;  5B2J A;  3W96 A;  3AV1 C;  3X1T D;  4Z5T B;  3LEL A;  5DNM D;  3X1U C;  5B31 G;  3TU4 C;  5B2I C;  5B0Z B;  5AVB D;  5B1L D;  1P3A C;  3REL A;  4KUD C;  5AY8 D;  1HQ3 B;  5CPK B;  2NZD B;  5AV8 B;  3AFA C;  1BH8 B;  3AZG C;  4G91 B;  5B31 C;  4Z66 D;  4NE3 A;  1B6W A;  4AWL B;  4WU8 D;  3MNN C;  4WU9 C;  5CPJ C;  3REJ C;  3AV1 A;  1P3P B;  4YS3 D;  2PYO A;  4X23 C;  4XUJ B;  3MGP C;  4XZQ D;  1EQZ B;  3V9R A;  3X1U A;  3AZL C;  3TU4 A;  3AZN C;  5B2I A;  3B6F D;  1P3A A;  4KUD A;  5F99 C;  4NFT A;  3AFA A;  3REH C;  4J8V C;  1M1A D;  4CSR A;  2BYM A;  5B31 A;  5BT1 D;  5CP6 D;  4Z5T D;  4J8W C;  1F66 A;  1M19 B;  4WU9 A;  5CPJ A;  4QLC B;  3MGS B;  5B1M B;  3AZJ C;  3REJ A;  2CWE A;  4X23 A;  5BNV B;  3B0D B;  5B0Z D;  5F99 B;  4WZS B;  3X1V A;  1AOI D;  3MGP A;  1ZLA A;  2F8N B;  5BNX A;  2BYK B;  3AZK B;  4KGC C;  5AVC B;  3O62 C;  2NZD D;  3AZL A;  4LD9 D;  5G49 B;  3WAA C;  4KHA A;  4J8W B;  3AZN A;  1P34 D;  3X1S A;  3WA9 A;  4DRB A;  1TZY C;  3LJA A;  3MGQ B;  3AYW C;  3A6N A;  3REH A;  3AZJ B;  2FJ7 C;  3KWQ C;  4J8V A;  3AZF B;  1P3G B;  4H9R B;  3X1T C;  3LZ1 C;  3W99 B;  5JA4 A;  2YFV B;  3UT9 B;  1KX3 D;  1N1J A;  4H9P A;  3AV2 B;  5B32 G;  1P3I C;  3LZ0 D;  3WTP B;  2FJ7 B;  5B1L C;  4KGC A;  5AY8 C;  3O62 A;  3REI B;  1P3F A;  4WNN B;  3WAA A;  4NE5 A;  5B32 C;  1TAF B;  5B24 C;  4Z66 C;  3MGR B;  5DNM B;  3AYW A;  1S32 D;  4CAY A;  5AVB B;  2ARO C;  4H9O A;  4YS3 C;  5FUG A;  3LZ1 A;  2HIO D;  3AZK D;  1KX4 D;  5AVC D;  2CV5 D;  3WKJ C;  4J8X D;  1P3I A;  3NQJ A;  5B1L A;  1WWS A;  3KXB D;  3REK A;  3B6F C;  4WU8 B;  5AY8 A;  4J8U D;  4H9N A;  4HGA C;  4JJN D;  3UTA D;  1P3G D;  1U35 B;  4YM6 B;  5B32 A;  4H9Q B;  4NE6 A;  5B24 A;  4Z66 A;  5GT0 D;  4XZQ B;  5CHL B;  4Z5T C;  1P3K B;  5E5A D;  3UT9 D;  1KX5 D;  3W98 D;  2YFW B;  4ZUX D;  2ARO A;  4YS3 A;  1P3L B;  5C3I B;  1M18 B;  5B0Z C;  3WTP D;  1P3O D;  4UUZ A;  5KDM A;  1M1A B;  1P3M D;  1HQ3 C;  5CPK C;  3R45 A;  3WKJ A;  2NZD C;  5AV8 C;  5CP6 B;  4G91 C;  3B6F A;  3MGR D;  1P34 C;  3UTB D;  2HUE B;  3AZE D;  4AWL C;  2NQB D;  3AN2 D;  1JFI A;  4WV4 B;  5AV9 D;  1AOI B;  1P3P C;  2LY8 A;  3KUY B;  2F8N K;  4XUJ C;  5B40 B;  4LD9 B;  3B6G D;  3W97 A;  3B0B A;  1P34 B;  4DRA A;  5CPI D;  4Z2M G;  5B0Z A;  1BH9 B;  3B0C W;  1HQ3 A;  5CPK A;  2NZD A;  5AV8 A;  5AV6 D;  5JRG B;  1BH8 A;  5B0Y D;  1U35 D;  4YM6 D;  4G92 B;  5B33 D;  2F8N G;  1P3K D;  1P3B D;  1M19 C;  1KX3 B;  4QLC C;  3MGS C;  5B1M C;  3C1B D;  3LZ0 B;  1P3P A;  1P3L D; 
#chains in the Genus database with same CATH topology
 3C1C B;  3VH6 W;  3AZI D;  3B0D C;  4XUJ A;  1M18 D;  2RVQ C;  2Y2O A;  3KSY A;  2ZY4 A;  4E45 A;  3AZK C;  5AV5 D;  5AVC C;  3AZG A;  3AZH D;  3H0M C;  5GT3 D;  3VH6 A;  5GSU D;  1S32 B;  3MNN A;  3MGQ C;  2ZY2 A;  3AZF C;  1P3G C;  3KUY D;  2HIO B;  1KX4 B;  1F66 B;  1M19 A;  3W99 C;  3LEL D;  4QLC A;  1Q9C A;  5DNN B;  3B0C T;  5B40 D;  3MGS A;  5B1M A;  2CV5 B;  3UT9 C;  4J8X B;  1KX5 C;  3AV2 C;  3KXB B;  5BNV A;  5F99 A;  2G5H C;  3WTP C;  4J8U B;  1ZLA B;  2F8N A;  2Y2M A;  2BYK A;  3AZK A;  4JJN B;  3REL D;  5AVC A;  3UTA B;  3REI C;  5JRG D;  5G49 A;  5GXQ B;  1H3O B;  5GT0 B;  5BO0 B;  4J8W A;  3AZM B;  3MGR C;  5E5A B;  3VH6 T;  5DNM C;  3X1S B;  3MGQ A;  2L5A A;  3WA9 B;  3AZJ A;  3LJA B;  1KX5 B;  3AZF A;  3W98 B;  4ZUX B;  1WWI A;  2UWX A;  1P3G A;  3NQU B;  5AVB C;  3C1C D;  1P3O B;  2PYO D;  1P3M B;  3W99 A;  3MVD B;  2YFV A;  4R8P B;  2Y2L A;  3AV2 A;  3X1U D;  1TZY A;  3UTB B;  3TU4 D;  3AZE B;  5B2I D;  2FJ7 A;  3FDD A;  3KWQ A;  1P3A D;  4WU8 C;  3AN2 B;  2NQB B;  3REI A;  4EO5 B;  4WNN A;  3AFA D;  5AV9 B;  3X1T A;  5B0Y C;  1U35 C;  4YM6 C;  1ID3 B;  1TAF A;  3MGR A;  4XZQ C;  5DNM A;  1P3K C;  1F66 D;  5DNN D;  1EQZ D;  3B6G B;  4WU9 D;  5CPI B;  3REJ D;  2DF4 C;  5AVB A;  1P3L C;  4X23 D;  5C3I C;  3VH5 W;  1M18 C;  3X1V D;  1ZLA D;  5AV6 B;  1B67 A;  1M1A C;  2F2A C;  2IO5 B;  5AV5 C;  5B0Y B;  3AZH C;  3AZL D;  5GXQ D;  5B33 B;  3AZM D;  5BT1 C;  1F1E A;  5CP6 C;  3AZN D;  1P3B B;  1KU5 A;  4WU8 A;  3REK B;  3X1S D;  3WA9 D;  2HUE C;  3LJA D;  3A6N D;  3C1B B;  4J8V D;  3A1I A;  2G5I C;  4YM6 A;  3AZI B;  4H9Q A;  1AOI C;  3KUY C;  4XZQ A;  5AV5 B;  3MVD D;  3AZH B;  1ULY A;  5B40 C;  4R8P D;  2YFW A;  4LD9 C;  5GT3 B;  5GSU B;  1P3L A;  1M18 A;  1M1A A;  3O62 D;  5JRG C;  4H9S C;  5B2J B;  1P3F D;  3W96 B;  5CP6 A;  4Z5T A;  3WAA D;  1ID3 D;  2JCH A;  4G92 C;  3LEL B;  3VH5 T;  3AYW D;  1KX3 C;  1JFI B;  2XD5 A;  3LZ0 C;  1AOI A;  3KUY A;  3C1C C;  2PYO C;  4E44 A;  3REL B;  2VQR A;  3IP4 C;  3LZ1 D;  5B40 A;  4LD9 A;  1P34 A;  3W97 B;  1P3I D;  1BH9 A;  2BG1 A;  3REK D;  1S32 C;  5JRG A;  4H9S A;  4Z2M H;  3AV1 B;  2PYO B;  5B32 D;  5B24 D;  2HIO C;  1KX4 C;  1F66 C;  3V9R B;  1KX3 A;  2CV5 C;  5DNN C;  1EQZ C;  3X1U B;  4J8X C;  3LZ0 A;  3TU4 B;  5B2I B;  3KXB C;  2F8N H;  2ARO D;  3C1C A;  1P3A B;  4KUD B;  4J8U C;  3X1V C;  1ZLA C;  3AFA B;  4ZBJ C;  4JJN C;  2JSS A;  3UTA C;  4CSR B;  3AZG B;  3WKJ D;  2BYM B;  5B2J D;  3W96 D;  5B31 B;  5GT0 C;  5GXQ C;  3AZM C;  1R4V A;  1S32 A;  5E5A C;  3MNN B;  3X1S C;  4WU9 B;  3WA9 C;  5CPJ B;  3LJA C;  3W98 C;  3A6N C;  4ZUX C;  3REJ B;  2Y2N A;  4X23 B;  1A7W A;  4DQY B;  3X1V B;  1P3P A;  2HIO A;  1P3O C;  3MGP B;  4ZBJ B;  1KX4 A;  5BNX B;  1P3M C;  2CV5 A;  5DNN A;  1EQZ A;  3MVD C;  4J8X A;  4R8P C;  3AZL B;  2Y2J A;  3AZN B;  4KHA B;  3KXB A;  3W97 D;  3UTB C;  4J8U A;  3AZE C;  3A6N B;  4JJN A;  3REH B;  3AN2 C;  4J8V B;  3UTA A;  2NQB C;  1HQ3 D;  5CPK D;  4EO5 C;  4H9R A;  5AV8 D;  5AV9 C;  5GT0 A;  5GXQ A;  1H3O A;  3AV1 D;  5BO0 A;  3AZM A;  1P3F C;  1ID3 C;  5E5A A;  1PZR A;  3UT9 A;  1KX5 A;  3W98 A;  5JA4 B;  4ZUX A;  3B6G C;  1N1J B;  4H9P B;  3NQU A;  5CPI C;  4M6B A;  3WTP A;  1P3P D;  1P3O A;  4KUD D;  1P3M A;  4KGC B;  4XUJ D;  3O62 B;  3H0R C;  5AV6 C;  3MVD A;  2IO5 C;  4UPK A;  4R8P A;  1P3F B;  3AZG D;  3WAA B;  5B31 D;  5B33 C;  3UTB A;  1TZY B;  3AZE A;  3AYW B;  1P3B C;  3AN2 A;  3REK C;  4CAY B;  3MNN D;  3KWQ B;  2NQB A;  5CPJ D;  3C1B C;  5AV9 A;  1HTA A;  5BS7 C;  4H9O B;  3AZI C;  3X1T B;  3F6T A;  5FUG B;  1ID3 A;  4WJ3 C;  3MGP D;  3LZ1 B;  3B6G A;  1M19 D;  4QLC D;  3MGS D;  5CPI A;  5B1M D;  5GT3 C;  3VH5 A;  5GSU C;  3NQJ B;  1P3I B;  5B1L B;  3WTP E;  5AY8 B;  5F99 D;  5AV6 A;  2RVQ D;  2F8N D;  3REH D;  4H9N B;  5B0Y A;  1U35 A;  5B2J C;  3W96 C;  5B33 A;  5B32 B;  4Z66 B;  5B24 B;  4J8W D;  1P3K A;  1P3B A;  3LEL C;  1BFM A;  3MGQ D;  3C1B A;  3AZJ D;  5BS7 A;  3AZF D;  2ARO B;  4YS3 B;  3AZI A;  4UUZ B;  5AV5 A;  5KDM B;  2Y2K A;  3REL C;  4KGC D;  3AZH A;  3W99 D;  3R45 B;  3WKJ B;  5GT3 A;  5GSU A;  2Y2P A;  3AV2 D;  3W97 C;  3B6F B;  1TZY D;  2FJ7 D;  3KWQ D;  4HGA B;  3REI D;  5B2J A;  3W96 A;  3AV1 C;  3X1T D;  3EG5 B;  4Z5T B;  3LEL A;  5DNM D;  3X1U C;  5B31 G;  3TU4 C;  5B2I C;  5B0Z B;  5AVB D;  5B1L D;  1P3A C;  3REL A;  4KUD C;  5AY8 D;  1HQ3 B;  5CPK B;  2NZD B;  5AV8 B;  3AFA C;  1BH8 B;  3A1K A;  3AZG C;  4G91 B;  5B31 C;  4Z66 D;  4NE3 A;  1B6W A;  4AWL B;  4WU8 D;  3MNN C;  4WU9 C;  5CPJ C;  3REJ C;  3AV1 A;  2Y2G A;  1P3P B;  4YS3 D;  2PYO A;  4X23 C;  4XUJ B;  3MGP C;  4XZQ D;  1EQZ B;  3V9R A;  1T3U A;  3X1U A;  3AZL C;  3TU4 A;  3AZN C;  5B2I A;  2ZY3 A;  3B6F D;  1P3A A;  2W8S A;  4KUD A;  5F99 C;  4NFT A;  3AFA A;  3REH C;  3EPH A;  4J8V C;  1M1A D;  4CSR A;  2BYM A;  5B31 A;  5BT1 D;  5CP6 D;  4Z5T D;  4J8W C;  1F66 A;  1M19 B;  4WU9 A;  5CPJ A;  4QLC B;  3MGS B;  5B1M B;  3AZJ C;  3REJ A;  2CWE A;  4X23 A;  3EPJ A;  5BNV B;  3B0D B;  5B0Z D;  5F99 B;  4WZS B;  3X1V A;  1AOI D;  3MGP A;  1ZLA A;  2F8N B;  5BNX A;  2BYK B;  3AZK B;  4KGC C;  5AVC B;  3O62 C;  3EPL A;  2NZD D;  3AZL A;  4LD9 D;  5G49 B;  2JE5 A;  4KHA A;  3WAA C;  4J8W B;  3AZN A;  1P34 D;  3X1S A;  3WA9 A;  4DRB A;  3P5J B;  1TZY C;  3LJA A;  3MGQ B;  3AYW C;  3A6N A;  3REH A;  3AZJ B;  2FJ7 C;  3KWQ C;  4J8V A;  3AZF B;  1P3G B;  4H9R B;  3X1T C;  3LZ1 C;  3W99 B;  5JA4 A;  2YFV B;  3UT9 B;  1KX3 D;  1N1J A;  4H9P A;  3AV2 B;  5B32 G;  1P3I C;  3LZ0 D;  3WTP B;  2FJ7 B;  5B1L C;  4KGC A;  5AY8 C;  3AL0 C;  3O62 A;  1Z2C B;  3REI B;  1P3F A;  4WNN B;  2ZM5 A;  3WAA A;  4NE5 A;  5B32 C;  1TAF B;  5B24 C;  4Z66 C;  3MGR B;  5DNM B;  3AYW A;  1S32 D;  4CAY A;  5AVB B;  2ARO C;  4H9O A;  4YS3 C;  5FUG A;  3LZ1 A;  2HIO D;  3AZK D;  1KX4 D;  5AVC D;  2CV5 D;  3WKJ C;  4J8X D;  1P3I A;  3NQJ A;  5B1L A;  1WWS A;  3KXB D;  3REK A;  3B6F C;  4WU8 B;  5AY8 A;  4J8U D;  2RIQ A;  4H9N A;  4HGA C;  4JJN D;  2DQN C;  3UTA D;  1P3G D;  1U35 B;  4YM6 B;  5B32 A;  4H9Q B;  4NE6 A;  5B24 A;  4Z66 A;  5GT0 D;  4XZQ B;  5CHL B;  4Z5T C;  1P3K B;  2XD1 A;  5E5A D;  3UT9 D;  1KX5 D;  3W98 D;  2YFW B;  3EPK A;  4ZUX D;  2ARO A;  4YS3 A;  1P3L B;  2FFF B;  5C3I B;  1M18 B;  5B0Z C;  3WTP D;  1P3O D;  4UUZ A;  5KDM A;  1M1A B;  1P3M D;  1HQ3 C;  5CPK C;  3R45 A;  3WKJ A;  2NZD C;  5AV8 C;  2Y2I A;  5CP6 B;  4G91 C;  3B6F A;  3MGR D;  1P34 C;  2Y2Q A;  3UTB D;  2HUE B;  3AZE D;  4AWL C;  2NQB D;  3AN2 D;  2J8P A;  1JFI A;  4WV4 B;  5AV9 D;  1AOI B;  1P3P C;  2LY8 A;  3KUY B;  2F8N K;  4XUJ C;  5B40 B;  3KFU G;  4LD9 B;  3B6G D;  3W97 A;  3B0B A;  2ZY5 A;  1P34 B;  4DRA A;  5CPI D;  4Z2M G;  5B0Z A;  3H0L C;  1BH9 B;  3B0C W;  1HQ3 A;  5CPK A;  2NZD A;  5AV8 A;  5AV6 D;  5JRG B;  1BH8 A;  5B0Y D;  1U35 D;  4YM6 D;  4G92 B;  5B33 D;  2F8N G;  1P3K D;  1P3B D;  1M19 C;  1KX3 B;  4QLC C;  3MGS C;  5B1M C;  3C1B D;  1W2E A;  3LZ0 B;  2Y2H A;  1P3L D; 
#chains in the Genus database with same CATH homology
 3C1C B;  3VH6 W;  3AZI D;  3B0D C;  4XUJ A;  1M18 D;  2RVQ C;  2Y2O A;  3KSY A;  2ZY4 A;  4E45 A;  3AZK C;  5AV5 D;  5AVC C;  3AZG A;  3AZH D;  3H0M C;  5GT3 D;  3VH6 A;  5GSU D;  1S32 B;  3MNN A;  3MGQ C;  2ZY2 A;  3AZF C;  1P3G C;  3KUY D;  2HIO B;  1KX4 B;  1F66 B;  1M19 A;  3W99 C;  3LEL D;  4QLC A;  1Q9C A;  5DNN B;  3B0C T;  5B40 D;  3MGS A;  5B1M A;  2CV5 B;  3UT9 C;  4J8X B;  1KX5 C;  3AV2 C;  3KXB B;  5BNV A;  5F99 A;  2G5H C;  3WTP C;  4J8U B;  1ZLA B;  2F8N A;  2Y2M A;  2BYK A;  3AZK A;  4JJN B;  3REL D;  5AVC A;  3UTA B;  3REI C;  5JRG D;  5G49 A;  5GXQ B;  1H3O B;  5GT0 B;  5BO0 B;  4J8W A;  3AZM B;  3MGR C;  5E5A B;  3VH6 T;  5DNM C;  3X1S B;  3MGQ A;  2L5A A;  3WA9 B;  3AZJ A;  3LJA B;  1KX5 B;  3AZF A;  3W98 B;  4ZUX B;  1WWI A;  2UWX A;  1P3G A;  3NQU B;  5AVB C;  3C1C D;  1P3O B;  2PYO D;  1P3M B;  3W99 A;  3MVD B;  2YFV A;  4R8P B;  2Y2L A;  3AV2 A;  3X1U D;  1TZY A;  3UTB B;  3TU4 D;  3AZE B;  5B2I D;  2FJ7 A;  3FDD A;  3KWQ A;  1P3A D;  4WU8 C;  3AN2 B;  2NQB B;  3REI A;  4EO5 B;  4WNN A;  3AFA D;  5AV9 B;  3X1T A;  5B0Y C;  1U35 C;  4YM6 C;  1ID3 B;  1TAF A;  3MGR A;  4XZQ C;  5DNM A;  1P3K C;  1F66 D;  5DNN D;  1EQZ D;  3B6G B;  4WU9 D;  5CPI B;  3REJ D;  2DF4 C;  5AVB A;  1P3L C;  4X23 D;  5C3I C;  3VH5 W;  1M18 C;  3X1V D;  1ZLA D;  5AV6 B;  1B67 A;  1M1A C;  2F2A C;  2IO5 B;  5AV5 C;  5B0Y B;  3AZH C;  3AZL D;  5GXQ D;  5B33 B;  3AZM D;  5BT1 C;  1F1E A;  5CP6 C;  3AZN D;  1P3B B;  1KU5 A;  4WU8 A;  3REK B;  3X1S D;  3WA9 D;  2HUE C;  3LJA D;  3A6N D;  3C1B B;  4J8V D;  3A1I A;  2G5I C;  4YM6 A;  3AZI B;  4H9Q A;  1AOI C;  3KUY C;  4XZQ A;  5AV5 B;  3MVD D;  3AZH B;  1ULY A;  5B40 C;  4R8P D;  2YFW A;  4LD9 C;  5GT3 B;  5GSU B;  1P3L A;  1M18 A;  1M1A A;  3O62 D;  5JRG C;  4H9S C;  5B2J B;  1P3F D;  3W96 B;  5CP6 A;  4Z5T A;  3WAA D;  1ID3 D;  2JCH A;  4G92 C;  3LEL B;  3VH5 T;  3AYW D;  1KX3 C;  1JFI B;  2XD5 A;  3LZ0 C;  1AOI A;  3KUY A;  3C1C C;  2PYO C;  4E44 A;  3REL B;  2VQR A;  3IP4 C;  3LZ1 D;  5B40 A;  4LD9 A;  1P34 A;  3W97 B;  1P3I D;  1BH9 A;  2BG1 A;  3REK D;  1S32 C;  5JRG A;  4H9S A;  4Z2M H;  3AV1 B;  2PYO B;  5B32 D;  5B24 D;  2HIO C;  1KX4 C;  1F66 C;  3V9R B;  1KX3 A;  2CV5 C;  5DNN C;  1EQZ C;  3X1U B;  4J8X C;  3LZ0 A;  3TU4 B;  5B2I B;  3KXB C;  2F8N H;  2ARO D;  3C1C A;  1P3A B;  4KUD B;  4J8U C;  3X1V C;  1ZLA C;  3AFA B;  4ZBJ C;  4JJN C;  2JSS A;  3UTA C;  4CSR B;  3AZG B;  3WKJ D;  2BYM B;  5B2J D;  3W96 D;  5B31 B;  5GT0 C;  5GXQ C;  3AZM C;  1R4V A;  1S32 A;  5E5A C;  3MNN B;  3X1S C;  4WU9 B;  3WA9 C;  5CPJ B;  3LJA C;  3W98 C;  3A6N C;  4ZUX C;  3REJ B;  2Y2N A;  4X23 B;  1A7W A;  4DQY B;  3X1V B;  1P3P A;  2HIO A;  1P3O C;  3MGP B;  4ZBJ B;  1KX4 A;  5BNX B;  1P3M C;  2CV5 A;  5DNN A;  1EQZ A;  3MVD C;  4J8X A;  4R8P C;  3AZL B;  2Y2J A;  3AZN B;  4KHA B;  3KXB A;  3W97 D;  3UTB C;  4J8U A;  3AZE C;  3A6N B;  4JJN A;  3REH B;  3AN2 C;  4J8V B;  3UTA A;  2NQB C;  1HQ3 D;  5CPK D;  4EO5 C;  4H9R A;  5AV8 D;  5AV9 C;  5GT0 A;  5GXQ A;  1H3O A;  3AV1 D;  5BO0 A;  3AZM A;  1P3F C;  1ID3 C;  5E5A A;  1PZR A;  3UT9 A;  1KX5 A;  3W98 A;  5JA4 B;  4ZUX A;  3B6G C;  1N1J B;  4H9P B;  3NQU A;  5CPI C;  4M6B A;  3WTP A;  1P3P D;  1P3O A;  4KUD D;  1P3M A;  4KGC B;  4XUJ D;  3O62 B;  3H0R C;  5AV6 C;  3MVD A;  2IO5 C;  4UPK A;  4R8P A;  1P3F B;  3AZG D;  3WAA B;  5B31 D;  5B33 C;  3UTB A;  1TZY B;  3AZE A;  3AYW B;  1P3B C;  3AN2 A;  3REK C;  4CAY B;  3MNN D;  3KWQ B;  2NQB A;  5CPJ D;  3C1B C;  5AV9 A;  1HTA A;  5BS7 C;  4H9O B;  3AZI C;  3X1T B;  3F6T A;  5FUG B;  1ID3 A;  4WJ3 C;  3MGP D;  3LZ1 B;  3B6G A;  1M19 D;  4QLC D;  3MGS D;  5CPI A;  5B1M D;  5GT3 C;  3VH5 A;  5GSU C;  3NQJ B;  1P3I B;  5B1L B;  3WTP E;  5AY8 B;  5F99 D;  5AV6 A;  2RVQ D;  2F8N D;  3REH D;  4H9N B;  5B0Y A;  1U35 A;  5B2J C;  3W96 C;  5B33 A;  5B32 B;  4Z66 B;  5B24 B;  4J8W D;  1P3K A;  1P3B A;  3LEL C;  1BFM A;  3MGQ D;  3C1B A;  3AZJ D;  5BS7 A;  3AZF D;  2ARO B;  4YS3 B;  3AZI A;  4UUZ B;  5AV5 A;  5KDM B;  2Y2K A;  3REL C;  4KGC D;  3AZH A;  3W99 D;  3R45 B;  3WKJ B;  5GT3 A;  5GSU A;  2Y2P A;  3AV2 D;  3W97 C;  3B6F B;  1TZY D;  2FJ7 D;  3KWQ D;  4HGA B;  3REI D;  5B2J A;  3W96 A;  3AV1 C;  3X1T D;  3EG5 B;  4Z5T B;  3LEL A;  5DNM D;  3X1U C;  5B31 G;  3TU4 C;  5B2I C;  5B0Z B;  5AVB D;  5B1L D;  1P3A C;  3REL A;  4KUD C;  5AY8 D;  1HQ3 B;  5CPK B;  2NZD B;  5AV8 B;  3AFA C;  1BH8 B;  3A1K A;  3AZG C;  4G91 B;  5B31 C;  4Z66 D;  4NE3 A;  1B6W A;  4AWL B;  4WU8 D;  3MNN C;  4WU9 C;  5CPJ C;  3REJ C;  3AV1 A;  2Y2G A;  1P3P B;  4YS3 D;  2PYO A;  4X23 C;  4XUJ B;  3MGP C;  4XZQ D;  1EQZ B;  3V9R A;  1T3U A;  3X1U A;  3AZL C;  3TU4 A;  3AZN C;  5B2I A;  2ZY3 A;  3B6F D;  1P3A A;  2W8S A;  4KUD A;  5F99 C;  4NFT A;  3AFA A;  3REH C;  3EPH A;  4J8V C;  1M1A D;  4CSR A;  2BYM A;  5B31 A;  5BT1 D;  5CP6 D;  4Z5T D;  4J8W C;  1F66 A;  1M19 B;  4WU9 A;  5CPJ A;  4QLC B;  3MGS B;  5B1M B;  3AZJ C;  3REJ A;  2CWE A;  4X23 A;  3EPJ A;  5BNV B;  3B0D B;  5B0Z D;  5F99 B;  4WZS B;  3X1V A;  1AOI D;  3MGP A;  1ZLA A;  2F8N B;  5BNX A;  2BYK B;  3AZK B;  4KGC C;  5AVC B;  3O62 C;  3EPL A;  2NZD D;  3AZL A;  4LD9 D;  5G49 B;  2JE5 A;  4KHA A;  3WAA C;  4J8W B;  3AZN A;  1P34 D;  3X1S A;  3WA9 A;  4DRB A;  3P5J B;  1TZY C;  3LJA A;  3MGQ B;  3AYW C;  3A6N A;  3REH A;  3AZJ B;  2FJ7 C;  3KWQ C;  4J8V A;  3AZF B;  1P3G B;  4H9R B;  3X1T C;  3LZ1 C;  3W99 B;  5JA4 A;  2YFV B;  3UT9 B;  1KX3 D;  1N1J A;  4H9P A;  3AV2 B;  5B32 G;  1P3I C;  3LZ0 D;  3WTP B;  2FJ7 B;  5B1L C;  4KGC A;  5AY8 C;  3AL0 C;  3O62 A;  1Z2C B;  3REI B;  1P3F A;  4WNN B;  2ZM5 A;  3WAA A;  4NE5 A;  5B32 C;  1TAF B;  5B24 C;  4Z66 C;  3MGR B;  5DNM B;  3AYW A;  1S32 D;  4CAY A;  5AVB B;  2ARO C;  4H9O A;  4YS3 C;  5FUG A;  3LZ1 A;  2HIO D;  3AZK D;  1KX4 D;  5AVC D;  2CV5 D;  3WKJ C;  4J8X D;  1P3I A;  3NQJ A;  5B1L A;  1WWS A;  3KXB D;  3REK A;  3B6F C;  4WU8 B;  5AY8 A;  4J8U D;  2RIQ A;  4H9N A;  4HGA C;  4JJN D;  2DQN C;  3UTA D;  1P3G D;  1U35 B;  4YM6 B;  5B32 A;  4H9Q B;  4NE6 A;  5B24 A;  4Z66 A;  5GT0 D;  4XZQ B;  5CHL B;  4Z5T C;  1P3K B;  2XD1 A;  5E5A D;  3UT9 D;  1KX5 D;  3W98 D;  2YFW B;  3EPK A;  4ZUX D;  2ARO A;  4YS3 A;  1P3L B;  2FFF B;  5C3I B;  1M18 B;  5B0Z C;  3WTP D;  1P3O D;  4UUZ A;  5KDM A;  1M1A B;  1P3M D;  1HQ3 C;  5CPK C;  3R45 A;  3WKJ A;  2NZD C;  5AV8 C;  2Y2I A;  5CP6 B;  4G91 C;  3B6F A;  3MGR D;  1P34 C;  2Y2Q A;  3UTB D;  2HUE B;  3AZE D;  4AWL C;  2NQB D;  3AN2 D;  2J8P A;  1JFI A;  4WV4 B;  5AV9 D;  1AOI B;  1P3P C;  2LY8 A;  3KUY B;  2F8N K;  4XUJ C;  5B40 B;  3KFU G;  4LD9 B;  3B6G D;  3W97 A;  3B0B A;  2ZY5 A;  1P34 B;  4DRA A;  5CPI D;  4Z2M G;  5B0Z A;  3H0L C;  1BH9 B;  3B0C W;  1HQ3 A;  5CPK A;  2NZD A;  5AV8 A;  5AV6 D;  5JRG B;  1BH8 A;  5B0Y D;  1U35 D;  4YM6 D;  4G92 B;  5B33 D;  2F8N G;  1P3K D;  1P3B D;  1M19 C;  1KX3 B;  4QLC C;  3MGS C;  5B1M C;  3C1B D;  1W2E A;  3LZ0 B;  2Y2H A;  1P3L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...