5JRGC

Crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5jrgC00
4E45A 5B31G 1KX4C 4LD9B 5FUGA 1KX4A 1R4VA 5GXQD 3C1CD 3RELD 3KWQD 3W99A 3W97B 5AV5A 4WU8A 1P3OC 5AV8B 4UUZB 1M18A 1M18C 5E5AC 4YS3C 3MGQD 3W96B 3REJA 1Q9CA 4DRBA 3REIB 1P3BC 4XZQA 3B6FA 5GXQB 3B6FC 4JJNC 1P3PA 4JJNA 2CV5C 4Z66D 3TU4A 4R8PD 4X23B 5CP6D 3O62C 4KUDB 3X1UB 3O62A 5BNVB 2AROD 5GT0D 1EQZB 5GT0A 2L5AA 3O62D 4QLCB 3WKJA 3B0CT 3AYWB 3X1VD 3AZND 4Z66A 3REHC 3TU4D 1P3PD 4M6BA 4HGAB 5AY8D 3AZMC 4E44A 4XZQD 3REJD 3MVDA 2LY8A 3UTBB 1P3KB 4LD9A 1AOID 3W98D 4LD9C 1ZLAB 1P3OB 3W99D 2HUEC 3VH5A 1AOIC 3AZIA 3W98C 1KX4D 4LD9D 5AV8C 3MGRB 1M19B 4CSRA 3X1UC 5B2JC 5B2IB 3AZNA 3AV1A 3KXBD 3X1VA 5AVCB 2AROA 4KHAB 2PYOB 5CP6A 1F66C 4WV4B 1N1JA 3B0BA 2HIOA 4XUJB 4J8WA 1P3FD 4CAYA 3B6FD 5DNMD 1ZLAC 5B32A 1ID3D 5GT3D 5B40D 1M18D 4G91C 5AV5D 3AZMD 1JFIB 3AFAC 2FJ7C 3RELA 3C1CA 5B24C 1M19C 3R45A 1TZYC 5CPJA 3AZNB 2F8NB 1ULYA 5CPIB 5B2JB 1P3GA 5DNNA 4XUJD 5CP6C 1F66A 3UT9D 4NFTA 5B1LA 4XZQC 3LELA 3LJAB 4WU9D 3MGPB 3NQJB 5B0ZB 3REID 1U35C 3KUYA 3AZJA 3AN2A 5AV9B 5AY8C 5CHLB 4G92C 5CPKB 1P3LA 3REHD 5B0YA 3TU4C 3AZEC 3AFAA 2FJ7A 1KX5D 4WNNA 1KX5A 4Z66C 3REHA 3X1TC 4KGCA 2F8NG 3WKJC 1WWSA 3KUYD 3AZJD 5F99B 1S32A 1BH9A 4H9SA 3R45B 4J8VA 5DNNC 1P3IA 5B31B 1TZYB 4H9PB 2NZDB 3LZ1D 1ID3C 4YS3D 3MGQC 3AV2B 4H9OA 1P3GB 5GXQC 5B33D 5GSUD 1KX3D 3A6NC 4QLCD 3KUYB 3AZJB 5B1MB 4ZUXC 3X1SC 5AV9A 4ZBJC 5B0YC 3MGPC 5CPKA 3VH6T 5CP6B 1P3MA 4EO5B 1P3AC 5BNXB 5AV6B 3REHB 3B6FB 5B0ZC 1F1EA 4WNNB 5B1MD 5GT3A 5B40A 5AV8D 3WAAC 3NQUA 5AY8B 2NQBB 4J8WD 1P3FA 3AZLB 3LJAD 3AZEB 2NZDA 1JFIA 1ID3B 5JA4A 2BYMA 3AYWC 3LZ1B 3KXBB 5BT1C 4YM6B 3A6NA 3AZHA 4WZSB 4ZUXA 5F99D 3C1BB 5B31C 3AV1D 1P3AA 5B24A 3MGQB 5E5AA 1ZLAD 4NE6A 5B0ZA 1M1AC 3B6GC 5GT3C 4EO5C 5B40C 3AN2B 4J8UD 1WWIA 3UTBA 3KWQB 1P3FC 1ZLAA 5B2IC 4WU9B 5B2IA 3AV1B 4H9NB 5E5AD 3AZLA 3X1VB 1KX5B 3REJC 3WTPA 1P3OD 5AY8A 4CSRB 5JA4B 1P3AD 5AV6C 3VH6A 3MNNB 3WTPE 3VH5W 3AZHC 3AZEA 4ZUXD 5B33B 1KX3B 2F8ND 1TZYA 3MGPD 3X1TA 2PYOA 3UTAC 1H3OA 2YFWA 3W96D 5BO0A 4Z5TA 4YM6C 4WU8B 3MGQA 3MVDC 5AV8A 1B6WA 1M18B 5B1MA 5E5AB 3W97A 4WU8D 1BH8B 4AWLC 3AZFD 3MGRC 3AV1C 4J8UB 4J8XA 3KWQA 3X1SA 4J8XC 3KWQC 5AV9C 5GXQA 3MNNC 4NE3A 5CPKD 1P3PB 1P34D 5AV9D 1EQZC 3B6GB 3V9RA 1KX5C 5B33A 5B2JA 1KX3A 1P3FB 1F66B 3X1TB 1P3MC 3C1BD 3AZGA 4KUDD 5KDMB 1P3BD 3WAAA 2CV5D 4J8VC 3UT9B 1P3IC 3MGRD 4KUDC 5AVCD 2NZDC 3MGSC 2CWEA 4Z2MH 1S32D 3AV2C 5C3IB 3WA9B 3LZ0D 3UTAB 1AOIB 3W98B 3AZMB 3UTAD 3X1SB 3AFAD 2FJ7D 2RVQD 1P3KC 5AV6D 3V9RB 2JSSA 4H9RB 5DNMB 5B31A 5AVCC 5AVBC 5AVCA 4WU9A 1M1AA 3B6GA 1HQ3C 2AROB 3LELD 4XZQB 2CV5A 5JRGB 4J8VB 3UT9C 1P3IB 4DRAA 3KUYC 3AZJC 4JJNB 4XUJC 3AZGD 1F66D 1P3GD 4J8WB 3MGSB 4Z2MG 3UTBC 5B1LC 1M1AD 5GT0B 1P34C 1EQZD 1TAFA 1P34A 5CPJD 3MNND 3REKA 3KXBC 3REKC 5CPID 3B0CW 3WA9A 5AV6A 3AZMA 3WA9C 4Z5TB 1U35D 3C1CB 3UTAA 3AZFA 2BYKB 5G49A 5B32D 4NE5A 1ID3A 3LZ0A 5DNMA 2NQBA 3LZ0C 5AVBB 5B32G 2HIOD 5GT3B 5B40B 4H9SC 5JRGC 4YS3B 3AZIB 3MGRA 1KU5A 4YM6A 3A6NB 1HQ3B 1TZYD 3MGPA 3AZNC 1P3BA 2CV5B 5B1MC 3X1VC 4ZUXB 2BYMB 1M19D 5B1LB 3C1BA 1B67A 3KXBA 3NQJA 3AZHB 3REKB 2AROC 4R8PB 5B33C 3AZLD 1TAFB 5GT0C 1P34B 1KX3C 5B2ID 3AZID 2PYOC 4CAYB 1P3LB 3W99B 3X1SD 3AFAB 4J8WC 4UUZA 4J8XD 2FJ7B 4H9QB 3UTBD 4HGAC 2NQBC 5FUGB 1KX4B 4Z5TC 3WTPB 3AZFB 3W97D 3LZ0B 3AZGC 5B0ZD 1AOIA 3W98A 4H9NA 4H9PA 3TU4B 3MVDD 3RELB 3W97C 2HUEB 4Z5TD 3C1CC 2RVQC 1P3KD 3W96A 3W96C 3X1UD 3C1BC 3AV2A 3WKJD 4X23D 3AYWA 3AZIC 2PYOD 2F8NH 5BNVA 5BT1D 5DNNB 3X1TD 3A6ND 2F8NA 3VH6W 1HTAA 4X23A 3AYWD 3AV2D 4X23C 3X1UA 3O62B 4R8PA 3VH5T 4G92B 5CPKC 5BO0B 3AZED 1P3KA 5BNXA 4JJND 3LJAA 3W99C 2NZDD 4AWLB 1P3MB 3WTPD 1H3OB 1P3OA 3LELB 4Z66B 4J8XB 3WTPC 1P3PC 4H9QA 4J8UA 3RELC 1BH8A 5C3IC 1P3MD 4G91B 2BYKA 5G49B 5BS7A 5B24D 3B0DC 4KGCB 4KHAA 3AZFC 5F99A 3AZKC 2YFVB 1S32B 5F99C 3AZKA 1M19A 1BFMA 3AZHD 4YS3A 5CPJC 5DNMC 4YM6D 2IO5B 5AV5C 1HQ3A 4WU8C 1P3AB 5B32B 5KDMA 1P3GC 3AN2C 4KGCD 2NQBD 3KSYA 4J8UC 1N1JB 3LELC 3REJB 5AVBD 4H9RA 3AZLC 5BS7C 1U35A 1P3LD 3WA9D 1M1AB 5CPIA 3MNNA 3REKD 1EQZA 3NQUB 2YFVA 5B1LD 4QLCA 5JRGD 3MGSA 5GSUA 3WKJB 5GSUC 5CPJB 3B0DB 2HIOC 4KGCC 2F8NK 3AZKB 1S32C 2YFWB 5B32C 3LZ1A 5JRGA 3MGSD 3LZ1C 3MVDB 3B6GD 2IO5C 4J8VD 1P3ID 5B31D 5B24B 5AV5B 4ZBJB 5B0YB 1U35B 5AVBA 4R8PC 5CPIC 1BH9B 5B0YD 1A7WA 3AN2D 4QLCC 3REIA 3REIC 1P3BB 5GSUB 3LJAC 3WAAB 4WU9C 1HQ3D 3AZGB 3WAAD 4KUDA 3UT9A 4H9OB 3AZKD 2HIOB 4XUJA 5DNND 5B2JD 1P3LC
chains in the Genus database with same CATH superfamily
4E45A 5B31G 1Z2CB 2JCHA 1KX4C 4LD9B 5FUGA 1KX4A 1R4VA 5GXQD 3C1CD 3RELD 3KWQD 3W99A 3W97B 5AV5A 4WU8A 1P3OC 5AV8B 4UUZB 1M18A 1M18C 5E5AC 4YS3C 3MGQD 3W96B 3REJA 1Q9CA 4DRBA 3REIB 1P3BC 4XZQA 3B6FA 5GXQB 3B6FC 4JJNC 1P3PA 4JJNA 2CV5C 4Z66D 3TU4A 4R8PD 4X23B 5CP6D 3O62C 2FFFB 4KUDB 3X1UB 3O62A 3H0LC 5BNVB 2AROD 5GT0D 1EQZB 4UPKA 5GT0A 2L5AA 3IP4C 4QLCB 3O62D 3WKJA 3B0CT 3AYWB 3X1VD 3AZND 4Z66A 3REHC 3TU4D 1P3PD 4M6BA 4HGAB 5AY8D 3AZMC 4E44A 4XZQD 3REJD 3MVDA 2LY8A 3UTBB 1P3KB 4LD9A 1AOID 2JE5A 3W98D 4LD9C 1ZLAB 1P3OB 3W99D 2HUEC 3VH5A 1AOIC 3AZIA 3W98C 1KX4D 4LD9D 5AV8C 3MGRB 2G5IC 2Y2NA 1M19B 4CSRA 3X1UC 3AL0C 5B2JC 5B2IB 3AZNA 3AV1A 3KXBD 3X1VA 5AVCB 2G5HC 2AROA 4KHAB 2Y2PA 2PYOB 5CP6A 1F66C 2Y2LA 4WV4B 1N1JA 3B0BA 3EPJA 2HIOA 4XUJB 4J8WA 1P3FD 4CAYA 3B6FD 3EPHA 5DNMD 1ZLAC 5B32A 1ID3D 5GT3D 5B40D 1M18D 4G91C 5AV5D 3AZMD 1JFIB 3AFAC 2FJ7C 3RELA 3C1CA 5B24C 1M19C 3R45A 1TZYC 5CPJA 3AZNB 2F8NB 1ULYA 5CPIB 5B2JB 1P3GA 5DNNA 4XUJD 5CP6C 1F66A 3UT9D 4NFTA 5B1LA 4XZQC 3LELA 3LJAB 4WU9D 3MGPB 3NQJB 5B0ZB 3REID 1U35C 3KUYA 3AZJA 2DQNC 3AN2A 5AV9B 5AY8C 5CHLB 4G92C 5CPKB 1P3LA 3REHD 5B0YA 3TU4C 3AZEC 2VQRA 3AFAA 2FJ7A 1KX5D 4WNNA 1KX5A 4Z66C 3REHA 3X1TC 2F2AC 4KGCA 2F8NG 2UWXA 3WKJC 1WWSA 3KUYD 3AZJD 5F99B 1S32A 1BH9A 4H9SA 3R45B 4J8VA 5DNNC 1P3IA 5B31B 1TZYB 4H9PB 2NZDB 2Y2GA 3LZ1D 1ID3C 4YS3D 3MGQC 3AV2B 4H9OA 1P3GB 5GXQC 5B33D 5GSUD 2ZY2A 3A6NC 4QLCD 1KX3D 3KUYB 3AZJB 5B1MB 4ZUXC 3X1SC 5AV9A 1PZRA 4ZBJC 5B0YC 2RIQA 3MGPC 5CPKA 3VH6T 2XD5A 5CP6B 1P3MA 4EO5B 1P3AC 5BNXB 5AV6B 3REHB 3B6FB 5B0ZC 1F1EA 4WNNB 3H0RC 5B1MD 5GT3A 5B40A 5AV8D 3WAAC 3NQUA 5AY8B 2NQBB 4J8WD 1P3FA 3AZLB 3LJAD 3AZEB 2NZDA 1JFIA 1ID3B 5JA4A 2BYMA 3AYWC 3P5JB 3LZ1B 3KXBB 5BT1C 4YM6B 3A6NA 3AZHA 4WZSB 4ZUXA 5F99D 3C1BB 4DQYB 5B31C 3AV1D 1P3AA 5B24A 3MGQB 5E5AA 2BG1A 1ZLAD 4NE6A 5B0ZA 1M1AC 3B6GC 5GT3C 4EO5C 5B40C 3AN2B 4J8UD 1WWIA 3UTBA 3KWQB 1P3FC 3EG5B 1ZLAA 5B2IC 4WU9B 5B2IA 3AV1B 4H9NB 5E5AD 3AZLA 3X1VB 1KX5B 3REJC 3WTPA 1P3OD 5AY8A 4CSRB 5JA4B 1P3AD 5AV6C 3VH6A 3MNNB 3WTPE 3VH5W 3AZHC 3AZEA 4ZUXD 5B33B 1KX3B 2F8ND 1TZYA 3MGPD 3X1TA 2PYOA 3UTAC 1H3OA 2YFWA 3W96D 2Y2MA 5BO0A 4Z5TA 4YM6C 4WU8B 3MGQA 3MVDC 5AV8A 1B6WA 1M18B 5B1MA 5E5AB 3W97A 4WU8D 1BH8B 4AWLC 3AZFD 3MGRC 3AV1C 4J8UB 4J8XA 3KWQA 3X1SA 4J8XC 3KWQC 5AV9C 5GXQA 3MNNC 4NE3A 5CPKD 1P3PB 3EPLA 5AV9D 1P34D 1EQZC 3B6GB 3V9RA 1KX5C 5B33A 5B2JA 1KX3A 1P3FB 1F66B 3X1TB 1P3MC 3C1BD 3AZGA 3EPKA 2Y2JA 5KDMB 1P3BD 3WAAA 2CV5D 4J8VC 3UT9B 1P3IC 4KUDD 3MGRD 4KUDC 5AVCD 2NZDC 3MGSC 2CWEA 4Z2MH 1S32D 3AV2C 5C3IB 3WA9B 2J8PA 3LZ0D 3UTAB 1AOIB 3W98B 3AZMB 3H0MC 3UTAD 3X1SB 3AFAD 2FJ7D 2RVQD 1P3KC 5AV6D 3V9RB 2JSSA 4H9RB 5DNMB 3KFUG 5B31A 5AVCC 5AVBC 2ZY3A 5AVCA 4WU9A 1M1AA 3B6GA 1HQ3C 2AROB 3LELD 4XZQB 2CV5A 5JRGB 4J8VB 3UT9C 1P3IB 4DRAA 3KUYC 3AZJC 4JJNB 4XUJC 3AZGD 1F66D 1P3GD 4J8WB 3MGSB 4Z2MG 2Y2IA 3UTBC 5B1LC 1M1AD 5GT0B 1P34C 1EQZD 1TAFA 1P34A 5CPJD 3MNND 3REKA 3KXBC 3REKC 5CPID 3B0CW 3WA9A 5AV6A 3AZMA 3WA9C 4Z5TB 1U35D 3C1CB 3UTAA 3AZFA 3A1IA 2BYKB 5G49A 5B32D 4NE5A 1ID3A 3LZ0A 5DNMA 2NQBA 3LZ0C 5AVBB 5B32G 2HIOD 5GT3B 5B40B 4H9SC 5JRGC 4YS3B 3AZIB 1W2EA 3MGRA 1KU5A 4YM6A 3A6NB 1HQ3B 1TZYD 3MGPA 3AZNC 1P3BA 2CV5B 5B1MC 3X1VC 4ZUXB 2BYMB 3FDDA 1M19D 5B1LB 3C1BA 1B67A 3KXBA 3NQJA 3AZHB 3REKB 2AROC 4R8PB 5B33C 3AZLD 1TAFB 5GT0C 1P34B 1T3UA 5B2ID 3AZID 1KX3C 4CAYB 1P3LB 2PYOC 3W99B 3X1SD 3AFAB 4J8WC 4UUZA 4J8XD 2FJ7B 4H9QB 3UTBD 4HGAC 4WJ3C 2NQBC 5FUGB 1KX4B 4Z5TC 2DF4C 2ZY5A 3WTPB 3AZFB 3W97D 3LZ0B 3AZGC 5B0ZD 1AOIA 3W98A 4H9NA 4H9PA 3TU4B 3MVDD 3RELB 3W97C 2HUEB 4Z5TD 3C1CC 2RVQC 1P3KD 3W96A 3W96C 3X1UD 3C1BC 3AV2A 3WKJD 4X23D 3AYWA 3AZIC 2PYOD 2F8NH 5BNVA 5BT1D 5DNNB 3X1TD 3A6ND 2F8NA 3VH6W 1HTAA 4X23A 3AYWD 3AV2D 4X23C 3X1UA 3O62B 4R8PA 3VH5T 4G92B 5CPKC 5BO0B 3AZED 1P3KA 5BNXA 4JJND 2Y2HA 3LJAA 3W99C 2NZDD 4AWLB 1P3MB 3WTPD 1H3OB 1P3OA 3LELB 4Z66B 4J8XB 3WTPC 1P3PC 4H9QA 4J8UA 3RELC 1BH8A 5C3IC 1P3MD 4G91B 2BYKA 5G49B 5BS7A 2ZY4A 5B24D 3B0DC 4KGCB 3F6TA 4KHAA 3AZFC 5F99A 3AZKC 2YFVB 1S32B 5F99C 3AZKA 1M19A 1BFMA 3AZHD 4YS3A 5CPJC 5DNMC 4YM6D 2IO5B 5AV5C 1HQ3A 4WU8C 1P3AB 5B32B 5KDMA 1P3GC 3AN2C 4KGCD 2NQBD 3KSYA 4J8UC 1N1JB 2Y2KA 2Y2OA 3LELC 3A1KA 3REJB 5AVBD 4H9RA 3AZLC 5BS7C 1U35A 1P3LD 3WA9D 1M1AB 5CPIA 3MNNA 3REKD 2Y2QA 1EQZA 3NQUB 2YFVA 5JRGD 5B1LD 4QLCA 3MGSA 5GSUA 3WKJB 5GSUC 5CPJB 3B0DB 2HIOC 4KGCC 2F8NK 3AZKB 1S32C 2YFWB 5B32C 3LZ1A 5JRGA 3MGSD 3LZ1C 3MVDB 3B6GD 2IO5C 4J8VD 1P3ID 5B31D 5B24B 2W8SA 5AV5B 4ZBJB 5B0YB 1U35B 5AVBA 4R8PC 5CPIC 1BH9B 2ZM5A 5B0YD 1A7WA 3AN2D 4QLCC 3REIA 3REIC 1P3BB 5GSUB 3LJAC 3WAAB 4WU9C 1HQ3D 2XD1A 3AZGB 3WAAD 4KUDA 3UT9A 4H9OB 3AZKD 2HIOB 4XUJA 5DNND 5B2JD 1P3LC
chains in the Genus database with same CATH topology
4E45A 5B31G 1Z2CB 2JCHA 1KX4C 4LD9B 5FUGA 1KX4A 1R4VA 5GXQD 3C1CD 3RELD 3KWQD 3W99A 3W97B 5AV5A 4WU8A 1P3OC 5AV8B 4UUZB 1M18A 1M18C 5E5AC 4YS3C 3MGQD 3W96B 3REJA 1Q9CA 4DRBA 3REIB 1P3BC 4XZQA 3B6FA 5GXQB 3B6FC 4JJNC 1P3PA 4JJNA 2CV5C 4Z66D 3TU4A 4R8PD 4X23B 5CP6D 3O62C 2FFFB 4KUDB 3X1UB 3O62A 3H0LC 5BNVB 2AROD 5GT0D 1EQZB 4UPKA 5GT0A 2L5AA 3IP4C 4QLCB 3O62D 3WKJA 3B0CT 3AYWB 3X1VD 3AZND 4Z66A 3REHC 3TU4D 1P3PD 4M6BA 4HGAB 5AY8D 3AZMC 4E44A 4XZQD 3REJD 3MVDA 2LY8A 3UTBB 1P3KB 4LD9A 1AOID 2JE5A 3W98D 4LD9C 1ZLAB 1P3OB 3W99D 2HUEC 3VH5A 1AOIC 3AZIA 3W98C 1KX4D 4LD9D 5AV8C 3MGRB 2G5IC 2Y2NA 1M19B 4CSRA 3X1UC 3AL0C 5B2JC 5B2IB 3AZNA 3AV1A 3KXBD 3X1VA 5AVCB 2G5HC 2AROA 4KHAB 2Y2PA 2PYOB 5CP6A 1F66C 2Y2LA 4WV4B 1N1JA 3B0BA 3EPJA 2HIOA 4XUJB 4J8WA 1P3FD 4CAYA 3B6FD 3EPHA 5DNMD 1ZLAC 5B32A 1ID3D 5GT3D 5B40D 1M18D 4G91C 5AV5D 3AZMD 1JFIB 3AFAC 2FJ7C 3RELA 3C1CA 5B24C 1M19C 3R45A 1TZYC 5CPJA 3AZNB 2F8NB 1ULYA 5CPIB 5B2JB 1P3GA 5DNNA 4XUJD 5CP6C 1F66A 3UT9D 4NFTA 5B1LA 4XZQC 3LELA 3LJAB 4WU9D 3MGPB 3NQJB 5B0ZB 3REID 1U35C 3KUYA 3AZJA 2DQNC 3AN2A 5AV9B 5AY8C 5CHLB 4G92C 5CPKB 1P3LA 3REHD 5B0YA 3TU4C 3AZEC 2VQRA 3AFAA 2FJ7A 1KX5D 4WNNA 1KX5A 4Z66C 3REHA 3X1TC 2F2AC 4KGCA 2F8NG 2UWXA 3WKJC 1WWSA 3KUYD 3AZJD 5F99B 1S32A 1BH9A 4H9SA 3R45B 4J8VA 5DNNC 1P3IA 5B31B 1TZYB 4H9PB 2NZDB 2Y2GA 3LZ1D 1ID3C 4YS3D 3MGQC 3AV2B 4H9OA 1P3GB 5GXQC 5B33D 5GSUD 2ZY2A 3A6NC 4QLCD 1KX3D 3KUYB 3AZJB 5B1MB 4ZUXC 3X1SC 5AV9A 1PZRA 4ZBJC 5B0YC 2RIQA 3MGPC 5CPKA 3VH6T 2XD5A 5CP6B 1P3MA 4EO5B 1P3AC 5BNXB 5AV6B 3REHB 3B6FB 5B0ZC 1F1EA 4WNNB 3H0RC 5B1MD 5GT3A 5B40A 5AV8D 3WAAC 3NQUA 5AY8B 2NQBB 4J8WD 1P3FA 3AZLB 3LJAD 3AZEB 2NZDA 1JFIA 1ID3B 5JA4A 2BYMA 3AYWC 3P5JB 3LZ1B 3KXBB 5BT1C 4YM6B 3A6NA 3AZHA 4WZSB 4ZUXA 5F99D 3C1BB 4DQYB 5B31C 3AV1D 1P3AA 5B24A 3MGQB 5E5AA 2BG1A 1ZLAD 4NE6A 5B0ZA 1M1AC 3B6GC 5GT3C 4EO5C 5B40C 3AN2B 4J8UD 1WWIA 3UTBA 3KWQB 1P3FC 3EG5B 1ZLAA 5B2IC 4WU9B 5B2IA 3AV1B 4H9NB 5E5AD 3AZLA 3X1VB 1KX5B 3REJC 3WTPA 1P3OD 5AY8A 4CSRB 5JA4B 1P3AD 5AV6C 3VH6A 3MNNB 3WTPE 3VH5W 3AZHC 3AZEA 4ZUXD 5B33B 1KX3B 2F8ND 1TZYA 3MGPD 3X1TA 2PYOA 3UTAC 1H3OA 2YFWA 3W96D 2Y2MA 5BO0A 4Z5TA 4YM6C 4WU8B 3MGQA 3MVDC 5AV8A 1B6WA 1M18B 5B1MA 5E5AB 3W97A 4WU8D 1BH8B 4AWLC 3AZFD 3MGRC 3AV1C 4J8UB 4J8XA 3KWQA 3X1SA 4J8XC 3KWQC 5AV9C 5GXQA 3MNNC 4NE3A 5CPKD 1P3PB 3EPLA 5AV9D 1P34D 1EQZC 3B6GB 3V9RA 1KX5C 5B33A 5B2JA 1KX3A 1P3FB 1F66B 3X1TB 1P3MC 3C1BD 3AZGA 3EPKA 2Y2JA 5KDMB 1P3BD 3WAAA 2CV5D 4J8VC 3UT9B 1P3IC 4KUDD 3MGRD 4KUDC 5AVCD 2NZDC 3MGSC 2CWEA 4Z2MH 1S32D 3AV2C 5C3IB 3WA9B 2J8PA 3LZ0D 3UTAB 1AOIB 3W98B 3AZMB 3H0MC 3UTAD 3X1SB 3AFAD 2FJ7D 2RVQD 1P3KC 5AV6D 3V9RB 2JSSA 4H9RB 5DNMB 3KFUG 5B31A 5AVCC 5AVBC 2ZY3A 5AVCA 4WU9A 1M1AA 3B6GA 1HQ3C 2AROB 3LELD 4XZQB 2CV5A 5JRGB 4J8VB 3UT9C 1P3IB 4DRAA 3KUYC 3AZJC 4JJNB 4XUJC 3AZGD 1F66D 1P3GD 4J8WB 3MGSB 4Z2MG 2Y2IA 3UTBC 5B1LC 1M1AD 5GT0B 1P34C 1EQZD 1TAFA 1P34A 5CPJD 3MNND 3REKA 3KXBC 3REKC 5CPID 3B0CW 3WA9A 5AV6A 3AZMA 3WA9C 4Z5TB 1U35D 3C1CB 3UTAA 3AZFA 3A1IA 2BYKB 5G49A 5B32D 4NE5A 1ID3A 3LZ0A 5DNMA 2NQBA 3LZ0C 5AVBB 5B32G 2HIOD 5GT3B 5B40B 4H9SC 5JRGC 4YS3B 3AZIB 1W2EA 3MGRA 1KU5A 4YM6A 3A6NB 1HQ3B 1TZYD 3MGPA 3AZNC 1P3BA 2CV5B 5B1MC 3X1VC 4ZUXB 2BYMB 3FDDA 1M19D 5B1LB 3C1BA 1B67A 3KXBA 3NQJA 3AZHB 3REKB 2AROC 4R8PB 5B33C 3AZLD 1TAFB 5GT0C 1P34B 1T3UA 5B2ID 3AZID 1KX3C 4CAYB 1P3LB 2PYOC 3W99B 3X1SD 3AFAB 4J8WC 4UUZA 4J8XD 2FJ7B 4H9QB 3UTBD 4HGAC 4WJ3C 2NQBC 5FUGB 1KX4B 4Z5TC 2DF4C 2ZY5A 3WTPB 3AZFB 3W97D 3LZ0B 3AZGC 5B0ZD 1AOIA 3W98A 4H9NA 4H9PA 3TU4B 3MVDD 3RELB 3W97C 2HUEB 4Z5TD 3C1CC 2RVQC 1P3KD 3W96A 3W96C 3X1UD 3C1BC 3AV2A 3WKJD 4X23D 3AYWA 3AZIC 2PYOD 2F8NH 5BNVA 5BT1D 5DNNB 3X1TD 3A6ND 2F8NA 3VH6W 1HTAA 4X23A 3AYWD 3AV2D 4X23C 3X1UA 3O62B 4R8PA 3VH5T 4G92B 5CPKC 5BO0B 3AZED 1P3KA 5BNXA 4JJND 2Y2HA 3LJAA 3W99C 2NZDD 4AWLB 1P3MB 3WTPD 1H3OB 1P3OA 3LELB 4Z66B 4J8XB 3WTPC 1P3PC 4H9QA 4J8UA 3RELC 1BH8A 5C3IC 1P3MD 4G91B 2BYKA 5G49B 5BS7A 2ZY4A 5B24D 3B0DC 4KGCB 3F6TA 4KHAA 3AZFC 5F99A 3AZKC 2YFVB 1S32B 5F99C 3AZKA 1M19A 1BFMA 3AZHD 4YS3A 5CPJC 5DNMC 4YM6D 2IO5B 5AV5C 1HQ3A 4WU8C 1P3AB 5B32B 5KDMA 1P3GC 3AN2C 4KGCD 2NQBD 3KSYA 4J8UC 1N1JB 2Y2KA 2Y2OA 3LELC 3A1KA 3REJB 5AVBD 4H9RA 3AZLC 5BS7C 1U35A 1P3LD 3WA9D 1M1AB 5CPIA 3MNNA 3REKD 2Y2QA 1EQZA 3NQUB 2YFVA 5JRGD 5B1LD 4QLCA 3MGSA 5GSUA 3WKJB 5GSUC 5CPJB 3B0DB 2HIOC 4KGCC 2F8NK 3AZKB 1S32C 2YFWB 5B32C 3LZ1A 5JRGA 3MGSD 3LZ1C 3MVDB 3B6GD 2IO5C 4J8VD 1P3ID 5B31D 5B24B 2W8SA 5AV5B 4ZBJB 5B0YB 1U35B 5AVBA 4R8PC 5CPIC 1BH9B 2ZM5A 5B0YD 1A7WA 3AN2D 4QLCC 3REIA 3REIC 1P3BB 5GSUB 3LJAC 3WAAB 4WU9C 1HQ3D 2XD1A 3AZGB 3WAAD 4KUDA 3UT9A 4H9OB 3AZKD 2HIOB 4XUJA 5DNND 5B2JD 1P3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E45 A;  5B31 G;  1KX4 C;  4LD9 B;  5FUG A;  1KX4 A;  1R4V A;  5GXQ D;  3C1C D;  3REL D;  3KWQ D;  3W99 A;  3W97 B;  5AV5 A;  4WU8 A;  1P3O C;  5AV8 B;  4UUZ B;  1M18 A;  1M18 C;  5E5A C;  4YS3 C;  3MGQ D;  3W96 B;  3REJ A;  1Q9C A;  4DRB A;  3REI B;  1P3B C;  4XZQ A;  3B6F A;  5GXQ B;  3B6F C;  4JJN C;  1P3P A;  4JJN A;  2CV5 C;  4Z66 D;  3TU4 A;  4R8P D;  4X23 B;  5CP6 D;  3O62 C;  4KUD B;  3X1U B;  3O62 A;  5BNV B;  2ARO D;  5GT0 D;  1EQZ B;  5GT0 A;  2L5A A;  3O62 D;  4QLC B;  3WKJ A;  3B0C T;  3AYW B;  3X1V D;  3AZN D;  4Z66 A;  3REH C;  3TU4 D;  1P3P D;  4M6B A;  4HGA B;  5AY8 D;  3AZM C;  4E44 A;  4XZQ D;  3REJ D;  3MVD A;  2LY8 A;  3UTB B;  1P3K B;  4LD9 A;  1AOI D;  3W98 D;  4LD9 C;  1ZLA B;  1P3O B;  3W99 D;  2HUE C;  3VH5 A;  1AOI C;  3AZI A;  3W98 C;  1KX4 D;  4LD9 D;  5AV8 C;  3MGR B;  1M19 B;  4CSR A;  3X1U C;  5B2J C;  5B2I B;  3AZN A;  3AV1 A;  3KXB D;  3X1V A;  5AVC B;  2ARO A;  4KHA B;  2PYO B;  5CP6 A;  1F66 C;  4WV4 B;  1N1J A;  3B0B A;  2HIO A;  4XUJ B;  4J8W A;  1P3F D;  4CAY A;  3B6F D;  5DNM D;  1ZLA C;  5B32 A;  1ID3 D;  5GT3 D;  5B40 D;  1M18 D;  4G91 C;  5AV5 D;  3AZM D;  1JFI B;  3AFA C;  2FJ7 C;  3REL A;  3C1C A;  5B24 C;  1M19 C;  3R45 A;  1TZY C;  5CPJ A;  3AZN B;  2F8N B;  1ULY A;  5CPI B;  5B2J B;  1P3G A;  5DNN A;  4XUJ D;  5CP6 C;  1F66 A;  3UT9 D;  4NFT A;  5B1L A;  4XZQ C;  3LEL A;  3LJA B;  4WU9 D;  3MGP B;  3NQJ B;  5B0Z B;  3REI D;  1U35 C;  3KUY A;  3AZJ A;  3AN2 A;  5AV9 B;  5AY8 C;  5CHL B;  4G92 C;  5CPK B;  1P3L A;  3REH D;  5B0Y A;  3TU4 C;  3AZE C;  3AFA A;  2FJ7 A;  1KX5 D;  4WNN A;  1KX5 A;  4Z66 C;  3REH A;  3X1T C;  4KGC A;  2F8N G;  3WKJ C;  1WWS A;  3KUY D;  3AZJ D;  5F99 B;  1S32 A;  1BH9 A;  4H9S A;  3R45 B;  4J8V A;  5DNN C;  1P3I A;  5B31 B;  1TZY B;  4H9P B;  2NZD B;  3LZ1 D;  1ID3 C;  4YS3 D;  3MGQ C;  3AV2 B;  4H9O A;  1P3G B;  5GXQ C;  5B33 D;  5GSU D;  1KX3 D;  3A6N C;  4QLC D;  3KUY B;  3AZJ B;  5B1M B;  4ZUX C;  3X1S C;  5AV9 A;  4ZBJ C;  5B0Y C;  3MGP C;  5CPK A;  3VH6 T;  5CP6 B;  1P3M A;  4EO5 B;  1P3A C;  5BNX B;  5AV6 B;  3REH B;  3B6F B;  5B0Z C;  1F1E A;  4WNN B;  5B1M D;  5GT3 A;  5B40 A;  5AV8 D;  3WAA C;  3NQU A;  5AY8 B;  2NQB B;  4J8W D;  1P3F A;  3AZL B;  3LJA D;  3AZE B;  2NZD A;  1JFI A;  1ID3 B;  5JA4 A;  2BYM A;  3AYW C;  3LZ1 B;  3KXB B;  5BT1 C;  4YM6 B;  3A6N A;  3AZH A;  4WZS B;  4ZUX A;  5F99 D;  3C1B B;  5B31 C;  3AV1 D;  1P3A A;  5B24 A;  3MGQ B;  5E5A A;  1ZLA D;  4NE6 A;  5B0Z A;  1M1A C;  3B6G C;  5GT3 C;  4EO5 C;  5B40 C;  3AN2 B;  4J8U D;  1WWI A;  3UTB A;  3KWQ B;  1P3F C;  1ZLA A;  5B2I C;  4WU9 B;  5B2I A;  3AV1 B;  4H9N B;  5E5A D;  3AZL A;  3X1V B;  1KX5 B;  3REJ C;  3WTP A;  1P3O D;  5AY8 A;  4CSR B;  5JA4 B;  1P3A D;  5AV6 C;  3VH6 A;  3MNN B;  3WTP E;  3VH5 W;  3AZH C;  3AZE A;  4ZUX D;  5B33 B;  1KX3 B;  2F8N D;  1TZY A;  3MGP D;  3X1T A;  2PYO A;  3UTA C;  1H3O A;  2YFW A;  3W96 D;  5BO0 A;  4Z5T A;  4YM6 C;  4WU8 B;  3MGQ A;  3MVD C;  5AV8 A;  1B6W A;  1M18 B;  5B1M A;  5E5A B;  3W97 A;  4WU8 D;  1BH8 B;  4AWL C;  3AZF D;  3MGR C;  3AV1 C;  4J8U B;  4J8X A;  3KWQ A;  3X1S A;  4J8X C;  3KWQ C;  5AV9 C;  5GXQ A;  3MNN C;  4NE3 A;  5CPK D;  1P3P B;  1P34 D;  5AV9 D;  1EQZ C;  3B6G B;  3V9R A;  1KX5 C;  5B33 A;  5B2J A;  1KX3 A;  1P3F B;  1F66 B;  3X1T B;  1P3M C;  3C1B D;  3AZG A;  4KUD D;  5KDM B;  1P3B D;  3WAA A;  2CV5 D;  4J8V C;  3UT9 B;  1P3I C;  3MGR D;  4KUD C;  5AVC D;  2NZD C;  3MGS C;  2CWE A;  4Z2M H;  1S32 D;  3AV2 C;  5C3I B;  3WA9 B;  3LZ0 D;  3UTA B;  1AOI B;  3W98 B;  3AZM B;  3UTA D;  3X1S B;  3AFA D;  2FJ7 D;  2RVQ D;  1P3K C;  5AV6 D;  3V9R B;  2JSS A;  4H9R B;  5DNM B;  5B31 A;  5AVC C;  5AVB C;  5AVC A;  4WU9 A;  1M1A A;  3B6G A;  1HQ3 C;  2ARO B;  3LEL D;  4XZQ B;  2CV5 A;  5JRG B;  4J8V B;  3UT9 C;  1P3I B;  4DRA A;  3KUY C;  3AZJ C;  4JJN B;  4XUJ C;  3AZG D;  1F66 D;  1P3G D;  4J8W B;  3MGS B;  4Z2M G;  3UTB C;  5B1L C;  1M1A D;  5GT0 B;  1P34 C;  1EQZ D;  1TAF A;  1P34 A;  5CPJ D;  3MNN D;  3REK A;  3KXB C;  3REK C;  5CPI D;  3B0C W;  3WA9 A;  5AV6 A;  3AZM A;  3WA9 C;  4Z5T B;  1U35 D;  3C1C B;  3UTA A;  3AZF A;  2BYK B;  5G49 A;  5B32 D;  4NE5 A;  1ID3 A;  3LZ0 A;  5DNM A;  2NQB A;  3LZ0 C;  5AVB B;  5B32 G;  2HIO D;  5GT3 B;  5B40 B;  4H9S C;  5JRG C;  4YS3 B;  3AZI B;  3MGR A;  1KU5 A;  4YM6 A;  3A6N B;  1HQ3 B;  1TZY D;  3MGP A;  3AZN C;  1P3B A;  2CV5 B;  5B1M C;  3X1V C;  4ZUX B;  2BYM B;  1M19 D;  5B1L B;  3C1B A;  1B67 A;  3KXB A;  3NQJ A;  3AZH B;  3REK B;  2ARO C;  4R8P B;  5B33 C;  3AZL D;  1TAF B;  5GT0 C;  1P34 B;  1KX3 C;  5B2I D;  3AZI D;  2PYO C;  4CAY B;  1P3L B;  3W99 B;  3X1S D;  3AFA B;  4J8W C;  4UUZ A;  4J8X D;  2FJ7 B;  4H9Q B;  3UTB D;  4HGA C;  2NQB C;  5FUG B;  1KX4 B;  4Z5T C;  3WTP B;  3AZF B;  3W97 D;  3LZ0 B;  3AZG C;  5B0Z D;  1AOI A;  3W98 A;  4H9N A;  4H9P A;  3TU4 B;  3MVD D;  3REL B;  3W97 C;  2HUE B;  4Z5T D;  3C1C C;  2RVQ C;  1P3K D;  3W96 A;  3W96 C;  3X1U D;  3C1B C;  3AV2 A;  3WKJ D;  4X23 D;  3AYW A;  3AZI C;  2PYO D;  2F8N H;  5BNV A;  5BT1 D;  5DNN B;  3X1T D;  3A6N D;  2F8N A;  3VH6 W;  1HTA A;  4X23 A;  3AYW D;  3AV2 D;  4X23 C;  3X1U A;  3O62 B;  4R8P A;  3VH5 T;  4G92 B;  5CPK C;  5BO0 B;  3AZE D;  1P3K A;  5BNX A;  4JJN D;  3LJA A;  3W99 C;  2NZD D;  4AWL B;  1P3M B;  3WTP D;  1H3O B;  1P3O A;  3LEL B;  4Z66 B;  4J8X B;  3WTP C;  1P3P C;  4H9Q A;  4J8U A;  3REL C;  1BH8 A;  5C3I C;  1P3M D;  4G91 B;  2BYK A;  5G49 B;  5BS7 A;  5B24 D;  3B0D C;  4KGC B;  4KHA A;  3AZF C;  5F99 A;  3AZK C;  2YFV B;  1S32 B;  5F99 C;  3AZK A;  1M19 A;  1BFM A;  3AZH D;  4YS3 A;  5CPJ C;  5DNM C;  4YM6 D;  2IO5 B;  5AV5 C;  1HQ3 A;  4WU8 C;  1P3A B;  5B32 B;  5KDM A;  1P3G C;  3AN2 C;  4KGC D;  2NQB D;  3KSY A;  4J8U C;  1N1J B;  3LEL C;  3REJ B;  5AVB D;  4H9R A;  3AZL C;  5BS7 C;  1U35 A;  1P3L D;  3WA9 D;  1M1A B;  5CPI A;  3MNN A;  3REK D;  1EQZ A;  3NQU B;  2YFV A;  5B1L D;  4QLC A;  5JRG D;  3MGS A;  5GSU A;  3WKJ B;  5GSU C;  5CPJ B;  3B0D B;  2HIO C;  4KGC C;  2F8N K;  3AZK B;  1S32 C;  2YFW B;  5B32 C;  3LZ1 A;  5JRG A;  3MGS D;  3LZ1 C;  3MVD B;  3B6G D;  2IO5 C;  4J8V D;  1P3I D;  5B31 D;  5B24 B;  5AV5 B;  4ZBJ B;  5B0Y B;  1U35 B;  5AVB A;  4R8P C;  5CPI C;  1BH9 B;  5B0Y D;  1A7W A;  3AN2 D;  4QLC C;  3REI A;  3REI C;  1P3B B;  5GSU B;  3LJA C;  3WAA B;  4WU9 C;  1HQ3 D;  3AZG B;  3WAA D;  4KUD A;  3UT9 A;  4H9O B;  3AZK D;  2HIO B;  4XUJ A;  5DNN D;  5B2J D;  1P3L C; 
#chains in the Genus database with same CATH topology
 4E45 A;  5B31 G;  1Z2C B;  2JCH A;  1KX4 C;  4LD9 B;  5FUG A;  1KX4 A;  1R4V A;  5GXQ D;  3C1C D;  3REL D;  3KWQ D;  3W99 A;  3W97 B;  5AV5 A;  4WU8 A;  1P3O C;  5AV8 B;  4UUZ B;  1M18 A;  1M18 C;  5E5A C;  4YS3 C;  3MGQ D;  3W96 B;  3REJ A;  1Q9C A;  4DRB A;  3REI B;  1P3B C;  4XZQ A;  3B6F A;  5GXQ B;  3B6F C;  4JJN C;  1P3P A;  4JJN A;  2CV5 C;  4Z66 D;  3TU4 A;  4R8P D;  4X23 B;  5CP6 D;  3O62 C;  2FFF B;  4KUD B;  3X1U B;  3O62 A;  3H0L C;  5BNV B;  2ARO D;  5GT0 D;  1EQZ B;  4UPK A;  5GT0 A;  2L5A A;  3IP4 C;  4QLC B;  3O62 D;  3WKJ A;  3B0C T;  3AYW B;  3X1V D;  3AZN D;  4Z66 A;  3REH C;  3TU4 D;  1P3P D;  4M6B A;  4HGA B;  5AY8 D;  3AZM C;  4E44 A;  4XZQ D;  3REJ D;  3MVD A;  2LY8 A;  3UTB B;  1P3K B;  4LD9 A;  1AOI D;  2JE5 A;  3W98 D;  4LD9 C;  1ZLA B;  1P3O B;  3W99 D;  2HUE C;  3VH5 A;  1AOI C;  3AZI A;  3W98 C;  1KX4 D;  4LD9 D;  5AV8 C;  3MGR B;  2G5I C;  2Y2N A;  1M19 B;  4CSR A;  3X1U C;  3AL0 C;  5B2J C;  5B2I B;  3AZN A;  3AV1 A;  3KXB D;  3X1V A;  5AVC B;  2G5H C;  2ARO A;  4KHA B;  2Y2P A;  2PYO B;  5CP6 A;  1F66 C;  2Y2L A;  4WV4 B;  1N1J A;  3B0B A;  3EPJ A;  2HIO A;  4XUJ B;  4J8W A;  1P3F D;  4CAY A;  3B6F D;  3EPH A;  5DNM D;  1ZLA C;  5B32 A;  1ID3 D;  5GT3 D;  5B40 D;  1M18 D;  4G91 C;  5AV5 D;  3AZM D;  1JFI B;  3AFA C;  2FJ7 C;  3REL A;  3C1C A;  5B24 C;  1M19 C;  3R45 A;  1TZY C;  5CPJ A;  3AZN B;  2F8N B;  1ULY A;  5CPI B;  5B2J B;  1P3G A;  5DNN A;  4XUJ D;  5CP6 C;  1F66 A;  3UT9 D;  4NFT A;  5B1L A;  4XZQ C;  3LEL A;  3LJA B;  4WU9 D;  3MGP B;  3NQJ B;  5B0Z B;  3REI D;  1U35 C;  3KUY A;  3AZJ A;  2DQN C;  3AN2 A;  5AV9 B;  5AY8 C;  5CHL B;  4G92 C;  5CPK B;  1P3L A;  3REH D;  5B0Y A;  3TU4 C;  3AZE C;  2VQR A;  3AFA A;  2FJ7 A;  1KX5 D;  4WNN A;  1KX5 A;  4Z66 C;  3REH A;  3X1T C;  2F2A C;  4KGC A;  2F8N G;  2UWX A;  3WKJ C;  1WWS A;  3KUY D;  3AZJ D;  5F99 B;  1S32 A;  1BH9 A;  4H9S A;  3R45 B;  4J8V A;  5DNN C;  1P3I A;  5B31 B;  1TZY B;  4H9P B;  2NZD B;  2Y2G A;  3LZ1 D;  1ID3 C;  4YS3 D;  3MGQ C;  3AV2 B;  4H9O A;  1P3G B;  5GXQ C;  5B33 D;  5GSU D;  2ZY2 A;  3A6N C;  4QLC D;  1KX3 D;  3KUY B;  3AZJ B;  5B1M B;  4ZUX C;  3X1S C;  5AV9 A;  1PZR A;  4ZBJ C;  5B0Y C;  2RIQ A;  3MGP C;  5CPK A;  3VH6 T;  2XD5 A;  5CP6 B;  1P3M A;  4EO5 B;  1P3A C;  5BNX B;  5AV6 B;  3REH B;  3B6F B;  5B0Z C;  1F1E A;  4WNN B;  3H0R C;  5B1M D;  5GT3 A;  5B40 A;  5AV8 D;  3WAA C;  3NQU A;  5AY8 B;  2NQB B;  4J8W D;  1P3F A;  3AZL B;  3LJA D;  3AZE B;  2NZD A;  1JFI A;  1ID3 B;  5JA4 A;  2BYM A;  3AYW C;  3P5J B;  3LZ1 B;  3KXB B;  5BT1 C;  4YM6 B;  3A6N A;  3AZH A;  4WZS B;  4ZUX A;  5F99 D;  3C1B B;  4DQY B;  5B31 C;  3AV1 D;  1P3A A;  5B24 A;  3MGQ B;  5E5A A;  2BG1 A;  1ZLA D;  4NE6 A;  5B0Z A;  1M1A C;  3B6G C;  5GT3 C;  4EO5 C;  5B40 C;  3AN2 B;  4J8U D;  1WWI A;  3UTB A;  3KWQ B;  1P3F C;  3EG5 B;  1ZLA A;  5B2I C;  4WU9 B;  5B2I A;  3AV1 B;  4H9N B;  5E5A D;  3AZL A;  3X1V B;  1KX5 B;  3REJ C;  3WTP A;  1P3O D;  5AY8 A;  4CSR B;  5JA4 B;  1P3A D;  5AV6 C;  3VH6 A;  3MNN B;  3WTP E;  3VH5 W;  3AZH C;  3AZE A;  4ZUX D;  5B33 B;  1KX3 B;  2F8N D;  1TZY A;  3MGP D;  3X1T A;  2PYO A;  3UTA C;  1H3O A;  2YFW A;  3W96 D;  2Y2M A;  5BO0 A;  4Z5T A;  4YM6 C;  4WU8 B;  3MGQ A;  3MVD C;  5AV8 A;  1B6W A;  1M18 B;  5B1M A;  5E5A B;  3W97 A;  4WU8 D;  1BH8 B;  4AWL C;  3AZF D;  3MGR C;  3AV1 C;  4J8U B;  4J8X A;  3KWQ A;  3X1S A;  4J8X C;  3KWQ C;  5AV9 C;  5GXQ A;  3MNN C;  4NE3 A;  5CPK D;  1P3P B;  3EPL A;  5AV9 D;  1P34 D;  1EQZ C;  3B6G B;  3V9R A;  1KX5 C;  5B33 A;  5B2J A;  1KX3 A;  1P3F B;  1F66 B;  3X1T B;  1P3M C;  3C1B D;  3AZG A;  3EPK A;  2Y2J A;  5KDM B;  1P3B D;  3WAA A;  2CV5 D;  4J8V C;  3UT9 B;  1P3I C;  4KUD D;  3MGR D;  4KUD C;  5AVC D;  2NZD C;  3MGS C;  2CWE A;  4Z2M H;  1S32 D;  3AV2 C;  5C3I B;  3WA9 B;  2J8P A;  3LZ0 D;  3UTA B;  1AOI B;  3W98 B;  3AZM B;  3H0M C;  3UTA D;  3X1S B;  3AFA D;  2FJ7 D;  2RVQ D;  1P3K C;  5AV6 D;  3V9R B;  2JSS A;  4H9R B;  5DNM B;  3KFU G;  5B31 A;  5AVC C;  5AVB C;  2ZY3 A;  5AVC A;  4WU9 A;  1M1A A;  3B6G A;  1HQ3 C;  2ARO B;  3LEL D;  4XZQ B;  2CV5 A;  5JRG B;  4J8V B;  3UT9 C;  1P3I B;  4DRA A;  3KUY C;  3AZJ C;  4JJN B;  4XUJ C;  3AZG D;  1F66 D;  1P3G D;  4J8W B;  3MGS B;  4Z2M G;  2Y2I A;  3UTB C;  5B1L C;  1M1A D;  5GT0 B;  1P34 C;  1EQZ D;  1TAF A;  1P34 A;  5CPJ D;  3MNN D;  3REK A;  3KXB C;  3REK C;  5CPI D;  3B0C W;  3WA9 A;  5AV6 A;  3AZM A;  3WA9 C;  4Z5T B;  1U35 D;  3C1C B;  3UTA A;  3AZF A;  3A1I A;  2BYK B;  5G49 A;  5B32 D;  4NE5 A;  1ID3 A;  3LZ0 A;  5DNM A;  2NQB A;  3LZ0 C;  5AVB B;  5B32 G;  2HIO D;  5GT3 B;  5B40 B;  4H9S C;  5JRG C;  4YS3 B;  3AZI B;  1W2E A;  3MGR A;  1KU5 A;  4YM6 A;  3A6N B;  1HQ3 B;  1TZY D;  3MGP A;  3AZN C;  1P3B A;  2CV5 B;  5B1M C;  3X1V C;  4ZUX B;  2BYM B;  3FDD A;  1M19 D;  5B1L B;  3C1B A;  1B67 A;  3KXB A;  3NQJ A;  3AZH B;  3REK B;  2ARO C;  4R8P B;  5B33 C;  3AZL D;  1TAF B;  5GT0 C;  1P34 B;  1T3U A;  5B2I D;  3AZI D;  1KX3 C;  4CAY B;  1P3L B;  2PYO C;  3W99 B;  3X1S D;  3AFA B;  4J8W C;  4UUZ A;  4J8X D;  2FJ7 B;  4H9Q B;  3UTB D;  4HGA C;  4WJ3 C;  2NQB C;  5FUG B;  1KX4 B;  4Z5T C;  2DF4 C;  2ZY5 A;  3WTP B;  3AZF B;  3W97 D;  3LZ0 B;  3AZG C;  5B0Z D;  1AOI A;  3W98 A;  4H9N A;  4H9P A;  3TU4 B;  3MVD D;  3REL B;  3W97 C;  2HUE B;  4Z5T D;  3C1C C;  2RVQ C;  1P3K D;  3W96 A;  3W96 C;  3X1U D;  3C1B C;  3AV2 A;  3WKJ D;  4X23 D;  3AYW A;  3AZI C;  2PYO D;  2F8N H;  5BNV A;  5BT1 D;  5DNN B;  3X1T D;  3A6N D;  2F8N A;  3VH6 W;  1HTA A;  4X23 A;  3AYW D;  3AV2 D;  4X23 C;  3X1U A;  3O62 B;  4R8P A;  3VH5 T;  4G92 B;  5CPK C;  5BO0 B;  3AZE D;  1P3K A;  5BNX A;  4JJN D;  2Y2H A;  3LJA A;  3W99 C;  2NZD D;  4AWL B;  1P3M B;  3WTP D;  1H3O B;  1P3O A;  3LEL B;  4Z66 B;  4J8X B;  3WTP C;  1P3P C;  4H9Q A;  4J8U A;  3REL C;  1BH8 A;  5C3I C;  1P3M D;  4G91 B;  2BYK A;  5G49 B;  5BS7 A;  2ZY4 A;  5B24 D;  3B0D C;  4KGC B;  3F6T A;  4KHA A;  3AZF C;  5F99 A;  3AZK C;  2YFV B;  1S32 B;  5F99 C;  3AZK A;  1M19 A;  1BFM A;  3AZH D;  4YS3 A;  5CPJ C;  5DNM C;  4YM6 D;  2IO5 B;  5AV5 C;  1HQ3 A;  4WU8 C;  1P3A B;  5B32 B;  5KDM A;  1P3G C;  3AN2 C;  4KGC D;  2NQB D;  3KSY A;  4J8U C;  1N1J B;  2Y2K A;  2Y2O A;  3LEL C;  3A1K A;  3REJ B;  5AVB D;  4H9R A;  3AZL C;  5BS7 C;  1U35 A;  1P3L D;  3WA9 D;  1M1A B;  5CPI A;  3MNN A;  3REK D;  2Y2Q A;  1EQZ A;  3NQU B;  2YFV A;  5JRG D;  5B1L D;  4QLC A;  3MGS A;  5GSU A;  3WKJ B;  5GSU C;  5CPJ B;  3B0D B;  2HIO C;  4KGC C;  2F8N K;  3AZK B;  1S32 C;  2YFW B;  5B32 C;  3LZ1 A;  5JRG A;  3MGS D;  3LZ1 C;  3MVD B;  3B6G D;  2IO5 C;  4J8V D;  1P3I D;  5B31 D;  5B24 B;  2W8S A;  5AV5 B;  4ZBJ B;  5B0Y B;  1U35 B;  5AVB A;  4R8P C;  5CPI C;  1BH9 B;  2ZM5 A;  5B0Y D;  1A7W A;  3AN2 D;  4QLC C;  3REI A;  3REI C;  1P3B B;  5GSU B;  3LJA C;  3WAA B;  4WU9 C;  1HQ3 D;  2XD1 A;  3AZG B;  3WAA D;  4KUD A;  3UT9 A;  4H9O B;  3AZK D;  2HIO B;  4XUJ A;  5DNN D;  5B2J D;  1P3L C; 
#chains in the Genus database with same CATH homology
 4E45 A;  5B31 G;  1Z2C B;  2JCH A;  1KX4 C;  4LD9 B;  5FUG A;  1KX4 A;  1R4V A;  5GXQ D;  3C1C D;  3REL D;  3KWQ D;  3W99 A;  3W97 B;  5AV5 A;  4WU8 A;  1P3O C;  5AV8 B;  4UUZ B;  1M18 A;  1M18 C;  5E5A C;  4YS3 C;  3MGQ D;  3W96 B;  3REJ A;  1Q9C A;  4DRB A;  3REI B;  1P3B C;  4XZQ A;  3B6F A;  5GXQ B;  3B6F C;  4JJN C;  1P3P A;  4JJN A;  2CV5 C;  4Z66 D;  3TU4 A;  4R8P D;  4X23 B;  5CP6 D;  3O62 C;  2FFF B;  4KUD B;  3X1U B;  3O62 A;  3H0L C;  5BNV B;  2ARO D;  5GT0 D;  1EQZ B;  4UPK A;  5GT0 A;  2L5A A;  3IP4 C;  4QLC B;  3O62 D;  3WKJ A;  3B0C T;  3AYW B;  3X1V D;  3AZN D;  4Z66 A;  3REH C;  3TU4 D;  1P3P D;  4M6B A;  4HGA B;  5AY8 D;  3AZM C;  4E44 A;  4XZQ D;  3REJ D;  3MVD A;  2LY8 A;  3UTB B;  1P3K B;  4LD9 A;  1AOI D;  2JE5 A;  3W98 D;  4LD9 C;  1ZLA B;  1P3O B;  3W99 D;  2HUE C;  3VH5 A;  1AOI C;  3AZI A;  3W98 C;  1KX4 D;  4LD9 D;  5AV8 C;  3MGR B;  2G5I C;  2Y2N A;  1M19 B;  4CSR A;  3X1U C;  3AL0 C;  5B2J C;  5B2I B;  3AZN A;  3AV1 A;  3KXB D;  3X1V A;  5AVC B;  2G5H C;  2ARO A;  4KHA B;  2Y2P A;  2PYO B;  5CP6 A;  1F66 C;  2Y2L A;  4WV4 B;  1N1J A;  3B0B A;  3EPJ A;  2HIO A;  4XUJ B;  4J8W A;  1P3F D;  4CAY A;  3B6F D;  3EPH A;  5DNM D;  1ZLA C;  5B32 A;  1ID3 D;  5GT3 D;  5B40 D;  1M18 D;  4G91 C;  5AV5 D;  3AZM D;  1JFI B;  3AFA C;  2FJ7 C;  3REL A;  3C1C A;  5B24 C;  1M19 C;  3R45 A;  1TZY C;  5CPJ A;  3AZN B;  2F8N B;  1ULY A;  5CPI B;  5B2J B;  1P3G A;  5DNN A;  4XUJ D;  5CP6 C;  1F66 A;  3UT9 D;  4NFT A;  5B1L A;  4XZQ C;  3LEL A;  3LJA B;  4WU9 D;  3MGP B;  3NQJ B;  5B0Z B;  3REI D;  1U35 C;  3KUY A;  3AZJ A;  2DQN C;  3AN2 A;  5AV9 B;  5AY8 C;  5CHL B;  4G92 C;  5CPK B;  1P3L A;  3REH D;  5B0Y A;  3TU4 C;  3AZE C;  2VQR A;  3AFA A;  2FJ7 A;  1KX5 D;  4WNN A;  1KX5 A;  4Z66 C;  3REH A;  3X1T C;  2F2A C;  4KGC A;  2F8N G;  2UWX A;  3WKJ C;  1WWS A;  3KUY D;  3AZJ D;  5F99 B;  1S32 A;  1BH9 A;  4H9S A;  3R45 B;  4J8V A;  5DNN C;  1P3I A;  5B31 B;  1TZY B;  4H9P B;  2NZD B;  2Y2G A;  3LZ1 D;  1ID3 C;  4YS3 D;  3MGQ C;  3AV2 B;  4H9O A;  1P3G B;  5GXQ C;  5B33 D;  5GSU D;  2ZY2 A;  3A6N C;  4QLC D;  1KX3 D;  3KUY B;  3AZJ B;  5B1M B;  4ZUX C;  3X1S C;  5AV9 A;  1PZR A;  4ZBJ C;  5B0Y C;  2RIQ A;  3MGP C;  5CPK A;  3VH6 T;  2XD5 A;  5CP6 B;  1P3M A;  4EO5 B;  1P3A C;  5BNX B;  5AV6 B;  3REH B;  3B6F B;  5B0Z C;  1F1E A;  4WNN B;  3H0R C;  5B1M D;  5GT3 A;  5B40 A;  5AV8 D;  3WAA C;  3NQU A;  5AY8 B;  2NQB B;  4J8W D;  1P3F A;  3AZL B;  3LJA D;  3AZE B;  2NZD A;  1JFI A;  1ID3 B;  5JA4 A;  2BYM A;  3AYW C;  3P5J B;  3LZ1 B;  3KXB B;  5BT1 C;  4YM6 B;  3A6N A;  3AZH A;  4WZS B;  4ZUX A;  5F99 D;  3C1B B;  4DQY B;  5B31 C;  3AV1 D;  1P3A A;  5B24 A;  3MGQ B;  5E5A A;  2BG1 A;  1ZLA D;  4NE6 A;  5B0Z A;  1M1A C;  3B6G C;  5GT3 C;  4EO5 C;  5B40 C;  3AN2 B;  4J8U D;  1WWI A;  3UTB A;  3KWQ B;  1P3F C;  3EG5 B;  1ZLA A;  5B2I C;  4WU9 B;  5B2I A;  3AV1 B;  4H9N B;  5E5A D;  3AZL A;  3X1V B;  1KX5 B;  3REJ C;  3WTP A;  1P3O D;  5AY8 A;  4CSR B;  5JA4 B;  1P3A D;  5AV6 C;  3VH6 A;  3MNN B;  3WTP E;  3VH5 W;  3AZH C;  3AZE A;  4ZUX D;  5B33 B;  1KX3 B;  2F8N D;  1TZY A;  3MGP D;  3X1T A;  2PYO A;  3UTA C;  1H3O A;  2YFW A;  3W96 D;  2Y2M A;  5BO0 A;  4Z5T A;  4YM6 C;  4WU8 B;  3MGQ A;  3MVD C;  5AV8 A;  1B6W A;  1M18 B;  5B1M A;  5E5A B;  3W97 A;  4WU8 D;  1BH8 B;  4AWL C;  3AZF D;  3MGR C;  3AV1 C;  4J8U B;  4J8X A;  3KWQ A;  3X1S A;  4J8X C;  3KWQ C;  5AV9 C;  5GXQ A;  3MNN C;  4NE3 A;  5CPK D;  1P3P B;  3EPL A;  5AV9 D;  1P34 D;  1EQZ C;  3B6G B;  3V9R A;  1KX5 C;  5B33 A;  5B2J A;  1KX3 A;  1P3F B;  1F66 B;  3X1T B;  1P3M C;  3C1B D;  3AZG A;  3EPK A;  2Y2J A;  5KDM B;  1P3B D;  3WAA A;  2CV5 D;  4J8V C;  3UT9 B;  1P3I C;  4KUD D;  3MGR D;  4KUD C;  5AVC D;  2NZD C;  3MGS C;  2CWE A;  4Z2M H;  1S32 D;  3AV2 C;  5C3I B;  3WA9 B;  2J8P A;  3LZ0 D;  3UTA B;  1AOI B;  3W98 B;  3AZM B;  3H0M C;  3UTA D;  3X1S B;  3AFA D;  2FJ7 D;  2RVQ D;  1P3K C;  5AV6 D;  3V9R B;  2JSS A;  4H9R B;  5DNM B;  3KFU G;  5B31 A;  5AVC C;  5AVB C;  2ZY3 A;  5AVC A;  4WU9 A;  1M1A A;  3B6G A;  1HQ3 C;  2ARO B;  3LEL D;  4XZQ B;  2CV5 A;  5JRG B;  4J8V B;  3UT9 C;  1P3I B;  4DRA A;  3KUY C;  3AZJ C;  4JJN B;  4XUJ C;  3AZG D;  1F66 D;  1P3G D;  4J8W B;  3MGS B;  4Z2M G;  2Y2I A;  3UTB C;  5B1L C;  1M1A D;  5GT0 B;  1P34 C;  1EQZ D;  1TAF A;  1P34 A;  5CPJ D;  3MNN D;  3REK A;  3KXB C;  3REK C;  5CPI D;  3B0C W;  3WA9 A;  5AV6 A;  3AZM A;  3WA9 C;  4Z5T B;  1U35 D;  3C1C B;  3UTA A;  3AZF A;  3A1I A;  2BYK B;  5G49 A;  5B32 D;  4NE5 A;  1ID3 A;  3LZ0 A;  5DNM A;  2NQB A;  3LZ0 C;  5AVB B;  5B32 G;  2HIO D;  5GT3 B;  5B40 B;  4H9S C;  5JRG C;  4YS3 B;  3AZI B;  1W2E A;  3MGR A;  1KU5 A;  4YM6 A;  3A6N B;  1HQ3 B;  1TZY D;  3MGP A;  3AZN C;  1P3B A;  2CV5 B;  5B1M C;  3X1V C;  4ZUX B;  2BYM B;  3FDD A;  1M19 D;  5B1L B;  3C1B A;  1B67 A;  3KXB A;  3NQJ A;  3AZH B;  3REK B;  2ARO C;  4R8P B;  5B33 C;  3AZL D;  1TAF B;  5GT0 C;  1P34 B;  1T3U A;  5B2I D;  3AZI D;  1KX3 C;  4CAY B;  1P3L B;  2PYO C;  3W99 B;  3X1S D;  3AFA B;  4J8W C;  4UUZ A;  4J8X D;  2FJ7 B;  4H9Q B;  3UTB D;  4HGA C;  4WJ3 C;  2NQB C;  5FUG B;  1KX4 B;  4Z5T C;  2DF4 C;  2ZY5 A;  3WTP B;  3AZF B;  3W97 D;  3LZ0 B;  3AZG C;  5B0Z D;  1AOI A;  3W98 A;  4H9N A;  4H9P A;  3TU4 B;  3MVD D;  3REL B;  3W97 C;  2HUE B;  4Z5T D;  3C1C C;  2RVQ C;  1P3K D;  3W96 A;  3W96 C;  3X1U D;  3C1B C;  3AV2 A;  3WKJ D;  4X23 D;  3AYW A;  3AZI C;  2PYO D;  2F8N H;  5BNV A;  5BT1 D;  5DNN B;  3X1T D;  3A6N D;  2F8N A;  3VH6 W;  1HTA A;  4X23 A;  3AYW D;  3AV2 D;  4X23 C;  3X1U A;  3O62 B;  4R8P A;  3VH5 T;  4G92 B;  5CPK C;  5BO0 B;  3AZE D;  1P3K A;  5BNX A;  4JJN D;  2Y2H A;  3LJA A;  3W99 C;  2NZD D;  4AWL B;  1P3M B;  3WTP D;  1H3O B;  1P3O A;  3LEL B;  4Z66 B;  4J8X B;  3WTP C;  1P3P C;  4H9Q A;  4J8U A;  3REL C;  1BH8 A;  5C3I C;  1P3M D;  4G91 B;  2BYK A;  5G49 B;  5BS7 A;  2ZY4 A;  5B24 D;  3B0D C;  4KGC B;  3F6T A;  4KHA A;  3AZF C;  5F99 A;  3AZK C;  2YFV B;  1S32 B;  5F99 C;  3AZK A;  1M19 A;  1BFM A;  3AZH D;  4YS3 A;  5CPJ C;  5DNM C;  4YM6 D;  2IO5 B;  5AV5 C;  1HQ3 A;  4WU8 C;  1P3A B;  5B32 B;  5KDM A;  1P3G C;  3AN2 C;  4KGC D;  2NQB D;  3KSY A;  4J8U C;  1N1J B;  2Y2K A;  2Y2O A;  3LEL C;  3A1K A;  3REJ B;  5AVB D;  4H9R A;  3AZL C;  5BS7 C;  1U35 A;  1P3L D;  3WA9 D;  1M1A B;  5CPI A;  3MNN A;  3REK D;  2Y2Q A;  1EQZ A;  3NQU B;  2YFV A;  5JRG D;  5B1L D;  4QLC A;  3MGS A;  5GSU A;  3WKJ B;  5GSU C;  5CPJ B;  3B0D B;  2HIO C;  4KGC C;  2F8N K;  3AZK B;  1S32 C;  2YFW B;  5B32 C;  3LZ1 A;  5JRG A;  3MGS D;  3LZ1 C;  3MVD B;  3B6G D;  2IO5 C;  4J8V D;  1P3I D;  5B31 D;  5B24 B;  2W8S A;  5AV5 B;  4ZBJ B;  5B0Y B;  1U35 B;  5AVB A;  4R8P C;  5CPI C;  1BH9 B;  2ZM5 A;  5B0Y D;  1A7W A;  3AN2 D;  4QLC C;  3REI A;  3REI C;  1P3B B;  5GSU B;  3LJA C;  3WAA B;  4WU9 C;  1HQ3 D;  2XD1 A;  3AZG B;  3WAA D;  4KUD A;  3UT9 A;  4H9O B;  3AZK D;  2HIO B;  4XUJ A;  5DNN D;  5B2J D;  1P3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...