5JRGC

Crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
b'AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5jrgC00
5BT1D 3WA9C 4QLCA 3AV1C 1F66C 5BNXA 3UTAA 3UT9A 3NQUA 3W98A 1KX5A 1TAFB 3AZNB 3AZFA 2FJ7C 3LZ1A 3X1UD 1N1JA 4YS3C 4X23D 4J8VA 4AWLC 1KX4A 1P3KC 5G49A 5BS7C 1ZLAC 4M6BA 5GT0D 5AV9A 3MGRD 5AY8A 5CP6C 1M1AB 3W96D 2NZDB 3RELB 3AZFC 1U35A 4LD9B 4DRBA 3AZID 5DNNA 2CV5C 1P34C 4JJNA 1P3OD 1EQZB 3W97D 2RVQD 1P3GD 4KGCA 2BYKB 3X1VB 1Q9CA 3UTBB 2PYOC 3C1CC 4CSRB 4NE6A 1P3BA 1BH8B 3AZHD 2NQBB 3KWQB 4J8WB 2HIOC 1F1EA 1P3LC 1HQ3C 5B33A 5E5AC 5GXQA 5DNMB 2AROB 5GT3B 3AZGD 5B2IA 1ULYA 5GSUA 3LELB 5AVCA 3KUYD 5JRGB 3B6FB 1KX5D 1HTAA 1TZYA 3AZMA 3B6GB 3REJA 5B0ZA 5B31A 3WTPD 4KUDB 5B1MD 5B1LB 4R8PD 5JA4A 1M1AC 4J8VD 1M19C 5BO0B 5AVCC 4KHAA 4UUZA 3RELC 1ID3B 2NZDC 3WKJD 1B6WA 3X1TD 4LD9C 1KX3C 3MGSB 5CPKA 3AZJD 2F8NG 1EQZC 4H9OA 3WAAB 5B2JD 3X1VC 3UTBC 4H9SC 3WTPE 5AV6A 1P3AB 3AFAA 2NQBC 4WU9A 3KWQC 5AV5B 3REKD 5F99C 3REHA 1M18D 3KXBA 5DNMC 2AROC 4WNNB 5CPID 5B33D 5AV8D 3MGQA 5GXQD 4CAYA 4E45A 3O62C 3REIA 3C1BA 1P3PD 3LELC 3AZKD 3X1UB 2YFVA 5JRGC 1JFIA 4X23B 3B6FC 1P3FA 5GSUD 3B6GC 5GT0B 3MGRB 3V9RA 4KUDC 2LY8A 3W96B 4WU8A 5B1LC 5B0YA 4H9NB 3TU4A 5B31D 3AZIB 1ID3C 3W99A 1P3OB 3MGSC 3A6ND 3W97B 4Z5TD 1P3GB 5B40D 4EO5C 3WAAC 3MGPD 3AZHB 3AV2A 1P3MA 3AZLC 5KDMB 5CPJA 1P3AC 4XZQA 3LJAC 2BYMB 5AV5C 5AV6D 3AN2A 4H9RA 1KU5A 1P3IA 3AZGB 5BT1C 3B0BA 3WA9A 3AV1A 1F66A 3KXBD 3X1SD 4Z66B 3KUYB 2FJ7A 5B32D 3X1UC 1KX5B 3MVDD 1BH9A 4YS3A 3C1BD 1P3KA 3B0CT 3WTPB 5BS7A 1ZLAA 5B1MB 4R8PB 5GT0C 4Z2MG 5CP6A 4J8VB 2IO5B 1P3FD 3WKJB 3X1TB 1S32D 4J8XD 5B0YD 4ZUXC 3AZJB 4WU8D 2CV5A 1P34A 1H3OB 3AYWD 1P3GC 1P3OC 1AOID 5B2JB 3W99D 2PYOA 4XUJA 3C1CA 3B0DB 3AZED 3AZHC 5B24D 3KSYA 2HIOA 3REKB 1P3LA 4YM6C 1HQ3A 1P3MD 1M18B 5E5AA 5CPJD 4XZQD 4XUJC 5CPIB 3AZGC 5AV8B 4J8UD 5GXQB 3AN2D 1P3PB 5C3IB 3AZKB 3MNND 1TAFA 4Z66C 3KUYC 1F66D 5GSUB 3LZ0D 3WTPC 5B1MC 5AVBD 2IO5C 1M1AA 1M19A 2NZDA 5B31B 3RELA 3AZNC 1P3KD 1ZLAD 3X1TC 5B32G 4QLCD 3WKJC 3VH6W 1KX3A 4LD9A 3A6NB 3UTAD 4Z5TB 3UT9D 3W98D 3AZJC 1EQZA 3AZFD 1WWSA 5B40B 5B2JC 3LZ1D 3X1VA 3MGPB 3UTBA 4H9SA 1P34D 3B0DC 1KX4D 1BH8A 2NQBA 4H9QB 3KWQA 5AV9D 5AV6B 5AY8D 4H9PB 3C1CD 2PYOD 3REKC 5F99A 5FUGB 1M18C 1U35D 5DNMA 3B0CW 4HGAB 2HIOD 2AROA 5CPIC 5DNND 4JJND 5AV8C 3KXBB 3X1SB 4KGCD 3O62A 4J8WC 1P3PC 5C3IC 3AZKC 3LELA 5B32B 1P3BD 3MVDB 5JRGA 3B6FA 3C1BB 3B6GA 5GT3C 4KUDA 1P3FB 5B1LA 5BO0A 5B2ID 1S32B 1ID3A 4J8XB 5B0YB 4WU8B 1AOIB 3A6NC 3MGSA 4Z5TC 3AYWB 1M19D 5AVCD 5B40C 3NQJB 1KX3D 3VH5A 3WAAA 3MGPC 3AZEB 1TZYD 3AZMD 3AZLA 3REJD 5B0ZD 5B24B 1P3AA 3LJAA 3X1VD 5AV5A 3R45A 1P3MB 5CPJB 4XZQB 1A7WA 4HGAC 4J8UB 5CPKD 4WNNA 2F8NK 5F99D 4NFTA 2L5AA 3X1SC 3MNNB 3VH6T 1F66B 5B32C 3X1UA 3LZ0B 3MVDC 3AFAD 4NE5A 1WWIA 4WU9D 3O62D 2YFWB 2F8NA 5AVBB 4G92B 5GT0A 1BH9B 3REHD 4ZBJB 3W96A 1P3KB 1ZLAB 4H9NA 4QLCB 5BNXB 3UTAB 3UT9B 3NQUB 3MGQD 4J8XC 1S32C 3W98B 1AOIC 1P3OA 4ZUXA 3REID 4X23C 3AYWC 3AZFB 1P3GA 3LZ1B 3MGRC 1P34B 1N1JB 3W96C 3AZEC 1KX4B 5G49B 3AZHA 2CWEA 5KDMA 5B24C 5AV9B 3AZIC 5AY8B 3C1CB 2BYMA 4YM6A 3W97C 2RVQC 3TU4D 3AZLD 1U35B 2HIOB 5BNVA 3LJAD 5DNNB 3AZGA 4JJNB 4KGCB 5B31G 3MNNC 1P3BB 4Z66A 4G91B 3AV2D 3KUYA 1R4VA 3LZ0C 4WV4B 4NE3A 5B33B 3WTPA 5B1MA 5AVBC 4G92C 4R8PA 1B67A 1P3ID 4ZBJC 5B2IB 2F8ND 4WZSB 3AZNA 3WKJA 4QLCC 3X1TA 3WA9D 3AV1D 3UTAC 3UT9C 3W98C 1KX5C 1M19B 5AVCB 3AZJA 1H3OA 1KX3B 3LZ1C 5B2JA 2FJ7D 4R8PC 2F8NH 1TZYB 3AZMB 4ZUXD 5B0ZB 4J8VC 4YS3D 5CHLB 3REJB 1KX4C 5AV9C 5JA4B 5AY8C 5CP6D 3REKA 4KHAB 4UUZB 1M18A 1U35C 2BYKA 5CPKB 5CPIA 5DNNC 5F99B 4CSRA 4YM6D 4JJNC 2CV5D 4H9OB 5AV8A 4KGCC 4J8WA 1P3PA 4XUJD 3AZKA 1P3BC 4G91C 3AFAB 4WU9B 3O62B 1P3LD 5GT3A 5B33C 1HQ3D 4Z66D 3REHB 5E5AD 5GXQC 5B2IC 3MGQB 4CAYB 3REIB 3A6NA 4Z5TA 3VH5W 4E44A 5GSUC 3AZND 2YFVB 5B40A 4DRAA 1JFIB 3MGPA 1TZYC 3AZMC 3REJC 5B0ZC 3VH6A 5B31C 4EO5B 3V9RB 4H9QA 3TU4B 4H9PA 3AZLB 1BFMA 1M1AD 2NZDD 3W99B 3RELD 5FUGA 3LJAB 4LD9D 3R45B 5CPKC 2JSSA 1EQZD 3X1SA 3UTBD 5AV6C 3AV2B 5B32A 2HUEB 3MVDA 3AFAC 4WU9C 2NQBD 3KWQD 4J8WD 3AN2B 4H9RB 3REHC 3KXBC 1P3IB 5DNMD 2F8NB 3WA9B 2AROD 4Z2MH 3AV1B 5GT3D 3MGQC 1S32A 4J8XA 3REIC 1AOIA 4X23A 3AYWA 3C1BC 3LELD 2FJ7B 3NQJA 3MGRA 4ZUXB 5JRGD 4AWLB 4YS3B 1P3FC 3AZEA 3B6FD 3B6GD 5B24A 3AZIA 5CP6B 4KUDD 5B0YC 4WU8C 5B1LD 3W97A 3TU4C 3W99C 1ID3D 4YM6B 2CV5B 3MGSD 4J8UA 5BNVB 2PYOB 4XUJB 3MNNA 3WAAD 3AV2C 1P3MC 2HUEC 3VH5T 5CPJC 1P3AD 3LZ0A 4XZQC 1P3LB 1HQ3B 2YFWA 5AV5D 4J8UC 5E5AB 5AVBA 3AN2C 1P3IC
chains in the Genus database with same CATH superfamily
5BT1D 3WA9C 4QLCA 3AV1C 1F66C 5BNXA 3UTAA 3UT9A 3NQUA 3W98A 1KX5A 1TAFB 3AZNB 3AZFA 2FJ7C 3LZ1A 3X1UD 1N1JA 4YS3C 4X23D 4J8VA 4AWLC 1Z2CB 1P3KC 5G49A 5BS7C 1KX4A 1ZLAC 4M6BA 3A1KA 5GT0D 5AV9A 3MGRD 5AY8A 5CP6C 3EPLA 1M1AB 3W96D 2NZDB 3RELB 3AZFC 1U35A 4LD9B 4DRBA 3EPJA 3AZID 5DNNA 2CV5C 1P34C 4JJNA 1P3OD 1EQZB 3W97D 2RVQD 1P3GD 4KGCA 2BYKB 3X1VB 2Y2PA 1Q9CA 3UTBB 2PYOC 3C1CC 3EG5B 4NE6A 4CSRB 1P3BA 1BH8B 3AZHD 2NQBB 2JE5A 2ZY5A 3KWQB 4J8WB 2HIOC 4UPKA 1F1EA 1P3LC 1HQ3C 5B33A 5E5AC 5GXQA 5DNMB 2AROB 3H0RC 5GT3B 3AZGD 5B2IA 2Y2JA 1ULYA 5GSUA 3LELB 5AVCA 3KUYD 5JRGB 3B6FB 1KX5D 1HTAA 1TZYA 3AZMA 3B6GB 3REJA 5B0ZA 3A1IA 5B31A 3WTPD 4KUDB 5B1MD 3EPHA 5B1LB 4R8PD 5JA4A 1M1AC 4J8VD 1M19C 5BO0B 5AVCC 4KHAA 4UUZA 3RELC 1ID3B 2NZDC 3WKJD 1B6WA 3X1TD 4LD9C 1KX3C 3MGSB 5CPKA 3AZJD 2F8NG 1EQZC 4H9OA 3WAAB 5B2JD 3X1VC 2ZY3A 3UTBC 4H9SC 3WTPE 5AV6A 1P3AB 3AFAA 2NQBC 4WU9A 3KWQC 5AV5B 2F2AC 3REKD 5F99C 3REHA 1M18D 3KXBA 5DNMC 2AROC 4WNNB 5CPID 5B33D 5AV8D 3MGQA 5GXQD 4CAYA 4E45A 3O62C 3REIA 3C1BA 1P3PD 3LELC 3AZKD 3X1UB 2YFVA 5JRGC 1JFIA 4X23B 3B6FC 1P3FA 5GSUD 3B6GC 5GT0B 3MGRB 3V9RA 4KUDC 2LY8A 3W96B 5B1LC 5B0YA 4WU8A 1T3UA 4H9NB 3TU4A 5B31D 3AZIB 1ID3C 3W99A 1P3OB 3MGSC 3A6ND 3W97B 4Z5TD 1P3GB 5B40D 4EO5C 3WAAC 3MGPD 3AZHB 3AV2A 1P3MA 3AZLC 5KDMB 5CPJA 1P3AC 4XZQA 3LJAC 2BYMB 5AV5C 5AV6D 3AN2A 4H9RA 1KU5A 1P3IA 3AZGB 5BT1C 3B0BA 3WA9A 3AV1A 1F66A 3KXBD 3X1SD 4Z66B 3KUYB 2FJ7A 5B32D 3X1UC 1KX5B 3MVDD 1BH9A 2Y2LA 4YS3A 3C1BD 1P3KA 3B0CT 3WTPB 5BS7A 1ZLAA 5B1MB 4R8PB 5GT0C 4Z2MG 5CP6A 4J8VB 2IO5B 1P3FD 2G5IC 3WKJB 3X1TB 1S32D 4J8XD 5B0YD 4ZUXC 3AZJB 4WU8D 2CV5A 1P34A 1H3OB 3AYWD 1P3GC 1P3OC 1AOID 5B2JB 3W99D 2PYOA 4XUJA 3C1CA 3IP4C 3B0DB 3AZED 3AZHC 2ZY2A 5B24D 3KSYA 2HIOA 3REKB 1P3LA 4YM6C 1HQ3A 1P3MD 1M18B 2Y2MA 5E5AA 5CPJD 4XZQD 4XUJC 5CPIB 3AZGC 5AV8B 4J8UD 5GXQB 3AN2D 1P3PB 5C3IB 3AZKB 3MNND 1TAFA 4Z66C 3KUYC 2VQRA 1F66D 5GSUB 3LZ0D 3WTPC 5B1MC 5AVBD 3EPKA 2IO5C 1M1AA 1M19A 2NZDA 5B31B 3RELA 3AZNC 1P3KD 1ZLAD 3X1TC 5B32G 4QLCD 3WKJC 3VH6W 1KX3A 4LD9A 3A6NB 3UTAD 4Z5TB 3UT9D 3W98D 2Y2GA 3AZJC 1EQZA 3AZFD 1WWSA 5B40B 5B2JC 3LZ1D 3X1VA 3MGPB 3UTBA 4H9SA 1P34D 3B0DC 1KX4D 1BH8A 2NQBA 4H9QB 3KWQA 5AV9D 5AV6B 5AY8D 4H9PB 3C1CD 2PYOD 3REKC 5F99A 5FUGB 1M18C 1U35D 5DNMA 3B0CW 4HGAB 2HIOD 2AROA 5CPIC 5DNND 4JJND 5AV8C 2Y2IA 3KXBB 3X1SB 4KGCD 3O62A 4J8WC 1P3PC 5C3IC 3AZKC 3LELA 5B32B 1P3BD 3MVDB 5JRGA 3B6FA 3C1BB 3B6GA 5GT3C 1PZRA 4KUDA 1P3FB 5B1LA 2ZY4A 2RIQA 5BO0A 5B2ID 1S32B 1ID3A 4J8XB 5B0YB 4WU8B 1AOIB 3A6NC 3MGSA 4Z5TC 3AYWB 1M19D 5AVCD 5B40C 3NQJB 1KX3D 3VH5A 3WAAA 3MGPC 3AZEB 1TZYD 3AZMD 3AZLA 3REJD 5B0ZD 5B24B 1P3AA 3LJAA 3X1VD 5AV5A 3R45A 1P3MB 5CPJB 4XZQB 1A7WA 4HGAC 4J8UB 5CPKD 4WNNA 2F8NK 5F99D 4NFTA 2DF4C 2L5AA 3X1SC 3MNNB 3VH6T 1F66B 5B32C 3X1UA 3LZ0B 3MVDC 3AFAD 4NE5A 1WWIA 4WU9D 2BG1A 3H0LC 3O62D 2YFWB 2F8NA 5AVBB 4G92B 5GT0A 1BH9B 3REHD 3KFUG 4ZBJB 3W96A 1P3KB 1ZLAB 4H9NA 4QLCB 2JCHA 5BNXB 3UTAB 3UT9B 3NQUB 3MGQD 4J8XC 1S32C 3W98B 1AOIC 1P3OA 4ZUXA 3REID 4X23C 3AYWC 3AZFB 1P3GA 2Y2KA 3LZ1B 2UWXA 3MGRC 1P34B 1N1JB 3W96C 3AZEC 1KX4B 5G49B 2Y2QA 2CWEA 3AZHA 5KDMA 5B24C 2XD5A 5AV9B 3AZIC 5AY8B 3C1CB 2BYMA 4YM6A 3W97C 2RVQC 3TU4D 3AZLD 1U35B 2HIOB 5BNVA 3LJAD 5DNNB 3AZGA 4JJNB 4KGCB 5B31G 3F6TA 2FFFB 3MNNC 1P3BB 4Z66A 4G91B 3AV2D 3KUYA 1R4VA 3LZ0C 1W2EA 4WV4B 4NE3A 5B33B 3AL0C 3WTPA 5B1MA 5AVBC 4G92C 4R8PA 2XD1A 1B67A 1P3ID 2DQNC 4ZBJC 5B2IB 2F8ND 4WZSB 3AZNA 3WKJA 4QLCC 3X1TA 3WA9D 3AV1D 3UTAC 3UT9C 3W98C 1KX5C 1M19B 5AVCB 3AZJA 1H3OA 4DQYB 1KX3B 3LZ1C 5B2JA 2FJ7D 4R8PC 2F8NH 1TZYB 3AZMB 3H0MC 4ZUXD 5B0ZB 4J8VC 4YS3D 5CHLB 3REJB 1KX4C 5AV9C 5JA4B 5AY8C 5CP6D 3REKA 4KHAB 4UUZB 1M18A 1U35C 2BYKA 2G5HC 5CPKB 5CPIA 5DNNC 5F99B 4CSRA 4YM6D 4JJNC 2CV5D 4H9OB 5AV8A 4KGCC 4J8WA 1P3PA 4XUJD 3AZKA 1P3BC 4G91C 3AFAB 4WU9B 3O62B 1P3LD 5GT3A 5B33C 1HQ3D 4Z66D 3REHB 5E5AD 5GXQC 5B2IC 3MGQB 4CAYB 3REIB 3A6NA 4Z5TA 5GSUC 3VH5W 4E44A 3AZND 2YFVB 5B40A 2Y2NA 4DRAA 1JFIB 3MGPA 1TZYC 3AZMC 3REJC 5B0ZC 3VH6A 5B31C 4EO5B 3V9RB 4H9QA 3TU4B 4H9PA 3AZLB 1BFMA 1M1AD 2NZDD 3W99B 3RELD 5FUGA 3LJAB 4LD9D 3R45B 5CPKC 2JSSA 1EQZD 3X1SA 3UTBD 5AV6C 3AV2B 5B32A 2HUEB 3MVDA 3AFAC 4WU9C 2NQBD 3KWQD 4J8WD 3AN2B 4H9RB 3REHC 2W8SA 3KXBC 1P3IB 5DNMD 2F8NB 3WA9B 2AROD 4Z2MH 3AV1B 5GT3D 3MGQC 1S32A 4J8XA 2Y2HA 3REIC 1AOIA 4X23A 3AYWA 3C1BC 3LELD 2FJ7B 2Y2OA 3NQJA 3MGRA 4ZUXB 5JRGD 4AWLB 4YS3B 1P3FC 3AZEA 3B6FD 3B6GD 5B24A 3AZIA 5CP6B 4KUDD 5B0YC 4WU8C 5B1LD 4WJ3C 3W97A 3FDDA 3TU4C 3W99C 1ID3D 4YM6B 2CV5B 3MGSD 4J8UA 2J8PA 5BNVB 2PYOB 4XUJB 3MNNA 3WAAD 2ZM5A 3AV2C 1P3MC 2HUEC 3VH5T 5CPJC 1P3AD 3LZ0A 4XZQC 1P3LB 1HQ3B 2YFWA 5AV5D 4J8UC 5E5AB 5AVBA 3AN2C 3P5JB 1P3IC
chains in the Genus database with same CATH topology
5BT1D 3WA9C 4QLCA 3AV1C 1F66C 5BNXA 3UTAA 3UT9A 3NQUA 3W98A 1KX5A 1TAFB 3AZNB 3AZFA 2FJ7C 3LZ1A 3X1UD 1N1JA 4YS3C 4X23D 4J8VA 4AWLC 1Z2CB 1P3KC 5G49A 5BS7C 1KX4A 1ZLAC 4M6BA 3A1KA 5GT0D 5AV9A 3MGRD 5AY8A 5CP6C 3EPLA 1M1AB 3W96D 2NZDB 3RELB 3AZFC 1U35A 4LD9B 4DRBA 3EPJA 3AZID 5DNNA 2CV5C 1P34C 4JJNA 1P3OD 1EQZB 3W97D 2RVQD 1P3GD 4KGCA 2BYKB 3X1VB 2Y2PA 1Q9CA 3UTBB 2PYOC 3C1CC 3EG5B 4NE6A 4CSRB 1P3BA 1BH8B 3AZHD 2NQBB 2JE5A 2ZY5A 3KWQB 4J8WB 2HIOC 4UPKA 1F1EA 1P3LC 1HQ3C 5B33A 5E5AC 5GXQA 5DNMB 2AROB 3H0RC 5GT3B 3AZGD 5B2IA 2Y2JA 1ULYA 5GSUA 3LELB 5AVCA 3KUYD 5JRGB 3B6FB 1KX5D 1HTAA 1TZYA 3AZMA 3B6GB 3REJA 5B0ZA 3A1IA 5B31A 3WTPD 4KUDB 5B1MD 3EPHA 5B1LB 4R8PD 5JA4A 1M1AC 4J8VD 1M19C 5BO0B 5AVCC 4KHAA 4UUZA 3RELC 1ID3B 2NZDC 3WKJD 1B6WA 3X1TD 4LD9C 1KX3C 3MGSB 5CPKA 3AZJD 2F8NG 1EQZC 4H9OA 3WAAB 5B2JD 3X1VC 2ZY3A 3UTBC 4H9SC 3WTPE 5AV6A 1P3AB 3AFAA 2NQBC 4WU9A 3KWQC 5AV5B 2F2AC 3REKD 5F99C 3REHA 1M18D 3KXBA 5DNMC 2AROC 4WNNB 5CPID 5B33D 5AV8D 3MGQA 5GXQD 4CAYA 4E45A 3O62C 3REIA 3C1BA 1P3PD 3LELC 3AZKD 3X1UB 2YFVA 5JRGC 1JFIA 4X23B 3B6FC 1P3FA 5GSUD 3B6GC 5GT0B 3MGRB 3V9RA 4KUDC 2LY8A 3W96B 5B1LC 5B0YA 4WU8A 1T3UA 4H9NB 3TU4A 5B31D 3AZIB 1ID3C 3W99A 1P3OB 3MGSC 3A6ND 3W97B 4Z5TD 1P3GB 5B40D 4EO5C 3WAAC 3MGPD 3AZHB 3AV2A 1P3MA 3AZLC 5KDMB 5CPJA 1P3AC 4XZQA 3LJAC 2BYMB 5AV5C 5AV6D 3AN2A 4H9RA 1KU5A 1P3IA 3AZGB 5BT1C 3B0BA 3WA9A 3AV1A 1F66A 3KXBD 3X1SD 4Z66B 3KUYB 2FJ7A 5B32D 3X1UC 1KX5B 3MVDD 1BH9A 2Y2LA 4YS3A 3C1BD 1P3KA 3B0CT 3WTPB 5BS7A 1ZLAA 5B1MB 4R8PB 5GT0C 4Z2MG 5CP6A 4J8VB 2IO5B 1P3FD 2G5IC 3WKJB 3X1TB 1S32D 4J8XD 5B0YD 4ZUXC 3AZJB 4WU8D 2CV5A 1P34A 1H3OB 3AYWD 1P3GC 1P3OC 1AOID 5B2JB 3W99D 2PYOA 4XUJA 3C1CA 3IP4C 3B0DB 3AZED 3AZHC 2ZY2A 5B24D 3KSYA 2HIOA 3REKB 1P3LA 4YM6C 1HQ3A 1P3MD 1M18B 2Y2MA 5E5AA 5CPJD 4XZQD 4XUJC 5CPIB 3AZGC 5AV8B 4J8UD 5GXQB 3AN2D 1P3PB 5C3IB 3AZKB 3MNND 1TAFA 4Z66C 3KUYC 2VQRA 1F66D 5GSUB 3LZ0D 3WTPC 5B1MC 5AVBD 3EPKA 2IO5C 1M1AA 1M19A 2NZDA 5B31B 3RELA 3AZNC 1P3KD 1ZLAD 3X1TC 5B32G 4QLCD 3WKJC 3VH6W 1KX3A 4LD9A 3A6NB 3UTAD 4Z5TB 3UT9D 3W98D 2Y2GA 3AZJC 1EQZA 3AZFD 1WWSA 5B40B 5B2JC 3LZ1D 3X1VA 3MGPB 3UTBA 4H9SA 1P34D 3B0DC 1KX4D 1BH8A 2NQBA 4H9QB 3KWQA 5AV9D 5AV6B 5AY8D 4H9PB 3C1CD 2PYOD 3REKC 5F99A 5FUGB 1M18C 1U35D 5DNMA 3B0CW 4HGAB 2HIOD 2AROA 5CPIC 5DNND 4JJND 5AV8C 2Y2IA 3KXBB 3X1SB 4KGCD 3O62A 4J8WC 1P3PC 5C3IC 3AZKC 3LELA 5B32B 1P3BD 3MVDB 5JRGA 3B6FA 3C1BB 3B6GA 5GT3C 1PZRA 4KUDA 1P3FB 5B1LA 2ZY4A 2RIQA 5BO0A 5B2ID 1S32B 1ID3A 4J8XB 5B0YB 4WU8B 1AOIB 3A6NC 3MGSA 4Z5TC 3AYWB 1M19D 5AVCD 5B40C 3NQJB 1KX3D 3VH5A 3WAAA 3MGPC 3AZEB 1TZYD 3AZMD 3AZLA 3REJD 5B0ZD 5B24B 1P3AA 3LJAA 3X1VD 5AV5A 3R45A 1P3MB 5CPJB 4XZQB 1A7WA 4HGAC 4J8UB 5CPKD 4WNNA 2F8NK 5F99D 4NFTA 2DF4C 2L5AA 3X1SC 3MNNB 3VH6T 1F66B 5B32C 3X1UA 3LZ0B 3MVDC 3AFAD 4NE5A 1WWIA 4WU9D 2BG1A 3H0LC 3O62D 2YFWB 2F8NA 5AVBB 4G92B 5GT0A 1BH9B 3REHD 3KFUG 4ZBJB 3W96A 1P3KB 1ZLAB 4H9NA 4QLCB 2JCHA 5BNXB 3UTAB 3UT9B 3NQUB 3MGQD 4J8XC 1S32C 3W98B 1AOIC 1P3OA 4ZUXA 3REID 4X23C 3AYWC 3AZFB 1P3GA 2Y2KA 3LZ1B 2UWXA 3MGRC 1P34B 1N1JB 3W96C 3AZEC 1KX4B 5G49B 2Y2QA 2CWEA 3AZHA 5KDMA 5B24C 2XD5A 5AV9B 3AZIC 5AY8B 3C1CB 2BYMA 4YM6A 3W97C 2RVQC 3TU4D 3AZLD 1U35B 2HIOB 5BNVA 3LJAD 5DNNB 3AZGA 4JJNB 4KGCB 5B31G 3F6TA 2FFFB 3MNNC 1P3BB 4Z66A 4G91B 3AV2D 3KUYA 1R4VA 3LZ0C 1W2EA 4WV4B 4NE3A 5B33B 3AL0C 3WTPA 5B1MA 5AVBC 4G92C 4R8PA 2XD1A 1B67A 1P3ID 2DQNC 4ZBJC 5B2IB 2F8ND 4WZSB 3AZNA 3WKJA 4QLCC 3X1TA 3WA9D 3AV1D 3UTAC 3UT9C 3W98C 1KX5C 1M19B 5AVCB 3AZJA 1H3OA 4DQYB 1KX3B 3LZ1C 5B2JA 2FJ7D 4R8PC 2F8NH 1TZYB 3AZMB 3H0MC 4ZUXD 5B0ZB 4J8VC 4YS3D 5CHLB 3REJB 1KX4C 5AV9C 5JA4B 5AY8C 5CP6D 3REKA 4KHAB 4UUZB 1M18A 1U35C 2BYKA 2G5HC 5CPKB 5CPIA 5DNNC 5F99B 4CSRA 4YM6D 4JJNC 2CV5D 4H9OB 5AV8A 4KGCC 4J8WA 1P3PA 4XUJD 3AZKA 1P3BC 4G91C 3AFAB 4WU9B 3O62B 1P3LD 5GT3A 5B33C 1HQ3D 4Z66D 3REHB 5E5AD 5GXQC 5B2IC 3MGQB 4CAYB 3REIB 3A6NA 4Z5TA 5GSUC 3VH5W 4E44A 3AZND 2YFVB 5B40A 2Y2NA 4DRAA 1JFIB 3MGPA 1TZYC 3AZMC 3REJC 5B0ZC 3VH6A 5B31C 4EO5B 3V9RB 4H9QA 3TU4B 4H9PA 3AZLB 1BFMA 1M1AD 2NZDD 3W99B 3RELD 5FUGA 3LJAB 4LD9D 3R45B 5CPKC 2JSSA 1EQZD 3X1SA 3UTBD 5AV6C 3AV2B 5B32A 2HUEB 3MVDA 3AFAC 4WU9C 2NQBD 3KWQD 4J8WD 3AN2B 4H9RB 3REHC 2W8SA 3KXBC 1P3IB 5DNMD 2F8NB 3WA9B 2AROD 4Z2MH 3AV1B 5GT3D 3MGQC 1S32A 4J8XA 2Y2HA 3REIC 1AOIA 4X23A 3AYWA 3C1BC 3LELD 2FJ7B 2Y2OA 3NQJA 3MGRA 4ZUXB 5JRGD 4AWLB 4YS3B 1P3FC 3AZEA 3B6FD 3B6GD 5B24A 3AZIA 5CP6B 4KUDD 5B0YC 4WU8C 5B1LD 4WJ3C 3W97A 3FDDA 3TU4C 3W99C 1ID3D 4YM6B 2CV5B 3MGSD 4J8UA 2J8PA 5BNVB 2PYOB 4XUJB 3MNNA 3WAAD 2ZM5A 3AV2C 1P3MC 2HUEC 3VH5T 5CPJC 1P3AD 3LZ0A 4XZQC 1P3LB 1HQ3B 2YFWA 5AV5D 4J8UC 5E5AB 5AVBA 3AN2C 3P5JB 1P3IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT1 D;  3WA9 C;  4QLC A;  3AV1 C;  1F66 C;  5BNX A;  3UTA A;  3UT9 A;  3NQU A;  3W98 A;  1KX5 A;  1TAF B;  3AZN B;  3AZF A;  2FJ7 C;  3LZ1 A;  3X1U D;  1N1J A;  4YS3 C;  4X23 D;  4J8V A;  4AWL C;  1KX4 A;  1P3K C;  5G49 A;  5BS7 C;  1ZLA C;  4M6B A;  5GT0 D;  5AV9 A;  3MGR D;  5AY8 A;  5CP6 C;  1M1A B;  3W96 D;  2NZD B;  3REL B;  3AZF C;  1U35 A;  4LD9 B;  4DRB A;  3AZI D;  5DNN A;  2CV5 C;  1P34 C;  4JJN A;  1P3O D;  1EQZ B;  3W97 D;  2RVQ D;  1P3G D;  4KGC A;  2BYK B;  3X1V B;  1Q9C A;  3UTB B;  2PYO C;  3C1C C;  4CSR B;  4NE6 A;  1P3B A;  1BH8 B;  3AZH D;  2NQB B;  3KWQ B;  4J8W B;  2HIO C;  1F1E A;  1P3L C;  1HQ3 C;  5B33 A;  5E5A C;  5GXQ A;  5DNM B;  2ARO B;  5GT3 B;  3AZG D;  5B2I A;  1ULY A;  5GSU A;  3LEL B;  5AVC A;  3KUY D;  5JRG B;  3B6F B;  1KX5 D;  1HTA A;  1TZY A;  3AZM A;  3B6G B;  3REJ A;  5B0Z A;  5B31 A;  3WTP D;  4KUD B;  5B1M D;  5B1L B;  4R8P D;  5JA4 A;  1M1A C;  4J8V D;  1M19 C;  5BO0 B;  5AVC C;  4KHA A;  4UUZ A;  3REL C;  1ID3 B;  2NZD C;  3WKJ D;  1B6W A;  3X1T D;  4LD9 C;  1KX3 C;  3MGS B;  5CPK A;  3AZJ D;  2F8N G;  1EQZ C;  4H9O A;  3WAA B;  5B2J D;  3X1V C;  3UTB C;  4H9S C;  3WTP E;  5AV6 A;  1P3A B;  3AFA A;  2NQB C;  4WU9 A;  3KWQ C;  5AV5 B;  3REK D;  5F99 C;  3REH A;  1M18 D;  3KXB A;  5DNM C;  2ARO C;  4WNN B;  5CPI D;  5B33 D;  5AV8 D;  3MGQ A;  5GXQ D;  4CAY A;  4E45 A;  3O62 C;  3REI A;  3C1B A;  1P3P D;  3LEL C;  3AZK D;  3X1U B;  2YFV A;  5JRG C;  1JFI A;  4X23 B;  3B6F C;  1P3F A;  5GSU D;  3B6G C;  5GT0 B;  3MGR B;  3V9R A;  4KUD C;  2LY8 A;  3W96 B;  4WU8 A;  5B1L C;  5B0Y A;  4H9N B;  3TU4 A;  5B31 D;  3AZI B;  1ID3 C;  3W99 A;  1P3O B;  3MGS C;  3A6N D;  3W97 B;  4Z5T D;  1P3G B;  5B40 D;  4EO5 C;  3WAA C;  3MGP D;  3AZH B;  3AV2 A;  1P3M A;  3AZL C;  5KDM B;  5CPJ A;  1P3A C;  4XZQ A;  3LJA C;  2BYM B;  5AV5 C;  5AV6 D;  3AN2 A;  4H9R A;  1KU5 A;  1P3I A;  3AZG B;  5BT1 C;  3B0B A;  3WA9 A;  3AV1 A;  1F66 A;  3KXB D;  3X1S D;  4Z66 B;  3KUY B;  2FJ7 A;  5B32 D;  3X1U C;  1KX5 B;  3MVD D;  1BH9 A;  4YS3 A;  3C1B D;  1P3K A;  3B0C T;  3WTP B;  5BS7 A;  1ZLA A;  5B1M B;  4R8P B;  5GT0 C;  4Z2M G;  5CP6 A;  4J8V B;  2IO5 B;  1P3F D;  3WKJ B;  3X1T B;  1S32 D;  4J8X D;  5B0Y D;  4ZUX C;  3AZJ B;  4WU8 D;  2CV5 A;  1P34 A;  1H3O B;  3AYW D;  1P3G C;  1P3O C;  1AOI D;  5B2J B;  3W99 D;  2PYO A;  4XUJ A;  3C1C A;  3B0D B;  3AZE D;  3AZH C;  5B24 D;  3KSY A;  2HIO A;  3REK B;  1P3L A;  4YM6 C;  1HQ3 A;  1P3M D;  1M18 B;  5E5A A;  5CPJ D;  4XZQ D;  4XUJ C;  5CPI B;  3AZG C;  5AV8 B;  4J8U D;  5GXQ B;  3AN2 D;  1P3P B;  5C3I B;  3AZK B;  3MNN D;  1TAF A;  4Z66 C;  3KUY C;  1F66 D;  5GSU B;  3LZ0 D;  3WTP C;  5B1M C;  5AVB D;  2IO5 C;  1M1A A;  1M19 A;  2NZD A;  5B31 B;  3REL A;  3AZN C;  1P3K D;  1ZLA D;  3X1T C;  5B32 G;  4QLC D;  3WKJ C;  3VH6 W;  1KX3 A;  4LD9 A;  3A6N B;  3UTA D;  4Z5T B;  3UT9 D;  3W98 D;  3AZJ C;  1EQZ A;  3AZF D;  1WWS A;  5B40 B;  5B2J C;  3LZ1 D;  3X1V A;  3MGP B;  3UTB A;  4H9S A;  1P34 D;  3B0D C;  1KX4 D;  1BH8 A;  2NQB A;  4H9Q B;  3KWQ A;  5AV9 D;  5AV6 B;  5AY8 D;  4H9P B;  3C1C D;  2PYO D;  3REK C;  5F99 A;  5FUG B;  1M18 C;  1U35 D;  5DNM A;  3B0C W;  4HGA B;  2HIO D;  2ARO A;  5CPI C;  5DNN D;  4JJN D;  5AV8 C;  3KXB B;  3X1S B;  4KGC D;  3O62 A;  4J8W C;  1P3P C;  5C3I C;  3AZK C;  3LEL A;  5B32 B;  1P3B D;  3MVD B;  5JRG A;  3B6F A;  3C1B B;  3B6G A;  5GT3 C;  4KUD A;  1P3F B;  5B1L A;  5BO0 A;  5B2I D;  1S32 B;  1ID3 A;  4J8X B;  5B0Y B;  4WU8 B;  1AOI B;  3A6N C;  3MGS A;  4Z5T C;  3AYW B;  1M19 D;  5AVC D;  5B40 C;  3NQJ B;  1KX3 D;  3VH5 A;  3WAA A;  3MGP C;  3AZE B;  1TZY D;  3AZM D;  3AZL A;  3REJ D;  5B0Z D;  5B24 B;  1P3A A;  3LJA A;  3X1V D;  5AV5 A;  3R45 A;  1P3M B;  5CPJ B;  4XZQ B;  1A7W A;  4HGA C;  4J8U B;  5CPK D;  4WNN A;  2F8N K;  5F99 D;  4NFT A;  2L5A A;  3X1S C;  3MNN B;  3VH6 T;  1F66 B;  5B32 C;  3X1U A;  3LZ0 B;  3MVD C;  3AFA D;  4NE5 A;  1WWI A;  4WU9 D;  3O62 D;  2YFW B;  2F8N A;  5AVB B;  4G92 B;  5GT0 A;  1BH9 B;  3REH D;  4ZBJ B;  3W96 A;  1P3K B;  1ZLA B;  4H9N A;  4QLC B;  5BNX B;  3UTA B;  3UT9 B;  3NQU B;  3MGQ D;  4J8X C;  1S32 C;  3W98 B;  1AOI C;  1P3O A;  4ZUX A;  3REI D;  4X23 C;  3AYW C;  3AZF B;  1P3G A;  3LZ1 B;  3MGR C;  1P34 B;  1N1J B;  3W96 C;  3AZE C;  1KX4 B;  5G49 B;  3AZH A;  2CWE A;  5KDM A;  5B24 C;  5AV9 B;  3AZI C;  5AY8 B;  3C1C B;  2BYM A;  4YM6 A;  3W97 C;  2RVQ C;  3TU4 D;  3AZL D;  1U35 B;  2HIO B;  5BNV A;  3LJA D;  5DNN B;  3AZG A;  4JJN B;  4KGC B;  5B31 G;  3MNN C;  1P3B B;  4Z66 A;  4G91 B;  3AV2 D;  3KUY A;  1R4V A;  3LZ0 C;  4WV4 B;  4NE3 A;  5B33 B;  3WTP A;  5B1M A;  5AVB C;  4G92 C;  4R8P A;  1B67 A;  1P3I D;  4ZBJ C;  5B2I B;  2F8N D;  4WZS B;  3AZN A;  3WKJ A;  4QLC C;  3X1T A;  3WA9 D;  3AV1 D;  3UTA C;  3UT9 C;  3W98 C;  1KX5 C;  1M19 B;  5AVC B;  3AZJ A;  1H3O A;  1KX3 B;  3LZ1 C;  5B2J A;  2FJ7 D;  4R8P C;  2F8N H;  1TZY B;  3AZM B;  4ZUX D;  5B0Z B;  4J8V C;  4YS3 D;  5CHL B;  3REJ B;  1KX4 C;  5AV9 C;  5JA4 B;  5AY8 C;  5CP6 D;  3REK A;  4KHA B;  4UUZ B;  1M18 A;  1U35 C;  2BYK A;  5CPK B;  5CPI A;  5DNN C;  5F99 B;  4CSR A;  4YM6 D;  4JJN C;  2CV5 D;  4H9O B;  5AV8 A;  4KGC C;  4J8W A;  1P3P A;  4XUJ D;  3AZK A;  1P3B C;  4G91 C;  3AFA B;  4WU9 B;  3O62 B;  1P3L D;  5GT3 A;  5B33 C;  1HQ3 D;  4Z66 D;  3REH B;  5E5A D;  5GXQ C;  5B2I C;  3MGQ B;  4CAY B;  3REI B;  3A6N A;  4Z5T A;  3VH5 W;  4E44 A;  5GSU C;  3AZN D;  2YFV B;  5B40 A;  4DRA A;  1JFI B;  3MGP A;  1TZY C;  3AZM C;  3REJ C;  5B0Z C;  3VH6 A;  5B31 C;  4EO5 B;  3V9R B;  4H9Q A;  3TU4 B;  4H9P A;  3AZL B;  1BFM A;  1M1A D;  2NZD D;  3W99 B;  3REL D;  5FUG A;  3LJA B;  4LD9 D;  3R45 B;  5CPK C;  2JSS A;  1EQZ D;  3X1S A;  3UTB D;  5AV6 C;  3AV2 B;  5B32 A;  2HUE B;  3MVD A;  3AFA C;  4WU9 C;  2NQB D;  3KWQ D;  4J8W D;  3AN2 B;  4H9R B;  3REH C;  3KXB C;  1P3I B;  5DNM D;  2F8N B;  3WA9 B;  2ARO D;  4Z2M H;  3AV1 B;  5GT3 D;  3MGQ C;  1S32 A;  4J8X A;  3REI C;  1AOI A;  4X23 A;  3AYW A;  3C1B C;  3LEL D;  2FJ7 B;  3NQJ A;  3MGR A;  4ZUX B;  5JRG D;  4AWL B;  4YS3 B;  1P3F C;  3AZE A;  3B6F D;  3B6G D;  5B24 A;  3AZI A;  5CP6 B;  4KUD D;  5B0Y C;  4WU8 C;  5B1L D;  3W97 A;  3TU4 C;  3W99 C;  1ID3 D;  4YM6 B;  2CV5 B;  3MGS D;  4J8U A;  5BNV B;  2PYO B;  4XUJ B;  3MNN A;  3WAA D;  3AV2 C;  1P3M C;  2HUE C;  3VH5 T;  5CPJ C;  1P3A D;  3LZ0 A;  4XZQ C;  1P3L B;  1HQ3 B;  2YFW A;  5AV5 D;  4J8U C;  5E5A B;  5AVB A;  3AN2 C;  1P3I C; 
#chains in the Genus database with same CATH topology
 5BT1 D;  3WA9 C;  4QLC A;  3AV1 C;  1F66 C;  5BNX A;  3UTA A;  3UT9 A;  3NQU A;  3W98 A;  1KX5 A;  1TAF B;  3AZN B;  3AZF A;  2FJ7 C;  3LZ1 A;  3X1U D;  1N1J A;  4YS3 C;  4X23 D;  4J8V A;  4AWL C;  1Z2C B;  1P3K C;  5G49 A;  5BS7 C;  1KX4 A;  1ZLA C;  4M6B A;  3A1K A;  5GT0 D;  5AV9 A;  3MGR D;  5AY8 A;  5CP6 C;  3EPL A;  1M1A B;  3W96 D;  2NZD B;  3REL B;  3AZF C;  1U35 A;  4LD9 B;  4DRB A;  3EPJ A;  3AZI D;  5DNN A;  2CV5 C;  1P34 C;  4JJN A;  1P3O D;  1EQZ B;  3W97 D;  2RVQ D;  1P3G D;  4KGC A;  2BYK B;  3X1V B;  2Y2P A;  1Q9C A;  3UTB B;  2PYO C;  3C1C C;  3EG5 B;  4NE6 A;  4CSR B;  1P3B A;  1BH8 B;  3AZH D;  2NQB B;  2JE5 A;  2ZY5 A;  3KWQ B;  4J8W B;  2HIO C;  4UPK A;  1F1E A;  1P3L C;  1HQ3 C;  5B33 A;  5E5A C;  5GXQ A;  5DNM B;  2ARO B;  3H0R C;  5GT3 B;  3AZG D;  5B2I A;  2Y2J A;  1ULY A;  5GSU A;  3LEL B;  5AVC A;  3KUY D;  5JRG B;  3B6F B;  1KX5 D;  1HTA A;  1TZY A;  3AZM A;  3B6G B;  3REJ A;  5B0Z A;  3A1I A;  5B31 A;  3WTP D;  4KUD B;  5B1M D;  3EPH A;  5B1L B;  4R8P D;  5JA4 A;  1M1A C;  4J8V D;  1M19 C;  5BO0 B;  5AVC C;  4KHA A;  4UUZ A;  3REL C;  1ID3 B;  2NZD C;  3WKJ D;  1B6W A;  3X1T D;  4LD9 C;  1KX3 C;  3MGS B;  5CPK A;  3AZJ D;  2F8N G;  1EQZ C;  4H9O A;  3WAA B;  5B2J D;  3X1V C;  2ZY3 A;  3UTB C;  4H9S C;  3WTP E;  5AV6 A;  1P3A B;  3AFA A;  2NQB C;  4WU9 A;  3KWQ C;  5AV5 B;  2F2A C;  3REK D;  5F99 C;  3REH A;  1M18 D;  3KXB A;  5DNM C;  2ARO C;  4WNN B;  5CPI D;  5B33 D;  5AV8 D;  3MGQ A;  5GXQ D;  4CAY A;  4E45 A;  3O62 C;  3REI A;  3C1B A;  1P3P D;  3LEL C;  3AZK D;  3X1U B;  2YFV A;  5JRG C;  1JFI A;  4X23 B;  3B6F C;  1P3F A;  5GSU D;  3B6G C;  5GT0 B;  3MGR B;  3V9R A;  4KUD C;  2LY8 A;  3W96 B;  5B1L C;  5B0Y A;  4WU8 A;  1T3U A;  4H9N B;  3TU4 A;  5B31 D;  3AZI B;  1ID3 C;  3W99 A;  1P3O B;  3MGS C;  3A6N D;  3W97 B;  4Z5T D;  1P3G B;  5B40 D;  4EO5 C;  3WAA C;  3MGP D;  3AZH B;  3AV2 A;  1P3M A;  3AZL C;  5KDM B;  5CPJ A;  1P3A C;  4XZQ A;  3LJA C;  2BYM B;  5AV5 C;  5AV6 D;  3AN2 A;  4H9R A;  1KU5 A;  1P3I A;  3AZG B;  5BT1 C;  3B0B A;  3WA9 A;  3AV1 A;  1F66 A;  3KXB D;  3X1S D;  4Z66 B;  3KUY B;  2FJ7 A;  5B32 D;  3X1U C;  1KX5 B;  3MVD D;  1BH9 A;  2Y2L A;  4YS3 A;  3C1B D;  1P3K A;  3B0C T;  3WTP B;  5BS7 A;  1ZLA A;  5B1M B;  4R8P B;  5GT0 C;  4Z2M G;  5CP6 A;  4J8V B;  2IO5 B;  1P3F D;  2G5I C;  3WKJ B;  3X1T B;  1S32 D;  4J8X D;  5B0Y D;  4ZUX C;  3AZJ B;  4WU8 D;  2CV5 A;  1P34 A;  1H3O B;  3AYW D;  1P3G C;  1P3O C;  1AOI D;  5B2J B;  3W99 D;  2PYO A;  4XUJ A;  3C1C A;  3IP4 C;  3B0D B;  3AZE D;  3AZH C;  2ZY2 A;  5B24 D;  3KSY A;  2HIO A;  3REK B;  1P3L A;  4YM6 C;  1HQ3 A;  1P3M D;  1M18 B;  2Y2M A;  5E5A A;  5CPJ D;  4XZQ D;  4XUJ C;  5CPI B;  3AZG C;  5AV8 B;  4J8U D;  5GXQ B;  3AN2 D;  1P3P B;  5C3I B;  3AZK B;  3MNN D;  1TAF A;  4Z66 C;  3KUY C;  2VQR A;  1F66 D;  5GSU B;  3LZ0 D;  3WTP C;  5B1M C;  5AVB D;  3EPK A;  2IO5 C;  1M1A A;  1M19 A;  2NZD A;  5B31 B;  3REL A;  3AZN C;  1P3K D;  1ZLA D;  3X1T C;  5B32 G;  4QLC D;  3WKJ C;  3VH6 W;  1KX3 A;  4LD9 A;  3A6N B;  3UTA D;  4Z5T B;  3UT9 D;  3W98 D;  2Y2G A;  3AZJ C;  1EQZ A;  3AZF D;  1WWS A;  5B40 B;  5B2J C;  3LZ1 D;  3X1V A;  3MGP B;  3UTB A;  4H9S A;  1P34 D;  3B0D C;  1KX4 D;  1BH8 A;  2NQB A;  4H9Q B;  3KWQ A;  5AV9 D;  5AV6 B;  5AY8 D;  4H9P B;  3C1C D;  2PYO D;  3REK C;  5F99 A;  5FUG B;  1M18 C;  1U35 D;  5DNM A;  3B0C W;  4HGA B;  2HIO D;  2ARO A;  5CPI C;  5DNN D;  4JJN D;  5AV8 C;  2Y2I A;  3KXB B;  3X1S B;  4KGC D;  3O62 A;  4J8W C;  1P3P C;  5C3I C;  3AZK C;  3LEL A;  5B32 B;  1P3B D;  3MVD B;  5JRG A;  3B6F A;  3C1B B;  3B6G A;  5GT3 C;  1PZR A;  4KUD A;  1P3F B;  5B1L A;  2ZY4 A;  2RIQ A;  5BO0 A;  5B2I D;  1S32 B;  1ID3 A;  4J8X B;  5B0Y B;  4WU8 B;  1AOI B;  3A6N C;  3MGS A;  4Z5T C;  3AYW B;  1M19 D;  5AVC D;  5B40 C;  3NQJ B;  1KX3 D;  3VH5 A;  3WAA A;  3MGP C;  3AZE B;  1TZY D;  3AZM D;  3AZL A;  3REJ D;  5B0Z D;  5B24 B;  1P3A A;  3LJA A;  3X1V D;  5AV5 A;  3R45 A;  1P3M B;  5CPJ B;  4XZQ B;  1A7W A;  4HGA C;  4J8U B;  5CPK D;  4WNN A;  2F8N K;  5F99 D;  4NFT A;  2DF4 C;  2L5A A;  3X1S C;  3MNN B;  3VH6 T;  1F66 B;  5B32 C;  3X1U A;  3LZ0 B;  3MVD C;  3AFA D;  4NE5 A;  1WWI A;  4WU9 D;  2BG1 A;  3H0L C;  3O62 D;  2YFW B;  2F8N A;  5AVB B;  4G92 B;  5GT0 A;  1BH9 B;  3REH D;  3KFU G;  4ZBJ B;  3W96 A;  1P3K B;  1ZLA B;  4H9N A;  4QLC B;  2JCH A;  5BNX B;  3UTA B;  3UT9 B;  3NQU B;  3MGQ D;  4J8X C;  1S32 C;  3W98 B;  1AOI C;  1P3O A;  4ZUX A;  3REI D;  4X23 C;  3AYW C;  3AZF B;  1P3G A;  2Y2K A;  3LZ1 B;  2UWX A;  3MGR C;  1P34 B;  1N1J B;  3W96 C;  3AZE C;  1KX4 B;  5G49 B;  2Y2Q A;  2CWE A;  3AZH A;  5KDM A;  5B24 C;  2XD5 A;  5AV9 B;  3AZI C;  5AY8 B;  3C1C B;  2BYM A;  4YM6 A;  3W97 C;  2RVQ C;  3TU4 D;  3AZL D;  1U35 B;  2HIO B;  5BNV A;  3LJA D;  5DNN B;  3AZG A;  4JJN B;  4KGC B;  5B31 G;  3F6T A;  2FFF B;  3MNN C;  1P3B B;  4Z66 A;  4G91 B;  3AV2 D;  3KUY A;  1R4V A;  3LZ0 C;  1W2E A;  4WV4 B;  4NE3 A;  5B33 B;  3AL0 C;  3WTP A;  5B1M A;  5AVB C;  4G92 C;  4R8P A;  2XD1 A;  1B67 A;  1P3I D;  2DQN C;  4ZBJ C;  5B2I B;  2F8N D;  4WZS B;  3AZN A;  3WKJ A;  4QLC C;  3X1T A;  3WA9 D;  3AV1 D;  3UTA C;  3UT9 C;  3W98 C;  1KX5 C;  1M19 B;  5AVC B;  3AZJ A;  1H3O A;  4DQY B;  1KX3 B;  3LZ1 C;  5B2J A;  2FJ7 D;  4R8P C;  2F8N H;  1TZY B;  3AZM B;  3H0M C;  4ZUX D;  5B0Z B;  4J8V C;  4YS3 D;  5CHL B;  3REJ B;  1KX4 C;  5AV9 C;  5JA4 B;  5AY8 C;  5CP6 D;  3REK A;  4KHA B;  4UUZ B;  1M18 A;  1U35 C;  2BYK A;  2G5H C;  5CPK B;  5CPI A;  5DNN C;  5F99 B;  4CSR A;  4YM6 D;  4JJN C;  2CV5 D;  4H9O B;  5AV8 A;  4KGC C;  4J8W A;  1P3P A;  4XUJ D;  3AZK A;  1P3B C;  4G91 C;  3AFA B;  4WU9 B;  3O62 B;  1P3L D;  5GT3 A;  5B33 C;  1HQ3 D;  4Z66 D;  3REH B;  5E5A D;  5GXQ C;  5B2I C;  3MGQ B;  4CAY B;  3REI B;  3A6N A;  4Z5T A;  5GSU C;  3VH5 W;  4E44 A;  3AZN D;  2YFV B;  5B40 A;  2Y2N A;  4DRA A;  1JFI B;  3MGP A;  1TZY C;  3AZM C;  3REJ C;  5B0Z C;  3VH6 A;  5B31 C;  4EO5 B;  3V9R B;  4H9Q A;  3TU4 B;  4H9P A;  3AZL B;  1BFM A;  1M1A D;  2NZD D;  3W99 B;  3REL D;  5FUG A;  3LJA B;  4LD9 D;  3R45 B;  5CPK C;  2JSS A;  1EQZ D;  3X1S A;  3UTB D;  5AV6 C;  3AV2 B;  5B32 A;  2HUE B;  3MVD A;  3AFA C;  4WU9 C;  2NQB D;  3KWQ D;  4J8W D;  3AN2 B;  4H9R B;  3REH C;  2W8S A;  3KXB C;  1P3I B;  5DNM D;  2F8N B;  3WA9 B;  2ARO D;  4Z2M H;  3AV1 B;  5GT3 D;  3MGQ C;  1S32 A;  4J8X A;  2Y2H A;  3REI C;  1AOI A;  4X23 A;  3AYW A;  3C1B C;  3LEL D;  2FJ7 B;  2Y2O A;  3NQJ A;  3MGR A;  4ZUX B;  5JRG D;  4AWL B;  4YS3 B;  1P3F C;  3AZE A;  3B6F D;  3B6G D;  5B24 A;  3AZI A;  5CP6 B;  4KUD D;  5B0Y C;  4WU8 C;  5B1L D;  4WJ3 C;  3W97 A;  3FDD A;  3TU4 C;  3W99 C;  1ID3 D;  4YM6 B;  2CV5 B;  3MGS D;  4J8U A;  2J8P A;  5BNV B;  2PYO B;  4XUJ B;  3MNN A;  3WAA D;  2ZM5 A;  3AV2 C;  1P3M C;  2HUE C;  3VH5 T;  5CPJ C;  1P3A D;  3LZ0 A;  4XZQ C;  1P3L B;  1HQ3 B;  2YFW A;  5AV5 D;  4J8U C;  5E5A B;  5AVB A;  3AN2 C;  3P5J B;  1P3I C; 
#chains in the Genus database with same CATH homology
 5BT1 D;  3WA9 C;  4QLC A;  3AV1 C;  1F66 C;  5BNX A;  3UTA A;  3UT9 A;  3NQU A;  3W98 A;  1KX5 A;  1TAF B;  3AZN B;  3AZF A;  2FJ7 C;  3LZ1 A;  3X1U D;  1N1J A;  4YS3 C;  4X23 D;  4J8V A;  4AWL C;  1Z2C B;  1P3K C;  5G49 A;  5BS7 C;  1KX4 A;  1ZLA C;  4M6B A;  3A1K A;  5GT0 D;  5AV9 A;  3MGR D;  5AY8 A;  5CP6 C;  3EPL A;  1M1A B;  3W96 D;  2NZD B;  3REL B;  3AZF C;  1U35 A;  4LD9 B;  4DRB A;  3EPJ A;  3AZI D;  5DNN A;  2CV5 C;  1P34 C;  4JJN A;  1P3O D;  1EQZ B;  3W97 D;  2RVQ D;  1P3G D;  4KGC A;  2BYK B;  3X1V B;  2Y2P A;  1Q9C A;  3UTB B;  2PYO C;  3C1C C;  3EG5 B;  4NE6 A;  4CSR B;  1P3B A;  1BH8 B;  3AZH D;  2NQB B;  2JE5 A;  2ZY5 A;  3KWQ B;  4J8W B;  2HIO C;  4UPK A;  1F1E A;  1P3L C;  1HQ3 C;  5B33 A;  5E5A C;  5GXQ A;  5DNM B;  2ARO B;  3H0R C;  5GT3 B;  3AZG D;  5B2I A;  2Y2J A;  1ULY A;  5GSU A;  3LEL B;  5AVC A;  3KUY D;  5JRG B;  3B6F B;  1KX5 D;  1HTA A;  1TZY A;  3AZM A;  3B6G B;  3REJ A;  5B0Z A;  3A1I A;  5B31 A;  3WTP D;  4KUD B;  5B1M D;  3EPH A;  5B1L B;  4R8P D;  5JA4 A;  1M1A C;  4J8V D;  1M19 C;  5BO0 B;  5AVC C;  4KHA A;  4UUZ A;  3REL C;  1ID3 B;  2NZD C;  3WKJ D;  1B6W A;  3X1T D;  4LD9 C;  1KX3 C;  3MGS B;  5CPK A;  3AZJ D;  2F8N G;  1EQZ C;  4H9O A;  3WAA B;  5B2J D;  3X1V C;  2ZY3 A;  3UTB C;  4H9S C;  3WTP E;  5AV6 A;  1P3A B;  3AFA A;  2NQB C;  4WU9 A;  3KWQ C;  5AV5 B;  2F2A C;  3REK D;  5F99 C;  3REH A;  1M18 D;  3KXB A;  5DNM C;  2ARO C;  4WNN B;  5CPI D;  5B33 D;  5AV8 D;  3MGQ A;  5GXQ D;  4CAY A;  4E45 A;  3O62 C;  3REI A;  3C1B A;  1P3P D;  3LEL C;  3AZK D;  3X1U B;  2YFV A;  5JRG C;  1JFI A;  4X23 B;  3B6F C;  1P3F A;  5GSU D;  3B6G C;  5GT0 B;  3MGR B;  3V9R A;  4KUD C;  2LY8 A;  3W96 B;  5B1L C;  5B0Y A;  4WU8 A;  1T3U A;  4H9N B;  3TU4 A;  5B31 D;  3AZI B;  1ID3 C;  3W99 A;  1P3O B;  3MGS C;  3A6N D;  3W97 B;  4Z5T D;  1P3G B;  5B40 D;  4EO5 C;  3WAA C;  3MGP D;  3AZH B;  3AV2 A;  1P3M A;  3AZL C;  5KDM B;  5CPJ A;  1P3A C;  4XZQ A;  3LJA C;  2BYM B;  5AV5 C;  5AV6 D;  3AN2 A;  4H9R A;  1KU5 A;  1P3I A;  3AZG B;  5BT1 C;  3B0B A;  3WA9 A;  3AV1 A;  1F66 A;  3KXB D;  3X1S D;  4Z66 B;  3KUY B;  2FJ7 A;  5B32 D;  3X1U C;  1KX5 B;  3MVD D;  1BH9 A;  2Y2L A;  4YS3 A;  3C1B D;  1P3K A;  3B0C T;  3WTP B;  5BS7 A;  1ZLA A;  5B1M B;  4R8P B;  5GT0 C;  4Z2M G;  5CP6 A;  4J8V B;  2IO5 B;  1P3F D;  2G5I C;  3WKJ B;  3X1T B;  1S32 D;  4J8X D;  5B0Y D;  4ZUX C;  3AZJ B;  4WU8 D;  2CV5 A;  1P34 A;  1H3O B;  3AYW D;  1P3G C;  1P3O C;  1AOI D;  5B2J B;  3W99 D;  2PYO A;  4XUJ A;  3C1C A;  3IP4 C;  3B0D B;  3AZE D;  3AZH C;  2ZY2 A;  5B24 D;  3KSY A;  2HIO A;  3REK B;  1P3L A;  4YM6 C;  1HQ3 A;  1P3M D;  1M18 B;  2Y2M A;  5E5A A;  5CPJ D;  4XZQ D;  4XUJ C;  5CPI B;  3AZG C;  5AV8 B;  4J8U D;  5GXQ B;  3AN2 D;  1P3P B;  5C3I B;  3AZK B;  3MNN D;  1TAF A;  4Z66 C;  3KUY C;  2VQR A;  1F66 D;  5GSU B;  3LZ0 D;  3WTP C;  5B1M C;  5AVB D;  3EPK A;  2IO5 C;  1M1A A;  1M19 A;  2NZD A;  5B31 B;  3REL A;  3AZN C;  1P3K D;  1ZLA D;  3X1T C;  5B32 G;  4QLC D;  3WKJ C;  3VH6 W;  1KX3 A;  4LD9 A;  3A6N B;  3UTA D;  4Z5T B;  3UT9 D;  3W98 D;  2Y2G A;  3AZJ C;  1EQZ A;  3AZF D;  1WWS A;  5B40 B;  5B2J C;  3LZ1 D;  3X1V A;  3MGP B;  3UTB A;  4H9S A;  1P34 D;  3B0D C;  1KX4 D;  1BH8 A;  2NQB A;  4H9Q B;  3KWQ A;  5AV9 D;  5AV6 B;  5AY8 D;  4H9P B;  3C1C D;  2PYO D;  3REK C;  5F99 A;  5FUG B;  1M18 C;  1U35 D;  5DNM A;  3B0C W;  4HGA B;  2HIO D;  2ARO A;  5CPI C;  5DNN D;  4JJN D;  5AV8 C;  2Y2I A;  3KXB B;  3X1S B;  4KGC D;  3O62 A;  4J8W C;  1P3P C;  5C3I C;  3AZK C;  3LEL A;  5B32 B;  1P3B D;  3MVD B;  5JRG A;  3B6F A;  3C1B B;  3B6G A;  5GT3 C;  1PZR A;  4KUD A;  1P3F B;  5B1L A;  2ZY4 A;  2RIQ A;  5BO0 A;  5B2I D;  1S32 B;  1ID3 A;  4J8X B;  5B0Y B;  4WU8 B;  1AOI B;  3A6N C;  3MGS A;  4Z5T C;  3AYW B;  1M19 D;  5AVC D;  5B40 C;  3NQJ B;  1KX3 D;  3VH5 A;  3WAA A;  3MGP C;  3AZE B;  1TZY D;  3AZM D;  3AZL A;  3REJ D;  5B0Z D;  5B24 B;  1P3A A;  3LJA A;  3X1V D;  5AV5 A;  3R45 A;  1P3M B;  5CPJ B;  4XZQ B;  1A7W A;  4HGA C;  4J8U B;  5CPK D;  4WNN A;  2F8N K;  5F99 D;  4NFT A;  2DF4 C;  2L5A A;  3X1S C;  3MNN B;  3VH6 T;  1F66 B;  5B32 C;  3X1U A;  3LZ0 B;  3MVD C;  3AFA D;  4NE5 A;  1WWI A;  4WU9 D;  2BG1 A;  3H0L C;  3O62 D;  2YFW B;  2F8N A;  5AVB B;  4G92 B;  5GT0 A;  1BH9 B;  3REH D;  3KFU G;  4ZBJ B;  3W96 A;  1P3K B;  1ZLA B;  4H9N A;  4QLC B;  2JCH A;  5BNX B;  3UTA B;  3UT9 B;  3NQU B;  3MGQ D;  4J8X C;  1S32 C;  3W98 B;  1AOI C;  1P3O A;  4ZUX A;  3REI D;  4X23 C;  3AYW C;  3AZF B;  1P3G A;  2Y2K A;  3LZ1 B;  2UWX A;  3MGR C;  1P34 B;  1N1J B;  3W96 C;  3AZE C;  1KX4 B;  5G49 B;  2Y2Q A;  2CWE A;  3AZH A;  5KDM A;  5B24 C;  2XD5 A;  5AV9 B;  3AZI C;  5AY8 B;  3C1C B;  2BYM A;  4YM6 A;  3W97 C;  2RVQ C;  3TU4 D;  3AZL D;  1U35 B;  2HIO B;  5BNV A;  3LJA D;  5DNN B;  3AZG A;  4JJN B;  4KGC B;  5B31 G;  3F6T A;  2FFF B;  3MNN C;  1P3B B;  4Z66 A;  4G91 B;  3AV2 D;  3KUY A;  1R4V A;  3LZ0 C;  1W2E A;  4WV4 B;  4NE3 A;  5B33 B;  3AL0 C;  3WTP A;  5B1M A;  5AVB C;  4G92 C;  4R8P A;  2XD1 A;  1B67 A;  1P3I D;  2DQN C;  4ZBJ C;  5B2I B;  2F8N D;  4WZS B;  3AZN A;  3WKJ A;  4QLC C;  3X1T A;  3WA9 D;  3AV1 D;  3UTA C;  3UT9 C;  3W98 C;  1KX5 C;  1M19 B;  5AVC B;  3AZJ A;  1H3O A;  4DQY B;  1KX3 B;  3LZ1 C;  5B2J A;  2FJ7 D;  4R8P C;  2F8N H;  1TZY B;  3AZM B;  3H0M C;  4ZUX D;  5B0Z B;  4J8V C;  4YS3 D;  5CHL B;  3REJ B;  1KX4 C;  5AV9 C;  5JA4 B;  5AY8 C;  5CP6 D;  3REK A;  4KHA B;  4UUZ B;  1M18 A;  1U35 C;  2BYK A;  2G5H C;  5CPK B;  5CPI A;  5DNN C;  5F99 B;  4CSR A;  4YM6 D;  4JJN C;  2CV5 D;  4H9O B;  5AV8 A;  4KGC C;  4J8W A;  1P3P A;  4XUJ D;  3AZK A;  1P3B C;  4G91 C;  3AFA B;  4WU9 B;  3O62 B;  1P3L D;  5GT3 A;  5B33 C;  1HQ3 D;  4Z66 D;  3REH B;  5E5A D;  5GXQ C;  5B2I C;  3MGQ B;  4CAY B;  3REI B;  3A6N A;  4Z5T A;  5GSU C;  3VH5 W;  4E44 A;  3AZN D;  2YFV B;  5B40 A;  2Y2N A;  4DRA A;  1JFI B;  3MGP A;  1TZY C;  3AZM C;  3REJ C;  5B0Z C;  3VH6 A;  5B31 C;  4EO5 B;  3V9R B;  4H9Q A;  3TU4 B;  4H9P A;  3AZL B;  1BFM A;  1M1A D;  2NZD D;  3W99 B;  3REL D;  5FUG A;  3LJA B;  4LD9 D;  3R45 B;  5CPK C;  2JSS A;  1EQZ D;  3X1S A;  3UTB D;  5AV6 C;  3AV2 B;  5B32 A;  2HUE B;  3MVD A;  3AFA C;  4WU9 C;  2NQB D;  3KWQ D;  4J8W D;  3AN2 B;  4H9R B;  3REH C;  2W8S A;  3KXB C;  1P3I B;  5DNM D;  2F8N B;  3WA9 B;  2ARO D;  4Z2M H;  3AV1 B;  5GT3 D;  3MGQ C;  1S32 A;  4J8X A;  2Y2H A;  3REI C;  1AOI A;  4X23 A;  3AYW A;  3C1B C;  3LEL D;  2FJ7 B;  2Y2O A;  3NQJ A;  3MGR A;  4ZUX B;  5JRG D;  4AWL B;  4YS3 B;  1P3F C;  3AZE A;  3B6F D;  3B6G D;  5B24 A;  3AZI A;  5CP6 B;  4KUD D;  5B0Y C;  4WU8 C;  5B1L D;  4WJ3 C;  3W97 A;  3FDD A;  3TU4 C;  3W99 C;  1ID3 D;  4YM6 B;  2CV5 B;  3MGS D;  4J8U A;  2J8P A;  5BNV B;  2PYO B;  4XUJ B;  3MNN A;  3WAA D;  2ZM5 A;  3AV2 C;  1P3M C;  2HUE C;  3VH5 T;  5CPJ C;  1P3A D;  3LZ0 A;  4XZQ C;  1P3L B;  1HQ3 B;  2YFW A;  5AV5 D;  4J8U C;  5E5A B;  5AVB A;  3AN2 C;  3P5J B;  1P3I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...