5JRGC

Crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5jrgC00
5E5AB 5DNNA 5AV9C 5AV6B 3UT9A 3LJAA 3RELD 1M1AB 3RELC 3MGSB 3AV2A 1AOIA 3C1BC 5B0YD 2F8NH 3B0CW 5E5AD 5B1LD 3AFAB 5B1LC 1M1AD 3W96D 3W96C 5B40A 1HQ3B 3LELA 3AZIA 4HGAC 3B6FA 3MVDA 2HIOA 3WAAC 3LZ0D 4AWLC 3LZ0C 3KUYA 1P3LB 5B2ID 2YFVB 5B2IC 5CP6A 5FUGA 5B24B 3TU4C 4YM6D 1JFIA 4YM6C 2CWEA 2HUEB 5AVCD 1ZLAA 5AVCC 1KX3C 5AV8D 5AV8C 3WKJB 2BYMB 4JJNB 5B32B 4H9OB 1P3AC 2IO5C 3AZFB 3O62B 1U35B 3B0BA 5GT3D 2HUEC 5GT3C 4J8UA 3AZLB 4G91C 1N1JB 2YFWB 4NE3A 3LZ1B 3UTAA 4J8XB 4WU8A 4JJND 5B31C 2FJ7A 5AVBB 1U35D 5GT0A 1EQZC 1EQZD 2F8NA 5GXQB 2AROD 5AY8B 2AROC 4WU9D 3X1TB 3MGQA 4WU9C 3W97A 4XUJA 3REJC 3REJD 4J8XD 3AZEB 4X23B 1A7WA 4H9RB 5AVBD 4J8WC 3AZGA 1P3PB 1KX4D 1KX4C 1ID3B 3C1CA 1KX5D 1KX5C 3X1SB 5B0ZA 4WZSB 3AZHC 3VH5T 3X1VB 5JRGB 5B2JA 5DNMB 3AZND 3AZNC 1M18B 4Z66B 1B6WA 1BH9B 2BYKA 3X1SD 3AYWC 3NQJB 5CPKA 3VH5A 2LY8A 3X1VD 1P3BD 1BH8A 5B31G 3KXBA 4G92C 1P3BC 5BNXA 5C3IC 5F99A 1M18D 5CPJB 1P3MB 1BFMA 1P3OB 3WTPA 3W99A 4Z5TD 4Z5TC 4XZQD 4XZQC 3AZKB 3X1UD 4YS3B 3X1UC 5GSUD 5GSUC 4LD9B 1P3MD 3WA9A 2F8NK 1P3FB 1P3ID 1P3IC 3MGRB 3AZKD 3AZJA 3B6GC 1F66A 2NZDD 2NZDC 2CV5D 2CV5C 3W98D 3REKA 3UTBB 3W98C 1M19B 3AV1C 5B33C 4H9PB 3AN2B 4J8VA 3V9RB 3NQUB 4E45A 1TZYD 1TZYC 5AV9B 1H3OB 3MNND 3RELB 3MNNC 3AZMC 2NQBD 2NQBC 4M6BA 3REIA 5DNND 5DNNC 3C1BB 3UT9D 3LJAD 3UT9C 3LJAC 3AV2D 1P3KA 3AV2C 1AOID 1AOIC 4WV4B 3REHA 4QLCA 5AV9D 4H9QA 5CPIA 5B1LB 1ULYA 3W96B 1HTAA 4KGCA 4YS3A 4Z2MG 3MGPA 3C1BD 4HGAB 4LD9A 5B40D 5B40C 3LELD 3WAAB 3LELC 3AZIC 4AWLB 3LZ0B 1P3GA 1KU5A 1S32A 1P34A 3B6FC 3B6FD 5B2IB 3TU4B 2HIOD 2HIOC 4UUZA 2PYOA 4YM6B 5AVCB 5JA4B 5CP6C 4KUDA 1KX3B 5AV8B 1M19A 3VH6W 4R8PA 3WAAD 3A6NA 4WNNB 1ZLAD 1ZLAC 3KWQA 1P3AB 3TU4D 2IO5B 5GT3B 5KDMB 5B1MA 5AV5D 5AV5C 1KX3D 4G91B 3R45A 1P3AD 4J8UC 5B31B 5B0YA 1EQZB 3UTAD 3UTAC 4WU8D 4WU8C 3KSYA 5E5AA 2FJ7D 5AV6A 2FJ7C 4NE5A 2AROB 4WU9B 1M1AA 3MGSA 5GT0C 3REJB 5B31D 4H9NB 3MGQD 3MGQC 3W97D 4XUJC 4J8WB 3W97C 3LZ0A 1KX4B 3AFAA 1KX5B 3AZGD 1HQ3A 3AZGC 5BS7C 3C1CC 3AZHB 4ZUXD 4ZUXC 4J8WD 5B0ZC 1F1EA 1P3LA 3AZNB 2YFVA 5B24A 4CAYB 3AYWB 5B2JC 5KDMA 4KHAB 4CSRB 3AZHD 3WKJA 4G92B 1P3BB 5G49B 5BO0B 2BYMA 5C3IB 5CPKD 5CPKC 4JJNA 5B32A 4H9OA 4E44A 3AZFA 3O62A 3KXBC 3AYWD 1U35A 5F99D 5F99C 4WU9A 3AZLA 2F8NG 1N1JA 3REJA 2YFWA 4Z5TB 3LZ1A 4XZQB 4J8XA 3X1UB 3WTPD 3WTPC 5GSUB 3W99C 1TAFB 5AVBA 5GXQA 1KX5A 5AY8A 3X1TA 1Q9CA 3WA9C 1P3IB 3B6GB 3AZEA 4X23A 2NZDB 4H9RA 2CV5B 3W98B 3AV1B 3AZJC 1P3PA 1F66C 5B33B 1ID3A 3B0CT 3REKD 5B32G 3REKC 3X1SA 3B6GD 2JSSA 1TZYB 3X1VA 4J8VD 4J8VC 1WWSA 3B0DC 3MNNB 3AZMB 5JRGA 3AV1D 2NQBB 5DNMA 5B33D 5DNNB 3UT9B 1M18A 3LJAB 4Z66A 1BH9A 3AV2B 3REID 1AOIB 3NQJA 3REIC 1P3KD 1P3KC 4ZBJC 3AZMD 3REHD 3REHC 4QLCD 2L5AA 4QLCC 3VH5W 5CPJA 5CPIC 5CPID 1P3MA 4KGCD 4KGCC 5B40B 3LELB 3AZIB 3MGPC 1P3OA 3B6FB 2RVQD 2HIOB 2RVQC 1P3IA 3AZKA 1S32D 3KUYB 1S32C 1P34C 1P3GC 2NZDA 5CP6B 1JFIB 5FUGB 2PYOC 3AZID 1P3FA 1ZLAB 4EO5C 3MVDD 4KUDC 3MVDC 4R8PD 4R8PC 3A6ND 3A6NC 3MGRA 3KUYD 3KWQD 3KUYC 3KWQC 1R4VA 5CP6D 5AV5B 3UTBA 1B67A 4H9PA 4J8UB 5B1MD 5B1MC 3AN2A 4H9SA 3V9RA 4DRAA 3NQUA 3UTAB 4WU8B 5AV9A 5B0YC 2FJ7B 1H3OA 3RELA 5GT0B 2F8NB 5E5AC 3C1BA 5AV6D 4J8UD 5AV6C 1M1AC 3MGSD 3MGSC 3MGQB 4XUJB 3W97B 5B1LA 3W96A 5GT0D 3AZGB 2F8ND 3AFAD 3C1CB 3AFAC 4NFTA 4ZUXB 4XUJD 1HQ3D 3WAAA 1HQ3C 5B0ZB 1WWIA 5B2IA 3TU4A 4YM6A 5B2JB 1P3LD 1P3LC 5AVCA 5JA4A 5B24D 3C1CD 5AV5A 5B24C 1KX3A 5AV8A 2BYKB 5B0ZD 4WNNA 5CPKB 1P3AA 3WKJD 3WKJC 5BNVB 1BH8B 3KXBB 5B2JD 5GT3A 5BNXB 5B32D 5F99B 5B32C 4JJNC 3AZFD 3AZFC 3O62D 3O62C 1U35C 5B31A 3WTPB 3AZLD 3W99B 3AZLC 3KXBD 3LZ1D 1EQZA 3LZ1C 4J8XC 2AROA 5AVBC 3WA9B 4Z2MH 5GXQD 5GXQC 5BS7A 5AY8D 4H9NA 3W99D 5AY8C 3X1TD 3X1TC 4ZUXA 4J8WA 5CHLB 3AZJB 5BT1D 3AZED 5BT1C 4X23D 4X23C 3AZEC 1KX4A 1F66B 3REKB 3WA9D 1P3PD 1P3PC 1ID3D 3AZHA 1ID3C 4J8VB 3B0DB 3X1SC 3AZJD 4NE6A 4DRBA 1F66D 3AZNA 3X1VC 5BNVA 4CAYA 5JRGD 3AYWA 5JRGC 5DNMD 5DNMC 3REIB 4KHAA 4CSRA 4Z66D 1M18C 4Z66C 1P3KB 1P3BA 4ZBJB 5G49A 5BO0A 3REHB 4QLCB 4H9QB 5CPIB 3VH6T 4KGCB 3WTPE 3MGPB 5CPJD 5CPJC 1P3MC 4Z5TA 4XZQA 3X1UA 1P3OD 1P3GB 1P3OC 1S32B 1P34B 5GSUA 1TAFA 4UUZB 3VH6A 2PYOB 4YS3D 3AZKC 4YS3C 3MGPD 4LD9D 4EO5B 4LD9C 4KUDB 3MVDB 4R8PB 3A6NB 1P3FD 1P3FC 1P3GD 3B6GA 1P34D 3KWQB 2CV5A 2PYOD 3W98A 3MGRD 3MGRC 3AV1A 5B33A 5B1MB 4KUDD 3UTBD 3UTBC 1M19D 1M19C 3R45B 1TZYA 3AN2D 5B0YB 3AN2C 4H9SC 3MNNA 3AZMA 2NQBA
chains in the Genus database with same CATH superfamily
5E5AB 5DNNA 5AV9C 5AV6B 3UT9A 3LJAA 3RELD 1M1AB 3RELC 3MGSB 3AV2A 1AOIA 1W2EA 3C1BC 5B0YD 2F8NH 3B0CW 3A1IA 5E5AD 5B1LD 3AFAB 3H0MC 5B1LC 1M1AD 3W96D 3W96C 5B40A 1HQ3B 2W8SA 3LELA 3AZIA 4HGAC 3B6FA 3MVDA 3EPHA 2HIOA 3H0LC 3WAAC 3LZ0D 4AWLC 3LZ0C 3KUYA 1P3LB 5B2ID 2YFVB 5B2IC 5CP6A 5FUGA 5B24B 3TU4C 4YM6D 1JFIA 2JCHA 4YM6C 2CWEA 2HUEB 5AVCD 1ZLAA 5AVCC 3EG5B 1KX3C 5AV8D 5AV8C 3WKJB 2UWXA 4WJ3C 2BYMB 4JJNB 5B32B 4H9OB 1P3AC 2IO5C 4DQYB 3AZFB 3O62B 1U35B 3B0BA 5GT3D 2HUEC 5GT3C 4J8UA 3AZLB 4G91C 1N1JB 2YFWB 4NE3A 3LZ1B 3UTAA 4J8XB 4WU8A 4JJND 5B31C 2FJ7A 5AVBB 1U35D 5GT0A 1EQZC 1EQZD 2F8NA 5GXQB 2AROD 5AY8B 2AROC 4WU9D 3X1TB 3MGQA 4WU9C 3W97A 4XUJA 3REJC 3REJD 4J8XD 3AZEB 4X23B 1A7WA 4H9RB 5AVBD 4J8WC 3AZGA 1P3PB 1KX4D 1KX4C 1ID3B 3C1CA 1KX5D 1KX5C 3X1SB 5B0ZA 4WZSB 3AZHC 3VH5T 3X1VB 3AL0C 5JRGB 5B2JA 5DNMB 3AZND 3AZNC 1M18B 4Z66B 1B6WA 1BH9B 2BYKA 3X1SD 3AYWC 3NQJB 5CPKA 3VH5A 2LY8A 3X1VD 1P3BD 1BH8A 5B31G 3KXBA 4G92C 1P3BC 5BNXA 5C3IC 5F99A 1M18D 5CPJB 1P3MB 1BFMA 1P3OB 3WTPA 3W99A 4Z5TD 4Z5TC 4XZQD 4XZQC 3AZKB 3X1UD 4YS3B 3X1UC 5GSUD 5GSUC 1Z2CB 4LD9B 1P3MD 3WA9A 2F8NK 1P3FB 2DQNC 2ZM5A 1P3ID 1P3IC 3MGRB 3AZKD 3AZJA 3B6GC 1F66A 2NZDD 2NZDC 2CV5D 2CV5C 3W98D 3REKA 3UTBB 3W98C 1M19B 3AV1C 2ZY4A 5B33C 4H9PB 3AN2B 4J8VA 3V9RB 3NQUB 4E45A 1TZYD 1TZYC 5AV9B 1H3OB 3MNND 3RELB 3MNNC 3AZMC 2NQBD 2NQBC 4M6BA 3REIA 2Y2MA 5DNND 5DNNC 3C1BB 3UT9D 3LJAD 3UT9C 3LJAC 3AV2D 1P3KA 2Y2JA 3AV2C 1AOID 1AOIC 4WV4B 3REHA 4QLCA 5AV9D 4H9QA 5CPIA 5B1LB 1ULYA 3W96B 1HTAA 4KGCA 4YS3A 4Z2MG 3MGPA 3C1BD 4HGAB 4LD9A 5B40D 5B40C 3LELD 3WAAB 3LELC 3AZIC 4AWLB 3LZ0B 1P3GA 1KU5A 1S32A 1P34A 2F2AC 3B6FC 3B6FD 5B2IB 3TU4B 2HIOD 2HIOC 4UUZA 2PYOA 4YM6B 5AVCB 5JA4B 5CP6C 4KUDA 1KX3B 2G5IC 5AV8B 1M19A 3VH6W 4R8PA 3WAAD 3A6NA 4WNNB 1ZLAD 1ZLAC 3KWQA 1P3AB 3TU4D 2IO5B 5GT3B 5KDMB 5B1MA 5AV5D 5AV5C 1KX3D 4G91B 3R45A 1P3AD 4J8UC 5B31B 5B0YA 2Y2GA 3A1KA 1EQZB 3UTAD 3UTAC 4WU8D 4WU8C 3KSYA 5E5AA 2FJ7D 5AV6A 2FJ7C 2J8PA 4NE5A 2AROB 4WU9B 1M1AA 3MGSA 5GT0C 3REJB 2XD5A 5B31D 3EPLA 4H9NB 3MGQD 3MGQC 3W97D 4XUJC 4J8WB 3W97C 3LZ0A 1KX4B 3AFAA 1KX5B 2Y2OA 3AZGD 1HQ3A 3AZGC 5BS7C 3C1CC 3AZHB 4ZUXD 4ZUXC 4J8WD 5B0ZC 1F1EA 1P3LA 3AZNB 2YFVA 5B24A 4CAYB 3AYWB 5B2JC 5KDMA 4KHAB 4CSRB 3AZHD 3WKJA 4G92B 1P3BB 5G49B 5BO0B 2BYMA 5C3IB 5CPKD 5CPKC 4JJNA 5B32A 4H9OA 4E44A 3AZFA 3O62A 3KXBC 3AYWD 1U35A 5F99D 5F99C 4WU9A 3AZLA 2F8NG 1N1JA 3REJA 2YFWA 4Z5TB 3LZ1A 4XZQB 4J8XA 3X1UB 2FFFB 2Y2KA 3WTPD 3WTPC 5GSUB 3W99C 1TAFB 5AVBA 5GXQA 1KX5A 5AY8A 3X1TA 1Q9CA 3WA9C 1P3IB 3B6GB 3AZEA 4X23A 2Y2QA 2NZDB 2Y2NA 3H0RC 4H9RA 2CV5B 3W98B 3AV1B 3AZJC 1P3PA 1F66C 5B33B 1PZRA 1ID3A 3B0CT 3REKD 5B32G 3REKC 2ZY5A 3X1SA 2Y2IA 3B6GD 2JSSA 1TZYB 3X1VA 4J8VD 4J8VC 1WWSA 3B0DC 3MNNB 3AZMB 5JRGA 3AV1D 2NQBB 5DNMA 5B33D 5DNNB 3UT9B 1M18A 3LJAB 4Z66A 1BH9A 3AV2B 3REID 1AOIB 3NQJA 3REIC 1P3KD 1P3KC 4ZBJC 3AZMD 3REHD 3REHC 4QLCD 2L5AA 4QLCC 3VH5W 5CPJA 5CPIC 5CPID 1P3MA 4KGCD 4KGCC 5B40B 3LELB 3AZIB 3MGPC 1P3OA 3B6FB 2RVQD 2HIOB 2RVQC 1P3IA 3AZKA 1S32D 3KUYB 1S32C 1P34C 1P3GC 2NZDA 5CP6B 1JFIB 5FUGB 2PYOC 3AZID 1P3FA 1ZLAB 4EO5C 3MVDD 4KUDC 3MVDC 4R8PD 4R8PC 3A6ND 3A6NC 3MGRA 3KUYD 3KWQD 3KUYC 3KWQC 3EPJA 1R4VA 5CP6D 3EPKA 5AV5B 3UTBA 1B67A 2ZY3A 4H9PA 4J8UB 5B1MD 5B1MC 3AN2A 4H9SA 3V9RA 4DRAA 3NQUA 3UTAB 4WU8B 5AV9A 2JE5A 5B0YC 2FJ7B 1H3OA 3RELA 2VQRA 5GT0B 2F8NB 5E5AC 3C1BA 5AV6D 4J8UD 5AV6C 1M1AC 3MGSD 3MGSC 3MGQB 4XUJB 3W97B 3FDDA 2ZY2A 5B1LA 3W96A 5GT0D 2RIQA 3AZGB 2F8ND 3AFAD 3C1CB 3AFAC 4NFTA 4ZUXB 4XUJD 1HQ3D 3WAAA 1HQ3C 4UPKA 5B0ZB 1WWIA 5B2IA 3TU4A 4YM6A 5B2JB 1P3LD 1P3LC 5AVCA 5JA4A 5B24D 3C1CD 5AV5A 5B24C 1KX3A 5AV8A 2BYKB 5B0ZD 4WNNA 5CPKB 1P3AA 3WKJD 3WKJC 5BNVB 1BH8B 3KXBB 5B2JD 5GT3A 5BNXB 5B32D 5F99B 5B32C 4JJNC 3AZFD 3AZFC 3O62D 3O62C 1U35C 2DF4C 2Y2HA 5B31A 3WTPB 3AZLD 3W99B 3AZLC 3KXBD 3LZ1D 1EQZA 3LZ1C 2Y2PA 4J8XC 2AROA 5AVBC 3WA9B 4Z2MH 5GXQD 3F6TA 5GXQC 5BS7A 5AY8D 4H9NA 3W99D 5AY8C 3X1TD 3X1TC 4ZUXA 4J8WA 5CHLB 3AZJB 5BT1D 3AZED 5BT1C 4X23D 4X23C 3AZEC 1KX4A 1F66B 3REKB 3WA9D 3P5JB 1P3PD 1P3PC 3KFUG 1ID3D 3AZHA 1ID3C 4J8VB 3IP4C 3B0DB 3X1SC 3AZJD 4NE6A 4DRBA 1F66D 3AZNA 3X1VC 5BNVA 2Y2LA 4CAYA 5JRGD 5JRGC 3AYWA 5DNMD 5DNMC 3REIB 4KHAA 4CSRA 4Z66D 1M18C 4Z66C 1P3KB 1P3BA 4ZBJB 5G49A 5BO0A 2G5HC 3REHB 4QLCB 4H9QB 5CPIB 3VH6T 4KGCB 3WTPE 3MGPB 1T3UA 5CPJD 5CPJC 1P3MC 4Z5TA 4XZQA 3X1UA 1P3OD 1P3GB 1P3OC 1S32B 1P34B 5GSUA 1TAFA 4UUZB 3VH6A 2PYOB 2BG1A 4YS3D 3AZKC 4YS3C 3MGPD 4LD9D 2XD1A 4EO5B 4KUDB 3MVDB 4LD9C 4R8PB 3A6NB 1P3FD 1P3FC 1P3GD 3B6GA 1P34D 3KWQB 2CV5A 2PYOD 3W98A 3MGRD 3MGRC 3AV1A 5B33A 5B1MB 4KUDD 3UTBD 3UTBC 1M19D 1M19C 3R45B 1TZYA 3AN2D 5B0YB 3AN2C 4H9SC 3MNNA 3AZMA 2NQBA
chains in the Genus database with same CATH topology
5E5AB 5DNNA 5AV9C 5AV6B 3UT9A 3LJAA 3RELD 1M1AB 3RELC 3MGSB 3AV2A 1AOIA 1W2EA 3C1BC 5B0YD 2F8NH 3B0CW 3A1IA 5E5AD 5B1LD 3AFAB 3H0MC 5B1LC 1M1AD 3W96D 3W96C 5B40A 1HQ3B 2W8SA 3LELA 3AZIA 4HGAC 3B6FA 3MVDA 3EPHA 2HIOA 3H0LC 3WAAC 3LZ0D 4AWLC 3LZ0C 3KUYA 1P3LB 5B2ID 2YFVB 5B2IC 5CP6A 5FUGA 5B24B 3TU4C 4YM6D 1JFIA 2JCHA 4YM6C 2CWEA 2HUEB 5AVCD 1ZLAA 5AVCC 3EG5B 1KX3C 5AV8D 5AV8C 3WKJB 2UWXA 4WJ3C 2BYMB 4JJNB 5B32B 4H9OB 1P3AC 2IO5C 4DQYB 3AZFB 3O62B 1U35B 3B0BA 5GT3D 2HUEC 5GT3C 4J8UA 3AZLB 4G91C 1N1JB 2YFWB 4NE3A 3LZ1B 3UTAA 4J8XB 4WU8A 4JJND 5B31C 2FJ7A 5AVBB 1U35D 5GT0A 1EQZC 1EQZD 2F8NA 5GXQB 2AROD 5AY8B 2AROC 4WU9D 3X1TB 3MGQA 4WU9C 3W97A 4XUJA 3REJC 3REJD 4J8XD 3AZEB 4X23B 1A7WA 4H9RB 5AVBD 4J8WC 3AZGA 1P3PB 1KX4D 1KX4C 1ID3B 3C1CA 1KX5D 1KX5C 3X1SB 5B0ZA 4WZSB 3AZHC 3VH5T 3X1VB 3AL0C 5JRGB 5B2JA 5DNMB 3AZND 3AZNC 1M18B 4Z66B 1B6WA 1BH9B 2BYKA 3X1SD 3AYWC 3NQJB 5CPKA 3VH5A 2LY8A 3X1VD 1P3BD 1BH8A 5B31G 3KXBA 4G92C 1P3BC 5BNXA 5C3IC 5F99A 1M18D 5CPJB 1P3MB 1BFMA 1P3OB 3WTPA 3W99A 4Z5TD 4Z5TC 4XZQD 4XZQC 3AZKB 3X1UD 4YS3B 3X1UC 5GSUD 5GSUC 1Z2CB 4LD9B 1P3MD 3WA9A 2F8NK 1P3FB 2DQNC 2ZM5A 1P3ID 1P3IC 3MGRB 3AZKD 3AZJA 3B6GC 1F66A 2NZDD 2NZDC 2CV5D 2CV5C 3W98D 3REKA 3UTBB 3W98C 1M19B 3AV1C 2ZY4A 5B33C 4H9PB 3AN2B 4J8VA 3V9RB 3NQUB 4E45A 1TZYD 1TZYC 5AV9B 1H3OB 3MNND 3RELB 3MNNC 3AZMC 2NQBD 2NQBC 4M6BA 3REIA 2Y2MA 5DNND 5DNNC 3C1BB 3UT9D 3LJAD 3UT9C 3LJAC 3AV2D 1P3KA 2Y2JA 3AV2C 1AOID 1AOIC 4WV4B 3REHA 4QLCA 5AV9D 4H9QA 5CPIA 5B1LB 1ULYA 3W96B 1HTAA 4KGCA 4YS3A 4Z2MG 3MGPA 3C1BD 4HGAB 4LD9A 5B40D 5B40C 3LELD 3WAAB 3LELC 3AZIC 4AWLB 3LZ0B 1P3GA 1KU5A 1S32A 1P34A 2F2AC 3B6FC 3B6FD 5B2IB 3TU4B 2HIOD 2HIOC 4UUZA 2PYOA 4YM6B 5AVCB 5JA4B 5CP6C 4KUDA 1KX3B 2G5IC 5AV8B 1M19A 3VH6W 4R8PA 3WAAD 3A6NA 4WNNB 1ZLAD 1ZLAC 3KWQA 1P3AB 3TU4D 2IO5B 5GT3B 5KDMB 5B1MA 5AV5D 5AV5C 1KX3D 4G91B 3R45A 1P3AD 4J8UC 5B31B 5B0YA 2Y2GA 3A1KA 1EQZB 3UTAD 3UTAC 4WU8D 4WU8C 3KSYA 5E5AA 2FJ7D 5AV6A 2FJ7C 2J8PA 4NE5A 2AROB 4WU9B 1M1AA 3MGSA 5GT0C 3REJB 2XD5A 5B31D 3EPLA 4H9NB 3MGQD 3MGQC 3W97D 4XUJC 4J8WB 3W97C 3LZ0A 1KX4B 3AFAA 1KX5B 2Y2OA 3AZGD 1HQ3A 3AZGC 5BS7C 3C1CC 3AZHB 4ZUXD 4ZUXC 4J8WD 5B0ZC 1F1EA 1P3LA 3AZNB 2YFVA 5B24A 4CAYB 3AYWB 5B2JC 5KDMA 4KHAB 4CSRB 3AZHD 3WKJA 4G92B 1P3BB 5G49B 5BO0B 2BYMA 5C3IB 5CPKD 5CPKC 4JJNA 5B32A 4H9OA 4E44A 3AZFA 3O62A 3KXBC 3AYWD 1U35A 5F99D 5F99C 4WU9A 3AZLA 2F8NG 1N1JA 3REJA 2YFWA 4Z5TB 3LZ1A 4XZQB 4J8XA 3X1UB 2FFFB 2Y2KA 3WTPD 3WTPC 5GSUB 3W99C 1TAFB 5AVBA 5GXQA 1KX5A 5AY8A 3X1TA 1Q9CA 3WA9C 1P3IB 3B6GB 3AZEA 4X23A 2Y2QA 2NZDB 2Y2NA 3H0RC 4H9RA 2CV5B 3W98B 3AV1B 3AZJC 1P3PA 1F66C 5B33B 1PZRA 1ID3A 3B0CT 3REKD 5B32G 3REKC 2ZY5A 3X1SA 2Y2IA 3B6GD 2JSSA 1TZYB 3X1VA 4J8VD 4J8VC 1WWSA 3B0DC 3MNNB 3AZMB 5JRGA 3AV1D 2NQBB 5DNMA 5B33D 5DNNB 3UT9B 1M18A 3LJAB 4Z66A 1BH9A 3AV2B 3REID 1AOIB 3NQJA 3REIC 1P3KD 1P3KC 4ZBJC 3AZMD 3REHD 3REHC 4QLCD 2L5AA 4QLCC 3VH5W 5CPJA 5CPIC 5CPID 1P3MA 4KGCD 4KGCC 5B40B 3LELB 3AZIB 3MGPC 1P3OA 3B6FB 2RVQD 2HIOB 2RVQC 1P3IA 3AZKA 1S32D 3KUYB 1S32C 1P34C 1P3GC 2NZDA 5CP6B 1JFIB 5FUGB 2PYOC 3AZID 1P3FA 1ZLAB 4EO5C 3MVDD 4KUDC 3MVDC 4R8PD 4R8PC 3A6ND 3A6NC 3MGRA 3KUYD 3KWQD 3KUYC 3KWQC 3EPJA 1R4VA 5CP6D 3EPKA 5AV5B 3UTBA 1B67A 2ZY3A 4H9PA 4J8UB 5B1MD 5B1MC 3AN2A 4H9SA 3V9RA 4DRAA 3NQUA 3UTAB 4WU8B 5AV9A 2JE5A 5B0YC 2FJ7B 1H3OA 3RELA 2VQRA 5GT0B 2F8NB 5E5AC 3C1BA 5AV6D 4J8UD 5AV6C 1M1AC 3MGSD 3MGSC 3MGQB 4XUJB 3W97B 3FDDA 2ZY2A 5B1LA 3W96A 5GT0D 2RIQA 3AZGB 2F8ND 3AFAD 3C1CB 3AFAC 4NFTA 4ZUXB 4XUJD 1HQ3D 3WAAA 1HQ3C 4UPKA 5B0ZB 1WWIA 5B2IA 3TU4A 4YM6A 5B2JB 1P3LD 1P3LC 5AVCA 5JA4A 5B24D 3C1CD 5AV5A 5B24C 1KX3A 5AV8A 2BYKB 5B0ZD 4WNNA 5CPKB 1P3AA 3WKJD 3WKJC 5BNVB 1BH8B 3KXBB 5B2JD 5GT3A 5BNXB 5B32D 5F99B 5B32C 4JJNC 3AZFD 3AZFC 3O62D 3O62C 1U35C 2DF4C 2Y2HA 5B31A 3WTPB 3AZLD 3W99B 3AZLC 3KXBD 3LZ1D 1EQZA 3LZ1C 2Y2PA 4J8XC 2AROA 5AVBC 3WA9B 4Z2MH 5GXQD 3F6TA 5GXQC 5BS7A 5AY8D 4H9NA 3W99D 5AY8C 3X1TD 3X1TC 4ZUXA 4J8WA 5CHLB 3AZJB 5BT1D 3AZED 5BT1C 4X23D 4X23C 3AZEC 1KX4A 1F66B 3REKB 3WA9D 3P5JB 1P3PD 1P3PC 3KFUG 1ID3D 3AZHA 1ID3C 4J8VB 3IP4C 3B0DB 3X1SC 3AZJD 4NE6A 4DRBA 1F66D 3AZNA 3X1VC 5BNVA 2Y2LA 4CAYA 5JRGD 5JRGC 3AYWA 5DNMD 5DNMC 3REIB 4KHAA 4CSRA 4Z66D 1M18C 4Z66C 1P3KB 1P3BA 4ZBJB 5G49A 5BO0A 2G5HC 3REHB 4QLCB 4H9QB 5CPIB 3VH6T 4KGCB 3WTPE 3MGPB 1T3UA 5CPJD 5CPJC 1P3MC 4Z5TA 4XZQA 3X1UA 1P3OD 1P3GB 1P3OC 1S32B 1P34B 5GSUA 1TAFA 4UUZB 3VH6A 2PYOB 2BG1A 4YS3D 3AZKC 4YS3C 3MGPD 4LD9D 2XD1A 4EO5B 4KUDB 3MVDB 4LD9C 4R8PB 3A6NB 1P3FD 1P3FC 1P3GD 3B6GA 1P34D 3KWQB 2CV5A 2PYOD 3W98A 3MGRD 3MGRC 3AV1A 5B33A 5B1MB 4KUDD 3UTBD 3UTBC 1M19D 1M19C 3R45B 1TZYA 3AN2D 5B0YB 3AN2C 4H9SC 3MNNA 3AZMA 2NQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E5A B;  5DNN A;  5AV9 C;  5AV6 B;  3UT9 A;  3LJA A;  3REL D;  1M1A B;  3REL C;  3MGS B;  3AV2 A;  1AOI A;  3C1B C;  5B0Y D;  2F8N H;  3B0C W;  5E5A D;  5B1L D;  3AFA B;  5B1L C;  1M1A D;  3W96 D;  3W96 C;  5B40 A;  1HQ3 B;  3LEL A;  3AZI A;  4HGA C;  3B6F A;  3MVD A;  2HIO A;  3WAA C;  3LZ0 D;  4AWL C;  3LZ0 C;  3KUY A;  1P3L B;  5B2I D;  2YFV B;  5B2I C;  5CP6 A;  5FUG A;  5B24 B;  3TU4 C;  4YM6 D;  1JFI A;  4YM6 C;  2CWE A;  2HUE B;  5AVC D;  1ZLA A;  5AVC C;  1KX3 C;  5AV8 D;  5AV8 C;  3WKJ B;  2BYM B;  4JJN B;  5B32 B;  4H9O B;  1P3A C;  2IO5 C;  3AZF B;  3O62 B;  1U35 B;  3B0B A;  5GT3 D;  2HUE C;  5GT3 C;  4J8U A;  3AZL B;  4G91 C;  1N1J B;  2YFW B;  4NE3 A;  3LZ1 B;  3UTA A;  4J8X B;  4WU8 A;  4JJN D;  5B31 C;  2FJ7 A;  5AVB B;  1U35 D;  5GT0 A;  1EQZ C;  1EQZ D;  2F8N A;  5GXQ B;  2ARO D;  5AY8 B;  2ARO C;  4WU9 D;  3X1T B;  3MGQ A;  4WU9 C;  3W97 A;  4XUJ A;  3REJ C;  3REJ D;  4J8X D;  3AZE B;  4X23 B;  1A7W A;  4H9R B;  5AVB D;  4J8W C;  3AZG A;  1P3P B;  1KX4 D;  1KX4 C;  1ID3 B;  3C1C A;  1KX5 D;  1KX5 C;  3X1S B;  5B0Z A;  4WZS B;  3AZH C;  3VH5 T;  3X1V B;  5JRG B;  5B2J A;  5DNM B;  3AZN D;  3AZN C;  1M18 B;  4Z66 B;  1B6W A;  1BH9 B;  2BYK A;  3X1S D;  3AYW C;  3NQJ B;  5CPK A;  3VH5 A;  2LY8 A;  3X1V D;  1P3B D;  1BH8 A;  5B31 G;  3KXB A;  4G92 C;  1P3B C;  5BNX A;  5C3I C;  5F99 A;  1M18 D;  5CPJ B;  1P3M B;  1BFM A;  1P3O B;  3WTP A;  3W99 A;  4Z5T D;  4Z5T C;  4XZQ D;  4XZQ C;  3AZK B;  3X1U D;  4YS3 B;  3X1U C;  5GSU D;  5GSU C;  4LD9 B;  1P3M D;  3WA9 A;  2F8N K;  1P3F B;  1P3I D;  1P3I C;  3MGR B;  3AZK D;  3AZJ A;  3B6G C;  1F66 A;  2NZD D;  2NZD C;  2CV5 D;  2CV5 C;  3W98 D;  3REK A;  3UTB B;  3W98 C;  1M19 B;  3AV1 C;  5B33 C;  4H9P B;  3AN2 B;  4J8V A;  3V9R B;  3NQU B;  4E45 A;  1TZY D;  1TZY C;  5AV9 B;  1H3O B;  3MNN D;  3REL B;  3MNN C;  3AZM C;  2NQB D;  2NQB C;  4M6B A;  3REI A;  5DNN D;  5DNN C;  3C1B B;  3UT9 D;  3LJA D;  3UT9 C;  3LJA C;  3AV2 D;  1P3K A;  3AV2 C;  1AOI D;  1AOI C;  4WV4 B;  3REH A;  4QLC A;  5AV9 D;  4H9Q A;  5CPI A;  5B1L B;  1ULY A;  3W96 B;  1HTA A;  4KGC A;  4YS3 A;  4Z2M G;  3MGP A;  3C1B D;  4HGA B;  4LD9 A;  5B40 D;  5B40 C;  3LEL D;  3WAA B;  3LEL C;  3AZI C;  4AWL B;  3LZ0 B;  1P3G A;  1KU5 A;  1S32 A;  1P34 A;  3B6F C;  3B6F D;  5B2I B;  3TU4 B;  2HIO D;  2HIO C;  4UUZ A;  2PYO A;  4YM6 B;  5AVC B;  5JA4 B;  5CP6 C;  4KUD A;  1KX3 B;  5AV8 B;  1M19 A;  3VH6 W;  4R8P A;  3WAA D;  3A6N A;  4WNN B;  1ZLA D;  1ZLA C;  3KWQ A;  1P3A B;  3TU4 D;  2IO5 B;  5GT3 B;  5KDM B;  5B1M A;  5AV5 D;  5AV5 C;  1KX3 D;  4G91 B;  3R45 A;  1P3A D;  4J8U C;  5B31 B;  5B0Y A;  1EQZ B;  3UTA D;  3UTA C;  4WU8 D;  4WU8 C;  3KSY A;  5E5A A;  2FJ7 D;  5AV6 A;  2FJ7 C;  4NE5 A;  2ARO B;  4WU9 B;  1M1A A;  3MGS A;  5GT0 C;  3REJ B;  5B31 D;  4H9N B;  3MGQ D;  3MGQ C;  3W97 D;  4XUJ C;  4J8W B;  3W97 C;  3LZ0 A;  1KX4 B;  3AFA A;  1KX5 B;  3AZG D;  1HQ3 A;  3AZG C;  5BS7 C;  3C1C C;  3AZH B;  4ZUX D;  4ZUX C;  4J8W D;  5B0Z C;  1F1E A;  1P3L A;  3AZN B;  2YFV A;  5B24 A;  4CAY B;  3AYW B;  5B2J C;  5KDM A;  4KHA B;  4CSR B;  3AZH D;  3WKJ A;  4G92 B;  1P3B B;  5G49 B;  5BO0 B;  2BYM A;  5C3I B;  5CPK D;  5CPK C;  4JJN A;  5B32 A;  4H9O A;  4E44 A;  3AZF A;  3O62 A;  3KXB C;  3AYW D;  1U35 A;  5F99 D;  5F99 C;  4WU9 A;  3AZL A;  2F8N G;  1N1J A;  3REJ A;  2YFW A;  4Z5T B;  3LZ1 A;  4XZQ B;  4J8X A;  3X1U B;  3WTP D;  3WTP C;  5GSU B;  3W99 C;  1TAF B;  5AVB A;  5GXQ A;  1KX5 A;  5AY8 A;  3X1T A;  1Q9C A;  3WA9 C;  1P3I B;  3B6G B;  3AZE A;  4X23 A;  2NZD B;  4H9R A;  2CV5 B;  3W98 B;  3AV1 B;  3AZJ C;  1P3P A;  1F66 C;  5B33 B;  1ID3 A;  3B0C T;  3REK D;  5B32 G;  3REK C;  3X1S A;  3B6G D;  2JSS A;  1TZY B;  3X1V A;  4J8V D;  4J8V C;  1WWS A;  3B0D C;  3MNN B;  3AZM B;  5JRG A;  3AV1 D;  2NQB B;  5DNM A;  5B33 D;  5DNN B;  3UT9 B;  1M18 A;  3LJA B;  4Z66 A;  1BH9 A;  3AV2 B;  3REI D;  1AOI B;  3NQJ A;  3REI C;  1P3K D;  1P3K C;  4ZBJ C;  3AZM D;  3REH D;  3REH C;  4QLC D;  2L5A A;  4QLC C;  3VH5 W;  5CPJ A;  5CPI C;  5CPI D;  1P3M A;  4KGC D;  4KGC C;  5B40 B;  3LEL B;  3AZI B;  3MGP C;  1P3O A;  3B6F B;  2RVQ D;  2HIO B;  2RVQ C;  1P3I A;  3AZK A;  1S32 D;  3KUY B;  1S32 C;  1P34 C;  1P3G C;  2NZD A;  5CP6 B;  1JFI B;  5FUG B;  2PYO C;  3AZI D;  1P3F A;  1ZLA B;  4EO5 C;  3MVD D;  4KUD C;  3MVD C;  4R8P D;  4R8P C;  3A6N D;  3A6N C;  3MGR A;  3KUY D;  3KWQ D;  3KUY C;  3KWQ C;  1R4V A;  5CP6 D;  5AV5 B;  3UTB A;  1B67 A;  4H9P A;  4J8U B;  5B1M D;  5B1M C;  3AN2 A;  4H9S A;  3V9R A;  4DRA A;  3NQU A;  3UTA B;  4WU8 B;  5AV9 A;  5B0Y C;  2FJ7 B;  1H3O A;  3REL A;  5GT0 B;  2F8N B;  5E5A C;  3C1B A;  5AV6 D;  4J8U D;  5AV6 C;  1M1A C;  3MGS D;  3MGS C;  3MGQ B;  4XUJ B;  3W97 B;  5B1L A;  3W96 A;  5GT0 D;  3AZG B;  2F8N D;  3AFA D;  3C1C B;  3AFA C;  4NFT A;  4ZUX B;  4XUJ D;  1HQ3 D;  3WAA A;  1HQ3 C;  5B0Z B;  1WWI A;  5B2I A;  3TU4 A;  4YM6 A;  5B2J B;  1P3L D;  1P3L C;  5AVC A;  5JA4 A;  5B24 D;  3C1C D;  5AV5 A;  5B24 C;  1KX3 A;  5AV8 A;  2BYK B;  5B0Z D;  4WNN A;  5CPK B;  1P3A A;  3WKJ D;  3WKJ C;  5BNV B;  1BH8 B;  3KXB B;  5B2J D;  5GT3 A;  5BNX B;  5B32 D;  5F99 B;  5B32 C;  4JJN C;  3AZF D;  3AZF C;  3O62 D;  3O62 C;  1U35 C;  5B31 A;  3WTP B;  3AZL D;  3W99 B;  3AZL C;  3KXB D;  3LZ1 D;  1EQZ A;  3LZ1 C;  4J8X C;  2ARO A;  5AVB C;  3WA9 B;  4Z2M H;  5GXQ D;  5GXQ C;  5BS7 A;  5AY8 D;  4H9N A;  3W99 D;  5AY8 C;  3X1T D;  3X1T C;  4ZUX A;  4J8W A;  5CHL B;  3AZJ B;  5BT1 D;  3AZE D;  5BT1 C;  4X23 D;  4X23 C;  3AZE C;  1KX4 A;  1F66 B;  3REK B;  3WA9 D;  1P3P D;  1P3P C;  1ID3 D;  3AZH A;  1ID3 C;  4J8V B;  3B0D B;  3X1S C;  3AZJ D;  4NE6 A;  4DRB A;  1F66 D;  3AZN A;  3X1V C;  5BNV A;  4CAY A;  5JRG D;  3AYW A;  5JRG C;  5DNM D;  5DNM C;  3REI B;  4KHA A;  4CSR A;  4Z66 D;  1M18 C;  4Z66 C;  1P3K B;  1P3B A;  4ZBJ B;  5G49 A;  5BO0 A;  3REH B;  4QLC B;  4H9Q B;  5CPI B;  3VH6 T;  4KGC B;  3WTP E;  3MGP B;  5CPJ D;  5CPJ C;  1P3M C;  4Z5T A;  4XZQ A;  3X1U A;  1P3O D;  1P3G B;  1P3O C;  1S32 B;  1P34 B;  5GSU A;  1TAF A;  4UUZ B;  3VH6 A;  2PYO B;  4YS3 D;  3AZK C;  4YS3 C;  3MGP D;  4LD9 D;  4EO5 B;  4LD9 C;  4KUD B;  3MVD B;  4R8P B;  3A6N B;  1P3F D;  1P3F C;  1P3G D;  3B6G A;  1P34 D;  3KWQ B;  2CV5 A;  2PYO D;  3W98 A;  3MGR D;  3MGR C;  3AV1 A;  5B33 A;  5B1M B;  4KUD D;  3UTB D;  3UTB C;  1M19 D;  1M19 C;  3R45 B;  1TZY A;  3AN2 D;  5B0Y B;  3AN2 C;  4H9S C;  3MNN A;  3AZM A;  2NQB A; 
#chains in the Genus database with same CATH topology
 5E5A B;  5DNN A;  5AV9 C;  5AV6 B;  3UT9 A;  3LJA A;  3REL D;  1M1A B;  3REL C;  3MGS B;  3AV2 A;  1AOI A;  1W2E A;  3C1B C;  5B0Y D;  2F8N H;  3B0C W;  3A1I A;  5E5A D;  5B1L D;  3AFA B;  3H0M C;  5B1L C;  1M1A D;  3W96 D;  3W96 C;  5B40 A;  1HQ3 B;  2W8S A;  3LEL A;  3AZI A;  4HGA C;  3B6F A;  3MVD A;  3EPH A;  2HIO A;  3H0L C;  3WAA C;  3LZ0 D;  4AWL C;  3LZ0 C;  3KUY A;  1P3L B;  5B2I D;  2YFV B;  5B2I C;  5CP6 A;  5FUG A;  5B24 B;  3TU4 C;  4YM6 D;  1JFI A;  2JCH A;  4YM6 C;  2CWE A;  2HUE B;  5AVC D;  1ZLA A;  5AVC C;  3EG5 B;  1KX3 C;  5AV8 D;  5AV8 C;  3WKJ B;  2UWX A;  4WJ3 C;  2BYM B;  4JJN B;  5B32 B;  4H9O B;  1P3A C;  2IO5 C;  4DQY B;  3AZF B;  3O62 B;  1U35 B;  3B0B A;  5GT3 D;  2HUE C;  5GT3 C;  4J8U A;  3AZL B;  4G91 C;  1N1J B;  2YFW B;  4NE3 A;  3LZ1 B;  3UTA A;  4J8X B;  4WU8 A;  4JJN D;  5B31 C;  2FJ7 A;  5AVB B;  1U35 D;  5GT0 A;  1EQZ C;  1EQZ D;  2F8N A;  5GXQ B;  2ARO D;  5AY8 B;  2ARO C;  4WU9 D;  3X1T B;  3MGQ A;  4WU9 C;  3W97 A;  4XUJ A;  3REJ C;  3REJ D;  4J8X D;  3AZE B;  4X23 B;  1A7W A;  4H9R B;  5AVB D;  4J8W C;  3AZG A;  1P3P B;  1KX4 D;  1KX4 C;  1ID3 B;  3C1C A;  1KX5 D;  1KX5 C;  3X1S B;  5B0Z A;  4WZS B;  3AZH C;  3VH5 T;  3X1V B;  3AL0 C;  5JRG B;  5B2J A;  5DNM B;  3AZN D;  3AZN C;  1M18 B;  4Z66 B;  1B6W A;  1BH9 B;  2BYK A;  3X1S D;  3AYW C;  3NQJ B;  5CPK A;  3VH5 A;  2LY8 A;  3X1V D;  1P3B D;  1BH8 A;  5B31 G;  3KXB A;  4G92 C;  1P3B C;  5BNX A;  5C3I C;  5F99 A;  1M18 D;  5CPJ B;  1P3M B;  1BFM A;  1P3O B;  3WTP A;  3W99 A;  4Z5T D;  4Z5T C;  4XZQ D;  4XZQ C;  3AZK B;  3X1U D;  4YS3 B;  3X1U C;  5GSU D;  5GSU C;  1Z2C B;  4LD9 B;  1P3M D;  3WA9 A;  2F8N K;  1P3F B;  2DQN C;  2ZM5 A;  1P3I D;  1P3I C;  3MGR B;  3AZK D;  3AZJ A;  3B6G C;  1F66 A;  2NZD D;  2NZD C;  2CV5 D;  2CV5 C;  3W98 D;  3REK A;  3UTB B;  3W98 C;  1M19 B;  3AV1 C;  2ZY4 A;  5B33 C;  4H9P B;  3AN2 B;  4J8V A;  3V9R B;  3NQU B;  4E45 A;  1TZY D;  1TZY C;  5AV9 B;  1H3O B;  3MNN D;  3REL B;  3MNN C;  3AZM C;  2NQB D;  2NQB C;  4M6B A;  3REI A;  2Y2M A;  5DNN D;  5DNN C;  3C1B B;  3UT9 D;  3LJA D;  3UT9 C;  3LJA C;  3AV2 D;  1P3K A;  2Y2J A;  3AV2 C;  1AOI D;  1AOI C;  4WV4 B;  3REH A;  4QLC A;  5AV9 D;  4H9Q A;  5CPI A;  5B1L B;  1ULY A;  3W96 B;  1HTA A;  4KGC A;  4YS3 A;  4Z2M G;  3MGP A;  3C1B D;  4HGA B;  4LD9 A;  5B40 D;  5B40 C;  3LEL D;  3WAA B;  3LEL C;  3AZI C;  4AWL B;  3LZ0 B;  1P3G A;  1KU5 A;  1S32 A;  1P34 A;  2F2A C;  3B6F C;  3B6F D;  5B2I B;  3TU4 B;  2HIO D;  2HIO C;  4UUZ A;  2PYO A;  4YM6 B;  5AVC B;  5JA4 B;  5CP6 C;  4KUD A;  1KX3 B;  2G5I C;  5AV8 B;  1M19 A;  3VH6 W;  4R8P A;  3WAA D;  3A6N A;  4WNN B;  1ZLA D;  1ZLA C;  3KWQ A;  1P3A B;  3TU4 D;  2IO5 B;  5GT3 B;  5KDM B;  5B1M A;  5AV5 D;  5AV5 C;  1KX3 D;  4G91 B;  3R45 A;  1P3A D;  4J8U C;  5B31 B;  5B0Y A;  2Y2G A;  3A1K A;  1EQZ B;  3UTA D;  3UTA C;  4WU8 D;  4WU8 C;  3KSY A;  5E5A A;  2FJ7 D;  5AV6 A;  2FJ7 C;  2J8P A;  4NE5 A;  2ARO B;  4WU9 B;  1M1A A;  3MGS A;  5GT0 C;  3REJ B;  2XD5 A;  5B31 D;  3EPL A;  4H9N B;  3MGQ D;  3MGQ C;  3W97 D;  4XUJ C;  4J8W B;  3W97 C;  3LZ0 A;  1KX4 B;  3AFA A;  1KX5 B;  2Y2O A;  3AZG D;  1HQ3 A;  3AZG C;  5BS7 C;  3C1C C;  3AZH B;  4ZUX D;  4ZUX C;  4J8W D;  5B0Z C;  1F1E A;  1P3L A;  3AZN B;  2YFV A;  5B24 A;  4CAY B;  3AYW B;  5B2J C;  5KDM A;  4KHA B;  4CSR B;  3AZH D;  3WKJ A;  4G92 B;  1P3B B;  5G49 B;  5BO0 B;  2BYM A;  5C3I B;  5CPK D;  5CPK C;  4JJN A;  5B32 A;  4H9O A;  4E44 A;  3AZF A;  3O62 A;  3KXB C;  3AYW D;  1U35 A;  5F99 D;  5F99 C;  4WU9 A;  3AZL A;  2F8N G;  1N1J A;  3REJ A;  2YFW A;  4Z5T B;  3LZ1 A;  4XZQ B;  4J8X A;  3X1U B;  2FFF B;  2Y2K A;  3WTP D;  3WTP C;  5GSU B;  3W99 C;  1TAF B;  5AVB A;  5GXQ A;  1KX5 A;  5AY8 A;  3X1T A;  1Q9C A;  3WA9 C;  1P3I B;  3B6G B;  3AZE A;  4X23 A;  2Y2Q A;  2NZD B;  2Y2N A;  3H0R C;  4H9R A;  2CV5 B;  3W98 B;  3AV1 B;  3AZJ C;  1P3P A;  1F66 C;  5B33 B;  1PZR A;  1ID3 A;  3B0C T;  3REK D;  5B32 G;  3REK C;  2ZY5 A;  3X1S A;  2Y2I A;  3B6G D;  2JSS A;  1TZY B;  3X1V A;  4J8V D;  4J8V C;  1WWS A;  3B0D C;  3MNN B;  3AZM B;  5JRG A;  3AV1 D;  2NQB B;  5DNM A;  5B33 D;  5DNN B;  3UT9 B;  1M18 A;  3LJA B;  4Z66 A;  1BH9 A;  3AV2 B;  3REI D;  1AOI B;  3NQJ A;  3REI C;  1P3K D;  1P3K C;  4ZBJ C;  3AZM D;  3REH D;  3REH C;  4QLC D;  2L5A A;  4QLC C;  3VH5 W;  5CPJ A;  5CPI C;  5CPI D;  1P3M A;  4KGC D;  4KGC C;  5B40 B;  3LEL B;  3AZI B;  3MGP C;  1P3O A;  3B6F B;  2RVQ D;  2HIO B;  2RVQ C;  1P3I A;  3AZK A;  1S32 D;  3KUY B;  1S32 C;  1P34 C;  1P3G C;  2NZD A;  5CP6 B;  1JFI B;  5FUG B;  2PYO C;  3AZI D;  1P3F A;  1ZLA B;  4EO5 C;  3MVD D;  4KUD C;  3MVD C;  4R8P D;  4R8P C;  3A6N D;  3A6N C;  3MGR A;  3KUY D;  3KWQ D;  3KUY C;  3KWQ C;  3EPJ A;  1R4V A;  5CP6 D;  3EPK A;  5AV5 B;  3UTB A;  1B67 A;  2ZY3 A;  4H9P A;  4J8U B;  5B1M D;  5B1M C;  3AN2 A;  4H9S A;  3V9R A;  4DRA A;  3NQU A;  3UTA B;  4WU8 B;  5AV9 A;  2JE5 A;  5B0Y C;  2FJ7 B;  1H3O A;  3REL A;  2VQR A;  5GT0 B;  2F8N B;  5E5A C;  3C1B A;  5AV6 D;  4J8U D;  5AV6 C;  1M1A C;  3MGS D;  3MGS C;  3MGQ B;  4XUJ B;  3W97 B;  3FDD A;  2ZY2 A;  5B1L A;  3W96 A;  5GT0 D;  2RIQ A;  3AZG B;  2F8N D;  3AFA D;  3C1C B;  3AFA C;  4NFT A;  4ZUX B;  4XUJ D;  1HQ3 D;  3WAA A;  1HQ3 C;  4UPK A;  5B0Z B;  1WWI A;  5B2I A;  3TU4 A;  4YM6 A;  5B2J B;  1P3L D;  1P3L C;  5AVC A;  5JA4 A;  5B24 D;  3C1C D;  5AV5 A;  5B24 C;  1KX3 A;  5AV8 A;  2BYK B;  5B0Z D;  4WNN A;  5CPK B;  1P3A A;  3WKJ D;  3WKJ C;  5BNV B;  1BH8 B;  3KXB B;  5B2J D;  5GT3 A;  5BNX B;  5B32 D;  5F99 B;  5B32 C;  4JJN C;  3AZF D;  3AZF C;  3O62 D;  3O62 C;  1U35 C;  2DF4 C;  2Y2H A;  5B31 A;  3WTP B;  3AZL D;  3W99 B;  3AZL C;  3KXB D;  3LZ1 D;  1EQZ A;  3LZ1 C;  2Y2P A;  4J8X C;  2ARO A;  5AVB C;  3WA9 B;  4Z2M H;  5GXQ D;  3F6T A;  5GXQ C;  5BS7 A;  5AY8 D;  4H9N A;  3W99 D;  5AY8 C;  3X1T D;  3X1T C;  4ZUX A;  4J8W A;  5CHL B;  3AZJ B;  5BT1 D;  3AZE D;  5BT1 C;  4X23 D;  4X23 C;  3AZE C;  1KX4 A;  1F66 B;  3REK B;  3WA9 D;  3P5J B;  1P3P D;  1P3P C;  3KFU G;  1ID3 D;  3AZH A;  1ID3 C;  4J8V B;  3IP4 C;  3B0D B;  3X1S C;  3AZJ D;  4NE6 A;  4DRB A;  1F66 D;  3AZN A;  3X1V C;  5BNV A;  2Y2L A;  4CAY A;  5JRG D;  5JRG C;  3AYW A;  5DNM D;  5DNM C;  3REI B;  4KHA A;  4CSR A;  4Z66 D;  1M18 C;  4Z66 C;  1P3K B;  1P3B A;  4ZBJ B;  5G49 A;  5BO0 A;  2G5H C;  3REH B;  4QLC B;  4H9Q B;  5CPI B;  3VH6 T;  4KGC B;  3WTP E;  3MGP B;  1T3U A;  5CPJ D;  5CPJ C;  1P3M C;  4Z5T A;  4XZQ A;  3X1U A;  1P3O D;  1P3G B;  1P3O C;  1S32 B;  1P34 B;  5GSU A;  1TAF A;  4UUZ B;  3VH6 A;  2PYO B;  2BG1 A;  4YS3 D;  3AZK C;  4YS3 C;  3MGP D;  4LD9 D;  2XD1 A;  4EO5 B;  4KUD B;  3MVD B;  4LD9 C;  4R8P B;  3A6N B;  1P3F D;  1P3F C;  1P3G D;  3B6G A;  1P34 D;  3KWQ B;  2CV5 A;  2PYO D;  3W98 A;  3MGR D;  3MGR C;  3AV1 A;  5B33 A;  5B1M B;  4KUD D;  3UTB D;  3UTB C;  1M19 D;  1M19 C;  3R45 B;  1TZY A;  3AN2 D;  5B0Y B;  3AN2 C;  4H9S C;  3MNN A;  3AZM A;  2NQB A; 
#chains in the Genus database with same CATH homology
 5E5A B;  5DNN A;  5AV9 C;  5AV6 B;  3UT9 A;  3LJA A;  3REL D;  1M1A B;  3REL C;  3MGS B;  3AV2 A;  1AOI A;  1W2E A;  3C1B C;  5B0Y D;  2F8N H;  3B0C W;  3A1I A;  5E5A D;  5B1L D;  3AFA B;  3H0M C;  5B1L C;  1M1A D;  3W96 D;  3W96 C;  5B40 A;  1HQ3 B;  2W8S A;  3LEL A;  3AZI A;  4HGA C;  3B6F A;  3MVD A;  3EPH A;  2HIO A;  3H0L C;  3WAA C;  3LZ0 D;  4AWL C;  3LZ0 C;  3KUY A;  1P3L B;  5B2I D;  2YFV B;  5B2I C;  5CP6 A;  5FUG A;  5B24 B;  3TU4 C;  4YM6 D;  1JFI A;  2JCH A;  4YM6 C;  2CWE A;  2HUE B;  5AVC D;  1ZLA A;  5AVC C;  3EG5 B;  1KX3 C;  5AV8 D;  5AV8 C;  3WKJ B;  2UWX A;  4WJ3 C;  2BYM B;  4JJN B;  5B32 B;  4H9O B;  1P3A C;  2IO5 C;  4DQY B;  3AZF B;  3O62 B;  1U35 B;  3B0B A;  5GT3 D;  2HUE C;  5GT3 C;  4J8U A;  3AZL B;  4G91 C;  1N1J B;  2YFW B;  4NE3 A;  3LZ1 B;  3UTA A;  4J8X B;  4WU8 A;  4JJN D;  5B31 C;  2FJ7 A;  5AVB B;  1U35 D;  5GT0 A;  1EQZ C;  1EQZ D;  2F8N A;  5GXQ B;  2ARO D;  5AY8 B;  2ARO C;  4WU9 D;  3X1T B;  3MGQ A;  4WU9 C;  3W97 A;  4XUJ A;  3REJ C;  3REJ D;  4J8X D;  3AZE B;  4X23 B;  1A7W A;  4H9R B;  5AVB D;  4J8W C;  3AZG A;  1P3P B;  1KX4 D;  1KX4 C;  1ID3 B;  3C1C A;  1KX5 D;  1KX5 C;  3X1S B;  5B0Z A;  4WZS B;  3AZH C;  3VH5 T;  3X1V B;  3AL0 C;  5JRG B;  5B2J A;  5DNM B;  3AZN D;  3AZN C;  1M18 B;  4Z66 B;  1B6W A;  1BH9 B;  2BYK A;  3X1S D;  3AYW C;  3NQJ B;  5CPK A;  3VH5 A;  2LY8 A;  3X1V D;  1P3B D;  1BH8 A;  5B31 G;  3KXB A;  4G92 C;  1P3B C;  5BNX A;  5C3I C;  5F99 A;  1M18 D;  5CPJ B;  1P3M B;  1BFM A;  1P3O B;  3WTP A;  3W99 A;  4Z5T D;  4Z5T C;  4XZQ D;  4XZQ C;  3AZK B;  3X1U D;  4YS3 B;  3X1U C;  5GSU D;  5GSU C;  1Z2C B;  4LD9 B;  1P3M D;  3WA9 A;  2F8N K;  1P3F B;  2DQN C;  2ZM5 A;  1P3I D;  1P3I C;  3MGR B;  3AZK D;  3AZJ A;  3B6G C;  1F66 A;  2NZD D;  2NZD C;  2CV5 D;  2CV5 C;  3W98 D;  3REK A;  3UTB B;  3W98 C;  1M19 B;  3AV1 C;  2ZY4 A;  5B33 C;  4H9P B;  3AN2 B;  4J8V A;  3V9R B;  3NQU B;  4E45 A;  1TZY D;  1TZY C;  5AV9 B;  1H3O B;  3MNN D;  3REL B;  3MNN C;  3AZM C;  2NQB D;  2NQB C;  4M6B A;  3REI A;  2Y2M A;  5DNN D;  5DNN C;  3C1B B;  3UT9 D;  3LJA D;  3UT9 C;  3LJA C;  3AV2 D;  1P3K A;  2Y2J A;  3AV2 C;  1AOI D;  1AOI C;  4WV4 B;  3REH A;  4QLC A;  5AV9 D;  4H9Q A;  5CPI A;  5B1L B;  1ULY A;  3W96 B;  1HTA A;  4KGC A;  4YS3 A;  4Z2M G;  3MGP A;  3C1B D;  4HGA B;  4LD9 A;  5B40 D;  5B40 C;  3LEL D;  3WAA B;  3LEL C;  3AZI C;  4AWL B;  3LZ0 B;  1P3G A;  1KU5 A;  1S32 A;  1P34 A;  2F2A C;  3B6F C;  3B6F D;  5B2I B;  3TU4 B;  2HIO D;  2HIO C;  4UUZ A;  2PYO A;  4YM6 B;  5AVC B;  5JA4 B;  5CP6 C;  4KUD A;  1KX3 B;  2G5I C;  5AV8 B;  1M19 A;  3VH6 W;  4R8P A;  3WAA D;  3A6N A;  4WNN B;  1ZLA D;  1ZLA C;  3KWQ A;  1P3A B;  3TU4 D;  2IO5 B;  5GT3 B;  5KDM B;  5B1M A;  5AV5 D;  5AV5 C;  1KX3 D;  4G91 B;  3R45 A;  1P3A D;  4J8U C;  5B31 B;  5B0Y A;  2Y2G A;  3A1K A;  1EQZ B;  3UTA D;  3UTA C;  4WU8 D;  4WU8 C;  3KSY A;  5E5A A;  2FJ7 D;  5AV6 A;  2FJ7 C;  2J8P A;  4NE5 A;  2ARO B;  4WU9 B;  1M1A A;  3MGS A;  5GT0 C;  3REJ B;  2XD5 A;  5B31 D;  3EPL A;  4H9N B;  3MGQ D;  3MGQ C;  3W97 D;  4XUJ C;  4J8W B;  3W97 C;  3LZ0 A;  1KX4 B;  3AFA A;  1KX5 B;  2Y2O A;  3AZG D;  1HQ3 A;  3AZG C;  5BS7 C;  3C1C C;  3AZH B;  4ZUX D;  4ZUX C;  4J8W D;  5B0Z C;  1F1E A;  1P3L A;  3AZN B;  2YFV A;  5B24 A;  4CAY B;  3AYW B;  5B2J C;  5KDM A;  4KHA B;  4CSR B;  3AZH D;  3WKJ A;  4G92 B;  1P3B B;  5G49 B;  5BO0 B;  2BYM A;  5C3I B;  5CPK D;  5CPK C;  4JJN A;  5B32 A;  4H9O A;  4E44 A;  3AZF A;  3O62 A;  3KXB C;  3AYW D;  1U35 A;  5F99 D;  5F99 C;  4WU9 A;  3AZL A;  2F8N G;  1N1J A;  3REJ A;  2YFW A;  4Z5T B;  3LZ1 A;  4XZQ B;  4J8X A;  3X1U B;  2FFF B;  2Y2K A;  3WTP D;  3WTP C;  5GSU B;  3W99 C;  1TAF B;  5AVB A;  5GXQ A;  1KX5 A;  5AY8 A;  3X1T A;  1Q9C A;  3WA9 C;  1P3I B;  3B6G B;  3AZE A;  4X23 A;  2Y2Q A;  2NZD B;  2Y2N A;  3H0R C;  4H9R A;  2CV5 B;  3W98 B;  3AV1 B;  3AZJ C;  1P3P A;  1F66 C;  5B33 B;  1PZR A;  1ID3 A;  3B0C T;  3REK D;  5B32 G;  3REK C;  2ZY5 A;  3X1S A;  2Y2I A;  3B6G D;  2JSS A;  1TZY B;  3X1V A;  4J8V D;  4J8V C;  1WWS A;  3B0D C;  3MNN B;  3AZM B;  5JRG A;  3AV1 D;  2NQB B;  5DNM A;  5B33 D;  5DNN B;  3UT9 B;  1M18 A;  3LJA B;  4Z66 A;  1BH9 A;  3AV2 B;  3REI D;  1AOI B;  3NQJ A;  3REI C;  1P3K D;  1P3K C;  4ZBJ C;  3AZM D;  3REH D;  3REH C;  4QLC D;  2L5A A;  4QLC C;  3VH5 W;  5CPJ A;  5CPI C;  5CPI D;  1P3M A;  4KGC D;  4KGC C;  5B40 B;  3LEL B;  3AZI B;  3MGP C;  1P3O A;  3B6F B;  2RVQ D;  2HIO B;  2RVQ C;  1P3I A;  3AZK A;  1S32 D;  3KUY B;  1S32 C;  1P34 C;  1P3G C;  2NZD A;  5CP6 B;  1JFI B;  5FUG B;  2PYO C;  3AZI D;  1P3F A;  1ZLA B;  4EO5 C;  3MVD D;  4KUD C;  3MVD C;  4R8P D;  4R8P C;  3A6N D;  3A6N C;  3MGR A;  3KUY D;  3KWQ D;  3KUY C;  3KWQ C;  3EPJ A;  1R4V A;  5CP6 D;  3EPK A;  5AV5 B;  3UTB A;  1B67 A;  2ZY3 A;  4H9P A;  4J8U B;  5B1M D;  5B1M C;  3AN2 A;  4H9S A;  3V9R A;  4DRA A;  3NQU A;  3UTA B;  4WU8 B;  5AV9 A;  2JE5 A;  5B0Y C;  2FJ7 B;  1H3O A;  3REL A;  2VQR A;  5GT0 B;  2F8N B;  5E5A C;  3C1B A;  5AV6 D;  4J8U D;  5AV6 C;  1M1A C;  3MGS D;  3MGS C;  3MGQ B;  4XUJ B;  3W97 B;  3FDD A;  2ZY2 A;  5B1L A;  3W96 A;  5GT0 D;  2RIQ A;  3AZG B;  2F8N D;  3AFA D;  3C1C B;  3AFA C;  4NFT A;  4ZUX B;  4XUJ D;  1HQ3 D;  3WAA A;  1HQ3 C;  4UPK A;  5B0Z B;  1WWI A;  5B2I A;  3TU4 A;  4YM6 A;  5B2J B;  1P3L D;  1P3L C;  5AVC A;  5JA4 A;  5B24 D;  3C1C D;  5AV5 A;  5B24 C;  1KX3 A;  5AV8 A;  2BYK B;  5B0Z D;  4WNN A;  5CPK B;  1P3A A;  3WKJ D;  3WKJ C;  5BNV B;  1BH8 B;  3KXB B;  5B2J D;  5GT3 A;  5BNX B;  5B32 D;  5F99 B;  5B32 C;  4JJN C;  3AZF D;  3AZF C;  3O62 D;  3O62 C;  1U35 C;  2DF4 C;  2Y2H A;  5B31 A;  3WTP B;  3AZL D;  3W99 B;  3AZL C;  3KXB D;  3LZ1 D;  1EQZ A;  3LZ1 C;  2Y2P A;  4J8X C;  2ARO A;  5AVB C;  3WA9 B;  4Z2M H;  5GXQ D;  3F6T A;  5GXQ C;  5BS7 A;  5AY8 D;  4H9N A;  3W99 D;  5AY8 C;  3X1T D;  3X1T C;  4ZUX A;  4J8W A;  5CHL B;  3AZJ B;  5BT1 D;  3AZE D;  5BT1 C;  4X23 D;  4X23 C;  3AZE C;  1KX4 A;  1F66 B;  3REK B;  3WA9 D;  3P5J B;  1P3P D;  1P3P C;  3KFU G;  1ID3 D;  3AZH A;  1ID3 C;  4J8V B;  3IP4 C;  3B0D B;  3X1S C;  3AZJ D;  4NE6 A;  4DRB A;  1F66 D;  3AZN A;  3X1V C;  5BNV A;  2Y2L A;  4CAY A;  5JRG D;  5JRG C;  3AYW A;  5DNM D;  5DNM C;  3REI B;  4KHA A;  4CSR A;  4Z66 D;  1M18 C;  4Z66 C;  1P3K B;  1P3B A;  4ZBJ B;  5G49 A;  5BO0 A;  2G5H C;  3REH B;  4QLC B;  4H9Q B;  5CPI B;  3VH6 T;  4KGC B;  3WTP E;  3MGP B;  1T3U A;  5CPJ D;  5CPJ C;  1P3M C;  4Z5T A;  4XZQ A;  3X1U A;  1P3O D;  1P3G B;  1P3O C;  1S32 B;  1P34 B;  5GSU A;  1TAF A;  4UUZ B;  3VH6 A;  2PYO B;  2BG1 A;  4YS3 D;  3AZK C;  4YS3 C;  3MGP D;  4LD9 D;  2XD1 A;  4EO5 B;  4KUD B;  3MVD B;  4LD9 C;  4R8P B;  3A6N B;  1P3F D;  1P3F C;  1P3G D;  3B6G A;  1P34 D;  3KWQ B;  2CV5 A;  2PYO D;  3W98 A;  3MGR D;  3MGR C;  3AV1 A;  5B33 A;  5B1M B;  4KUD D;  3UTB D;  3UTB C;  1M19 D;  1M19 C;  3R45 B;  1TZY A;  3AN2 D;  5B0Y B;  3AN2 C;  4H9S C;  3MNN A;  3AZM A;  2NQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...