2LY8A

The budding yeast chaperone scm3 recognizes the partially unfolded dimer of the centromere-specific cse4/h4 histone variant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
121
structure length
121
Chain Sequence
LISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHLVPRGSKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Budding yeast chaperone Scm3
publication title Identification of Functionally Conserved Regions in the Structure of the Chaperone/CenH3/H4 Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 34
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2ly8A00
5BS7C 2AROD 3AZJB 1P3IC 3VH5T 4H9RA 4ZUXA 1P3AB 3MGSD 4X23A 2CWEA 5CPIB 2BYKA 4KUDD 4Z5TB 1AOIA 4HGAC 1KX3C 3AZHB 3MGPC 5DNMD 3RELC 3X1SD 3LELD 3W97B 2BYKB 4WV4B 3AZJC 3REHB 4QLCB 5AVCA 3O62D 5GXQA 5GT3A 2CV5D 3W98B 5B24C 5CPIC 5B40D 1B6WA 4Z5TC 3MVDA 4DRBA 3V9RA 3MGRB 3A6ND 4ZUXC 4J8UA 3X1UD 5BT1C 4X23C 5AVCB 5JRGD 3AV2B 3AZED 3NQJB 1AOIC 1P3KB 1HQ3D 4QLCC 1P34D 3W96D 2FJ7A 4WU8B 5F99A 1EQZA 3REID 4ZBJB 3AV1B 4CAYB 5B0YA 5AVCC 4J8VA 3B6FA 5GXQC 5B33B 2HUEC 3NQUA 3UTAA 2NZDD 5CPKD 3WA9A 3AN2A 1P3LD 3MVDC 5JA4B 5CP6A 3TU4D 1KX4D 4J8XA 4R8PD 5CPJB 3AZNA 5B2JA 4XZQB 5AV8A 4WU8C 1BFMA 3WA9B 5FUGA 3AZFA 3AN2B 4J8XB 5B32B 1BH9A 5B2IA 5B33C 3AZNB 4YS3D 3KXBA 5F99C 4H9PA 3REJB 3AZLB 5B0YC 3B6FC 4J8VC 5B1MD 5B2IB 3UT9D 3R45A 4H9SA 4XZQC 5B31A 1F66A 2F8ND 2PYOD 3WA9C 5B1LB 3AN2C 3WAAD 4Z66B 4H9PB 3UTBD 3B6GA 5CP6C 4WZSB 4J8XC 5B32C 1H3OB 1KU5A 3AZNC 5B2JC 5AV8C 1F1EA 1N1JB 1P3MA 3AZFC 4YM6A 4JJND 1P3FB 3VH6A 3KUYD 1M1AB 5AY8A 1U35D 5B2IC 1ZLAB 3VH6T 3KXBC 5GSUD 3MGQD 4Z66C 4YM6B 1KX5D 5BNVA 3AZGD 1M18B 3X1TA 5AY8B 4XUJA 3MNNB 3LZ1D 4H9SC 5B31C 5AV5D 5DNND 1TAFB 1M19A 1P3FC 3AFAB 3LJAA 3B6GC 5B32G 1TZYA 2HIOA 4CSRA 1ULYA 1P3BA 1P3MC 4YM6C 1M19B 3WTPE 4WNNA 5AY8C 2AROA 3W99D 1TZYB 2HIOB 5G49A 3MGSA 1P3PB 1P3GD 4KGCD 4H9OA 3KWQD 4KUDA 4WNNB 2AROB 4XUJC 4WU9D 1BH8A 1M19C 3WTPD 1Q9CA 3LJAC 5AV9D 5DNMA 3X1SA 3LELA 4KUDB 1TZYC 2HIOC 2NQBD 1P3PC 3O62A 3C1CD 4E45A 1KX3B 2CV5A 5B40A 5DNMB 2AROC 4J8WD 3A6NA 3X1UA 5GT0D 3MGSC 1P3OD 1ID3D 5JRGA 3AZEA 5AVBD 5B24B 4KUDC 1HQ3A 3REKD 3X1UB 4H9RB 4ZUXB 1P34A 4X23B 5DNMC 3W96A 3C1BD 1JFIA 3REIA 5B0ZD 1AOIB 3WKJD 4EO5B 1P34B 2CV5C 2YFWA 5B40C 4LD9D 3W96B 5CPKA 2NZDA 1P3LA 1P3ID 3TU4A 1KX4A 3X1UC 4R8PA 4AWLB 3X1VD 5GXQB 5GT3B 2HUEB 5AV6D 3MVDB 3V9RB 1HQ3C 1KX4B 4EO5C 4J8UB 1P34C 3RELD 3W96C 4YS3A 4E44A 3AZJD 1P3AD 4UUZA 4H9QA 5B1MA 4AWLC 3UT9A 2F8NA 2PYOA 5GT3C 5CPID 3WAAA 1P3LC 4Z5TD 2FJ7B 5F99B 1EQZB 3UTBA 3TU4C 1KX4C 3AZHD 4J8UC 4R8PC 5B0YB 3B6FB 4J8VB 2F8NB 3W97D 3NQUB 3UTAB 4JJNA 2YFVA 3KUYA 3REHD 4QLCD 5CP6B 1U35A 3W98D 4YS3C 5GSUA 5E5AA 5B2JB 5AV8B 3MGQA 1EQZC 2FJ7C 3B0CW 3MGRD 1KX5A 5FUGB 3AZFB 3KUYB 3AZGA 3AV2D 3LZ1A 3UT9C 2PYOC 3WAAC 1BH9B 5GSUB 5E5AB 5AV5A 5DNNA 3KXBB 3MGQB 3UTAC 1S32D 1P3KD 3AZKD 3AZID 3LZ1B 4WU8D 1F66B 3R45B 5B31B 4JJNC 3AV1D 3KUYC 4LD9C 3B6GB 3W99A 1U35C 5B33D 2RVQC 5GSUC 5E5AC 3MGQC 1P3GA 1P3MB 1KX5C 3KSYA 4KGCA 1WWIA 3KWQA 5CPJD 3W99B 3LZ1C 2LY8A 4Z2MH 4XZQD 1F66C 5AV5C 5DNNC 4WU9A 3WTPA 5AV9A 3AYWD 5BNVB 5B32D 3X1TB 2NQBA 4XUJB 3C1CA 3REJD 5AV9B 3LJAB 3AZLD 3VH5W 3W99C 4J8WA 5B1LD 4CSRB 5GT0A 1P3OA 1ID3A 4Z66D 1P3BB 1P3GC 5AVBA 4H9NA 3X1TC 5B31G 3REKA 5G49B 4Z2MG 4WU9C 3WTPC 3MGSB 1P3FD 5AV9C 3C1BA 1M1AD 1ZLAD 4H9OB 5B0ZA 3WKJA 3B0BA 1WWSA 1P3BC 2BYMA 2IO5C 1BH8B 4M6BA 1M18D 3X1SB 3LELB 3MNND 1P3IA 5BO0A 1P3OC 1ID3C 3AZMD 3X1VA 3O62B 3AFAD 2BYMB 5AVBC 1R4VA 2CV5B 5B40B 5AV6A 5BO0B 5CHLB 3REKC 3A6NB 3X1VB 2JSSA 5JRGB 3RELA 3C1BC 3AZEB 3X1SC 3LELC 2HIOD 3AZJA 4NE5A 1P3AA 1P3PD 1HQ3B 3O62C 4G92B 5CPIA 4Z5TA 3LZ0D 1JFIB 3REIB 3AZHA 3A6NC 3X1VC 5JRGC 3AZEC 3W97A 2YFWB 5AV6C 5CPKB 2NZDB 3B0DC 1P3LB 3REHA 5C3IC 4QLCA 3TU4B 4G92C 1KX3D 3W98A 4R8PB 3MGPD 1B67A 3MGRA 3REIC 1P3AC 3AV2A 5B24D 4YS3B 5CPKC 2NZDC 3NQJA 1S32A 1P3KA 3AZKA 3AZHC 4ZUXD 5BT1D 4UUZB 4X23D 3AZIA 4H9QB 5B1MB 4WU8A 3UT9B 2PYOB 3W97C 3WAAB 2L5AA 3AV1A 1S32B 3REHC 3UTBB 4CAYA 3AZKB 1AOID 1HTAA 3VH6W 5B33A 3W98C 3AZIB 5JA4A 3MGRC 4JJNB 2YFVB 3AV2C 5CPJA 2F8NH 5AVCD 5B1MC 5GXQD 4XZQA 5GT3D 1U35B 1S32C 3MVDD 3UTBC 1P3KC 4DRAA 3AZKC 1KX5B 3AYWA 5B32A 4J8UD 3AZGB 3AZIC 4ZBJC 3AV1C 5AV5B 5DNNB 3REJA 3AZLA 3AYWB 2F8NK 5B1LA 2FJ7D 5F99D 4Z66A 1EQZD 1A7WA 1H3OA 4NE3A 5B0YD 3AZGC 4J8VD 5CPJC 2F8NG 3B6FD 1N1JA 3UTAD 3WA9D 3AN2D 1P3FA 1P3GB 1M1AA 3AYWC 5CP6D 4KGCB 1ZLAA 3KWQB 4J8XD 3AZND 5B2JD 5AV8D 4NFTA 3AZFD 3REJC 4WU9B 3WTPB 3AZLC 5BNXA 1M18A 5KDMA 3MNNA 2RVQD 5B2ID 4KHAA 5B1LC 5E5AD 3KXBD 1TAFA 3AZMA 2NQBB 3AFAA 3C1CB 4KGCC 2IO5B 5BNXB 3B0CT 3KWQC 5KDMB 4G91B 4J8WB 1F66D 4KHAB 5B31D 3AZMB 5GT0B 1P3OB 1ID3B 5AVBB 1M1AC 3B6GD 1ZLAC 4H9NB 2NQBC 1P3PA 3REKB 1P3MD 3C1CC 4YM6D 4LD9A 1M18C 3LZ0A 3C1BB 5BS7A 5AY8D 3MNNC 4G91C 4J8WC 5B0ZB 3AZMC 5GT0C 3WKJB 3AFAC 4LD9B 3LZ0B 3X1TD 4XUJD 1P3IB 1KX3A 1M19D 3LJAD 3MGPA 5AV6B 1TZYD 3B0DB 5B0ZC 4HGAB 5C3IB 1P3BD 3WKJC 3VH5A 5B24A 3MGPB 3RELB 3LZ0C 4NE6A
chains in the Genus database with same CATH superfamily
5BS7C 2AROD 3AZJB 1P3IC 3VH5T 4H9RA 4ZUXA 1P3AB 3MGSD 4X23A 2CWEA 5CPIB 2BYKA 4KUDD 4Z5TB 1AOIA 4HGAC 1KX3C 3AZHB 3MGPC 5DNMD 3RELC 3X1SD 3LELD 3W97B 2BYKB 4WV4B 2JE5A 3AZJC 3REHB 3KFUG 4QLCB 5AVCA 3O62D 5GXQA 5GT3A 2CV5D 3W98B 5B24C 2VQRA 5CPIC 5B40D 2BG1A 1B6WA 4Z5TC 3MVDA 4DRBA 3V9RA 3MGRB 3A6ND 2ZY3A 4ZUXC 3X1UD 5BT1C 4J8UA 4X23C 5AVCB 5JRGD 3AV2B 3AZED 3NQJB 1AOIC 2ZY5A 1P3KB 1HQ3D 4QLCC 1P34D 3W96D 2FJ7A 4WU8B 2FFFB 5F99A 1EQZA 3REID 4ZBJB 2ZM5A 3AV1B 4CAYB 5B0YA 5AVCC 4J8VA 3B6FA 5GXQC 5B33B 2HUEC 3NQUA 3UTAA 2NZDD 5CPKD 3WA9A 3AN2A 1P3LD 3MVDC 5JA4B 5CP6A 3TU4D 1KX4D 4J8XA 4R8PD 5CPJB 3AZNA 5B2JA 4XZQB 5AV8A 4WU8C 1BFMA 3WA9B 5FUGA 3AZFA 3AN2B 4J8XB 5B32B 1BH9A 5B2IA 5B33C 3AZNB 4YS3D 3KXBA 5F99C 4H9PA 2DQNC 3REJB 3AZLB 5B0YC 3B6FC 4J8VC 5B1MD 5B2IB 3UT9D 3R45A 4H9SA 4XZQC 5B31A 1F66A 2F8ND 2PYOD 3WA9C 5B1LB 3AN2C 3WAAD 4Z66B 4H9PB 3UTBD 3B6GA 5CP6C 4WZSB 4J8XC 5B32C 1H3OB 1KU5A 3AZNC 5B2JC 5AV8C 1F1EA 1N1JB 1P3MA 3AZFC 4YM6A 4JJND 1P3FB 3VH6A 3KUYD 1M1AB 3H0LC 5AY8A 1U35D 5B2IC 1ZLAB 3VH6T 3KXBC 5GSUD 3MGQD 2Y2JA 4Z66C 4YM6B 1KX5D 4UPKA 5BNVA 3A1KA 3AZGD 1M18B 3X1TA 5AY8B 4XUJA 3MNNB 3LZ1D 4H9SC 5B31C 5AV5D 5DNND 1TAFB 1M19A 1P3FC 3AFAB 3LJAA 3B6GC 5B32G 1TZYA 2HIOA 4CSRA 1ULYA 1P3BA 1W2EA 1P3MC 4YM6C 1M19B 3WTPE 4WNNA 5AY8C 2AROA 3W99D 1TZYB 2HIOB 5G49A 3MGSA 1P3PB 2F2AC 2Y2LA 1P3GD 4KGCD 4H9OA 3KWQD 4KUDA 4WNNB 2AROB 4XUJC 2Y2KA 4WU9D 1BH8A 1M19C 3WTPD 1Q9CA 3LJAC 5AV9D 5DNMA 3X1SA 3LELA 4KUDB 1TZYC 2HIOC 2NQBD 2Y2NA 1P3PC 3O62A 3C1CD 4E45A 1KX3B 2J8PA 2CV5A 5B40A 5DNMB 2AROC 4J8WD 3A6NA 3X1UA 5GT0D 3MGSC 1P3OD 1ID3D 5JRGA 3AZEA 5AVBD 5B24B 4KUDC 1HQ3A 3REKD 3X1UB 4H9RB 4ZUXB 1P34A 4X23B 2W8SA 5DNMC 3W96A 3C1BD 1JFIA 3REIA 5B0ZD 1AOIB 3WKJD 4EO5B 1P34B 2CV5C 2YFWA 5B40C 4LD9D 3W96B 5CPKA 2NZDA 1P3LA 1P3ID 3TU4A 1KX4A 3X1UC 2XD1A 4R8PA 4AWLB 3X1VD 5GXQB 5GT3B 2HUEB 5AV6D 3MVDB 3V9RB 1HQ3C 1KX4B 4EO5C 4J8UB 1P34C 3RELD 3W96C 3FDDA 4YS3A 4E44A 3AZJD 2Y2IA 1P3AD 4UUZA 4H9QA 5B1MA 4AWLC 3UT9A 2F8NA 2PYOA 5GT3C 5CPID 3WAAA 1P3LC 4Z5TD 2FJ7B 5F99B 1EQZB 3UTBA 3TU4C 1KX4C 3AZHD 4J8UC 4R8PC 5B0YB 3B6FB 4J8VB 2F8NB 3H0RC 3W97D 3NQUB 3UTAB 4JJNA 2Y2MA 2YFVA 3KUYA 3REHD 4QLCD 2Y2GA 2DF4C 5CP6B 1U35A 3W98D 4YS3C 5GSUA 5E5AA 5B2JB 5AV8B 3MGQA 1EQZC 2FJ7C 2G5IC 3B0CW 3MGRD 1KX5A 5FUGB 3AZFB 3KUYB 3AZGA 3AV2D 3LZ1A 3UT9C 2PYOC 3WAAC 1BH9B 5GSUB 5E5AB 5AV5A 5DNNA 3KXBB 3MGQB 3UTAC 1S32D 1P3KD 3AZKD 3AZID 3LZ1B 4WU8D 1F66B 3R45B 5B31B 3EPJA 4JJNC 3AV1D 3KUYC 4LD9C 3B6GB 4WJ3C 3W99A 1U35C 5B33D 2RVQC 5GSUC 5E5AC 3MGQC 2G5HC 1P3GA 1P3MB 1KX5C 3KSYA 4KGCA 1WWIA 3KWQA 3F6TA 5CPJD 3W99B 3LZ1C 2LY8A 4Z2MH 4XZQD 1F66C 5AV5C 5DNNC 4WU9A 3WTPA 5AV9A 2ZY4A 3P5JB 3AYWD 5BNVB 5B32D 3X1TB 2NQBA 4XUJB 3C1CA 3REJD 5AV9B 3LJAB 3AZLD 1PZRA 3VH5W 3W99C 4J8WA 3IP4C 5B1LD 4CSRB 5GT0A 1P3OA 1ID3A 4Z66D 1P3BB 1P3GC 5AVBA 4H9NA 3X1TC 5B31G 3REKA 5G49B 4Z2MG 4WU9C 3WTPC 3MGSB 1P3FD 5AV9C 3C1BA 1M1AD 1ZLAD 4H9OB 5B0ZA 3WKJA 3B0BA 1WWSA 1P3BC 2BYMA 2IO5C 1BH8B 4M6BA 1M18D 3X1SB 3LELB 3MNND 1P3IA 5BO0A 1P3OC 1ID3C 3AZMD 3X1VA 3O62B 3AFAD 2BYMB 5AVBC 1R4VA 2CV5B 5B40B 5AV6A 5BO0B 5CHLB 3EPKA 3REKC 3A6NB 3X1VB 2JSSA 1T3UA 5JRGB 3RELA 3C1BC 3AZEB 2Y2HA 3X1SC 3LELC 2HIOD 3AZJA 4NE5A 1P3AA 1P3PD 1HQ3B 3O62C 4G92B 5CPIA 4Z5TA 3LZ0D 1JFIB 3REIB 3AZHA 3A6NC 3X1VC 5JRGC 3AZEC 3W97A 2YFWB 5AV6C 5CPKB 2NZDB 3B0DC 1P3LB 3REHA 5C3IC 4QLCA 3TU4B 4G92C 1KX3D 2XD5A 3W98A 4R8PB 3MGPD 1B67A 3MGRA 3REIC 3A1IA 1P3AC 3AV2A 5B24D 4YS3B 2UWXA 5CPKC 2NZDC 3NQJA 1S32A 1P3KA 3AZKA 3AZHC 4ZUXD 2RIQA 5BT1D 4UUZB 4X23D 3AZIA 4H9QB 5B1MB 4WU8A 3UT9B 2PYOB 3EG5B 3W97C 3WAAB 2L5AA 3AV1A 2ZY2A 3REHC 1S32B 3UTBB 2JCHA 4CAYA 3AZKB 1AOID 1HTAA 3VH6W 5B33A 3W98C 3AZIB 5JA4A 3MGRC 4JJNB 2YFVB 3AV2C 5CPJA 2F8NH 5AVCD 5B1MC 5GXQD 4XZQA 5GT3D 1U35B 1S32C 3MVDD 3UTBC 1P3KC 4DRAA 3AZKC 1KX5B 3AYWA 5B32A 4J8UD 3AZGB 3AZIC 4ZBJC 3AV1C 5AV5B 5DNNB 3REJA 3EPHA 3AZLA 3AYWB 2F8NK 5B1LA 2FJ7D 5F99D 4Z66A 1EQZD 1A7WA 1H3OA 4NE3A 5B0YD 3AZGC 4J8VD 5CPJC 2F8NG 3B6FD 1N1JA 3UTAD 4DQYB 3WA9D 3AN2D 1P3FA 1P3GB 1M1AA 3AYWC 5CP6D 4KGCB 1ZLAA 3KWQB 4J8XD 3AZND 5B2JD 5AV8D 4NFTA 2Y2PA 3AZFD 3REJC 4WU9B 3WTPB 3AZLC 5BNXA 1M18A 5KDMA 3MNNA 2RVQD 1Z2CB 5B2ID 4KHAA 5B1LC 5E5AD 3KXBD 1TAFA 2Y2QA 3AZMA 2NQBB 3AFAA 3C1CB 4KGCC 2IO5B 5BNXB 3B0CT 3KWQC 5KDMB 4G91B 4J8WB 1F66D 4KHAB 5B31D 3AZMB 5GT0B 1P3OB 1ID3B 5AVBB 1M1AC 3B6GD 1ZLAC 4H9NB 2Y2OA 2NQBC 1P3PA 3REKB 1P3MD 3C1CC 4YM6D 4LD9A 1M18C 3LZ0A 3C1BB 5BS7A 5AY8D 3MNNC 3EPLA 4G91C 4J8WC 5B0ZB 3AL0C 3AZMC 5GT0C 3WKJB 3AFAC 4LD9B 3LZ0B 3X1TD 4XUJD 1P3IB 3H0MC 1KX3A 1M19D 3LJAD 3MGPA 5AV6B 1TZYD 3B0DB 5B0ZC 4HGAB 5C3IB 1P3BD 3WKJC 3VH5A 5B24A 3MGPB 3RELB 3LZ0C 4NE6A
chains in the Genus database with same CATH topology
5BS7C 2AROD 3AZJB 1P3IC 3VH5T 4H9RA 4ZUXA 1P3AB 3MGSD 4X23A 2CWEA 5CPIB 2BYKA 4KUDD 4Z5TB 1AOIA 4HGAC 1KX3C 3AZHB 3MGPC 5DNMD 3RELC 3X1SD 3LELD 3W97B 2BYKB 4WV4B 2JE5A 3AZJC 3REHB 3KFUG 4QLCB 5AVCA 3O62D 5GXQA 5GT3A 2CV5D 3W98B 5B24C 2VQRA 5CPIC 5B40D 2BG1A 1B6WA 4Z5TC 3MVDA 4DRBA 3V9RA 3MGRB 3A6ND 2ZY3A 4ZUXC 3X1UD 5BT1C 4J8UA 4X23C 5AVCB 5JRGD 3AV2B 3AZED 3NQJB 1AOIC 2ZY5A 1P3KB 1HQ3D 4QLCC 1P34D 3W96D 2FJ7A 4WU8B 2FFFB 5F99A 1EQZA 3REID 4ZBJB 2ZM5A 3AV1B 4CAYB 5B0YA 5AVCC 4J8VA 3B6FA 5GXQC 5B33B 2HUEC 3NQUA 3UTAA 2NZDD 5CPKD 3WA9A 3AN2A 1P3LD 3MVDC 5JA4B 5CP6A 3TU4D 1KX4D 4J8XA 4R8PD 5CPJB 3AZNA 5B2JA 4XZQB 5AV8A 4WU8C 1BFMA 3WA9B 5FUGA 3AZFA 3AN2B 4J8XB 5B32B 1BH9A 5B2IA 5B33C 3AZNB 4YS3D 3KXBA 5F99C 4H9PA 2DQNC 3REJB 3AZLB 5B0YC 3B6FC 4J8VC 5B1MD 5B2IB 3UT9D 3R45A 4H9SA 4XZQC 5B31A 1F66A 2F8ND 2PYOD 3WA9C 5B1LB 3AN2C 3WAAD 4Z66B 4H9PB 3UTBD 3B6GA 5CP6C 4WZSB 4J8XC 5B32C 1H3OB 1KU5A 3AZNC 5B2JC 5AV8C 1F1EA 1N1JB 1P3MA 3AZFC 4YM6A 4JJND 1P3FB 3VH6A 3KUYD 1M1AB 3H0LC 5AY8A 1U35D 5B2IC 1ZLAB 3VH6T 3KXBC 5GSUD 3MGQD 2Y2JA 4Z66C 4YM6B 1KX5D 4UPKA 5BNVA 3A1KA 3AZGD 1M18B 3X1TA 5AY8B 4XUJA 3MNNB 3LZ1D 4H9SC 5B31C 5AV5D 5DNND 1TAFB 1M19A 1P3FC 3AFAB 3LJAA 3B6GC 5B32G 1TZYA 2HIOA 4CSRA 1ULYA 1P3BA 1W2EA 1P3MC 4YM6C 1M19B 3WTPE 4WNNA 5AY8C 2AROA 3W99D 1TZYB 2HIOB 5G49A 3MGSA 1P3PB 2F2AC 2Y2LA 1P3GD 4KGCD 4H9OA 3KWQD 4KUDA 4WNNB 2AROB 4XUJC 2Y2KA 4WU9D 1BH8A 1M19C 3WTPD 1Q9CA 3LJAC 5AV9D 5DNMA 3X1SA 3LELA 4KUDB 1TZYC 2HIOC 2NQBD 2Y2NA 1P3PC 3O62A 3C1CD 4E45A 1KX3B 2J8PA 2CV5A 5B40A 5DNMB 2AROC 4J8WD 3A6NA 3X1UA 5GT0D 3MGSC 1P3OD 1ID3D 5JRGA 3AZEA 5AVBD 5B24B 4KUDC 1HQ3A 3REKD 3X1UB 4H9RB 4ZUXB 1P34A 4X23B 2W8SA 5DNMC 3W96A 3C1BD 1JFIA 3REIA 5B0ZD 1AOIB 3WKJD 4EO5B 1P34B 2CV5C 2YFWA 5B40C 4LD9D 3W96B 5CPKA 2NZDA 1P3LA 1P3ID 3TU4A 1KX4A 3X1UC 2XD1A 4R8PA 4AWLB 3X1VD 5GXQB 5GT3B 2HUEB 5AV6D 3MVDB 3V9RB 1HQ3C 1KX4B 4EO5C 4J8UB 1P34C 3RELD 3W96C 3FDDA 4YS3A 4E44A 3AZJD 2Y2IA 1P3AD 4UUZA 4H9QA 5B1MA 4AWLC 3UT9A 2F8NA 2PYOA 5GT3C 5CPID 3WAAA 1P3LC 4Z5TD 2FJ7B 5F99B 1EQZB 3UTBA 3TU4C 1KX4C 3AZHD 4J8UC 4R8PC 5B0YB 3B6FB 4J8VB 2F8NB 3H0RC 3W97D 3NQUB 3UTAB 4JJNA 2Y2MA 2YFVA 3KUYA 3REHD 4QLCD 2Y2GA 2DF4C 5CP6B 1U35A 3W98D 4YS3C 5GSUA 5E5AA 5B2JB 5AV8B 3MGQA 1EQZC 2FJ7C 2G5IC 3B0CW 3MGRD 1KX5A 5FUGB 3AZFB 3KUYB 3AZGA 3AV2D 3LZ1A 3UT9C 2PYOC 3WAAC 1BH9B 5GSUB 5E5AB 5AV5A 5DNNA 3KXBB 3MGQB 3UTAC 1S32D 1P3KD 3AZKD 3AZID 3LZ1B 4WU8D 1F66B 3R45B 5B31B 3EPJA 4JJNC 3AV1D 3KUYC 4LD9C 3B6GB 4WJ3C 3W99A 1U35C 5B33D 2RVQC 5GSUC 5E5AC 3MGQC 2G5HC 1P3GA 1P3MB 1KX5C 3KSYA 4KGCA 1WWIA 3KWQA 3F6TA 5CPJD 3W99B 3LZ1C 2LY8A 4Z2MH 4XZQD 1F66C 5AV5C 5DNNC 4WU9A 3WTPA 5AV9A 2ZY4A 3P5JB 3AYWD 5BNVB 5B32D 3X1TB 2NQBA 4XUJB 3C1CA 3REJD 5AV9B 3LJAB 3AZLD 1PZRA 3VH5W 3W99C 4J8WA 3IP4C 5B1LD 4CSRB 5GT0A 1P3OA 1ID3A 4Z66D 1P3BB 1P3GC 5AVBA 4H9NA 3X1TC 5B31G 3REKA 5G49B 4Z2MG 4WU9C 3WTPC 3MGSB 1P3FD 5AV9C 3C1BA 1M1AD 1ZLAD 4H9OB 5B0ZA 3WKJA 3B0BA 1WWSA 1P3BC 2BYMA 2IO5C 1BH8B 4M6BA 1M18D 3X1SB 3LELB 3MNND 1P3IA 5BO0A 1P3OC 1ID3C 3AZMD 3X1VA 3O62B 3AFAD 2BYMB 5AVBC 1R4VA 2CV5B 5B40B 5AV6A 5BO0B 5CHLB 3EPKA 3REKC 3A6NB 3X1VB 2JSSA 1T3UA 5JRGB 3RELA 3C1BC 3AZEB 2Y2HA 3X1SC 3LELC 2HIOD 3AZJA 4NE5A 1P3AA 1P3PD 1HQ3B 3O62C 4G92B 5CPIA 4Z5TA 3LZ0D 1JFIB 3REIB 3AZHA 3A6NC 3X1VC 5JRGC 3AZEC 3W97A 2YFWB 5AV6C 5CPKB 2NZDB 3B0DC 1P3LB 3REHA 5C3IC 4QLCA 3TU4B 4G92C 1KX3D 2XD5A 3W98A 4R8PB 3MGPD 1B67A 3MGRA 3REIC 3A1IA 1P3AC 3AV2A 5B24D 4YS3B 2UWXA 5CPKC 2NZDC 3NQJA 1S32A 1P3KA 3AZKA 3AZHC 4ZUXD 2RIQA 5BT1D 4UUZB 4X23D 3AZIA 4H9QB 5B1MB 4WU8A 3UT9B 2PYOB 3EG5B 3W97C 3WAAB 2L5AA 3AV1A 2ZY2A 3REHC 1S32B 3UTBB 2JCHA 4CAYA 3AZKB 1AOID 1HTAA 3VH6W 5B33A 3W98C 3AZIB 5JA4A 3MGRC 4JJNB 2YFVB 3AV2C 5CPJA 2F8NH 5AVCD 5B1MC 5GXQD 4XZQA 5GT3D 1U35B 1S32C 3MVDD 3UTBC 1P3KC 4DRAA 3AZKC 1KX5B 3AYWA 5B32A 4J8UD 3AZGB 3AZIC 4ZBJC 3AV1C 5AV5B 5DNNB 3REJA 3EPHA 3AZLA 3AYWB 2F8NK 5B1LA 2FJ7D 5F99D 4Z66A 1EQZD 1A7WA 1H3OA 4NE3A 5B0YD 3AZGC 4J8VD 5CPJC 2F8NG 3B6FD 1N1JA 3UTAD 4DQYB 3WA9D 3AN2D 1P3FA 1P3GB 1M1AA 3AYWC 5CP6D 4KGCB 1ZLAA 3KWQB 4J8XD 3AZND 5B2JD 5AV8D 4NFTA 2Y2PA 3AZFD 3REJC 4WU9B 3WTPB 3AZLC 5BNXA 1M18A 5KDMA 3MNNA 2RVQD 1Z2CB 5B2ID 4KHAA 5B1LC 5E5AD 3KXBD 1TAFA 2Y2QA 3AZMA 2NQBB 3AFAA 3C1CB 4KGCC 2IO5B 5BNXB 3B0CT 3KWQC 5KDMB 4G91B 4J8WB 1F66D 4KHAB 5B31D 3AZMB 5GT0B 1P3OB 1ID3B 5AVBB 1M1AC 3B6GD 1ZLAC 4H9NB 2Y2OA 2NQBC 1P3PA 3REKB 1P3MD 3C1CC 4YM6D 4LD9A 1M18C 3LZ0A 3C1BB 5BS7A 5AY8D 3MNNC 3EPLA 4G91C 4J8WC 5B0ZB 3AL0C 3AZMC 5GT0C 3WKJB 3AFAC 4LD9B 3LZ0B 3X1TD 4XUJD 1P3IB 3H0MC 1KX3A 1M19D 3LJAD 3MGPA 5AV6B 1TZYD 3B0DB 5B0ZC 4HGAB 5C3IB 1P3BD 3WKJC 3VH5A 5B24A 3MGPB 3RELB 3LZ0C 4NE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS7 C;  2ARO D;  3AZJ B;  1P3I C;  3VH5 T;  4H9R A;  4ZUX A;  1P3A B;  3MGS D;  4X23 A;  2CWE A;  5CPI B;  2BYK A;  4KUD D;  4Z5T B;  1AOI A;  4HGA C;  1KX3 C;  3AZH B;  3MGP C;  5DNM D;  3REL C;  3X1S D;  3LEL D;  3W97 B;  2BYK B;  4WV4 B;  3AZJ C;  3REH B;  4QLC B;  5AVC A;  3O62 D;  5GXQ A;  5GT3 A;  2CV5 D;  3W98 B;  5B24 C;  5CPI C;  5B40 D;  1B6W A;  4Z5T C;  3MVD A;  4DRB A;  3V9R A;  3MGR B;  3A6N D;  4ZUX C;  4J8U A;  3X1U D;  5BT1 C;  4X23 C;  5AVC B;  5JRG D;  3AV2 B;  3AZE D;  3NQJ B;  1AOI C;  1P3K B;  1HQ3 D;  4QLC C;  1P34 D;  3W96 D;  2FJ7 A;  4WU8 B;  5F99 A;  1EQZ A;  3REI D;  4ZBJ B;  3AV1 B;  4CAY B;  5B0Y A;  5AVC C;  4J8V A;  3B6F A;  5GXQ C;  5B33 B;  2HUE C;  3NQU A;  3UTA A;  2NZD D;  5CPK D;  3WA9 A;  3AN2 A;  1P3L D;  3MVD C;  5JA4 B;  5CP6 A;  3TU4 D;  1KX4 D;  4J8X A;  4R8P D;  5CPJ B;  3AZN A;  5B2J A;  4XZQ B;  5AV8 A;  4WU8 C;  1BFM A;  3WA9 B;  5FUG A;  3AZF A;  3AN2 B;  4J8X B;  5B32 B;  1BH9 A;  5B2I A;  5B33 C;  3AZN B;  4YS3 D;  3KXB A;  5F99 C;  4H9P A;  3REJ B;  3AZL B;  5B0Y C;  3B6F C;  4J8V C;  5B1M D;  5B2I B;  3UT9 D;  3R45 A;  4H9S A;  4XZQ C;  5B31 A;  1F66 A;  2F8N D;  2PYO D;  3WA9 C;  5B1L B;  3AN2 C;  3WAA D;  4Z66 B;  4H9P B;  3UTB D;  3B6G A;  5CP6 C;  4WZS B;  4J8X C;  5B32 C;  1H3O B;  1KU5 A;  3AZN C;  5B2J C;  5AV8 C;  1F1E A;  1N1J B;  1P3M A;  3AZF C;  4YM6 A;  4JJN D;  1P3F B;  3VH6 A;  3KUY D;  1M1A B;  5AY8 A;  1U35 D;  5B2I C;  1ZLA B;  3VH6 T;  3KXB C;  5GSU D;  3MGQ D;  4Z66 C;  4YM6 B;  1KX5 D;  5BNV A;  3AZG D;  1M18 B;  3X1T A;  5AY8 B;  4XUJ A;  3MNN B;  3LZ1 D;  4H9S C;  5B31 C;  5AV5 D;  5DNN D;  1TAF B;  1M19 A;  1P3F C;  3AFA B;  3LJA A;  3B6G C;  5B32 G;  1TZY A;  2HIO A;  4CSR A;  1ULY A;  1P3B A;  1P3M C;  4YM6 C;  1M19 B;  3WTP E;  4WNN A;  5AY8 C;  2ARO A;  3W99 D;  1TZY B;  2HIO B;  5G49 A;  3MGS A;  1P3P B;  1P3G D;  4KGC D;  4H9O A;  3KWQ D;  4KUD A;  4WNN B;  2ARO B;  4XUJ C;  4WU9 D;  1BH8 A;  1M19 C;  3WTP D;  1Q9C A;  3LJA C;  5AV9 D;  5DNM A;  3X1S A;  3LEL A;  4KUD B;  1TZY C;  2HIO C;  2NQB D;  1P3P C;  3O62 A;  3C1C D;  4E45 A;  1KX3 B;  2CV5 A;  5B40 A;  5DNM B;  2ARO C;  4J8W D;  3A6N A;  3X1U A;  5GT0 D;  3MGS C;  1P3O D;  1ID3 D;  5JRG A;  3AZE A;  5AVB D;  5B24 B;  4KUD C;  1HQ3 A;  3REK D;  3X1U B;  4H9R B;  4ZUX B;  1P34 A;  4X23 B;  5DNM C;  3W96 A;  3C1B D;  1JFI A;  3REI A;  5B0Z D;  1AOI B;  3WKJ D;  4EO5 B;  1P34 B;  2CV5 C;  2YFW A;  5B40 C;  4LD9 D;  3W96 B;  5CPK A;  2NZD A;  1P3L A;  1P3I D;  3TU4 A;  1KX4 A;  3X1U C;  4R8P A;  4AWL B;  3X1V D;  5GXQ B;  5GT3 B;  2HUE B;  5AV6 D;  3MVD B;  3V9R B;  1HQ3 C;  1KX4 B;  4EO5 C;  4J8U B;  1P34 C;  3REL D;  3W96 C;  4YS3 A;  4E44 A;  3AZJ D;  1P3A D;  4UUZ A;  4H9Q A;  5B1M A;  4AWL C;  3UT9 A;  2F8N A;  2PYO A;  5GT3 C;  5CPI D;  3WAA A;  1P3L C;  4Z5T D;  2FJ7 B;  5F99 B;  1EQZ B;  3UTB A;  3TU4 C;  1KX4 C;  3AZH D;  4J8U C;  4R8P C;  5B0Y B;  3B6F B;  4J8V B;  2F8N B;  3W97 D;  3NQU B;  3UTA B;  4JJN A;  2YFV A;  3KUY A;  3REH D;  4QLC D;  5CP6 B;  1U35 A;  3W98 D;  4YS3 C;  5GSU A;  5E5A A;  5B2J B;  5AV8 B;  3MGQ A;  1EQZ C;  2FJ7 C;  3B0C W;  3MGR D;  1KX5 A;  5FUG B;  3AZF B;  3KUY B;  3AZG A;  3AV2 D;  3LZ1 A;  3UT9 C;  2PYO C;  3WAA C;  1BH9 B;  5GSU B;  5E5A B;  5AV5 A;  5DNN A;  3KXB B;  3MGQ B;  3UTA C;  1S32 D;  1P3K D;  3AZK D;  3AZI D;  3LZ1 B;  4WU8 D;  1F66 B;  3R45 B;  5B31 B;  4JJN C;  3AV1 D;  3KUY C;  4LD9 C;  3B6G B;  3W99 A;  1U35 C;  5B33 D;  2RVQ C;  5GSU C;  5E5A C;  3MGQ C;  1P3G A;  1P3M B;  1KX5 C;  3KSY A;  4KGC A;  1WWI A;  3KWQ A;  5CPJ D;  3W99 B;  3LZ1 C;  2LY8 A;  4Z2M H;  4XZQ D;  1F66 C;  5AV5 C;  5DNN C;  4WU9 A;  3WTP A;  5AV9 A;  3AYW D;  5BNV B;  5B32 D;  3X1T B;  2NQB A;  4XUJ B;  3C1C A;  3REJ D;  5AV9 B;  3LJA B;  3AZL D;  3VH5 W;  3W99 C;  4J8W A;  5B1L D;  4CSR B;  5GT0 A;  1P3O A;  1ID3 A;  4Z66 D;  1P3B B;  1P3G C;  5AVB A;  4H9N A;  3X1T C;  5B31 G;  3REK A;  5G49 B;  4Z2M G;  4WU9 C;  3WTP C;  3MGS B;  1P3F D;  5AV9 C;  3C1B A;  1M1A D;  1ZLA D;  4H9O B;  5B0Z A;  3WKJ A;  3B0B A;  1WWS A;  1P3B C;  2BYM A;  2IO5 C;  1BH8 B;  4M6B A;  1M18 D;  3X1S B;  3LEL B;  3MNN D;  1P3I A;  5BO0 A;  1P3O C;  1ID3 C;  3AZM D;  3X1V A;  3O62 B;  3AFA D;  2BYM B;  5AVB C;  1R4V A;  2CV5 B;  5B40 B;  5AV6 A;  5BO0 B;  5CHL B;  3REK C;  3A6N B;  3X1V B;  2JSS A;  5JRG B;  3REL A;  3C1B C;  3AZE B;  3X1S C;  3LEL C;  2HIO D;  3AZJ A;  4NE5 A;  1P3A A;  1P3P D;  1HQ3 B;  3O62 C;  4G92 B;  5CPI A;  4Z5T A;  3LZ0 D;  1JFI B;  3REI B;  3AZH A;  3A6N C;  3X1V C;  5JRG C;  3AZE C;  3W97 A;  2YFW B;  5AV6 C;  5CPK B;  2NZD B;  3B0D C;  1P3L B;  3REH A;  5C3I C;  4QLC A;  3TU4 B;  4G92 C;  1KX3 D;  3W98 A;  4R8P B;  3MGP D;  1B67 A;  3MGR A;  3REI C;  1P3A C;  3AV2 A;  5B24 D;  4YS3 B;  5CPK C;  2NZD C;  3NQJ A;  1S32 A;  1P3K A;  3AZK A;  3AZH C;  4ZUX D;  5BT1 D;  4UUZ B;  4X23 D;  3AZI A;  4H9Q B;  5B1M B;  4WU8 A;  3UT9 B;  2PYO B;  3W97 C;  3WAA B;  2L5A A;  3AV1 A;  1S32 B;  3REH C;  3UTB B;  4CAY A;  3AZK B;  1AOI D;  1HTA A;  3VH6 W;  5B33 A;  3W98 C;  3AZI B;  5JA4 A;  3MGR C;  4JJN B;  2YFV B;  3AV2 C;  5CPJ A;  2F8N H;  5AVC D;  5B1M C;  5GXQ D;  4XZQ A;  5GT3 D;  1U35 B;  1S32 C;  3MVD D;  3UTB C;  1P3K C;  4DRA A;  3AZK C;  1KX5 B;  3AYW A;  5B32 A;  4J8U D;  3AZG B;  3AZI C;  4ZBJ C;  3AV1 C;  5AV5 B;  5DNN B;  3REJ A;  3AZL A;  3AYW B;  2F8N K;  5B1L A;  2FJ7 D;  5F99 D;  4Z66 A;  1EQZ D;  1A7W A;  1H3O A;  4NE3 A;  5B0Y D;  3AZG C;  4J8V D;  5CPJ C;  2F8N G;  3B6F D;  1N1J A;  3UTA D;  3WA9 D;  3AN2 D;  1P3F A;  1P3G B;  1M1A A;  3AYW C;  5CP6 D;  4KGC B;  1ZLA A;  3KWQ B;  4J8X D;  3AZN D;  5B2J D;  5AV8 D;  4NFT A;  3AZF D;  3REJ C;  4WU9 B;  3WTP B;  3AZL C;  5BNX A;  1M18 A;  5KDM A;  3MNN A;  2RVQ D;  5B2I D;  4KHA A;  5B1L C;  5E5A D;  3KXB D;  1TAF A;  3AZM A;  2NQB B;  3AFA A;  3C1C B;  4KGC C;  2IO5 B;  5BNX B;  3B0C T;  3KWQ C;  5KDM B;  4G91 B;  4J8W B;  1F66 D;  4KHA B;  5B31 D;  3AZM B;  5GT0 B;  1P3O B;  1ID3 B;  5AVB B;  1M1A C;  3B6G D;  1ZLA C;  4H9N B;  2NQB C;  1P3P A;  3REK B;  1P3M D;  3C1C C;  4YM6 D;  4LD9 A;  1M18 C;  3LZ0 A;  3C1B B;  5BS7 A;  5AY8 D;  3MNN C;  4G91 C;  4J8W C;  5B0Z B;  3AZM C;  5GT0 C;  3WKJ B;  3AFA C;  4LD9 B;  3LZ0 B;  3X1T D;  4XUJ D;  1P3I B;  1KX3 A;  1M19 D;  3LJA D;  3MGP A;  5AV6 B;  1TZY D;  3B0D B;  5B0Z C;  4HGA B;  5C3I B;  1P3B D;  3WKJ C;  3VH5 A;  5B24 A;  3MGP B;  3REL B;  3LZ0 C;  4NE6 A; 
#chains in the Genus database with same CATH topology
 5BS7 C;  2ARO D;  3AZJ B;  1P3I C;  3VH5 T;  4H9R A;  4ZUX A;  1P3A B;  3MGS D;  4X23 A;  2CWE A;  5CPI B;  2BYK A;  4KUD D;  4Z5T B;  1AOI A;  4HGA C;  1KX3 C;  3AZH B;  3MGP C;  5DNM D;  3REL C;  3X1S D;  3LEL D;  3W97 B;  2BYK B;  4WV4 B;  2JE5 A;  3AZJ C;  3REH B;  3KFU G;  4QLC B;  5AVC A;  3O62 D;  5GXQ A;  5GT3 A;  2CV5 D;  3W98 B;  5B24 C;  2VQR A;  5CPI C;  5B40 D;  2BG1 A;  1B6W A;  4Z5T C;  3MVD A;  4DRB A;  3V9R A;  3MGR B;  3A6N D;  2ZY3 A;  4ZUX C;  3X1U D;  5BT1 C;  4J8U A;  4X23 C;  5AVC B;  5JRG D;  3AV2 B;  3AZE D;  3NQJ B;  1AOI C;  2ZY5 A;  1P3K B;  1HQ3 D;  4QLC C;  1P34 D;  3W96 D;  2FJ7 A;  4WU8 B;  2FFF B;  5F99 A;  1EQZ A;  3REI D;  4ZBJ B;  2ZM5 A;  3AV1 B;  4CAY B;  5B0Y A;  5AVC C;  4J8V A;  3B6F A;  5GXQ C;  5B33 B;  2HUE C;  3NQU A;  3UTA A;  2NZD D;  5CPK D;  3WA9 A;  3AN2 A;  1P3L D;  3MVD C;  5JA4 B;  5CP6 A;  3TU4 D;  1KX4 D;  4J8X A;  4R8P D;  5CPJ B;  3AZN A;  5B2J A;  4XZQ B;  5AV8 A;  4WU8 C;  1BFM A;  3WA9 B;  5FUG A;  3AZF A;  3AN2 B;  4J8X B;  5B32 B;  1BH9 A;  5B2I A;  5B33 C;  3AZN B;  4YS3 D;  3KXB A;  5F99 C;  4H9P A;  2DQN C;  3REJ B;  3AZL B;  5B0Y C;  3B6F C;  4J8V C;  5B1M D;  5B2I B;  3UT9 D;  3R45 A;  4H9S A;  4XZQ C;  5B31 A;  1F66 A;  2F8N D;  2PYO D;  3WA9 C;  5B1L B;  3AN2 C;  3WAA D;  4Z66 B;  4H9P B;  3UTB D;  3B6G A;  5CP6 C;  4WZS B;  4J8X C;  5B32 C;  1H3O B;  1KU5 A;  3AZN C;  5B2J C;  5AV8 C;  1F1E A;  1N1J B;  1P3M A;  3AZF C;  4YM6 A;  4JJN D;  1P3F B;  3VH6 A;  3KUY D;  1M1A B;  3H0L C;  5AY8 A;  1U35 D;  5B2I C;  1ZLA B;  3VH6 T;  3KXB C;  5GSU D;  3MGQ D;  2Y2J A;  4Z66 C;  4YM6 B;  1KX5 D;  4UPK A;  5BNV A;  3A1K A;  3AZG D;  1M18 B;  3X1T A;  5AY8 B;  4XUJ A;  3MNN B;  3LZ1 D;  4H9S C;  5B31 C;  5AV5 D;  5DNN D;  1TAF B;  1M19 A;  1P3F C;  3AFA B;  3LJA A;  3B6G C;  5B32 G;  1TZY A;  2HIO A;  4CSR A;  1ULY A;  1P3B A;  1W2E A;  1P3M C;  4YM6 C;  1M19 B;  3WTP E;  4WNN A;  5AY8 C;  2ARO A;  3W99 D;  1TZY B;  2HIO B;  5G49 A;  3MGS A;  1P3P B;  2F2A C;  2Y2L A;  1P3G D;  4KGC D;  4H9O A;  3KWQ D;  4KUD A;  4WNN B;  2ARO B;  4XUJ C;  2Y2K A;  4WU9 D;  1BH8 A;  1M19 C;  3WTP D;  1Q9C A;  3LJA C;  5AV9 D;  5DNM A;  3X1S A;  3LEL A;  4KUD B;  1TZY C;  2HIO C;  2NQB D;  2Y2N A;  1P3P C;  3O62 A;  3C1C D;  4E45 A;  1KX3 B;  2J8P A;  2CV5 A;  5B40 A;  5DNM B;  2ARO C;  4J8W D;  3A6N A;  3X1U A;  5GT0 D;  3MGS C;  1P3O D;  1ID3 D;  5JRG A;  3AZE A;  5AVB D;  5B24 B;  4KUD C;  1HQ3 A;  3REK D;  3X1U B;  4H9R B;  4ZUX B;  1P34 A;  4X23 B;  2W8S A;  5DNM C;  3W96 A;  3C1B D;  1JFI A;  3REI A;  5B0Z D;  1AOI B;  3WKJ D;  4EO5 B;  1P34 B;  2CV5 C;  2YFW A;  5B40 C;  4LD9 D;  3W96 B;  5CPK A;  2NZD A;  1P3L A;  1P3I D;  3TU4 A;  1KX4 A;  3X1U C;  2XD1 A;  4R8P A;  4AWL B;  3X1V D;  5GXQ B;  5GT3 B;  2HUE B;  5AV6 D;  3MVD B;  3V9R B;  1HQ3 C;  1KX4 B;  4EO5 C;  4J8U B;  1P34 C;  3REL D;  3W96 C;  3FDD A;  4YS3 A;  4E44 A;  3AZJ D;  2Y2I A;  1P3A D;  4UUZ A;  4H9Q A;  5B1M A;  4AWL C;  3UT9 A;  2F8N A;  2PYO A;  5GT3 C;  5CPI D;  3WAA A;  1P3L C;  4Z5T D;  2FJ7 B;  5F99 B;  1EQZ B;  3UTB A;  3TU4 C;  1KX4 C;  3AZH D;  4J8U C;  4R8P C;  5B0Y B;  3B6F B;  4J8V B;  2F8N B;  3H0R C;  3W97 D;  3NQU B;  3UTA B;  4JJN A;  2Y2M A;  2YFV A;  3KUY A;  3REH D;  4QLC D;  2Y2G A;  2DF4 C;  5CP6 B;  1U35 A;  3W98 D;  4YS3 C;  5GSU A;  5E5A A;  5B2J B;  5AV8 B;  3MGQ A;  1EQZ C;  2FJ7 C;  2G5I C;  3B0C W;  3MGR D;  1KX5 A;  5FUG B;  3AZF B;  3KUY B;  3AZG A;  3AV2 D;  3LZ1 A;  3UT9 C;  2PYO C;  3WAA C;  1BH9 B;  5GSU B;  5E5A B;  5AV5 A;  5DNN A;  3KXB B;  3MGQ B;  3UTA C;  1S32 D;  1P3K D;  3AZK D;  3AZI D;  3LZ1 B;  4WU8 D;  1F66 B;  3R45 B;  5B31 B;  3EPJ A;  4JJN C;  3AV1 D;  3KUY C;  4LD9 C;  3B6G B;  4WJ3 C;  3W99 A;  1U35 C;  5B33 D;  2RVQ C;  5GSU C;  5E5A C;  3MGQ C;  2G5H C;  1P3G A;  1P3M B;  1KX5 C;  3KSY A;  4KGC A;  1WWI A;  3KWQ A;  3F6T A;  5CPJ D;  3W99 B;  3LZ1 C;  2LY8 A;  4Z2M H;  4XZQ D;  1F66 C;  5AV5 C;  5DNN C;  4WU9 A;  3WTP A;  5AV9 A;  2ZY4 A;  3P5J B;  3AYW D;  5BNV B;  5B32 D;  3X1T B;  2NQB A;  4XUJ B;  3C1C A;  3REJ D;  5AV9 B;  3LJA B;  3AZL D;  1PZR A;  3VH5 W;  3W99 C;  4J8W A;  3IP4 C;  5B1L D;  4CSR B;  5GT0 A;  1P3O A;  1ID3 A;  4Z66 D;  1P3B B;  1P3G C;  5AVB A;  4H9N A;  3X1T C;  5B31 G;  3REK A;  5G49 B;  4Z2M G;  4WU9 C;  3WTP C;  3MGS B;  1P3F D;  5AV9 C;  3C1B A;  1M1A D;  1ZLA D;  4H9O B;  5B0Z A;  3WKJ A;  3B0B A;  1WWS A;  1P3B C;  2BYM A;  2IO5 C;  1BH8 B;  4M6B A;  1M18 D;  3X1S B;  3LEL B;  3MNN D;  1P3I A;  5BO0 A;  1P3O C;  1ID3 C;  3AZM D;  3X1V A;  3O62 B;  3AFA D;  2BYM B;  5AVB C;  1R4V A;  2CV5 B;  5B40 B;  5AV6 A;  5BO0 B;  5CHL B;  3EPK A;  3REK C;  3A6N B;  3X1V B;  2JSS A;  1T3U A;  5JRG B;  3REL A;  3C1B C;  3AZE B;  2Y2H A;  3X1S C;  3LEL C;  2HIO D;  3AZJ A;  4NE5 A;  1P3A A;  1P3P D;  1HQ3 B;  3O62 C;  4G92 B;  5CPI A;  4Z5T A;  3LZ0 D;  1JFI B;  3REI B;  3AZH A;  3A6N C;  3X1V C;  5JRG C;  3AZE C;  3W97 A;  2YFW B;  5AV6 C;  5CPK B;  2NZD B;  3B0D C;  1P3L B;  3REH A;  5C3I C;  4QLC A;  3TU4 B;  4G92 C;  1KX3 D;  2XD5 A;  3W98 A;  4R8P B;  3MGP D;  1B67 A;  3MGR A;  3REI C;  3A1I A;  1P3A C;  3AV2 A;  5B24 D;  4YS3 B;  2UWX A;  5CPK C;  2NZD C;  3NQJ A;  1S32 A;  1P3K A;  3AZK A;  3AZH C;  4ZUX D;  2RIQ A;  5BT1 D;  4UUZ B;  4X23 D;  3AZI A;  4H9Q B;  5B1M B;  4WU8 A;  3UT9 B;  2PYO B;  3EG5 B;  3W97 C;  3WAA B;  2L5A A;  3AV1 A;  2ZY2 A;  3REH C;  1S32 B;  3UTB B;  2JCH A;  4CAY A;  3AZK B;  1AOI D;  1HTA A;  3VH6 W;  5B33 A;  3W98 C;  3AZI B;  5JA4 A;  3MGR C;  4JJN B;  2YFV B;  3AV2 C;  5CPJ A;  2F8N H;  5AVC D;  5B1M C;  5GXQ D;  4XZQ A;  5GT3 D;  1U35 B;  1S32 C;  3MVD D;  3UTB C;  1P3K C;  4DRA A;  3AZK C;  1KX5 B;  3AYW A;  5B32 A;  4J8U D;  3AZG B;  3AZI C;  4ZBJ C;  3AV1 C;  5AV5 B;  5DNN B;  3REJ A;  3EPH A;  3AZL A;  3AYW B;  2F8N K;  5B1L A;  2FJ7 D;  5F99 D;  4Z66 A;  1EQZ D;  1A7W A;  1H3O A;  4NE3 A;  5B0Y D;  3AZG C;  4J8V D;  5CPJ C;  2F8N G;  3B6F D;  1N1J A;  3UTA D;  4DQY B;  3WA9 D;  3AN2 D;  1P3F A;  1P3G B;  1M1A A;  3AYW C;  5CP6 D;  4KGC B;  1ZLA A;  3KWQ B;  4J8X D;  3AZN D;  5B2J D;  5AV8 D;  4NFT A;  2Y2P A;  3AZF D;  3REJ C;  4WU9 B;  3WTP B;  3AZL C;  5BNX A;  1M18 A;  5KDM A;  3MNN A;  2RVQ D;  1Z2C B;  5B2I D;  4KHA A;  5B1L C;  5E5A D;  3KXB D;  1TAF A;  2Y2Q A;  3AZM A;  2NQB B;  3AFA A;  3C1C B;  4KGC C;  2IO5 B;  5BNX B;  3B0C T;  3KWQ C;  5KDM B;  4G91 B;  4J8W B;  1F66 D;  4KHA B;  5B31 D;  3AZM B;  5GT0 B;  1P3O B;  1ID3 B;  5AVB B;  1M1A C;  3B6G D;  1ZLA C;  4H9N B;  2Y2O A;  2NQB C;  1P3P A;  3REK B;  1P3M D;  3C1C C;  4YM6 D;  4LD9 A;  1M18 C;  3LZ0 A;  3C1B B;  5BS7 A;  5AY8 D;  3MNN C;  3EPL A;  4G91 C;  4J8W C;  5B0Z B;  3AL0 C;  3AZM C;  5GT0 C;  3WKJ B;  3AFA C;  4LD9 B;  3LZ0 B;  3X1T D;  4XUJ D;  1P3I B;  3H0M C;  1KX3 A;  1M19 D;  3LJA D;  3MGP A;  5AV6 B;  1TZY D;  3B0D B;  5B0Z C;  4HGA B;  5C3I B;  1P3B D;  3WKJ C;  3VH5 A;  5B24 A;  3MGP B;  3REL B;  3LZ0 C;  4NE6 A; 
#chains in the Genus database with same CATH homology
 5BS7 C;  2ARO D;  3AZJ B;  1P3I C;  3VH5 T;  4H9R A;  4ZUX A;  1P3A B;  3MGS D;  4X23 A;  2CWE A;  5CPI B;  2BYK A;  4KUD D;  4Z5T B;  1AOI A;  4HGA C;  1KX3 C;  3AZH B;  3MGP C;  5DNM D;  3REL C;  3X1S D;  3LEL D;  3W97 B;  2BYK B;  4WV4 B;  2JE5 A;  3AZJ C;  3REH B;  3KFU G;  4QLC B;  5AVC A;  3O62 D;  5GXQ A;  5GT3 A;  2CV5 D;  3W98 B;  5B24 C;  2VQR A;  5CPI C;  5B40 D;  2BG1 A;  1B6W A;  4Z5T C;  3MVD A;  4DRB A;  3V9R A;  3MGR B;  3A6N D;  2ZY3 A;  4ZUX C;  3X1U D;  5BT1 C;  4J8U A;  4X23 C;  5AVC B;  5JRG D;  3AV2 B;  3AZE D;  3NQJ B;  1AOI C;  2ZY5 A;  1P3K B;  1HQ3 D;  4QLC C;  1P34 D;  3W96 D;  2FJ7 A;  4WU8 B;  2FFF B;  5F99 A;  1EQZ A;  3REI D;  4ZBJ B;  2ZM5 A;  3AV1 B;  4CAY B;  5B0Y A;  5AVC C;  4J8V A;  3B6F A;  5GXQ C;  5B33 B;  2HUE C;  3NQU A;  3UTA A;  2NZD D;  5CPK D;  3WA9 A;  3AN2 A;  1P3L D;  3MVD C;  5JA4 B;  5CP6 A;  3TU4 D;  1KX4 D;  4J8X A;  4R8P D;  5CPJ B;  3AZN A;  5B2J A;  4XZQ B;  5AV8 A;  4WU8 C;  1BFM A;  3WA9 B;  5FUG A;  3AZF A;  3AN2 B;  4J8X B;  5B32 B;  1BH9 A;  5B2I A;  5B33 C;  3AZN B;  4YS3 D;  3KXB A;  5F99 C;  4H9P A;  2DQN C;  3REJ B;  3AZL B;  5B0Y C;  3B6F C;  4J8V C;  5B1M D;  5B2I B;  3UT9 D;  3R45 A;  4H9S A;  4XZQ C;  5B31 A;  1F66 A;  2F8N D;  2PYO D;  3WA9 C;  5B1L B;  3AN2 C;  3WAA D;  4Z66 B;  4H9P B;  3UTB D;  3B6G A;  5CP6 C;  4WZS B;  4J8X C;  5B32 C;  1H3O B;  1KU5 A;  3AZN C;  5B2J C;  5AV8 C;  1F1E A;  1N1J B;  1P3M A;  3AZF C;  4YM6 A;  4JJN D;  1P3F B;  3VH6 A;  3KUY D;  1M1A B;  3H0L C;  5AY8 A;  1U35 D;  5B2I C;  1ZLA B;  3VH6 T;  3KXB C;  5GSU D;  3MGQ D;  2Y2J A;  4Z66 C;  4YM6 B;  1KX5 D;  4UPK A;  5BNV A;  3A1K A;  3AZG D;  1M18 B;  3X1T A;  5AY8 B;  4XUJ A;  3MNN B;  3LZ1 D;  4H9S C;  5B31 C;  5AV5 D;  5DNN D;  1TAF B;  1M19 A;  1P3F C;  3AFA B;  3LJA A;  3B6G C;  5B32 G;  1TZY A;  2HIO A;  4CSR A;  1ULY A;  1P3B A;  1W2E A;  1P3M C;  4YM6 C;  1M19 B;  3WTP E;  4WNN A;  5AY8 C;  2ARO A;  3W99 D;  1TZY B;  2HIO B;  5G49 A;  3MGS A;  1P3P B;  2F2A C;  2Y2L A;  1P3G D;  4KGC D;  4H9O A;  3KWQ D;  4KUD A;  4WNN B;  2ARO B;  4XUJ C;  2Y2K A;  4WU9 D;  1BH8 A;  1M19 C;  3WTP D;  1Q9C A;  3LJA C;  5AV9 D;  5DNM A;  3X1S A;  3LEL A;  4KUD B;  1TZY C;  2HIO C;  2NQB D;  2Y2N A;  1P3P C;  3O62 A;  3C1C D;  4E45 A;  1KX3 B;  2J8P A;  2CV5 A;  5B40 A;  5DNM B;  2ARO C;  4J8W D;  3A6N A;  3X1U A;  5GT0 D;  3MGS C;  1P3O D;  1ID3 D;  5JRG A;  3AZE A;  5AVB D;  5B24 B;  4KUD C;  1HQ3 A;  3REK D;  3X1U B;  4H9R B;  4ZUX B;  1P34 A;  4X23 B;  2W8S A;  5DNM C;  3W96 A;  3C1B D;  1JFI A;  3REI A;  5B0Z D;  1AOI B;  3WKJ D;  4EO5 B;  1P34 B;  2CV5 C;  2YFW A;  5B40 C;  4LD9 D;  3W96 B;  5CPK A;  2NZD A;  1P3L A;  1P3I D;  3TU4 A;  1KX4 A;  3X1U C;  2XD1 A;  4R8P A;  4AWL B;  3X1V D;  5GXQ B;  5GT3 B;  2HUE B;  5AV6 D;  3MVD B;  3V9R B;  1HQ3 C;  1KX4 B;  4EO5 C;  4J8U B;  1P34 C;  3REL D;  3W96 C;  3FDD A;  4YS3 A;  4E44 A;  3AZJ D;  2Y2I A;  1P3A D;  4UUZ A;  4H9Q A;  5B1M A;  4AWL C;  3UT9 A;  2F8N A;  2PYO A;  5GT3 C;  5CPI D;  3WAA A;  1P3L C;  4Z5T D;  2FJ7 B;  5F99 B;  1EQZ B;  3UTB A;  3TU4 C;  1KX4 C;  3AZH D;  4J8U C;  4R8P C;  5B0Y B;  3B6F B;  4J8V B;  2F8N B;  3H0R C;  3W97 D;  3NQU B;  3UTA B;  4JJN A;  2Y2M A;  2YFV A;  3KUY A;  3REH D;  4QLC D;  2Y2G A;  2DF4 C;  5CP6 B;  1U35 A;  3W98 D;  4YS3 C;  5GSU A;  5E5A A;  5B2J B;  5AV8 B;  3MGQ A;  1EQZ C;  2FJ7 C;  2G5I C;  3B0C W;  3MGR D;  1KX5 A;  5FUG B;  3AZF B;  3KUY B;  3AZG A;  3AV2 D;  3LZ1 A;  3UT9 C;  2PYO C;  3WAA C;  1BH9 B;  5GSU B;  5E5A B;  5AV5 A;  5DNN A;  3KXB B;  3MGQ B;  3UTA C;  1S32 D;  1P3K D;  3AZK D;  3AZI D;  3LZ1 B;  4WU8 D;  1F66 B;  3R45 B;  5B31 B;  3EPJ A;  4JJN C;  3AV1 D;  3KUY C;  4LD9 C;  3B6G B;  4WJ3 C;  3W99 A;  1U35 C;  5B33 D;  2RVQ C;  5GSU C;  5E5A C;  3MGQ C;  2G5H C;  1P3G A;  1P3M B;  1KX5 C;  3KSY A;  4KGC A;  1WWI A;  3KWQ A;  3F6T A;  5CPJ D;  3W99 B;  3LZ1 C;  2LY8 A;  4Z2M H;  4XZQ D;  1F66 C;  5AV5 C;  5DNN C;  4WU9 A;  3WTP A;  5AV9 A;  2ZY4 A;  3P5J B;  3AYW D;  5BNV B;  5B32 D;  3X1T B;  2NQB A;  4XUJ B;  3C1C A;  3REJ D;  5AV9 B;  3LJA B;  3AZL D;  1PZR A;  3VH5 W;  3W99 C;  4J8W A;  3IP4 C;  5B1L D;  4CSR B;  5GT0 A;  1P3O A;  1ID3 A;  4Z66 D;  1P3B B;  1P3G C;  5AVB A;  4H9N A;  3X1T C;  5B31 G;  3REK A;  5G49 B;  4Z2M G;  4WU9 C;  3WTP C;  3MGS B;  1P3F D;  5AV9 C;  3C1B A;  1M1A D;  1ZLA D;  4H9O B;  5B0Z A;  3WKJ A;  3B0B A;  1WWS A;  1P3B C;  2BYM A;  2IO5 C;  1BH8 B;  4M6B A;  1M18 D;  3X1S B;  3LEL B;  3MNN D;  1P3I A;  5BO0 A;  1P3O C;  1ID3 C;  3AZM D;  3X1V A;  3O62 B;  3AFA D;  2BYM B;  5AVB C;  1R4V A;  2CV5 B;  5B40 B;  5AV6 A;  5BO0 B;  5CHL B;  3EPK A;  3REK C;  3A6N B;  3X1V B;  2JSS A;  1T3U A;  5JRG B;  3REL A;  3C1B C;  3AZE B;  2Y2H A;  3X1S C;  3LEL C;  2HIO D;  3AZJ A;  4NE5 A;  1P3A A;  1P3P D;  1HQ3 B;  3O62 C;  4G92 B;  5CPI A;  4Z5T A;  3LZ0 D;  1JFI B;  3REI B;  3AZH A;  3A6N C;  3X1V C;  5JRG C;  3AZE C;  3W97 A;  2YFW B;  5AV6 C;  5CPK B;  2NZD B;  3B0D C;  1P3L B;  3REH A;  5C3I C;  4QLC A;  3TU4 B;  4G92 C;  1KX3 D;  2XD5 A;  3W98 A;  4R8P B;  3MGP D;  1B67 A;  3MGR A;  3REI C;  3A1I A;  1P3A C;  3AV2 A;  5B24 D;  4YS3 B;  2UWX A;  5CPK C;  2NZD C;  3NQJ A;  1S32 A;  1P3K A;  3AZK A;  3AZH C;  4ZUX D;  2RIQ A;  5BT1 D;  4UUZ B;  4X23 D;  3AZI A;  4H9Q B;  5B1M B;  4WU8 A;  3UT9 B;  2PYO B;  3EG5 B;  3W97 C;  3WAA B;  2L5A A;  3AV1 A;  2ZY2 A;  3REH C;  1S32 B;  3UTB B;  2JCH A;  4CAY A;  3AZK B;  1AOI D;  1HTA A;  3VH6 W;  5B33 A;  3W98 C;  3AZI B;  5JA4 A;  3MGR C;  4JJN B;  2YFV B;  3AV2 C;  5CPJ A;  2F8N H;  5AVC D;  5B1M C;  5GXQ D;  4XZQ A;  5GT3 D;  1U35 B;  1S32 C;  3MVD D;  3UTB C;  1P3K C;  4DRA A;  3AZK C;  1KX5 B;  3AYW A;  5B32 A;  4J8U D;  3AZG B;  3AZI C;  4ZBJ C;  3AV1 C;  5AV5 B;  5DNN B;  3REJ A;  3EPH A;  3AZL A;  3AYW B;  2F8N K;  5B1L A;  2FJ7 D;  5F99 D;  4Z66 A;  1EQZ D;  1A7W A;  1H3O A;  4NE3 A;  5B0Y D;  3AZG C;  4J8V D;  5CPJ C;  2F8N G;  3B6F D;  1N1J A;  3UTA D;  4DQY B;  3WA9 D;  3AN2 D;  1P3F A;  1P3G B;  1M1A A;  3AYW C;  5CP6 D;  4KGC B;  1ZLA A;  3KWQ B;  4J8X D;  3AZN D;  5B2J D;  5AV8 D;  4NFT A;  2Y2P A;  3AZF D;  3REJ C;  4WU9 B;  3WTP B;  3AZL C;  5BNX A;  1M18 A;  5KDM A;  3MNN A;  2RVQ D;  1Z2C B;  5B2I D;  4KHA A;  5B1L C;  5E5A D;  3KXB D;  1TAF A;  2Y2Q A;  3AZM A;  2NQB B;  3AFA A;  3C1C B;  4KGC C;  2IO5 B;  5BNX B;  3B0C T;  3KWQ C;  5KDM B;  4G91 B;  4J8W B;  1F66 D;  4KHA B;  5B31 D;  3AZM B;  5GT0 B;  1P3O B;  1ID3 B;  5AVB B;  1M1A C;  3B6G D;  1ZLA C;  4H9N B;  2Y2O A;  2NQB C;  1P3P A;  3REK B;  1P3M D;  3C1C C;  4YM6 D;  4LD9 A;  1M18 C;  3LZ0 A;  3C1B B;  5BS7 A;  5AY8 D;  3MNN C;  3EPL A;  4G91 C;  4J8W C;  5B0Z B;  3AL0 C;  3AZM C;  5GT0 C;  3WKJ B;  3AFA C;  4LD9 B;  3LZ0 B;  3X1T D;  4XUJ D;  1P3I B;  3H0M C;  1KX3 A;  1M19 D;  3LJA D;  3MGP A;  5AV6 B;  1TZY D;  3B0D B;  5B0Z C;  4HGA B;  5C3I B;  1P3B D;  3WKJ C;  3VH5 A;  5B24 A;  3MGP B;  3REL B;  3LZ0 C;  4NE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...