5JRGC

Crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5jrgC00
5BS7A 5JRGD 2BYMB 3C1BD 4H9PA 3AZEB 1P3FC 3W99B 5CPIA 3C1CB 4J8VC 5FUGB 3LZ1C 3X1TC 3X1VA 1KX4C 3MVDA 1TAFB 3LZ0B 3X1SA 1BH8A 1Q9CA 3UTAD 2FJ7C 3MNND 2BYKA 4G91B 5B32B 4J8UA 1WWIA 5CPKA 3MGRD 5F99D 5AVBC 3AZKD 2F8NB 4WU8A 1JFIB 4Z5TB 4ZUXC 2LY8A 5B0ZD 1KX4B 4Z66D 4WU9A 3LELB 2YFVB 4H9OB 1M18C 3WTPA 1EQZC 5AV9C 2NQBA 5AV8A 3W97B 1R4VA 1KU5A 3REJD 3AYWD 5B31D 1P3AA 3LJAB 4ZBJC 3KWQD 1P3OD 3TU4D 4KHAB 1AOIA 4KGCA 5DNNA 3KXBA 4EO5C 3AZLA 1KX5C 5B1LD 3UT9A 1P3BB 1BH9B 5AV6D 1EQZB 1TZYD 5CHLB 4R8PD 2PYOC 3WAAB 3B0DC 1M1AB 3AN2B 5CPJC 5JRGB 3B0CW 3B6FC 3NQJA 5CP6C 3O62D 4JJND 3W96D 3AZGA 3C1BB 3UTBD 3AZIC 3W98C 2HIOD 1P3KD 1P3PD 3WTPE 4G92C 1P34A 1P3GA 5BNXB 5B0ZC 5GXQA 4J8XC 3AV2D 5B2ID 1S32C 3AZMA 5CPJB 3X1UD 3MGSD 3UTAB 5BT1D 3KUYD 3AFAA 3WA9A 1ULYA 2NZDA 3AZIB 3AZJA 4NE5A 4XUJC 4YM6D 5BS7C 4H9RB 5F99B 1H3OA 4H9NA 3MGPD 3MGRB 3W98B 3C1CD 4AWLB 5G49B 2RVQD 5GSUA 4G92B 5B0ZB 4J8XB 5CPIC 2CV5A 3X1VC 5AV5A 3MVDC 5B1MA 3X1SC 1P3FD 4KUDA 5B2JA 4J8VD 3REJB 5B31B 4CAYB 2F8ND 3KWQB 1HQ3A 4J8UC 3X1TD 3LZ1D 3TU4B 5CPKC 5B33A 5BNVA 4WNNA 3RELA 5B1LB 2FJ7D 5BO0A 4WU8C 1P3LA 4H9QB 5AV6B 4R8PB 4WU9C 2AROA 5DNMA 3VH6A 5GT3A 3WTPC 5AVBD 3AZFA 5AVCA 4ZUXD 4J8UB 4JJNB 2NQBC 5AV8C 3W96B 3UTBB 5CPKB 3AZNA 2JSSA 5B24D 4YM6C 5GT0A 1M18D 1EQZD 3VH5A 1AOIC 5AV9D 4KGCC 5DNNC 3KXBC 5B2IB 3AZLC 3UT9C 3MGSB 3KUYB 2YFWA 5KDMB 3REIA 3WKJA 5E5AA 1M19A 1P3IA 1KX5D 4YM6B 3MGPB 3AZGC 2PYOD 4WZSB 1ID3A 3B0BA 3REKA 1BFMA 5CPJD 5JA4A 1P34C 1P3GC 5CP6D 3B6FD 3AZID 3AZMC 1KX3A 1P3FB 3W98D 4QLCA 3NQJB 4J8VB 3AZHA 3AFAC 3WA9C 2NZDC 3LZ1B 4J8XD 3AZJC 3X1TB 1S32D 4YS3A 5B24C 3V9RB 2FJ7B 5GSUC 4CSRA 1P3GB 1A7WA 3A6NA 4X23A 4XUJD 3MGQA 5AVBB 2CV5C 4UUZB 2IO5C 3KSYA 5AV5C 4ZUXB 3AZJB 5B1MC 1N1JA 4LD9A 4H9NB 5B2JC 5CPID 4KUDC 5B24B 1B67A 4J8WA 1M18B 1HQ3C 1ZLAA 3X1VD 3NQUB 3MVDD 3B6GA 3AV1A 5AV9B 5B33C 1U35A 1F66A 3RELC 3X1SD 1P3LC 2BYMA 2IO5B 4ZBJB 2AROC 4J8UD 1B6WA 4DRBA 5B1MB 5DNMC 5CPKD 3AZEA 5GT3C 1HTAA 3W99A 3AZFC 3VH5W 4EO5B 1KX5B 4WU8D 5AVCC 5FUGA 2PYOB 3B0DB 4WU9D 3AZNC 4WNNB 3LZ0A 5GT0C 3WTPD 5BO0B 4DRAA 3B6FB 5CP6B 5B32A 5AV8D 2NQBD 3VH6T 1P3AD 5AVCB 1JFIA 4Z5TA 3REIC 3WKJC 5E5AC 1KX4A 1M19C 1AOID 1P3IC 4KGCD 5DNND 3KXBD 3LELA 3REHA 1S32B 3AZLD 5GT0B 3UT9D 5B0YA 4H9SA 1ID3C 3VH5T 1F1EA 3REKC 3W97A 3R45B 4XUJB 3LJAA 1P3MA 3AZGD 3WKJB 2HUEC 4H9PB 4KHAA 1KX3C 4XZQA 5CPIB 3AZHC 2L5AA 1P3BA 1BH9A 5B40A 1P34D 1P3GD 5GXQD 3WAAA 3X1VB 5AY8A 3MVDB 4YS3C 3AZMD 1M1AA 3AN2A 3X1SB 1BH8B 5JRGA 2BYKB 3A6NC 3AFAD 3WA9D 2NZDD 2HUEB 3C1BA 4X23C 3AZJD 1KX3B 3MGQC 1P3AC 5GSUD 4WU8B 5BNXA 5B32G 4WU9B 4LD9C 4E44A 4J8WC 3WTPB 3UTAA 2CV5D 1ZLAC 2F8NG 3MNNA 5AV5D 3B6GC 3AV1C 1U35C 4X23B 5AV8B 1F66C 2NQBB 5B1MD 3MGQB 5B2JD 4H9RA 5F99A 3MGRA 1P3AB 4KUDD 3AZKA 5G49A 5C3IC 1HQ3D 5B0ZA 1AOIB 3AZEC 5B33D 4NE6A 4Z66A 5DNNB 3KXBB 3W99C 3RELD 4KGCB 3AZLB 3UT9B 1P3LD 3AV1B 2AROD 4WV4B 5GXQC 1U35B 5DNMD 3LZ0C 5GT3D 3AZFD 3REJA 3AYWA 5B31A 4CAYA 5AVCD 5C3IB 3KWQA 4G91C 5B32C 3AZGB 1P3OA 3TU4A 3AZND 4Z2MH 5GT0D 5B1LA 4Z5TC 4H9QA 5AV6A 1TZYA 1P34B 4R8PA 2F8NH 5GXQB 4M6BA 3LELC 3REHC 3AZMB 5B0YC 4H9SC 3AFAB 3O62A 3REID 4NFTA 4JJNA 3WA9B 5E5AD 3W96A 1M19D 3UTBA 3W97C 1P3ID 3WKJD 2NZDB 1H3OB 3LJAC 1P3MC 2HIOA 5GSUB 1P3KA 4HGAC 1P3PA 1ID3D 3VH6W 3REHB 3REKD 3AV2A 4XZQC 5B2IA 4E45A 5B0YB 3X1UA 1P3BC 3MGSA 3KUYA 5B40C 2CV5B 3WAAC 5AY8C 5KDMA 5AV5B 1M1AC 1KX3D 3AN2C 4QLCD 4YM6A 5JRGC 5B2JB 3MGPA 3AZHD 1P3MB 4KUDB 3C1CA 4HGAB 1HQ3B 3C1BC 4XZQB 5B33B 5BNVB 4YS3D 1TAFA 3RELB 4NE3A 5B40B 5B31G 1P3LB 3A6ND 5AY8B 2F8NK 2AROB 4X23D 5DNMB 5GT3B 3MGQD 1P3FA 3UTAC 3AZFB 4J8VA 3MNNC 2F8NA 3LZ1A 3X1TA 4LD9D 3AZNB 3MGRC 5F99C 2YFVA 4J8WD 3AZKC 3V9RA 4H9OA 4AWLC 2FJ7A 1ZLAD 3B6GD 3AV1D 1U35D 4Z66C 1F66D 5AVBA 4UUZA 2YFWB 3MNNB 4ZUXA 3REIB 5E5AB 1M19B 3AZED 1P3IB 3W99D 5B24A 4QLCC 5B31C 3REJC 3AZKB 3AYWC 1M18A 3KWQC 1EQZA 1P3OC 3NQUA 3TU4C 2CWEA 1ID3B 3B0CT 4Z66B 5AV9A 3REKB 3LZ0D 5B1LC 5JA4B 5AV6C 1TZYC 4R8PC 1WWSA 5B32D 3AYWB 4QLCB 1KX5A 3AZHB 4Z5TD 3O62C 4JJNC 1P3OB 1KX4D 3W96C 3UTBC 2PYOA 3LELD 3REHD 4Z2MG 4YS3B 2HIOC 5B0YD 5CPJA 4CSRB 1TZYB 1P3KC 1P3PC 3B6FA 5CP6A 3A6NB 3AV2C 3AZIA 5B2IC 3W97D 3X1UC 3MGSC 3LJAD 5BT1C 3KUYC 1P3MD 3W98A 3O62B 4J8XA 1N1JB 4XZQD 1S32A 4LD9B 3MGPC 2HIOB 3C1CC 4J8WB 1P3BD 5B40D 2RVQC 1P3KB 1P3PB 1ZLAB 3WAAD 5AY8D 3AV2B 3B6GB 1M1AD 1F66B 3R45A 3AN2D 4XUJA 3X1UB
chains in the Genus database with same CATH superfamily
5BS7A 5JRGD 2BYMB 3C1BD 4H9PA 3AZEB 1P3FC 3W99B 5CPIA 3C1CB 4J8VC 5FUGB 3LZ1C 3X1TC 3X1VA 1KX4C 3MVDA 1TAFB 3LZ0B 3X1SA 1BH8A 1Q9CA 3UTAD 2FJ7C 3MNND 2BYKA 4G91B 5B32B 4J8UA 1WWIA 5CPKA 3MGRD 5F99D 5AVBC 3AZKD 2F8NB 4WU8A 1JFIB 4Z5TB 4ZUXC 2LY8A 5B0ZD 2ZM5A 1KX4B 4Z66D 3H0MC 3LELB 4WU9A 2G5IC 2YFVB 2W8SA 4H9OB 3WTPA 1M18C 1EQZC 5AV9C 2NQBA 5AV8A 3W97B 1R4VA 2F2AC 1KU5A 3REJD 3AYWD 5B31D 1P3AA 3LJAB 4ZBJC 3KWQD 2ZY3A 1P3OD 3TU4D 4KHAB 1AOIA 4KGCA 5DNNA 3KXBA 4EO5C 3AZLA 1KX5C 5B1LD 1T3UA 3UT9A 1P3BB 1BH9B 5AV6D 1EQZB 1TZYD 5CHLB 4R8PD 2PYOC 3WAAB 3B0DC 1M1AB 3AN2B 5CPJC 5JRGB 3B0CW 3B6FC 3NQJA 5CP6C 3O62D 4JJND 3W96D 3AZGA 3C1BB 3UTBD 3AZIC 3EPHA 3W98C 2HIOD 1P3KD 2JCHA 1P3PD 3WTPE 4G92C 1P34A 1P3GA 5BNXB 5B0ZC 5GXQA 4J8XC 3AV2D 5B2ID 1S32C 2ZY4A 3AZMA 5CPJB 3X1UD 3MGSD 3EPKA 5BT1D 3KUYD 2Y2NA 3UTAB 3A1IA 3AFAA 3WA9A 1ULYA 2NZDA 3AZIB 3AZJA 4NE5A 4XUJC 4YM6D 5BS7C 4H9RB 5F99B 1H3OA 4H9NA 3MGPD 3MGRB 3W98B 3C1CD 4AWLB 5G49B 2J8PA 2RVQD 2Y2LA 5GSUA 4G92B 5B0ZB 2Y2HA 4J8XB 4WJ3C 5CPIC 2CV5A 3X1VC 5AV5A 3MVDC 5B1MA 3X1SC 2Y2MA 1P3FD 4KUDA 5B2JA 4J8VD 3REJB 5B31B 4CAYB 2F8ND 3KWQB 1HQ3A 4J8UC 3X1TD 3LZ1D 3TU4B 5CPKC 5B33A 5BNVA 3AL0C 4WNNA 3RELA 5B1LB 2FJ7D 5BO0A 4WU8C 1P3LA 4H9QB 5AV6B 4R8PB 4WU9C 2AROA 5DNMA 3VH6A 5GT3A 3WTPC 5AVBD 3AZFA 5AVCA 4ZUXD 4J8UB 4JJNB 2NQBC 5AV8C 3W96B 3UTBB 5CPKB 3AZNA 2JSSA 5B24D 4YM6C 5GT0A 1M18D 1W2EA 1EQZD 3VH5A 1AOIC 5AV9D 4KGCC 5DNNC 3KXBC 5B2IB 3AZLC 3UT9C 3EPJA 3MGSB 3KUYB 2YFWA 5KDMB 3REIA 3WKJA 5E5AA 1M19A 1P3IA 1KX5D 4YM6B 3MGPB 2DQNC 3AZGC 2PYOD 4WZSB 1ID3A 3B0BA 2Y2IA 3REKA 1BFMA 5CPJD 5JA4A 2XD1A 1P34C 1P3GC 5CP6D 3B6FD 3AZID 3AZMC 1KX3A 1P3FB 3W98D 4QLCA 3NQJB 4J8VB 3AZHA 3AFAC 3WA9C 2NZDC 3LZ1B 4J8XD 3AZJC 3A1KA 3X1TB 1S32D 4YS3A 5B24C 3V9RB 2FJ7B 5GSUC 4CSRA 1P3GB 1A7WA 3A6NA 4DQYB 4X23A 4XUJD 3MGQA 5AVBB 2CV5C 4UUZB 2IO5C 3KSYA 5AV5C 4ZUXB 3AZJB 5B1MC 1N1JA 4LD9A 4H9NB 5B2JC 5CPID 4KUDC 5B24B 1B67A 4J8WA 1M18B 1HQ3C 1ZLAA 3X1VD 3NQUB 2XD5A 3MVDD 3B6GA 3AV1A 5AV9B 5B33C 1U35A 1F66A 3RELC 3X1SD 2ZY2A 2BYMA 2IO5B 2Y2KA 1P3LC 4ZBJB 2AROC 4J8UD 1B6WA 4DRBA 5B1MB 5DNMC 5CPKD 3AZEA 5GT3C 1HTAA 3W99A 3AZFC 3VH5W 4EO5B 1KX5B 4WU8D 5AVCC 5FUGA 2PYOB 3B0DB 4WU9D 3AZNC 4WNNB 3LZ0A 5GT0C 3WTPD 5BO0B 4DRAA 3B6FB 5CP6B 5B32A 5AV8D 2NQBD 3VH6T 1P3AD 5AVCB 1JFIA 4Z5TA 3REIC 3WKJC 5E5AC 1KX4A 1M19C 1AOID 1P3IC 4KGCD 5DNND 3KXBD 2ZY5A 3LELA 3REHA 3AZLD 1S32B 5GT0B 3UT9D 5B0YA 4H9SA 2G5HC 1ID3C 3VH5T 1F1EA 3REKC 3W97A 3R45B 4XUJB 3LJAA 1P3MA 3AZGD 3WKJB 2HUEC 4H9PB 4KHAA 1KX3C 4XZQA 5CPIB 3AZHC 2L5AA 1P3BA 1BH9A 5B40A 1P34D 3F6TA 1P3GD 5GXQD 3WAAA 3X1VB 5AY8A 3MVDB 4YS3C 3AZMD 1M1AA 3AN2A 3X1SB 1BH8B 5JRGA 2BYKB 3A6NC 3AFAD 3WA9D 2NZDD 2HUEB 3C1BA 4X23C 3AZJD 1KX3B 3MGQC 1P3AC 5GSUD 4WU8B 5BNXA 5B32G 4WU9B 4LD9C 4E44A 4J8WC 3WTPB 3UTAA 2CV5D 1ZLAC 2F8NG 2JE5A 2UWXA 3MNNA 5AV5D 3B6GC 3AV1C 1U35C 4X23B 5AV8B 1F66C 2NQBB 5B1MD 3MGQB 5B2JD 4H9RA 5F99A 3MGRA 1P3AB 4KUDD 3AZKA 5G49A 5C3IC 1HQ3D 2DF4C 5B0ZA 1AOIB 3AZEC 5B33D 4NE6A 4Z66A 5DNNB 3KXBB 3W99C 3RELD 4KGCB 3AZLB 3UT9B 1P3LD 3AV1B 2AROD 4WV4B 5GXQC 1U35B 3KFUG 5DNMD 3LZ0C 5GT3D 3AZFD 3REJA 3AYWA 5B31A 4CAYA 5AVCD 5C3IB 3KWQA 4G91C 5B32C 3AZGB 1P3OA 3TU4A 3AZND 4Z2MH 5GT0D 3H0LC 5B1LA 4Z5TC 4H9QA 5AV6A 1TZYA 1P34B 4R8PA 2F8NH 5GXQB 4M6BA 3LELC 3REHC 3AZMB 5B0YC 4H9SC 3EG5B 3AFAB 3O62A 3REID 4NFTA 4JJNA 3WA9B 5E5AD 3W96A 1M19D 3UTBA 3W97C 1P3ID 3WKJD 2NZDB 1H3OB 3LJAC 1P3MC 2HIOA 5GSUB 1P3KA 4HGAC 2Y2GA 1P3PA 1ID3D 3VH6W 4UPKA 3REHB 3REKD 3AV2A 4XZQC 5B2IA 4E45A 5B0YB 3X1UA 1P3BC 3MGSA 3KUYA 5B40C 2CV5B 3WAAC 5AY8C 1PZRA 5KDMA 5AV5B 1M1AC 1KX3D 3AN2C 4QLCD 4YM6A 5JRGC 5B2JB 3MGPA 3AZHD 1P3MB 4KUDB 3C1CA 4HGAB 1HQ3B 3C1BC 4XZQB 5B33B 5BNVB 4YS3D 1TAFA 3RELB 4NE3A 5B40B 5B31G 1P3LB 3A6ND 5AY8B 2F8NK 2AROB 3EPLA 3IP4C 4X23D 5DNMB 5GT3B 3MGQD 1P3FA 3UTAC 3AZFB 4J8VA 3MNNC 2F8NA 3LZ1A 3X1TA 4LD9D 3AZNB 3MGRC 5F99C 2YFVA 4J8WD 3AZKC 3V9RA 4H9OA 4AWLC 2FJ7A 1ZLAD 3B6GD 3AV1D 1U35D 4Z66C 1F66D 2RIQA 2Y2JA 5AVBA 2Y2OA 4UUZA 2YFWB 1Z2CB 3MNNB 4ZUXA 3REIB 5E5AB 1M19B 3AZED 1P3IB 3W99D 5B24A 4QLCC 5B31C 3REJC 3AZKB 3AYWC 1M18A 3KWQC 1EQZA 1P3OC 3NQUA 3H0RC 3TU4C 2CWEA 1ID3B 3B0CT 4Z66B 5AV9A 3REKB 3LZ0D 3P5JB 5B1LC 5JA4B 2FFFB 5AV6C 1TZYC 4R8PC 1WWSA 3FDDA 5B32D 3AYWB 4QLCB 1KX5A 3AZHB 4Z5TD 3O62C 4JJNC 1P3OB 1KX4D 3W96C 3UTBC 2PYOA 2Y2QA 3LELD 3REHD 4Z2MG 4YS3B 5B0YD 2HIOC 2VQRA 5CPJA 4CSRB 1TZYB 1P3KC 1P3PC 3B6FA 5CP6A 3A6NB 3AV2C 3AZIA 5B2IC 3W97D 3X1UC 3MGSC 3LJAD 5BT1C 3KUYC 1P3MD 3W98A 3O62B 2Y2PA 4J8XA 1N1JB 4XZQD 1S32A 4LD9B 3MGPC 2HIOB 3C1CC 4J8WB 1P3BD 5B40D 2BG1A 2RVQC 1P3KB 1P3PB 1ZLAB 3WAAD 5AY8D 3AV2B 3B6GB 1M1AD 1F66B 3R45A 3AN2D 4XUJA 3X1UB
chains in the Genus database with same CATH topology
5BS7A 5JRGD 2BYMB 3C1BD 4H9PA 3AZEB 1P3FC 3W99B 5CPIA 3C1CB 4J8VC 5FUGB 3LZ1C 3X1TC 3X1VA 1KX4C 3MVDA 1TAFB 3LZ0B 3X1SA 1BH8A 1Q9CA 3UTAD 2FJ7C 3MNND 2BYKA 4G91B 5B32B 4J8UA 1WWIA 5CPKA 3MGRD 5F99D 5AVBC 3AZKD 2F8NB 4WU8A 1JFIB 4Z5TB 4ZUXC 2LY8A 5B0ZD 2ZM5A 1KX4B 4Z66D 3H0MC 3LELB 4WU9A 2G5IC 2YFVB 2W8SA 4H9OB 3WTPA 1M18C 1EQZC 5AV9C 2NQBA 5AV8A 3W97B 1R4VA 2F2AC 1KU5A 3REJD 3AYWD 5B31D 1P3AA 3LJAB 4ZBJC 3KWQD 2ZY3A 1P3OD 3TU4D 4KHAB 1AOIA 4KGCA 5DNNA 3KXBA 4EO5C 3AZLA 1KX5C 5B1LD 1T3UA 3UT9A 1P3BB 1BH9B 5AV6D 1EQZB 1TZYD 5CHLB 4R8PD 2PYOC 3WAAB 3B0DC 1M1AB 3AN2B 5CPJC 5JRGB 3B0CW 3B6FC 3NQJA 5CP6C 3O62D 4JJND 3W96D 3AZGA 3C1BB 3UTBD 3AZIC 3EPHA 3W98C 2HIOD 1P3KD 2JCHA 1P3PD 3WTPE 4G92C 1P34A 1P3GA 5BNXB 5B0ZC 5GXQA 4J8XC 3AV2D 5B2ID 1S32C 2ZY4A 3AZMA 5CPJB 3X1UD 3MGSD 3EPKA 5BT1D 3KUYD 2Y2NA 3UTAB 3A1IA 3AFAA 3WA9A 1ULYA 2NZDA 3AZIB 3AZJA 4NE5A 4XUJC 4YM6D 5BS7C 4H9RB 5F99B 1H3OA 4H9NA 3MGPD 3MGRB 3W98B 3C1CD 4AWLB 5G49B 2J8PA 2RVQD 2Y2LA 5GSUA 4G92B 5B0ZB 2Y2HA 4J8XB 4WJ3C 5CPIC 2CV5A 3X1VC 5AV5A 3MVDC 5B1MA 3X1SC 2Y2MA 1P3FD 4KUDA 5B2JA 4J8VD 3REJB 5B31B 4CAYB 2F8ND 3KWQB 1HQ3A 4J8UC 3X1TD 3LZ1D 3TU4B 5CPKC 5B33A 5BNVA 3AL0C 4WNNA 3RELA 5B1LB 2FJ7D 5BO0A 4WU8C 1P3LA 4H9QB 5AV6B 4R8PB 4WU9C 2AROA 5DNMA 3VH6A 5GT3A 3WTPC 5AVBD 3AZFA 5AVCA 4ZUXD 4J8UB 4JJNB 2NQBC 5AV8C 3W96B 3UTBB 5CPKB 3AZNA 2JSSA 5B24D 4YM6C 5GT0A 1M18D 1W2EA 1EQZD 3VH5A 1AOIC 5AV9D 4KGCC 5DNNC 3KXBC 5B2IB 3AZLC 3UT9C 3EPJA 3MGSB 3KUYB 2YFWA 5KDMB 3REIA 3WKJA 5E5AA 1M19A 1P3IA 1KX5D 4YM6B 3MGPB 2DQNC 3AZGC 2PYOD 4WZSB 1ID3A 3B0BA 2Y2IA 3REKA 1BFMA 5CPJD 5JA4A 2XD1A 1P34C 1P3GC 5CP6D 3B6FD 3AZID 3AZMC 1KX3A 1P3FB 3W98D 4QLCA 3NQJB 4J8VB 3AZHA 3AFAC 3WA9C 2NZDC 3LZ1B 4J8XD 3AZJC 3A1KA 3X1TB 1S32D 4YS3A 5B24C 3V9RB 2FJ7B 5GSUC 4CSRA 1P3GB 1A7WA 3A6NA 4DQYB 4X23A 4XUJD 3MGQA 5AVBB 2CV5C 4UUZB 2IO5C 3KSYA 5AV5C 4ZUXB 3AZJB 5B1MC 1N1JA 4LD9A 4H9NB 5B2JC 5CPID 4KUDC 5B24B 1B67A 4J8WA 1M18B 1HQ3C 1ZLAA 3X1VD 3NQUB 2XD5A 3MVDD 3B6GA 3AV1A 5AV9B 5B33C 1U35A 1F66A 3RELC 3X1SD 2ZY2A 2BYMA 2IO5B 2Y2KA 1P3LC 4ZBJB 2AROC 4J8UD 1B6WA 4DRBA 5B1MB 5DNMC 5CPKD 3AZEA 5GT3C 1HTAA 3W99A 3AZFC 3VH5W 4EO5B 1KX5B 4WU8D 5AVCC 5FUGA 2PYOB 3B0DB 4WU9D 3AZNC 4WNNB 3LZ0A 5GT0C 3WTPD 5BO0B 4DRAA 3B6FB 5CP6B 5B32A 5AV8D 2NQBD 3VH6T 1P3AD 5AVCB 1JFIA 4Z5TA 3REIC 3WKJC 5E5AC 1KX4A 1M19C 1AOID 1P3IC 4KGCD 5DNND 3KXBD 2ZY5A 3LELA 3REHA 3AZLD 1S32B 5GT0B 3UT9D 5B0YA 4H9SA 2G5HC 1ID3C 3VH5T 1F1EA 3REKC 3W97A 3R45B 4XUJB 3LJAA 1P3MA 3AZGD 3WKJB 2HUEC 4H9PB 4KHAA 1KX3C 4XZQA 5CPIB 3AZHC 2L5AA 1P3BA 1BH9A 5B40A 1P34D 3F6TA 1P3GD 5GXQD 3WAAA 3X1VB 5AY8A 3MVDB 4YS3C 3AZMD 1M1AA 3AN2A 3X1SB 1BH8B 5JRGA 2BYKB 3A6NC 3AFAD 3WA9D 2NZDD 2HUEB 3C1BA 4X23C 3AZJD 1KX3B 3MGQC 1P3AC 5GSUD 4WU8B 5BNXA 5B32G 4WU9B 4LD9C 4E44A 4J8WC 3WTPB 3UTAA 2CV5D 1ZLAC 2F8NG 2JE5A 2UWXA 3MNNA 5AV5D 3B6GC 3AV1C 1U35C 4X23B 5AV8B 1F66C 2NQBB 5B1MD 3MGQB 5B2JD 4H9RA 5F99A 3MGRA 1P3AB 4KUDD 3AZKA 5G49A 5C3IC 1HQ3D 2DF4C 5B0ZA 1AOIB 3AZEC 5B33D 4NE6A 4Z66A 5DNNB 3KXBB 3W99C 3RELD 4KGCB 3AZLB 3UT9B 1P3LD 3AV1B 2AROD 4WV4B 5GXQC 1U35B 3KFUG 5DNMD 3LZ0C 5GT3D 3AZFD 3REJA 3AYWA 5B31A 4CAYA 5AVCD 5C3IB 3KWQA 4G91C 5B32C 3AZGB 1P3OA 3TU4A 3AZND 4Z2MH 5GT0D 3H0LC 5B1LA 4Z5TC 4H9QA 5AV6A 1TZYA 1P34B 4R8PA 2F8NH 5GXQB 4M6BA 3LELC 3REHC 3AZMB 5B0YC 4H9SC 3EG5B 3AFAB 3O62A 3REID 4NFTA 4JJNA 3WA9B 5E5AD 3W96A 1M19D 3UTBA 3W97C 1P3ID 3WKJD 2NZDB 1H3OB 3LJAC 1P3MC 2HIOA 5GSUB 1P3KA 4HGAC 2Y2GA 1P3PA 1ID3D 3VH6W 4UPKA 3REHB 3REKD 3AV2A 4XZQC 5B2IA 4E45A 5B0YB 3X1UA 1P3BC 3MGSA 3KUYA 5B40C 2CV5B 3WAAC 5AY8C 1PZRA 5KDMA 5AV5B 1M1AC 1KX3D 3AN2C 4QLCD 4YM6A 5JRGC 5B2JB 3MGPA 3AZHD 1P3MB 4KUDB 3C1CA 4HGAB 1HQ3B 3C1BC 4XZQB 5B33B 5BNVB 4YS3D 1TAFA 3RELB 4NE3A 5B40B 5B31G 1P3LB 3A6ND 5AY8B 2F8NK 2AROB 3EPLA 3IP4C 4X23D 5DNMB 5GT3B 3MGQD 1P3FA 3UTAC 3AZFB 4J8VA 3MNNC 2F8NA 3LZ1A 3X1TA 4LD9D 3AZNB 3MGRC 5F99C 2YFVA 4J8WD 3AZKC 3V9RA 4H9OA 4AWLC 2FJ7A 1ZLAD 3B6GD 3AV1D 1U35D 4Z66C 1F66D 2RIQA 2Y2JA 5AVBA 2Y2OA 4UUZA 2YFWB 1Z2CB 3MNNB 4ZUXA 3REIB 5E5AB 1M19B 3AZED 1P3IB 3W99D 5B24A 4QLCC 5B31C 3REJC 3AZKB 3AYWC 1M18A 3KWQC 1EQZA 1P3OC 3NQUA 3H0RC 3TU4C 2CWEA 1ID3B 3B0CT 4Z66B 5AV9A 3REKB 3LZ0D 3P5JB 5B1LC 5JA4B 2FFFB 5AV6C 1TZYC 4R8PC 1WWSA 3FDDA 5B32D 3AYWB 4QLCB 1KX5A 3AZHB 4Z5TD 3O62C 4JJNC 1P3OB 1KX4D 3W96C 3UTBC 2PYOA 2Y2QA 3LELD 3REHD 4Z2MG 4YS3B 5B0YD 2HIOC 2VQRA 5CPJA 4CSRB 1TZYB 1P3KC 1P3PC 3B6FA 5CP6A 3A6NB 3AV2C 3AZIA 5B2IC 3W97D 3X1UC 3MGSC 3LJAD 5BT1C 3KUYC 1P3MD 3W98A 3O62B 2Y2PA 4J8XA 1N1JB 4XZQD 1S32A 4LD9B 3MGPC 2HIOB 3C1CC 4J8WB 1P3BD 5B40D 2BG1A 2RVQC 1P3KB 1P3PB 1ZLAB 3WAAD 5AY8D 3AV2B 3B6GB 1M1AD 1F66B 3R45A 3AN2D 4XUJA 3X1UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS7 A;  5JRG D;  2BYM B;  3C1B D;  4H9P A;  3AZE B;  1P3F C;  3W99 B;  5CPI A;  3C1C B;  4J8V C;  5FUG B;  3LZ1 C;  3X1T C;  3X1V A;  1KX4 C;  3MVD A;  1TAF B;  3LZ0 B;  3X1S A;  1BH8 A;  1Q9C A;  3UTA D;  2FJ7 C;  3MNN D;  2BYK A;  4G91 B;  5B32 B;  4J8U A;  1WWI A;  5CPK A;  3MGR D;  5F99 D;  5AVB C;  3AZK D;  2F8N B;  4WU8 A;  1JFI B;  4Z5T B;  4ZUX C;  2LY8 A;  5B0Z D;  1KX4 B;  4Z66 D;  4WU9 A;  3LEL B;  2YFV B;  4H9O B;  1M18 C;  3WTP A;  1EQZ C;  5AV9 C;  2NQB A;  5AV8 A;  3W97 B;  1R4V A;  1KU5 A;  3REJ D;  3AYW D;  5B31 D;  1P3A A;  3LJA B;  4ZBJ C;  3KWQ D;  1P3O D;  3TU4 D;  4KHA B;  1AOI A;  4KGC A;  5DNN A;  3KXB A;  4EO5 C;  3AZL A;  1KX5 C;  5B1L D;  3UT9 A;  1P3B B;  1BH9 B;  5AV6 D;  1EQZ B;  1TZY D;  5CHL B;  4R8P D;  2PYO C;  3WAA B;  3B0D C;  1M1A B;  3AN2 B;  5CPJ C;  5JRG B;  3B0C W;  3B6F C;  3NQJ A;  5CP6 C;  3O62 D;  4JJN D;  3W96 D;  3AZG A;  3C1B B;  3UTB D;  3AZI C;  3W98 C;  2HIO D;  1P3K D;  1P3P D;  3WTP E;  4G92 C;  1P34 A;  1P3G A;  5BNX B;  5B0Z C;  5GXQ A;  4J8X C;  3AV2 D;  5B2I D;  1S32 C;  3AZM A;  5CPJ B;  3X1U D;  3MGS D;  3UTA B;  5BT1 D;  3KUY D;  3AFA A;  3WA9 A;  1ULY A;  2NZD A;  3AZI B;  3AZJ A;  4NE5 A;  4XUJ C;  4YM6 D;  5BS7 C;  4H9R B;  5F99 B;  1H3O A;  4H9N A;  3MGP D;  3MGR B;  3W98 B;  3C1C D;  4AWL B;  5G49 B;  2RVQ D;  5GSU A;  4G92 B;  5B0Z B;  4J8X B;  5CPI C;  2CV5 A;  3X1V C;  5AV5 A;  3MVD C;  5B1M A;  3X1S C;  1P3F D;  4KUD A;  5B2J A;  4J8V D;  3REJ B;  5B31 B;  4CAY B;  2F8N D;  3KWQ B;  1HQ3 A;  4J8U C;  3X1T D;  3LZ1 D;  3TU4 B;  5CPK C;  5B33 A;  5BNV A;  4WNN A;  3REL A;  5B1L B;  2FJ7 D;  5BO0 A;  4WU8 C;  1P3L A;  4H9Q B;  5AV6 B;  4R8P B;  4WU9 C;  2ARO A;  5DNM A;  3VH6 A;  5GT3 A;  3WTP C;  5AVB D;  3AZF A;  5AVC A;  4ZUX D;  4J8U B;  4JJN B;  2NQB C;  5AV8 C;  3W96 B;  3UTB B;  5CPK B;  3AZN A;  2JSS A;  5B24 D;  4YM6 C;  5GT0 A;  1M18 D;  1EQZ D;  3VH5 A;  1AOI C;  5AV9 D;  4KGC C;  5DNN C;  3KXB C;  5B2I B;  3AZL C;  3UT9 C;  3MGS B;  3KUY B;  2YFW A;  5KDM B;  3REI A;  3WKJ A;  5E5A A;  1M19 A;  1P3I A;  1KX5 D;  4YM6 B;  3MGP B;  3AZG C;  2PYO D;  4WZS B;  1ID3 A;  3B0B A;  3REK A;  1BFM A;  5CPJ D;  5JA4 A;  1P34 C;  1P3G C;  5CP6 D;  3B6F D;  3AZI D;  3AZM C;  1KX3 A;  1P3F B;  3W98 D;  4QLC A;  3NQJ B;  4J8V B;  3AZH A;  3AFA C;  3WA9 C;  2NZD C;  3LZ1 B;  4J8X D;  3AZJ C;  3X1T B;  1S32 D;  4YS3 A;  5B24 C;  3V9R B;  2FJ7 B;  5GSU C;  4CSR A;  1P3G B;  1A7W A;  3A6N A;  4X23 A;  4XUJ D;  3MGQ A;  5AVB B;  2CV5 C;  4UUZ B;  2IO5 C;  3KSY A;  5AV5 C;  4ZUX B;  3AZJ B;  5B1M C;  1N1J A;  4LD9 A;  4H9N B;  5B2J C;  5CPI D;  4KUD C;  5B24 B;  1B67 A;  4J8W A;  1M18 B;  1HQ3 C;  1ZLA A;  3X1V D;  3NQU B;  3MVD D;  3B6G A;  3AV1 A;  5AV9 B;  5B33 C;  1U35 A;  1F66 A;  3REL C;  3X1S D;  1P3L C;  2BYM A;  2IO5 B;  4ZBJ B;  2ARO C;  4J8U D;  1B6W A;  4DRB A;  5B1M B;  5DNM C;  5CPK D;  3AZE A;  5GT3 C;  1HTA A;  3W99 A;  3AZF C;  3VH5 W;  4EO5 B;  1KX5 B;  4WU8 D;  5AVC C;  5FUG A;  2PYO B;  3B0D B;  4WU9 D;  3AZN C;  4WNN B;  3LZ0 A;  5GT0 C;  3WTP D;  5BO0 B;  4DRA A;  3B6F B;  5CP6 B;  5B32 A;  5AV8 D;  2NQB D;  3VH6 T;  1P3A D;  5AVC B;  1JFI A;  4Z5T A;  3REI C;  3WKJ C;  5E5A C;  1KX4 A;  1M19 C;  1AOI D;  1P3I C;  4KGC D;  5DNN D;  3KXB D;  3LEL A;  3REH A;  1S32 B;  3AZL D;  5GT0 B;  3UT9 D;  5B0Y A;  4H9S A;  1ID3 C;  3VH5 T;  1F1E A;  3REK C;  3W97 A;  3R45 B;  4XUJ B;  3LJA A;  1P3M A;  3AZG D;  3WKJ B;  2HUE C;  4H9P B;  4KHA A;  1KX3 C;  4XZQ A;  5CPI B;  3AZH C;  2L5A A;  1P3B A;  1BH9 A;  5B40 A;  1P34 D;  1P3G D;  5GXQ D;  3WAA A;  3X1V B;  5AY8 A;  3MVD B;  4YS3 C;  3AZM D;  1M1A A;  3AN2 A;  3X1S B;  1BH8 B;  5JRG A;  2BYK B;  3A6N C;  3AFA D;  3WA9 D;  2NZD D;  2HUE B;  3C1B A;  4X23 C;  3AZJ D;  1KX3 B;  3MGQ C;  1P3A C;  5GSU D;  4WU8 B;  5BNX A;  5B32 G;  4WU9 B;  4LD9 C;  4E44 A;  4J8W C;  3WTP B;  3UTA A;  2CV5 D;  1ZLA C;  2F8N G;  3MNN A;  5AV5 D;  3B6G C;  3AV1 C;  1U35 C;  4X23 B;  5AV8 B;  1F66 C;  2NQB B;  5B1M D;  3MGQ B;  5B2J D;  4H9R A;  5F99 A;  3MGR A;  1P3A B;  4KUD D;  3AZK A;  5G49 A;  5C3I C;  1HQ3 D;  5B0Z A;  1AOI B;  3AZE C;  5B33 D;  4NE6 A;  4Z66 A;  5DNN B;  3KXB B;  3W99 C;  3REL D;  4KGC B;  3AZL B;  3UT9 B;  1P3L D;  3AV1 B;  2ARO D;  4WV4 B;  5GXQ C;  1U35 B;  5DNM D;  3LZ0 C;  5GT3 D;  3AZF D;  3REJ A;  3AYW A;  5B31 A;  4CAY A;  5AVC D;  5C3I B;  3KWQ A;  4G91 C;  5B32 C;  3AZG B;  1P3O A;  3TU4 A;  3AZN D;  4Z2M H;  5GT0 D;  5B1L A;  4Z5T C;  4H9Q A;  5AV6 A;  1TZY A;  1P34 B;  4R8P A;  2F8N H;  5GXQ B;  4M6B A;  3LEL C;  3REH C;  3AZM B;  5B0Y C;  4H9S C;  3AFA B;  3O62 A;  3REI D;  4NFT A;  4JJN A;  3WA9 B;  5E5A D;  3W96 A;  1M19 D;  3UTB A;  3W97 C;  1P3I D;  3WKJ D;  2NZD B;  1H3O B;  3LJA C;  1P3M C;  2HIO A;  5GSU B;  1P3K A;  4HGA C;  1P3P A;  1ID3 D;  3VH6 W;  3REH B;  3REK D;  3AV2 A;  4XZQ C;  5B2I A;  4E45 A;  5B0Y B;  3X1U A;  1P3B C;  3MGS A;  3KUY A;  5B40 C;  2CV5 B;  3WAA C;  5AY8 C;  5KDM A;  5AV5 B;  1M1A C;  1KX3 D;  3AN2 C;  4QLC D;  4YM6 A;  5JRG C;  5B2J B;  3MGP A;  3AZH D;  1P3M B;  4KUD B;  3C1C A;  4HGA B;  1HQ3 B;  3C1B C;  4XZQ B;  5B33 B;  5BNV B;  4YS3 D;  1TAF A;  3REL B;  4NE3 A;  5B40 B;  5B31 G;  1P3L B;  3A6N D;  5AY8 B;  2F8N K;  2ARO B;  4X23 D;  5DNM B;  5GT3 B;  3MGQ D;  1P3F A;  3UTA C;  3AZF B;  4J8V A;  3MNN C;  2F8N A;  3LZ1 A;  3X1T A;  4LD9 D;  3AZN B;  3MGR C;  5F99 C;  2YFV A;  4J8W D;  3AZK C;  3V9R A;  4H9O A;  4AWL C;  2FJ7 A;  1ZLA D;  3B6G D;  3AV1 D;  1U35 D;  4Z66 C;  1F66 D;  5AVB A;  4UUZ A;  2YFW B;  3MNN B;  4ZUX A;  3REI B;  5E5A B;  1M19 B;  3AZE D;  1P3I B;  3W99 D;  5B24 A;  4QLC C;  5B31 C;  3REJ C;  3AZK B;  3AYW C;  1M18 A;  3KWQ C;  1EQZ A;  1P3O C;  3NQU A;  3TU4 C;  2CWE A;  1ID3 B;  3B0C T;  4Z66 B;  5AV9 A;  3REK B;  3LZ0 D;  5B1L C;  5JA4 B;  5AV6 C;  1TZY C;  4R8P C;  1WWS A;  5B32 D;  3AYW B;  4QLC B;  1KX5 A;  3AZH B;  4Z5T D;  3O62 C;  4JJN C;  1P3O B;  1KX4 D;  3W96 C;  3UTB C;  2PYO A;  3LEL D;  3REH D;  4Z2M G;  4YS3 B;  2HIO C;  5B0Y D;  5CPJ A;  4CSR B;  1TZY B;  1P3K C;  1P3P C;  3B6F A;  5CP6 A;  3A6N B;  3AV2 C;  3AZI A;  5B2I C;  3W97 D;  3X1U C;  3MGS C;  3LJA D;  5BT1 C;  3KUY C;  1P3M D;  3W98 A;  3O62 B;  4J8X A;  1N1J B;  4XZQ D;  1S32 A;  4LD9 B;  3MGP C;  2HIO B;  3C1C C;  4J8W B;  1P3B D;  5B40 D;  2RVQ C;  1P3K B;  1P3P B;  1ZLA B;  3WAA D;  5AY8 D;  3AV2 B;  3B6G B;  1M1A D;  1F66 B;  3R45 A;  3AN2 D;  4XUJ A;  3X1U B; 
#chains in the Genus database with same CATH topology
 5BS7 A;  5JRG D;  2BYM B;  3C1B D;  4H9P A;  3AZE B;  1P3F C;  3W99 B;  5CPI A;  3C1C B;  4J8V C;  5FUG B;  3LZ1 C;  3X1T C;  3X1V A;  1KX4 C;  3MVD A;  1TAF B;  3LZ0 B;  3X1S A;  1BH8 A;  1Q9C A;  3UTA D;  2FJ7 C;  3MNN D;  2BYK A;  4G91 B;  5B32 B;  4J8U A;  1WWI A;  5CPK A;  3MGR D;  5F99 D;  5AVB C;  3AZK D;  2F8N B;  4WU8 A;  1JFI B;  4Z5T B;  4ZUX C;  2LY8 A;  5B0Z D;  2ZM5 A;  1KX4 B;  4Z66 D;  3H0M C;  3LEL B;  4WU9 A;  2G5I C;  2YFV B;  2W8S A;  4H9O B;  3WTP A;  1M18 C;  1EQZ C;  5AV9 C;  2NQB A;  5AV8 A;  3W97 B;  1R4V A;  2F2A C;  1KU5 A;  3REJ D;  3AYW D;  5B31 D;  1P3A A;  3LJA B;  4ZBJ C;  3KWQ D;  2ZY3 A;  1P3O D;  3TU4 D;  4KHA B;  1AOI A;  4KGC A;  5DNN A;  3KXB A;  4EO5 C;  3AZL A;  1KX5 C;  5B1L D;  1T3U A;  3UT9 A;  1P3B B;  1BH9 B;  5AV6 D;  1EQZ B;  1TZY D;  5CHL B;  4R8P D;  2PYO C;  3WAA B;  3B0D C;  1M1A B;  3AN2 B;  5CPJ C;  5JRG B;  3B0C W;  3B6F C;  3NQJ A;  5CP6 C;  3O62 D;  4JJN D;  3W96 D;  3AZG A;  3C1B B;  3UTB D;  3AZI C;  3EPH A;  3W98 C;  2HIO D;  1P3K D;  2JCH A;  1P3P D;  3WTP E;  4G92 C;  1P34 A;  1P3G A;  5BNX B;  5B0Z C;  5GXQ A;  4J8X C;  3AV2 D;  5B2I D;  1S32 C;  2ZY4 A;  3AZM A;  5CPJ B;  3X1U D;  3MGS D;  3EPK A;  5BT1 D;  3KUY D;  2Y2N A;  3UTA B;  3A1I A;  3AFA A;  3WA9 A;  1ULY A;  2NZD A;  3AZI B;  3AZJ A;  4NE5 A;  4XUJ C;  4YM6 D;  5BS7 C;  4H9R B;  5F99 B;  1H3O A;  4H9N A;  3MGP D;  3MGR B;  3W98 B;  3C1C D;  4AWL B;  5G49 B;  2J8P A;  2RVQ D;  2Y2L A;  5GSU A;  4G92 B;  5B0Z B;  2Y2H A;  4J8X B;  4WJ3 C;  5CPI C;  2CV5 A;  3X1V C;  5AV5 A;  3MVD C;  5B1M A;  3X1S C;  2Y2M A;  1P3F D;  4KUD A;  5B2J A;  4J8V D;  3REJ B;  5B31 B;  4CAY B;  2F8N D;  3KWQ B;  1HQ3 A;  4J8U C;  3X1T D;  3LZ1 D;  3TU4 B;  5CPK C;  5B33 A;  5BNV A;  3AL0 C;  4WNN A;  3REL A;  5B1L B;  2FJ7 D;  5BO0 A;  4WU8 C;  1P3L A;  4H9Q B;  5AV6 B;  4R8P B;  4WU9 C;  2ARO A;  5DNM A;  3VH6 A;  5GT3 A;  3WTP C;  5AVB D;  3AZF A;  5AVC A;  4ZUX D;  4J8U B;  4JJN B;  2NQB C;  5AV8 C;  3W96 B;  3UTB B;  5CPK B;  3AZN A;  2JSS A;  5B24 D;  4YM6 C;  5GT0 A;  1M18 D;  1W2E A;  1EQZ D;  3VH5 A;  1AOI C;  5AV9 D;  4KGC C;  5DNN C;  3KXB C;  5B2I B;  3AZL C;  3UT9 C;  3EPJ A;  3MGS B;  3KUY B;  2YFW A;  5KDM B;  3REI A;  3WKJ A;  5E5A A;  1M19 A;  1P3I A;  1KX5 D;  4YM6 B;  3MGP B;  2DQN C;  3AZG C;  2PYO D;  4WZS B;  1ID3 A;  3B0B A;  2Y2I A;  3REK A;  1BFM A;  5CPJ D;  5JA4 A;  2XD1 A;  1P34 C;  1P3G C;  5CP6 D;  3B6F D;  3AZI D;  3AZM C;  1KX3 A;  1P3F B;  3W98 D;  4QLC A;  3NQJ B;  4J8V B;  3AZH A;  3AFA C;  3WA9 C;  2NZD C;  3LZ1 B;  4J8X D;  3AZJ C;  3A1K A;  3X1T B;  1S32 D;  4YS3 A;  5B24 C;  3V9R B;  2FJ7 B;  5GSU C;  4CSR A;  1P3G B;  1A7W A;  3A6N A;  4DQY B;  4X23 A;  4XUJ D;  3MGQ A;  5AVB B;  2CV5 C;  4UUZ B;  2IO5 C;  3KSY A;  5AV5 C;  4ZUX B;  3AZJ B;  5B1M C;  1N1J A;  4LD9 A;  4H9N B;  5B2J C;  5CPI D;  4KUD C;  5B24 B;  1B67 A;  4J8W A;  1M18 B;  1HQ3 C;  1ZLA A;  3X1V D;  3NQU B;  2XD5 A;  3MVD D;  3B6G A;  3AV1 A;  5AV9 B;  5B33 C;  1U35 A;  1F66 A;  3REL C;  3X1S D;  2ZY2 A;  2BYM A;  2IO5 B;  2Y2K A;  1P3L C;  4ZBJ B;  2ARO C;  4J8U D;  1B6W A;  4DRB A;  5B1M B;  5DNM C;  5CPK D;  3AZE A;  5GT3 C;  1HTA A;  3W99 A;  3AZF C;  3VH5 W;  4EO5 B;  1KX5 B;  4WU8 D;  5AVC C;  5FUG A;  2PYO B;  3B0D B;  4WU9 D;  3AZN C;  4WNN B;  3LZ0 A;  5GT0 C;  3WTP D;  5BO0 B;  4DRA A;  3B6F B;  5CP6 B;  5B32 A;  5AV8 D;  2NQB D;  3VH6 T;  1P3A D;  5AVC B;  1JFI A;  4Z5T A;  3REI C;  3WKJ C;  5E5A C;  1KX4 A;  1M19 C;  1AOI D;  1P3I C;  4KGC D;  5DNN D;  3KXB D;  2ZY5 A;  3LEL A;  3REH A;  3AZL D;  1S32 B;  5GT0 B;  3UT9 D;  5B0Y A;  4H9S A;  2G5H C;  1ID3 C;  3VH5 T;  1F1E A;  3REK C;  3W97 A;  3R45 B;  4XUJ B;  3LJA A;  1P3M A;  3AZG D;  3WKJ B;  2HUE C;  4H9P B;  4KHA A;  1KX3 C;  4XZQ A;  5CPI B;  3AZH C;  2L5A A;  1P3B A;  1BH9 A;  5B40 A;  1P34 D;  3F6T A;  1P3G D;  5GXQ D;  3WAA A;  3X1V B;  5AY8 A;  3MVD B;  4YS3 C;  3AZM D;  1M1A A;  3AN2 A;  3X1S B;  1BH8 B;  5JRG A;  2BYK B;  3A6N C;  3AFA D;  3WA9 D;  2NZD D;  2HUE B;  3C1B A;  4X23 C;  3AZJ D;  1KX3 B;  3MGQ C;  1P3A C;  5GSU D;  4WU8 B;  5BNX A;  5B32 G;  4WU9 B;  4LD9 C;  4E44 A;  4J8W C;  3WTP B;  3UTA A;  2CV5 D;  1ZLA C;  2F8N G;  2JE5 A;  2UWX A;  3MNN A;  5AV5 D;  3B6G C;  3AV1 C;  1U35 C;  4X23 B;  5AV8 B;  1F66 C;  2NQB B;  5B1M D;  3MGQ B;  5B2J D;  4H9R A;  5F99 A;  3MGR A;  1P3A B;  4KUD D;  3AZK A;  5G49 A;  5C3I C;  1HQ3 D;  2DF4 C;  5B0Z A;  1AOI B;  3AZE C;  5B33 D;  4NE6 A;  4Z66 A;  5DNN B;  3KXB B;  3W99 C;  3REL D;  4KGC B;  3AZL B;  3UT9 B;  1P3L D;  3AV1 B;  2ARO D;  4WV4 B;  5GXQ C;  1U35 B;  3KFU G;  5DNM D;  3LZ0 C;  5GT3 D;  3AZF D;  3REJ A;  3AYW A;  5B31 A;  4CAY A;  5AVC D;  5C3I B;  3KWQ A;  4G91 C;  5B32 C;  3AZG B;  1P3O A;  3TU4 A;  3AZN D;  4Z2M H;  5GT0 D;  3H0L C;  5B1L A;  4Z5T C;  4H9Q A;  5AV6 A;  1TZY A;  1P34 B;  4R8P A;  2F8N H;  5GXQ B;  4M6B A;  3LEL C;  3REH C;  3AZM B;  5B0Y C;  4H9S C;  3EG5 B;  3AFA B;  3O62 A;  3REI D;  4NFT A;  4JJN A;  3WA9 B;  5E5A D;  3W96 A;  1M19 D;  3UTB A;  3W97 C;  1P3I D;  3WKJ D;  2NZD B;  1H3O B;  3LJA C;  1P3M C;  2HIO A;  5GSU B;  1P3K A;  4HGA C;  2Y2G A;  1P3P A;  1ID3 D;  3VH6 W;  4UPK A;  3REH B;  3REK D;  3AV2 A;  4XZQ C;  5B2I A;  4E45 A;  5B0Y B;  3X1U A;  1P3B C;  3MGS A;  3KUY A;  5B40 C;  2CV5 B;  3WAA C;  5AY8 C;  1PZR A;  5KDM A;  5AV5 B;  1M1A C;  1KX3 D;  3AN2 C;  4QLC D;  4YM6 A;  5JRG C;  5B2J B;  3MGP A;  3AZH D;  1P3M B;  4KUD B;  3C1C A;  4HGA B;  1HQ3 B;  3C1B C;  4XZQ B;  5B33 B;  5BNV B;  4YS3 D;  1TAF A;  3REL B;  4NE3 A;  5B40 B;  5B31 G;  1P3L B;  3A6N D;  5AY8 B;  2F8N K;  2ARO B;  3EPL A;  3IP4 C;  4X23 D;  5DNM B;  5GT3 B;  3MGQ D;  1P3F A;  3UTA C;  3AZF B;  4J8V A;  3MNN C;  2F8N A;  3LZ1 A;  3X1T A;  4LD9 D;  3AZN B;  3MGR C;  5F99 C;  2YFV A;  4J8W D;  3AZK C;  3V9R A;  4H9O A;  4AWL C;  2FJ7 A;  1ZLA D;  3B6G D;  3AV1 D;  1U35 D;  4Z66 C;  1F66 D;  2RIQ A;  2Y2J A;  5AVB A;  2Y2O A;  4UUZ A;  2YFW B;  1Z2C B;  3MNN B;  4ZUX A;  3REI B;  5E5A B;  1M19 B;  3AZE D;  1P3I B;  3W99 D;  5B24 A;  4QLC C;  5B31 C;  3REJ C;  3AZK B;  3AYW C;  1M18 A;  3KWQ C;  1EQZ A;  1P3O C;  3NQU A;  3H0R C;  3TU4 C;  2CWE A;  1ID3 B;  3B0C T;  4Z66 B;  5AV9 A;  3REK B;  3LZ0 D;  3P5J B;  5B1L C;  5JA4 B;  2FFF B;  5AV6 C;  1TZY C;  4R8P C;  1WWS A;  3FDD A;  5B32 D;  3AYW B;  4QLC B;  1KX5 A;  3AZH B;  4Z5T D;  3O62 C;  4JJN C;  1P3O B;  1KX4 D;  3W96 C;  3UTB C;  2PYO A;  2Y2Q A;  3LEL D;  3REH D;  4Z2M G;  4YS3 B;  5B0Y D;  2HIO C;  2VQR A;  5CPJ A;  4CSR B;  1TZY B;  1P3K C;  1P3P C;  3B6F A;  5CP6 A;  3A6N B;  3AV2 C;  3AZI A;  5B2I C;  3W97 D;  3X1U C;  3MGS C;  3LJA D;  5BT1 C;  3KUY C;  1P3M D;  3W98 A;  3O62 B;  2Y2P A;  4J8X A;  1N1J B;  4XZQ D;  1S32 A;  4LD9 B;  3MGP C;  2HIO B;  3C1C C;  4J8W B;  1P3B D;  5B40 D;  2BG1 A;  2RVQ C;  1P3K B;  1P3P B;  1ZLA B;  3WAA D;  5AY8 D;  3AV2 B;  3B6G B;  1M1A D;  1F66 B;  3R45 A;  3AN2 D;  4XUJ A;  3X1U B; 
#chains in the Genus database with same CATH homology
 5BS7 A;  5JRG D;  2BYM B;  3C1B D;  4H9P A;  3AZE B;  1P3F C;  3W99 B;  5CPI A;  3C1C B;  4J8V C;  5FUG B;  3LZ1 C;  3X1T C;  3X1V A;  1KX4 C;  3MVD A;  1TAF B;  3LZ0 B;  3X1S A;  1BH8 A;  1Q9C A;  3UTA D;  2FJ7 C;  3MNN D;  2BYK A;  4G91 B;  5B32 B;  4J8U A;  1WWI A;  5CPK A;  3MGR D;  5F99 D;  5AVB C;  3AZK D;  2F8N B;  4WU8 A;  1JFI B;  4Z5T B;  4ZUX C;  2LY8 A;  5B0Z D;  2ZM5 A;  1KX4 B;  4Z66 D;  3H0M C;  3LEL B;  4WU9 A;  2G5I C;  2YFV B;  2W8S A;  4H9O B;  3WTP A;  1M18 C;  1EQZ C;  5AV9 C;  2NQB A;  5AV8 A;  3W97 B;  1R4V A;  2F2A C;  1KU5 A;  3REJ D;  3AYW D;  5B31 D;  1P3A A;  3LJA B;  4ZBJ C;  3KWQ D;  2ZY3 A;  1P3O D;  3TU4 D;  4KHA B;  1AOI A;  4KGC A;  5DNN A;  3KXB A;  4EO5 C;  3AZL A;  1KX5 C;  5B1L D;  1T3U A;  3UT9 A;  1P3B B;  1BH9 B;  5AV6 D;  1EQZ B;  1TZY D;  5CHL B;  4R8P D;  2PYO C;  3WAA B;  3B0D C;  1M1A B;  3AN2 B;  5CPJ C;  5JRG B;  3B0C W;  3B6F C;  3NQJ A;  5CP6 C;  3O62 D;  4JJN D;  3W96 D;  3AZG A;  3C1B B;  3UTB D;  3AZI C;  3EPH A;  3W98 C;  2HIO D;  1P3K D;  2JCH A;  1P3P D;  3WTP E;  4G92 C;  1P34 A;  1P3G A;  5BNX B;  5B0Z C;  5GXQ A;  4J8X C;  3AV2 D;  5B2I D;  1S32 C;  2ZY4 A;  3AZM A;  5CPJ B;  3X1U D;  3MGS D;  3EPK A;  5BT1 D;  3KUY D;  2Y2N A;  3UTA B;  3A1I A;  3AFA A;  3WA9 A;  1ULY A;  2NZD A;  3AZI B;  3AZJ A;  4NE5 A;  4XUJ C;  4YM6 D;  5BS7 C;  4H9R B;  5F99 B;  1H3O A;  4H9N A;  3MGP D;  3MGR B;  3W98 B;  3C1C D;  4AWL B;  5G49 B;  2J8P A;  2RVQ D;  2Y2L A;  5GSU A;  4G92 B;  5B0Z B;  2Y2H A;  4J8X B;  4WJ3 C;  5CPI C;  2CV5 A;  3X1V C;  5AV5 A;  3MVD C;  5B1M A;  3X1S C;  2Y2M A;  1P3F D;  4KUD A;  5B2J A;  4J8V D;  3REJ B;  5B31 B;  4CAY B;  2F8N D;  3KWQ B;  1HQ3 A;  4J8U C;  3X1T D;  3LZ1 D;  3TU4 B;  5CPK C;  5B33 A;  5BNV A;  3AL0 C;  4WNN A;  3REL A;  5B1L B;  2FJ7 D;  5BO0 A;  4WU8 C;  1P3L A;  4H9Q B;  5AV6 B;  4R8P B;  4WU9 C;  2ARO A;  5DNM A;  3VH6 A;  5GT3 A;  3WTP C;  5AVB D;  3AZF A;  5AVC A;  4ZUX D;  4J8U B;  4JJN B;  2NQB C;  5AV8 C;  3W96 B;  3UTB B;  5CPK B;  3AZN A;  2JSS A;  5B24 D;  4YM6 C;  5GT0 A;  1M18 D;  1W2E A;  1EQZ D;  3VH5 A;  1AOI C;  5AV9 D;  4KGC C;  5DNN C;  3KXB C;  5B2I B;  3AZL C;  3UT9 C;  3EPJ A;  3MGS B;  3KUY B;  2YFW A;  5KDM B;  3REI A;  3WKJ A;  5E5A A;  1M19 A;  1P3I A;  1KX5 D;  4YM6 B;  3MGP B;  2DQN C;  3AZG C;  2PYO D;  4WZS B;  1ID3 A;  3B0B A;  2Y2I A;  3REK A;  1BFM A;  5CPJ D;  5JA4 A;  2XD1 A;  1P34 C;  1P3G C;  5CP6 D;  3B6F D;  3AZI D;  3AZM C;  1KX3 A;  1P3F B;  3W98 D;  4QLC A;  3NQJ B;  4J8V B;  3AZH A;  3AFA C;  3WA9 C;  2NZD C;  3LZ1 B;  4J8X D;  3AZJ C;  3A1K A;  3X1T B;  1S32 D;  4YS3 A;  5B24 C;  3V9R B;  2FJ7 B;  5GSU C;  4CSR A;  1P3G B;  1A7W A;  3A6N A;  4DQY B;  4X23 A;  4XUJ D;  3MGQ A;  5AVB B;  2CV5 C;  4UUZ B;  2IO5 C;  3KSY A;  5AV5 C;  4ZUX B;  3AZJ B;  5B1M C;  1N1J A;  4LD9 A;  4H9N B;  5B2J C;  5CPI D;  4KUD C;  5B24 B;  1B67 A;  4J8W A;  1M18 B;  1HQ3 C;  1ZLA A;  3X1V D;  3NQU B;  2XD5 A;  3MVD D;  3B6G A;  3AV1 A;  5AV9 B;  5B33 C;  1U35 A;  1F66 A;  3REL C;  3X1S D;  2ZY2 A;  2BYM A;  2IO5 B;  2Y2K A;  1P3L C;  4ZBJ B;  2ARO C;  4J8U D;  1B6W A;  4DRB A;  5B1M B;  5DNM C;  5CPK D;  3AZE A;  5GT3 C;  1HTA A;  3W99 A;  3AZF C;  3VH5 W;  4EO5 B;  1KX5 B;  4WU8 D;  5AVC C;  5FUG A;  2PYO B;  3B0D B;  4WU9 D;  3AZN C;  4WNN B;  3LZ0 A;  5GT0 C;  3WTP D;  5BO0 B;  4DRA A;  3B6F B;  5CP6 B;  5B32 A;  5AV8 D;  2NQB D;  3VH6 T;  1P3A D;  5AVC B;  1JFI A;  4Z5T A;  3REI C;  3WKJ C;  5E5A C;  1KX4 A;  1M19 C;  1AOI D;  1P3I C;  4KGC D;  5DNN D;  3KXB D;  2ZY5 A;  3LEL A;  3REH A;  3AZL D;  1S32 B;  5GT0 B;  3UT9 D;  5B0Y A;  4H9S A;  2G5H C;  1ID3 C;  3VH5 T;  1F1E A;  3REK C;  3W97 A;  3R45 B;  4XUJ B;  3LJA A;  1P3M A;  3AZG D;  3WKJ B;  2HUE C;  4H9P B;  4KHA A;  1KX3 C;  4XZQ A;  5CPI B;  3AZH C;  2L5A A;  1P3B A;  1BH9 A;  5B40 A;  1P34 D;  3F6T A;  1P3G D;  5GXQ D;  3WAA A;  3X1V B;  5AY8 A;  3MVD B;  4YS3 C;  3AZM D;  1M1A A;  3AN2 A;  3X1S B;  1BH8 B;  5JRG A;  2BYK B;  3A6N C;  3AFA D;  3WA9 D;  2NZD D;  2HUE B;  3C1B A;  4X23 C;  3AZJ D;  1KX3 B;  3MGQ C;  1P3A C;  5GSU D;  4WU8 B;  5BNX A;  5B32 G;  4WU9 B;  4LD9 C;  4E44 A;  4J8W C;  3WTP B;  3UTA A;  2CV5 D;  1ZLA C;  2F8N G;  2JE5 A;  2UWX A;  3MNN A;  5AV5 D;  3B6G C;  3AV1 C;  1U35 C;  4X23 B;  5AV8 B;  1F66 C;  2NQB B;  5B1M D;  3MGQ B;  5B2J D;  4H9R A;  5F99 A;  3MGR A;  1P3A B;  4KUD D;  3AZK A;  5G49 A;  5C3I C;  1HQ3 D;  2DF4 C;  5B0Z A;  1AOI B;  3AZE C;  5B33 D;  4NE6 A;  4Z66 A;  5DNN B;  3KXB B;  3W99 C;  3REL D;  4KGC B;  3AZL B;  3UT9 B;  1P3L D;  3AV1 B;  2ARO D;  4WV4 B;  5GXQ C;  1U35 B;  3KFU G;  5DNM D;  3LZ0 C;  5GT3 D;  3AZF D;  3REJ A;  3AYW A;  5B31 A;  4CAY A;  5AVC D;  5C3I B;  3KWQ A;  4G91 C;  5B32 C;  3AZG B;  1P3O A;  3TU4 A;  3AZN D;  4Z2M H;  5GT0 D;  3H0L C;  5B1L A;  4Z5T C;  4H9Q A;  5AV6 A;  1TZY A;  1P34 B;  4R8P A;  2F8N H;  5GXQ B;  4M6B A;  3LEL C;  3REH C;  3AZM B;  5B0Y C;  4H9S C;  3EG5 B;  3AFA B;  3O62 A;  3REI D;  4NFT A;  4JJN A;  3WA9 B;  5E5A D;  3W96 A;  1M19 D;  3UTB A;  3W97 C;  1P3I D;  3WKJ D;  2NZD B;  1H3O B;  3LJA C;  1P3M C;  2HIO A;  5GSU B;  1P3K A;  4HGA C;  2Y2G A;  1P3P A;  1ID3 D;  3VH6 W;  4UPK A;  3REH B;  3REK D;  3AV2 A;  4XZQ C;  5B2I A;  4E45 A;  5B0Y B;  3X1U A;  1P3B C;  3MGS A;  3KUY A;  5B40 C;  2CV5 B;  3WAA C;  5AY8 C;  1PZR A;  5KDM A;  5AV5 B;  1M1A C;  1KX3 D;  3AN2 C;  4QLC D;  4YM6 A;  5JRG C;  5B2J B;  3MGP A;  3AZH D;  1P3M B;  4KUD B;  3C1C A;  4HGA B;  1HQ3 B;  3C1B C;  4XZQ B;  5B33 B;  5BNV B;  4YS3 D;  1TAF A;  3REL B;  4NE3 A;  5B40 B;  5B31 G;  1P3L B;  3A6N D;  5AY8 B;  2F8N K;  2ARO B;  3EPL A;  3IP4 C;  4X23 D;  5DNM B;  5GT3 B;  3MGQ D;  1P3F A;  3UTA C;  3AZF B;  4J8V A;  3MNN C;  2F8N A;  3LZ1 A;  3X1T A;  4LD9 D;  3AZN B;  3MGR C;  5F99 C;  2YFV A;  4J8W D;  3AZK C;  3V9R A;  4H9O A;  4AWL C;  2FJ7 A;  1ZLA D;  3B6G D;  3AV1 D;  1U35 D;  4Z66 C;  1F66 D;  2RIQ A;  2Y2J A;  5AVB A;  2Y2O A;  4UUZ A;  2YFW B;  1Z2C B;  3MNN B;  4ZUX A;  3REI B;  5E5A B;  1M19 B;  3AZE D;  1P3I B;  3W99 D;  5B24 A;  4QLC C;  5B31 C;  3REJ C;  3AZK B;  3AYW C;  1M18 A;  3KWQ C;  1EQZ A;  1P3O C;  3NQU A;  3H0R C;  3TU4 C;  2CWE A;  1ID3 B;  3B0C T;  4Z66 B;  5AV9 A;  3REK B;  3LZ0 D;  3P5J B;  5B1L C;  5JA4 B;  2FFF B;  5AV6 C;  1TZY C;  4R8P C;  1WWS A;  3FDD A;  5B32 D;  3AYW B;  4QLC B;  1KX5 A;  3AZH B;  4Z5T D;  3O62 C;  4JJN C;  1P3O B;  1KX4 D;  3W96 C;  3UTB C;  2PYO A;  2Y2Q A;  3LEL D;  3REH D;  4Z2M G;  4YS3 B;  5B0Y D;  2HIO C;  2VQR A;  5CPJ A;  4CSR B;  1TZY B;  1P3K C;  1P3P C;  3B6F A;  5CP6 A;  3A6N B;  3AV2 C;  3AZI A;  5B2I C;  3W97 D;  3X1U C;  3MGS C;  3LJA D;  5BT1 C;  3KUY C;  1P3M D;  3W98 A;  3O62 B;  2Y2P A;  4J8X A;  1N1J B;  4XZQ D;  1S32 A;  4LD9 B;  3MGP C;  2HIO B;  3C1C C;  4J8W B;  1P3B D;  5B40 D;  2BG1 A;  2RVQ C;  1P3K B;  1P3P B;  1ZLA B;  3WAA D;  5AY8 D;  3AV2 B;  3B6G B;  1M1A D;  1F66 B;  3R45 A;  3AN2 D;  4XUJ A;  3X1U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...