1KX4C

X-ray structure of the nucleosome core particle, ncp146b, at 2.6 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx4C00
3C1BD 2FJ7D 1P3GA 1P3MA 1P3OA 5E5AC 3REJC 4KGCC 5AY8C 3AZIB 1HTAA 4CAYB 1EQZA 3LZ0C 1P3PD 3MGRC 2RVQC 1JFIB 5F99B 3C1CD 2AROC 5AV9C 4ZUXD 2L5AA 3X1VB 1M18C 1HQ3D 5B32D 5AV8C 1P3AA 3WKJC 5DNMD 4HGAB 2YFWB 4NFTA 4YM6B 4X23A 3RELA 3W98D 4E44A 5B40C 3AZJD 4QLCD 5JRGC 1N1JB 1ID3B 3NQUA 3W97A 3MVDD 2F8NH 3REIC 1S32B 3B6GD 5CPKB 1P34D 3LJAD 5AV5D 3UT9A 1KX3D 2BYMB 5E5AB 3NQJA 3REJB 4KGCB 5AY8B 3B6FA 3LZ0B 3AZND 4DRBA 3MGRB 4H9QA 2AROB 2LY8A 5GXQA 4XZQC 3A6NC 1M18B 1B6WA 5BT1D 3WKJB 3WA9D 4WU8A 5AVBA 4CSRA 5B40B 5JRGB 1P3GD 3AYWC 1P3MD 1P3OD 1KX5C 3REIB 3LELA 3AFAD 1U35A 3MGQA 1M1AC 3AN2A 1P3LA 4KUDA 1P3AD 5DNNA 3W99C 3AZHA 3KUYC 5GT0A 5B0YC 2NZDA 4XZQB 4X23D 3A6NB 3X1TC 4H9RA 3TU4C 3W97D 5B1MC 5AVCA 4G92C 2HIOC 3AYWB 1KX5B 4YS3A 5CPJA 3V9RB 4H9PB 3B6FD 1M1AB 3WAAC 5B31G 3UTAA 3WTPC 4KHAB 5BS7C 4Z5TC 3REHC 3B0CW 5GXQD 2YFVA 4G91C 5BNVA 3W99B 5B24C 3KUYB 5GT3A 5B0YB 4JJNC 3X1UC 4WU8D 5AVBD 4LD9D 3X1TB 3AZFC 3W96D 3TU4B 1M19A 1A7WA 5B1MB 5B32G 3MGSA 1U35D 3AZMC 5B2IA 3MGQD 4G92B 2HIOB 3REKC 2F8NA 3AN2D 3WAAB 5DNND 3AV1C 3WTPB 4H9OB 4Z5TB 5CP6A 3REHB 3AZHD 5B2JD 1R4VA 5GT0D 3C1BC 2NZDD 4G91B 3AV2C 4NE3A 4J8WA 3X1SA 5B24B 3MNNA 5CPIC 3X1UB 4JJNB 3C1CC 3AZFB 4M6BA 1HQ3C 5CPJD 4J8VA 1P3FC 1ZLAA 3MGPC 5DNMC 3AZMB 1WWSA 3UTAD 2F8NK 3X1VC 3REKB 3AZLC 5BO0B 3AZJC 3MVDC 5B31B 3AV1B 4HGAC 4R8PA 3AZIA 3UTBC 4CAYA 4NE5A 5GT3D 1JFIA 3C1BB 5AV5C 5B33C 3AV2B 1KU5A 4J8XC 1M19D 5CPIB 1KX4C 5JA4B 1P3PB 3MGSD 2YFWA 2PYOD 3B0DC 3C1CB 5B2ID 5B1LA 3B0BA 5B0ZD 1HQ3B 5G49A 1P3FB 1ULYA 1N1JA 3MGPB 1ID3A 2F8ND 5DNMB 3WA9C 1S32A 4WU9A 5CHLB 5CPKA 4H9NB 3AZLB 5CP6D 3WTPE 3KWQC 3AZJB 2BYMA 5E5AA 3MVDB 3REJA 4KGCA 4J8WD 5AY8A 3UTBB 3X1SD 3LZ0A 3AFAC 3MGRA 3MNND 2AROA 5AV5B 5B33B 5AV9A 3AZGC 5FUGB 3AZKD 4J8XB 1M18A 5AV8A 3WKJA 1KX4B 4J8VD 1ZLAD 3B0DB 5B40A 5JRGA 3WA9B 2HUEC 3W97C 1TAFA 1P3IA 4R8PD 3AZID 3KWQB 3KXBC 4DRAA 1BFMA 1P3OB 1P3KD 3AFAB 2CV5A 4Z2MG 3AZGB 3VH6W 2NQBC 4XZQA 3A6NA 5B1LD 3O62C 1P3AB 1ID3D 1EQZD 4NE6A 4EO5C 1S32D 4WU9D 5CPKD 4WU8C 4LD9C 3W96C 1KX5A 5E5AD 2HUEB 3NQUB 3AZEC 3REJD 3W97B 1AOIC 5AY8D 4H9PA 3V9RA 1M1AA 3RELD 3KXBB 1U35C 3MGRD 2RVQD 4KHAA 1BH9A 2AROD 5AV9D 1P3BC 1M18D 5AV8D 4XUJC 3AN2C 3WKJD 3W99A 4H9QB 5B0YA 3KUYA 3UT9D 1F66C 2NQBB 5AV6C 3X1TA 5GXQB 5GT0C 5B2JC 5B40D 3O62B 4Z66C 5GSUC 5JRGD 3LZ1A 4H9SC 4EO5B 5B1MA 1H3OB 1TZYC 1P3ID 4WU8B 4LD9B 2HIOA 3W96B 1BH8B 3AZEB 1AOIB 2F8NG 1Q9CA 1U35B 2CV5D 3WAAA 3WTPA 4H9OA 3KSYA 4Z5TA 5BS7A 3REHA 1P3BB 3A6ND 3LELD 4XUJB 3AN2B 5B24A 5DNNB 4JJNA 1F66B 3X1UA 5AV6B 5GT0B 5GT3C 5B2JB 3AZFA 4Z66B 5GSUB 3B0CT 1P3LD 4KUDD 4ZBJC 4J8UC 1KX5D 5B31C 1TZYB 3AZMA 2FJ7C 2PYOC 3REKA 5B0ZC 5BO0A 5CPJB 1P3PC 3AV1A 5AVCD 4ZUXC 3KUYD 5B0YD 3R45B 5B32C 4YS3D 3AV2A 2YFVB 3LZ1D 4WNNB 5CPIA 5B1MD 5JA4A 1F1EA 4UUZB 5GT3B 3W98C 4QLCC 2HIOD 4ZBJB 4J8UB 3AZKC 1HQ3A 2CWEA 1P3FA 3B6GC 3MGPA 1P34C 3LJAC 5KDMB 5F99A 2FJ7B 3MGSB 2PYOB 3WAAD 4H9NA 3AZLA 3X1VA 4AWLC 5B0ZB 1KX3C 4Z5TD 3REHD 3AZJA 3AZNC 5BNXB 3VH6A 5B24D 4YM6A 3UTBA 4ZUXB 4R8PC 4JJND 3X1UD 5CP6B 5AV5A 5B33A 5B32B 5BT1C 5FUGA 4J8XA 1P3KC 1KX4A 3VH5W 3MNNB 3W98B 3AZMD 2BYKB 4WZSB 5C3IC 4QLCB 1P3GC 3AZKB 1P3MC 1P3OC 3REKD 5B1LC 3B6GB 1P34B 3LJAB 3WA9A 1EQZC 3AV1D 1KX3B 4AWLB 3KWQA 3AV2D 1P3AC 3AZNB 3AFAA 4R8PB 5CPID 4X23C 3RELC 3AZGA 3VH5T 1B67A 3REIA 1P3KB 1P3FD 3MGPD 5F99D 5C3IB 1P3GB 3UT9C 1P3MB 3AZLD 3X1VD 5B1LB 5G49B 3B6FC 1EQZB 4WU9B 3UTBD 4YM6D 1P3IC 3KXBA 5GXQC 5B33D 4E45A 4J8XD 1KX4D 4X23B 5AVBC 3RELB 2CV5C 3AYWA 2NQBA 5AV9B 3O62A 4KGCD 5AV8B 3LELC 3LZ0D 1H3OA 3MGQC 3UT9B 4LD9A 3VH6T 3KWQD 3NQJB 3W96A 1P3LC 3B6FB 1BH8A 3AZEA 4KUDC 1AOIA 5DNNC 1TAFB 1P3IB 3AZHC 2NZDC 4WV4B 3AZGD 3TU4A 1P3BA 3REID 4XUJA 2JSSA 5AVBB 2CV5B 1F66A 4CSRB 5AVCC 5AV6A 5B2JA 4Z66A 5GSUA 4YS3C 3LELB 5CPJC 4H9SA 3LZ1C 3MGQB 1TZYA 3UTAC 4XZQD 3KXBD 1P3LB 4KUDB 2IO5C 3AZHB 2NZDB 1WWIA 4H9RB 3R45A 3AYWD 1BH9B 2NQBD 3O62D 1M19C 3VH5A 4WNNA 3MGSC 1M1AD 5AVCB 5B2IC 4UUZA 4YS3B 4J8UA 5B31A 3LZ1B 3W99D 3AZED 3UTAB 1AOID 5KDMA 3C1BA 2FJ7A 5CP6C 2PYOA 3X1TD 5B0ZA 5BNVB 3TU4D 4J8WC 1P3BD 3X1SC 2IO5B 4XUJD 1P3PA 3MNNC 5BNXA 3C1CA 4ZUXA 1F66D 5AV6D 5B32A 1M19B 4Z66D 5GSUD 5DNMA 4J8VC 1ZLAC 5B2IB 3WTPD 1TZYD 3W98A 2BYKA 4QLCA 2F8NB 3AZKA 3MVDA 4Z2MH 3B6GA 1P34A 3LJAA 3AZIC 5F99C 1KX3A 3AZFD 4J8WB 3X1SB 3AZNA 4YM6C 4J8VB 1ID3C 1ZLAB 4J8UD 5B31D 1P3KA 1S32C 4WU9C 5CPKC
chains in the Genus database with same CATH superfamily
3C1BD 2FJ7D 1P3GA 1P3MA 1P3OA 5E5AC 3REJC 4KGCC 5AY8C 3AZIB 1HTAA 4CAYB 1EQZA 3LZ0C 1P3PD 3MGRC 2RVQC 1JFIB 5F99B 3C1CD 2AROC 5AV9C 4ZUXD 2L5AA 3X1VB 1M18C 1HQ3D 5B32D 5AV8C 1P3AA 3WKJC 5DNMD 4HGAB 2YFWB 4NFTA 4YM6B 4X23A 3RELA 3W98D 2Y2PA 4E44A 5B40C 2RIQA 3AZJD 4QLCD 5JRGC 1N1JB 1ID3B 3NQUA 3W97A 3MVDD 2F8NH 3REIC 1S32B 3B6GD 5CPKB 1P34D 3LJAD 1W2EA 5AV5D 3UT9A 1KX3D 2BYMB 5E5AB 2JCHA 3NQJA 3REJB 4KGCB 5AY8B 3B6FA 3LZ0B 3AZND 4DRBA 3MGRB 4H9QA 3AL0C 2AROB 2LY8A 1Z2CB 5GXQA 3IP4C 4XZQC 3A6NC 1M18B 1B6WA 5BT1D 3WKJB 3WA9D 4WU8A 5AVBA 4CSRA 5B40B 5JRGB 1P3GD 3AYWC 1P3MD 1P3OD 1KX5C 3REIB 3LELA 3AFAD 1U35A 3MGQA 1M1AC 2Y2GA 2VQRA 3AN2A 1P3LA 2BG1A 4KUDA 1P3AD 5DNNA 3W99C 3EPKA 3AZHA 3KUYC 5GT0A 5B0YC 2NZDA 4XZQB 4X23D 3A6NB 3X1TC 4H9RA 3TU4C 3W97D 5B1MC 4DQYB 5AVCA 4G92C 2HIOC 3AYWB 2W8SA 1KX5B 4YS3A 5CPJA 3P5JB 3V9RB 4H9PB 3B6FD 1M1AB 3WAAC 5B31G 3UTAA 3WTPC 4KHAB 5BS7C 4Z5TC 3REHC 3B0CW 5GXQD 2ZY4A 2YFVA 4G91C 5BNVA 3W99B 2G5HC 5B24C 3KUYB 5GT3A 5B0YB 4JJNC 3X1UC 4WU8D 5AVBD 4LD9D 3X1TB 3AZFC 3W96D 3TU4B 1M19A 1A7WA 5B1MB 5B32G 3MGSA 1U35D 2Y2OA 3AZMC 5B2IA 3MGQD 4G92B 2HIOB 3REKC 2F8NA 4UPKA 3AN2D 3WAAB 5DNND 3AV1C 3WTPB 4H9OB 4Z5TB 5CP6A 3REHB 3AZHD 5B2JD 1R4VA 5GT0D 3C1BC 2NZDD 4G91B 3AV2C 4NE3A 3F6TA 4J8WA 3X1SA 5B24B 3MNNA 5CPIC 3X1UB 4JJNB 3C1CC 3AZFB 2ZY5A 4M6BA 1HQ3C 5CPJD 4J8VA 1P3FC 1ZLAA 3MGPC 2F2AC 5DNMC 3AZMB 1WWSA 3UTAD 2F8NK 3X1VC 3REKB 3AZLC 5BO0B 3AZJC 3MVDC 5B31B 3AV1B 4HGAC 4R8PA 3AZIA 3UTBC 4CAYA 4NE5A 5GT3D 1JFIA 3C1BB 5AV5C 5B33C 3AV2B 1KU5A 4J8XC 1M19D 5CPIB 1KX4C 5JA4B 1P3PB 3MGSD 2YFWA 2PYOD 3B0DC 3C1CB 5B2ID 5B1LA 3B0BA 5B0ZD 1HQ3B 5G49A 1P3FB 1ULYA 1N1JA 3MGPB 2Y2HA 2DQNC 1ID3A 2F8ND 5DNMB 3WA9C 1S32A 4WU9A 5CHLB 5CPKA 4H9NB 3AZLB 5CP6D 3WTPE 3KWQC 3AZJB 2BYMA 5E5AA 3MVDB 3REJA 4KGCA 4J8WD 5AY8A 3UTBB 3X1SD 3LZ0A 3AFAC 3MGRA 3MNND 2AROA 5AV5B 5B33B 5AV9A 3AZGC 5FUGB 3AZKD 4J8XB 1M18A 5AV8A 3WKJA 1KX4B 4J8VD 1ZLAD 3B0DB 5B40A 5JRGA 3WA9B 2HUEC 3W97C 1TAFA 1P3IA 4R8PD 3AZID 3KWQB 3KXBC 4DRAA 1PZRA 1BFMA 1P3OB 2Y2QA 1P3KD 3AFAB 2CV5A 4Z2MG 3AZGB 3VH6W 2NQBC 4XZQA 3A6NA 5B1LD 3O62C 3EPLA 1P3AB 1ID3D 1EQZD 4NE6A 4EO5C 1S32D 4WU9D 5CPKD 4WU8C 4LD9C 3W96C 1KX5A 5E5AD 2HUEB 3NQUB 3AZEC 3REJD 3W97B 1AOIC 5AY8D 4H9PA 3V9RA 1T3UA 3RELD 3KXBB 1U35C 3MGRD 2RVQD 3A1IA 1M1AA 4KHAA 1BH9A 2AROD 5AV9D 1P3BC 1M18D 2Y2KA 5AV8D 4XUJC 3AN2C 3WKJD 3W99A 4H9QB 5B0YA 3KUYA 3UT9D 1F66C 2NQBB 5AV6C 3X1TA 5GXQB 5GT0C 5B2JC 5B40D 3O62B 4Z66C 5GSUC 5JRGD 3LZ1A 4H9SC 4EO5B 5B1MA 1H3OB 1TZYC 1P3ID 3EG5B 4WU8B 4LD9B 2HIOA 3W96B 1BH8B 3AZEB 1AOIB 3H0LC 2F8NG 1Q9CA 1U35B 2CV5D 3WAAA 3WTPA 4H9OA 3KSYA 2ZY3A 4Z5TA 5BS7A 3REHA 1P3BB 3A6ND 3A1KA 3LELD 4XUJB 3AN2B 5B24A 5DNNB 4JJNA 1F66B 3X1UA 5AV6B 5GT0B 5GT3C 5B2JB 3AZFA 4Z66B 5GSUB 3B0CT 1P3LD 4KUDD 4ZBJC 4J8UC 1KX5D 5B31C 1TZYB 3AZMA 2FJ7C 2PYOC 3REKA 5B0ZC 5BO0A 5CPJB 1P3PC 3AV1A 5AVCD 4ZUXC 3KUYD 5B0YD 3R45B 5B32C 4YS3D 3AV2A 2YFVB 2XD1A 3LZ1D 4WNNB 5CPIA 5B1MD 5JA4A 1F1EA 4UUZB 2UWXA 5GT3B 3W98C 3H0RC 4QLCC 2HIOD 4ZBJB 4J8UB 3AZKC 1HQ3A 2CWEA 1P3FA 3B6GC 3MGPA 1P34C 3LJAC 5KDMB 5F99A 2FJ7B 3MGSB 2PYOB 2DF4C 3WAAD 4H9NA 3AZLA 3X1VA 4AWLC 5B0ZB 1KX3C 4Z5TD 3REHD 3AZJA 3AZNC 5BNXB 3VH6A 5B24D 4YM6A 3UTBA 4ZUXB 4R8PC 4JJND 3X1UD 5CP6B 5AV5A 3KFUG 5B33A 5B32B 5BT1C 5FUGA 2ZY2A 4J8XA 1P3KC 1KX4A 3VH5W 3MNNB 3W98B 3AZMD 2BYKB 4WZSB 5C3IC 4QLCB 1P3GC 3AZKB 1P3MC 1P3OC 3REKD 5B1LC 3B6GB 1P34B 3LJAB 3WA9A 1EQZC 3AV1D 1KX3B 4AWLB 3KWQA 3AV2D 1P3AC 3AZNB 2JE5A 3AFAA 4R8PB 5CPID 4X23C 3RELC 3AZGA 3VH5T 1B67A 3REIA 2ZM5A 1P3KB 1P3FD 3MGPD 3EPJA 5F99D 5C3IB 1P3GB 3UT9C 1P3MB 3AZLD 3X1VD 5B1LB 3FDDA 5G49B 3B6FC 1EQZB 4WU9B 3UTBD 4YM6D 1P3IC 3KXBA 5GXQC 5B33D 4E45A 4J8XD 2FFFB 1KX4D 4X23B 5AVBC 3RELB 2CV5C 3AYWA 2NQBA 5AV9B 3O62A 3H0MC 4KGCD 5AV8B 3LELC 4WJ3C 3LZ0D 1H3OA 3MGQC 3UT9B 4LD9A 3VH6T 3KWQD 3NQJB 3W96A 1P3LC 3B6FB 1BH8A 3AZEA 4KUDC 1AOIA 5DNNC 1TAFB 1P3IB 3AZHC 2NZDC 4WV4B 3AZGD 3TU4A 1P3BA 3REID 4XUJA 2JSSA 5AVBB 2CV5B 2G5IC 1F66A 4CSRB 5AVCC 5AV6A 5B2JA 4Z66A 5GSUA 4YS3C 3LELB 5CPJC 4H9SA 3LZ1C 3MGQB 1TZYA 3UTAC 4XZQD 3KXBD 2Y2LA 1P3LB 4KUDB 2IO5C 3AZHB 2NZDB 1WWIA 2XD5A 4H9RB 3R45A 3AYWD 1BH9B 2NQBD 3O62D 1M19C 3VH5A 4WNNA 3MGSC 1M1AD 5AVCB 5B2IC 4UUZA 4YS3B 4J8UA 5B31A 3LZ1B 3W99D 3AZED 3UTAB 1AOID 2Y2JA 5KDMA 3C1BA 2FJ7A 5CP6C 2PYOA 3X1TD 5B0ZA 5BNVB 3TU4D 4J8WC 1P3BD 3X1SC 2IO5B 4XUJD 1P3PA 3MNNC 5BNXA 3C1CA 4ZUXA 1F66D 3EPHA 5AV6D 5B32A 1M19B 4Z66D 5GSUD 5DNMA 4J8VC 1ZLAC 5B2IB 3WTPD 1TZYD 3W98A 2BYKA 4QLCA 2F8NB 3AZKA 3MVDA 4Z2MH 3B6GA 1P34A 3LJAA 3AZIC 2Y2NA 5F99C 3AZFD 1KX3A 2J8PA 4J8WB 3X1SB 3AZNA 2Y2MA 4YM6C 2Y2IA 4J8VB 1ID3C 1ZLAB 4J8UD 5B31D 1P3KA 1S32C 4WU9C 5CPKC
chains in the Genus database with same CATH topology
3C1BD 2FJ7D 1P3GA 1P3MA 1P3OA 5E5AC 3REJC 4KGCC 5AY8C 3AZIB 1HTAA 4CAYB 1EQZA 3LZ0C 1P3PD 3MGRC 2RVQC 1JFIB 5F99B 3C1CD 2AROC 5AV9C 4ZUXD 2L5AA 3X1VB 1M18C 1HQ3D 5B32D 5AV8C 1P3AA 3WKJC 5DNMD 4HGAB 2YFWB 4NFTA 4YM6B 4X23A 3RELA 3W98D 2Y2PA 4E44A 5B40C 2RIQA 3AZJD 4QLCD 5JRGC 1N1JB 1ID3B 3NQUA 3W97A 3MVDD 2F8NH 3REIC 1S32B 3B6GD 5CPKB 1P34D 3LJAD 1W2EA 5AV5D 3UT9A 1KX3D 2BYMB 5E5AB 2JCHA 3NQJA 3REJB 4KGCB 5AY8B 3B6FA 3LZ0B 3AZND 4DRBA 3MGRB 4H9QA 3AL0C 2AROB 2LY8A 1Z2CB 5GXQA 3IP4C 4XZQC 3A6NC 1M18B 1B6WA 5BT1D 3WKJB 3WA9D 4WU8A 5AVBA 4CSRA 5B40B 5JRGB 1P3GD 3AYWC 1P3MD 1P3OD 1KX5C 3REIB 3LELA 3AFAD 1U35A 3MGQA 1M1AC 2Y2GA 2VQRA 3AN2A 1P3LA 2BG1A 4KUDA 1P3AD 5DNNA 3W99C 3EPKA 3AZHA 3KUYC 5GT0A 5B0YC 2NZDA 4XZQB 4X23D 3A6NB 3X1TC 4H9RA 3TU4C 3W97D 5B1MC 4DQYB 5AVCA 4G92C 2HIOC 3AYWB 2W8SA 1KX5B 4YS3A 5CPJA 3P5JB 3V9RB 4H9PB 3B6FD 1M1AB 3WAAC 5B31G 3UTAA 3WTPC 4KHAB 5BS7C 4Z5TC 3REHC 3B0CW 5GXQD 2ZY4A 2YFVA 4G91C 5BNVA 3W99B 2G5HC 5B24C 3KUYB 5GT3A 5B0YB 4JJNC 3X1UC 4WU8D 5AVBD 4LD9D 3X1TB 3AZFC 3W96D 3TU4B 1M19A 1A7WA 5B1MB 5B32G 3MGSA 1U35D 2Y2OA 3AZMC 5B2IA 3MGQD 4G92B 2HIOB 3REKC 2F8NA 4UPKA 3AN2D 3WAAB 5DNND 3AV1C 3WTPB 4H9OB 4Z5TB 5CP6A 3REHB 3AZHD 5B2JD 1R4VA 5GT0D 3C1BC 2NZDD 4G91B 3AV2C 4NE3A 3F6TA 4J8WA 3X1SA 5B24B 3MNNA 5CPIC 3X1UB 4JJNB 3C1CC 3AZFB 2ZY5A 4M6BA 1HQ3C 5CPJD 4J8VA 1P3FC 1ZLAA 3MGPC 2F2AC 5DNMC 3AZMB 1WWSA 3UTAD 2F8NK 3X1VC 3REKB 3AZLC 5BO0B 3AZJC 3MVDC 5B31B 3AV1B 4HGAC 4R8PA 3AZIA 3UTBC 4CAYA 4NE5A 5GT3D 1JFIA 3C1BB 5AV5C 5B33C 3AV2B 1KU5A 4J8XC 1M19D 5CPIB 1KX4C 5JA4B 1P3PB 3MGSD 2YFWA 2PYOD 3B0DC 3C1CB 5B2ID 5B1LA 3B0BA 5B0ZD 1HQ3B 5G49A 1P3FB 1ULYA 1N1JA 3MGPB 2Y2HA 2DQNC 1ID3A 2F8ND 5DNMB 3WA9C 1S32A 4WU9A 5CHLB 5CPKA 4H9NB 3AZLB 5CP6D 3WTPE 3KWQC 3AZJB 2BYMA 5E5AA 3MVDB 3REJA 4KGCA 4J8WD 5AY8A 3UTBB 3X1SD 3LZ0A 3AFAC 3MGRA 3MNND 2AROA 5AV5B 5B33B 5AV9A 3AZGC 5FUGB 3AZKD 4J8XB 1M18A 5AV8A 3WKJA 1KX4B 4J8VD 1ZLAD 3B0DB 5B40A 5JRGA 3WA9B 2HUEC 3W97C 1TAFA 1P3IA 4R8PD 3AZID 3KWQB 3KXBC 4DRAA 1PZRA 1BFMA 1P3OB 2Y2QA 1P3KD 3AFAB 2CV5A 4Z2MG 3AZGB 3VH6W 2NQBC 4XZQA 3A6NA 5B1LD 3O62C 3EPLA 1P3AB 1ID3D 1EQZD 4NE6A 4EO5C 1S32D 4WU9D 5CPKD 4WU8C 4LD9C 3W96C 1KX5A 5E5AD 2HUEB 3NQUB 3AZEC 3REJD 3W97B 1AOIC 5AY8D 4H9PA 3V9RA 1T3UA 3RELD 3KXBB 1U35C 3MGRD 2RVQD 3A1IA 1M1AA 4KHAA 1BH9A 2AROD 5AV9D 1P3BC 1M18D 2Y2KA 5AV8D 4XUJC 3AN2C 3WKJD 3W99A 4H9QB 5B0YA 3KUYA 3UT9D 1F66C 2NQBB 5AV6C 3X1TA 5GXQB 5GT0C 5B2JC 5B40D 3O62B 4Z66C 5GSUC 5JRGD 3LZ1A 4H9SC 4EO5B 5B1MA 1H3OB 1TZYC 1P3ID 3EG5B 4WU8B 4LD9B 2HIOA 3W96B 1BH8B 3AZEB 1AOIB 3H0LC 2F8NG 1Q9CA 1U35B 2CV5D 3WAAA 3WTPA 4H9OA 3KSYA 2ZY3A 4Z5TA 5BS7A 3REHA 1P3BB 3A6ND 3A1KA 3LELD 4XUJB 3AN2B 5B24A 5DNNB 4JJNA 1F66B 3X1UA 5AV6B 5GT0B 5GT3C 5B2JB 3AZFA 4Z66B 5GSUB 3B0CT 1P3LD 4KUDD 4ZBJC 4J8UC 1KX5D 5B31C 1TZYB 3AZMA 2FJ7C 2PYOC 3REKA 5B0ZC 5BO0A 5CPJB 1P3PC 3AV1A 5AVCD 4ZUXC 3KUYD 5B0YD 3R45B 5B32C 4YS3D 3AV2A 2YFVB 2XD1A 3LZ1D 4WNNB 5CPIA 5B1MD 5JA4A 1F1EA 4UUZB 2UWXA 5GT3B 3W98C 3H0RC 4QLCC 2HIOD 4ZBJB 4J8UB 3AZKC 1HQ3A 2CWEA 1P3FA 3B6GC 3MGPA 1P34C 3LJAC 5KDMB 5F99A 2FJ7B 3MGSB 2PYOB 2DF4C 3WAAD 4H9NA 3AZLA 3X1VA 4AWLC 5B0ZB 1KX3C 4Z5TD 3REHD 3AZJA 3AZNC 5BNXB 3VH6A 5B24D 4YM6A 3UTBA 4ZUXB 4R8PC 4JJND 3X1UD 5CP6B 5AV5A 3KFUG 5B33A 5B32B 5BT1C 5FUGA 2ZY2A 4J8XA 1P3KC 1KX4A 3VH5W 3MNNB 3W98B 3AZMD 2BYKB 4WZSB 5C3IC 4QLCB 1P3GC 3AZKB 1P3MC 1P3OC 3REKD 5B1LC 3B6GB 1P34B 3LJAB 3WA9A 1EQZC 3AV1D 1KX3B 4AWLB 3KWQA 3AV2D 1P3AC 3AZNB 2JE5A 3AFAA 4R8PB 5CPID 4X23C 3RELC 3AZGA 3VH5T 1B67A 3REIA 2ZM5A 1P3KB 1P3FD 3MGPD 3EPJA 5F99D 5C3IB 1P3GB 3UT9C 1P3MB 3AZLD 3X1VD 5B1LB 3FDDA 5G49B 3B6FC 1EQZB 4WU9B 3UTBD 4YM6D 1P3IC 3KXBA 5GXQC 5B33D 4E45A 4J8XD 2FFFB 1KX4D 4X23B 5AVBC 3RELB 2CV5C 3AYWA 2NQBA 5AV9B 3O62A 3H0MC 4KGCD 5AV8B 3LELC 4WJ3C 3LZ0D 1H3OA 3MGQC 3UT9B 4LD9A 3VH6T 3KWQD 3NQJB 3W96A 1P3LC 3B6FB 1BH8A 3AZEA 4KUDC 1AOIA 5DNNC 1TAFB 1P3IB 3AZHC 2NZDC 4WV4B 3AZGD 3TU4A 1P3BA 3REID 4XUJA 2JSSA 5AVBB 2CV5B 2G5IC 1F66A 4CSRB 5AVCC 5AV6A 5B2JA 4Z66A 5GSUA 4YS3C 3LELB 5CPJC 4H9SA 3LZ1C 3MGQB 1TZYA 3UTAC 4XZQD 3KXBD 2Y2LA 1P3LB 4KUDB 2IO5C 3AZHB 2NZDB 1WWIA 2XD5A 4H9RB 3R45A 3AYWD 1BH9B 2NQBD 3O62D 1M19C 3VH5A 4WNNA 3MGSC 1M1AD 5AVCB 5B2IC 4UUZA 4YS3B 4J8UA 5B31A 3LZ1B 3W99D 3AZED 3UTAB 1AOID 2Y2JA 5KDMA 3C1BA 2FJ7A 5CP6C 2PYOA 3X1TD 5B0ZA 5BNVB 3TU4D 4J8WC 1P3BD 3X1SC 2IO5B 4XUJD 1P3PA 3MNNC 5BNXA 3C1CA 4ZUXA 1F66D 3EPHA 5AV6D 5B32A 1M19B 4Z66D 5GSUD 5DNMA 4J8VC 1ZLAC 5B2IB 3WTPD 1TZYD 3W98A 2BYKA 4QLCA 2F8NB 3AZKA 3MVDA 4Z2MH 3B6GA 1P34A 3LJAA 3AZIC 2Y2NA 5F99C 3AZFD 1KX3A 2J8PA 4J8WB 3X1SB 3AZNA 2Y2MA 4YM6C 2Y2IA 4J8VB 1ID3C 1ZLAB 4J8UD 5B31D 1P3KA 1S32C 4WU9C 5CPKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B D;  2FJ7 D;  1P3G A;  1P3M A;  1P3O A;  5E5A C;  3REJ C;  4KGC C;  5AY8 C;  3AZI B;  1HTA A;  4CAY B;  1EQZ A;  3LZ0 C;  1P3P D;  3MGR C;  2RVQ C;  1JFI B;  5F99 B;  3C1C D;  2ARO C;  5AV9 C;  4ZUX D;  2L5A A;  3X1V B;  1M18 C;  1HQ3 D;  5B32 D;  5AV8 C;  1P3A A;  3WKJ C;  5DNM D;  4HGA B;  2YFW B;  4NFT A;  4YM6 B;  4X23 A;  3REL A;  3W98 D;  4E44 A;  5B40 C;  3AZJ D;  4QLC D;  5JRG C;  1N1J B;  1ID3 B;  3NQU A;  3W97 A;  3MVD D;  2F8N H;  3REI C;  1S32 B;  3B6G D;  5CPK B;  1P34 D;  3LJA D;  5AV5 D;  3UT9 A;  1KX3 D;  2BYM B;  5E5A B;  3NQJ A;  3REJ B;  4KGC B;  5AY8 B;  3B6F A;  3LZ0 B;  3AZN D;  4DRB A;  3MGR B;  4H9Q A;  2ARO B;  2LY8 A;  5GXQ A;  4XZQ C;  3A6N C;  1M18 B;  1B6W A;  5BT1 D;  3WKJ B;  3WA9 D;  4WU8 A;  5AVB A;  4CSR A;  5B40 B;  5JRG B;  1P3G D;  3AYW C;  1P3M D;  1P3O D;  1KX5 C;  3REI B;  3LEL A;  3AFA D;  1U35 A;  3MGQ A;  1M1A C;  3AN2 A;  1P3L A;  4KUD A;  1P3A D;  5DNN A;  3W99 C;  3AZH A;  3KUY C;  5GT0 A;  5B0Y C;  2NZD A;  4XZQ B;  4X23 D;  3A6N B;  3X1T C;  4H9R A;  3TU4 C;  3W97 D;  5B1M C;  5AVC A;  4G92 C;  2HIO C;  3AYW B;  1KX5 B;  4YS3 A;  5CPJ A;  3V9R B;  4H9P B;  3B6F D;  1M1A B;  3WAA C;  5B31 G;  3UTA A;  3WTP C;  4KHA B;  5BS7 C;  4Z5T C;  3REH C;  3B0C W;  5GXQ D;  2YFV A;  4G91 C;  5BNV A;  3W99 B;  5B24 C;  3KUY B;  5GT3 A;  5B0Y B;  4JJN C;  3X1U C;  4WU8 D;  5AVB D;  4LD9 D;  3X1T B;  3AZF C;  3W96 D;  3TU4 B;  1M19 A;  1A7W A;  5B1M B;  5B32 G;  3MGS A;  1U35 D;  3AZM C;  5B2I A;  3MGQ D;  4G92 B;  2HIO B;  3REK C;  2F8N A;  3AN2 D;  3WAA B;  5DNN D;  3AV1 C;  3WTP B;  4H9O B;  4Z5T B;  5CP6 A;  3REH B;  3AZH D;  5B2J D;  1R4V A;  5GT0 D;  3C1B C;  2NZD D;  4G91 B;  3AV2 C;  4NE3 A;  4J8W A;  3X1S A;  5B24 B;  3MNN A;  5CPI C;  3X1U B;  4JJN B;  3C1C C;  3AZF B;  4M6B A;  1HQ3 C;  5CPJ D;  4J8V A;  1P3F C;  1ZLA A;  3MGP C;  5DNM C;  3AZM B;  1WWS A;  3UTA D;  2F8N K;  3X1V C;  3REK B;  3AZL C;  5BO0 B;  3AZJ C;  3MVD C;  5B31 B;  3AV1 B;  4HGA C;  4R8P A;  3AZI A;  3UTB C;  4CAY A;  4NE5 A;  5GT3 D;  1JFI A;  3C1B B;  5AV5 C;  5B33 C;  3AV2 B;  1KU5 A;  4J8X C;  1M19 D;  5CPI B;  1KX4 C;  5JA4 B;  1P3P B;  3MGS D;  2YFW A;  2PYO D;  3B0D C;  3C1C B;  5B2I D;  5B1L A;  3B0B A;  5B0Z D;  1HQ3 B;  5G49 A;  1P3F B;  1ULY A;  1N1J A;  3MGP B;  1ID3 A;  2F8N D;  5DNM B;  3WA9 C;  1S32 A;  4WU9 A;  5CHL B;  5CPK A;  4H9N B;  3AZL B;  5CP6 D;  3WTP E;  3KWQ C;  3AZJ B;  2BYM A;  5E5A A;  3MVD B;  3REJ A;  4KGC A;  4J8W D;  5AY8 A;  3UTB B;  3X1S D;  3LZ0 A;  3AFA C;  3MGR A;  3MNN D;  2ARO A;  5AV5 B;  5B33 B;  5AV9 A;  3AZG C;  5FUG B;  3AZK D;  4J8X B;  1M18 A;  5AV8 A;  3WKJ A;  1KX4 B;  4J8V D;  1ZLA D;  3B0D B;  5B40 A;  5JRG A;  3WA9 B;  2HUE C;  3W97 C;  1TAF A;  1P3I A;  4R8P D;  3AZI D;  3KWQ B;  3KXB C;  4DRA A;  1BFM A;  1P3O B;  1P3K D;  3AFA B;  2CV5 A;  4Z2M G;  3AZG B;  3VH6 W;  2NQB C;  4XZQ A;  3A6N A;  5B1L D;  3O62 C;  1P3A B;  1ID3 D;  1EQZ D;  4NE6 A;  4EO5 C;  1S32 D;  4WU9 D;  5CPK D;  4WU8 C;  4LD9 C;  3W96 C;  1KX5 A;  5E5A D;  2HUE B;  3NQU B;  3AZE C;  3REJ D;  3W97 B;  1AOI C;  5AY8 D;  4H9P A;  3V9R A;  1M1A A;  3REL D;  3KXB B;  1U35 C;  3MGR D;  2RVQ D;  4KHA A;  1BH9 A;  2ARO D;  5AV9 D;  1P3B C;  1M18 D;  5AV8 D;  4XUJ C;  3AN2 C;  3WKJ D;  3W99 A;  4H9Q B;  5B0Y A;  3KUY A;  3UT9 D;  1F66 C;  2NQB B;  5AV6 C;  3X1T A;  5GXQ B;  5GT0 C;  5B2J C;  5B40 D;  3O62 B;  4Z66 C;  5GSU C;  5JRG D;  3LZ1 A;  4H9S C;  4EO5 B;  5B1M A;  1H3O B;  1TZY C;  1P3I D;  4WU8 B;  4LD9 B;  2HIO A;  3W96 B;  1BH8 B;  3AZE B;  1AOI B;  2F8N G;  1Q9C A;  1U35 B;  2CV5 D;  3WAA A;  3WTP A;  4H9O A;  3KSY A;  4Z5T A;  5BS7 A;  3REH A;  1P3B B;  3A6N D;  3LEL D;  4XUJ B;  3AN2 B;  5B24 A;  5DNN B;  4JJN A;  1F66 B;  3X1U A;  5AV6 B;  5GT0 B;  5GT3 C;  5B2J B;  3AZF A;  4Z66 B;  5GSU B;  3B0C T;  1P3L D;  4KUD D;  4ZBJ C;  4J8U C;  1KX5 D;  5B31 C;  1TZY B;  3AZM A;  2FJ7 C;  2PYO C;  3REK A;  5B0Z C;  5BO0 A;  5CPJ B;  1P3P C;  3AV1 A;  5AVC D;  4ZUX C;  3KUY D;  5B0Y D;  3R45 B;  5B32 C;  4YS3 D;  3AV2 A;  2YFV B;  3LZ1 D;  4WNN B;  5CPI A;  5B1M D;  5JA4 A;  1F1E A;  4UUZ B;  5GT3 B;  3W98 C;  4QLC C;  2HIO D;  4ZBJ B;  4J8U B;  3AZK C;  1HQ3 A;  2CWE A;  1P3F A;  3B6G C;  3MGP A;  1P34 C;  3LJA C;  5KDM B;  5F99 A;  2FJ7 B;  3MGS B;  2PYO B;  3WAA D;  4H9N A;  3AZL A;  3X1V A;  4AWL C;  5B0Z B;  1KX3 C;  4Z5T D;  3REH D;  3AZJ A;  3AZN C;  5BNX B;  3VH6 A;  5B24 D;  4YM6 A;  3UTB A;  4ZUX B;  4R8P C;  4JJN D;  3X1U D;  5CP6 B;  5AV5 A;  5B33 A;  5B32 B;  5BT1 C;  5FUG A;  4J8X A;  1P3K C;  1KX4 A;  3VH5 W;  3MNN B;  3W98 B;  3AZM D;  2BYK B;  4WZS B;  5C3I C;  4QLC B;  1P3G C;  3AZK B;  1P3M C;  1P3O C;  3REK D;  5B1L C;  3B6G B;  1P34 B;  3LJA B;  3WA9 A;  1EQZ C;  3AV1 D;  1KX3 B;  4AWL B;  3KWQ A;  3AV2 D;  1P3A C;  3AZN B;  3AFA A;  4R8P B;  5CPI D;  4X23 C;  3REL C;  3AZG A;  3VH5 T;  1B67 A;  3REI A;  1P3K B;  1P3F D;  3MGP D;  5F99 D;  5C3I B;  1P3G B;  3UT9 C;  1P3M B;  3AZL D;  3X1V D;  5B1L B;  5G49 B;  3B6F C;  1EQZ B;  4WU9 B;  3UTB D;  4YM6 D;  1P3I C;  3KXB A;  5GXQ C;  5B33 D;  4E45 A;  4J8X D;  1KX4 D;  4X23 B;  5AVB C;  3REL B;  2CV5 C;  3AYW A;  2NQB A;  5AV9 B;  3O62 A;  4KGC D;  5AV8 B;  3LEL C;  3LZ0 D;  1H3O A;  3MGQ C;  3UT9 B;  4LD9 A;  3VH6 T;  3KWQ D;  3NQJ B;  3W96 A;  1P3L C;  3B6F B;  1BH8 A;  3AZE A;  4KUD C;  1AOI A;  5DNN C;  1TAF B;  1P3I B;  3AZH C;  2NZD C;  4WV4 B;  3AZG D;  3TU4 A;  1P3B A;  3REI D;  4XUJ A;  2JSS A;  5AVB B;  2CV5 B;  1F66 A;  4CSR B;  5AVC C;  5AV6 A;  5B2J A;  4Z66 A;  5GSU A;  4YS3 C;  3LEL B;  5CPJ C;  4H9S A;  3LZ1 C;  3MGQ B;  1TZY A;  3UTA C;  4XZQ D;  3KXB D;  1P3L B;  4KUD B;  2IO5 C;  3AZH B;  2NZD B;  1WWI A;  4H9R B;  3R45 A;  3AYW D;  1BH9 B;  2NQB D;  3O62 D;  1M19 C;  3VH5 A;  4WNN A;  3MGS C;  1M1A D;  5AVC B;  5B2I C;  4UUZ A;  4YS3 B;  4J8U A;  5B31 A;  3LZ1 B;  3W99 D;  3AZE D;  3UTA B;  1AOI D;  5KDM A;  3C1B A;  2FJ7 A;  5CP6 C;  2PYO A;  3X1T D;  5B0Z A;  5BNV B;  3TU4 D;  4J8W C;  1P3B D;  3X1S C;  2IO5 B;  4XUJ D;  1P3P A;  3MNN C;  5BNX A;  3C1C A;  4ZUX A;  1F66 D;  5AV6 D;  5B32 A;  1M19 B;  4Z66 D;  5GSU D;  5DNM A;  4J8V C;  1ZLA C;  5B2I B;  3WTP D;  1TZY D;  3W98 A;  2BYK A;  4QLC A;  2F8N B;  3AZK A;  3MVD A;  4Z2M H;  3B6G A;  1P34 A;  3LJA A;  3AZI C;  5F99 C;  1KX3 A;  3AZF D;  4J8W B;  3X1S B;  3AZN A;  4YM6 C;  4J8V B;  1ID3 C;  1ZLA B;  4J8U D;  5B31 D;  1P3K A;  1S32 C;  4WU9 C;  5CPK C; 
#chains in the Genus database with same CATH topology
 3C1B D;  2FJ7 D;  1P3G A;  1P3M A;  1P3O A;  5E5A C;  3REJ C;  4KGC C;  5AY8 C;  3AZI B;  1HTA A;  4CAY B;  1EQZ A;  3LZ0 C;  1P3P D;  3MGR C;  2RVQ C;  1JFI B;  5F99 B;  3C1C D;  2ARO C;  5AV9 C;  4ZUX D;  2L5A A;  3X1V B;  1M18 C;  1HQ3 D;  5B32 D;  5AV8 C;  1P3A A;  3WKJ C;  5DNM D;  4HGA B;  2YFW B;  4NFT A;  4YM6 B;  4X23 A;  3REL A;  3W98 D;  2Y2P A;  4E44 A;  5B40 C;  2RIQ A;  3AZJ D;  4QLC D;  5JRG C;  1N1J B;  1ID3 B;  3NQU A;  3W97 A;  3MVD D;  2F8N H;  3REI C;  1S32 B;  3B6G D;  5CPK B;  1P34 D;  3LJA D;  1W2E A;  5AV5 D;  3UT9 A;  1KX3 D;  2BYM B;  5E5A B;  2JCH A;  3NQJ A;  3REJ B;  4KGC B;  5AY8 B;  3B6F A;  3LZ0 B;  3AZN D;  4DRB A;  3MGR B;  4H9Q A;  3AL0 C;  2ARO B;  2LY8 A;  1Z2C B;  5GXQ A;  3IP4 C;  4XZQ C;  3A6N C;  1M18 B;  1B6W A;  5BT1 D;  3WKJ B;  3WA9 D;  4WU8 A;  5AVB A;  4CSR A;  5B40 B;  5JRG B;  1P3G D;  3AYW C;  1P3M D;  1P3O D;  1KX5 C;  3REI B;  3LEL A;  3AFA D;  1U35 A;  3MGQ A;  1M1A C;  2Y2G A;  2VQR A;  3AN2 A;  1P3L A;  2BG1 A;  4KUD A;  1P3A D;  5DNN A;  3W99 C;  3EPK A;  3AZH A;  3KUY C;  5GT0 A;  5B0Y C;  2NZD A;  4XZQ B;  4X23 D;  3A6N B;  3X1T C;  4H9R A;  3TU4 C;  3W97 D;  5B1M C;  4DQY B;  5AVC A;  4G92 C;  2HIO C;  3AYW B;  2W8S A;  1KX5 B;  4YS3 A;  5CPJ A;  3P5J B;  3V9R B;  4H9P B;  3B6F D;  1M1A B;  3WAA C;  5B31 G;  3UTA A;  3WTP C;  4KHA B;  5BS7 C;  4Z5T C;  3REH C;  3B0C W;  5GXQ D;  2ZY4 A;  2YFV A;  4G91 C;  5BNV A;  3W99 B;  2G5H C;  5B24 C;  3KUY B;  5GT3 A;  5B0Y B;  4JJN C;  3X1U C;  4WU8 D;  5AVB D;  4LD9 D;  3X1T B;  3AZF C;  3W96 D;  3TU4 B;  1M19 A;  1A7W A;  5B1M B;  5B32 G;  3MGS A;  1U35 D;  2Y2O A;  3AZM C;  5B2I A;  3MGQ D;  4G92 B;  2HIO B;  3REK C;  2F8N A;  4UPK A;  3AN2 D;  3WAA B;  5DNN D;  3AV1 C;  3WTP B;  4H9O B;  4Z5T B;  5CP6 A;  3REH B;  3AZH D;  5B2J D;  1R4V A;  5GT0 D;  3C1B C;  2NZD D;  4G91 B;  3AV2 C;  4NE3 A;  3F6T A;  4J8W A;  3X1S A;  5B24 B;  3MNN A;  5CPI C;  3X1U B;  4JJN B;  3C1C C;  3AZF B;  2ZY5 A;  4M6B A;  1HQ3 C;  5CPJ D;  4J8V A;  1P3F C;  1ZLA A;  3MGP C;  2F2A C;  5DNM C;  3AZM B;  1WWS A;  3UTA D;  2F8N K;  3X1V C;  3REK B;  3AZL C;  5BO0 B;  3AZJ C;  3MVD C;  5B31 B;  3AV1 B;  4HGA C;  4R8P A;  3AZI A;  3UTB C;  4CAY A;  4NE5 A;  5GT3 D;  1JFI A;  3C1B B;  5AV5 C;  5B33 C;  3AV2 B;  1KU5 A;  4J8X C;  1M19 D;  5CPI B;  1KX4 C;  5JA4 B;  1P3P B;  3MGS D;  2YFW A;  2PYO D;  3B0D C;  3C1C B;  5B2I D;  5B1L A;  3B0B A;  5B0Z D;  1HQ3 B;  5G49 A;  1P3F B;  1ULY A;  1N1J A;  3MGP B;  2Y2H A;  2DQN C;  1ID3 A;  2F8N D;  5DNM B;  3WA9 C;  1S32 A;  4WU9 A;  5CHL B;  5CPK A;  4H9N B;  3AZL B;  5CP6 D;  3WTP E;  3KWQ C;  3AZJ B;  2BYM A;  5E5A A;  3MVD B;  3REJ A;  4KGC A;  4J8W D;  5AY8 A;  3UTB B;  3X1S D;  3LZ0 A;  3AFA C;  3MGR A;  3MNN D;  2ARO A;  5AV5 B;  5B33 B;  5AV9 A;  3AZG C;  5FUG B;  3AZK D;  4J8X B;  1M18 A;  5AV8 A;  3WKJ A;  1KX4 B;  4J8V D;  1ZLA D;  3B0D B;  5B40 A;  5JRG A;  3WA9 B;  2HUE C;  3W97 C;  1TAF A;  1P3I A;  4R8P D;  3AZI D;  3KWQ B;  3KXB C;  4DRA A;  1PZR A;  1BFM A;  1P3O B;  2Y2Q A;  1P3K D;  3AFA B;  2CV5 A;  4Z2M G;  3AZG B;  3VH6 W;  2NQB C;  4XZQ A;  3A6N A;  5B1L D;  3O62 C;  3EPL A;  1P3A B;  1ID3 D;  1EQZ D;  4NE6 A;  4EO5 C;  1S32 D;  4WU9 D;  5CPK D;  4WU8 C;  4LD9 C;  3W96 C;  1KX5 A;  5E5A D;  2HUE B;  3NQU B;  3AZE C;  3REJ D;  3W97 B;  1AOI C;  5AY8 D;  4H9P A;  3V9R A;  1T3U A;  3REL D;  3KXB B;  1U35 C;  3MGR D;  2RVQ D;  3A1I A;  1M1A A;  4KHA A;  1BH9 A;  2ARO D;  5AV9 D;  1P3B C;  1M18 D;  2Y2K A;  5AV8 D;  4XUJ C;  3AN2 C;  3WKJ D;  3W99 A;  4H9Q B;  5B0Y A;  3KUY A;  3UT9 D;  1F66 C;  2NQB B;  5AV6 C;  3X1T A;  5GXQ B;  5GT0 C;  5B2J C;  5B40 D;  3O62 B;  4Z66 C;  5GSU C;  5JRG D;  3LZ1 A;  4H9S C;  4EO5 B;  5B1M A;  1H3O B;  1TZY C;  1P3I D;  3EG5 B;  4WU8 B;  4LD9 B;  2HIO A;  3W96 B;  1BH8 B;  3AZE B;  1AOI B;  3H0L C;  2F8N G;  1Q9C A;  1U35 B;  2CV5 D;  3WAA A;  3WTP A;  4H9O A;  3KSY A;  2ZY3 A;  4Z5T A;  5BS7 A;  3REH A;  1P3B B;  3A6N D;  3A1K A;  3LEL D;  4XUJ B;  3AN2 B;  5B24 A;  5DNN B;  4JJN A;  1F66 B;  3X1U A;  5AV6 B;  5GT0 B;  5GT3 C;  5B2J B;  3AZF A;  4Z66 B;  5GSU B;  3B0C T;  1P3L D;  4KUD D;  4ZBJ C;  4J8U C;  1KX5 D;  5B31 C;  1TZY B;  3AZM A;  2FJ7 C;  2PYO C;  3REK A;  5B0Z C;  5BO0 A;  5CPJ B;  1P3P C;  3AV1 A;  5AVC D;  4ZUX C;  3KUY D;  5B0Y D;  3R45 B;  5B32 C;  4YS3 D;  3AV2 A;  2YFV B;  2XD1 A;  3LZ1 D;  4WNN B;  5CPI A;  5B1M D;  5JA4 A;  1F1E A;  4UUZ B;  2UWX A;  5GT3 B;  3W98 C;  3H0R C;  4QLC C;  2HIO D;  4ZBJ B;  4J8U B;  3AZK C;  1HQ3 A;  2CWE A;  1P3F A;  3B6G C;  3MGP A;  1P34 C;  3LJA C;  5KDM B;  5F99 A;  2FJ7 B;  3MGS B;  2PYO B;  2DF4 C;  3WAA D;  4H9N A;  3AZL A;  3X1V A;  4AWL C;  5B0Z B;  1KX3 C;  4Z5T D;  3REH D;  3AZJ A;  3AZN C;  5BNX B;  3VH6 A;  5B24 D;  4YM6 A;  3UTB A;  4ZUX B;  4R8P C;  4JJN D;  3X1U D;  5CP6 B;  5AV5 A;  3KFU G;  5B33 A;  5B32 B;  5BT1 C;  5FUG A;  2ZY2 A;  4J8X A;  1P3K C;  1KX4 A;  3VH5 W;  3MNN B;  3W98 B;  3AZM D;  2BYK B;  4WZS B;  5C3I C;  4QLC B;  1P3G C;  3AZK B;  1P3M C;  1P3O C;  3REK D;  5B1L C;  3B6G B;  1P34 B;  3LJA B;  3WA9 A;  1EQZ C;  3AV1 D;  1KX3 B;  4AWL B;  3KWQ A;  3AV2 D;  1P3A C;  3AZN B;  2JE5 A;  3AFA A;  4R8P B;  5CPI D;  4X23 C;  3REL C;  3AZG A;  3VH5 T;  1B67 A;  3REI A;  2ZM5 A;  1P3K B;  1P3F D;  3MGP D;  3EPJ A;  5F99 D;  5C3I B;  1P3G B;  3UT9 C;  1P3M B;  3AZL D;  3X1V D;  5B1L B;  3FDD A;  5G49 B;  3B6F C;  1EQZ B;  4WU9 B;  3UTB D;  4YM6 D;  1P3I C;  3KXB A;  5GXQ C;  5B33 D;  4E45 A;  4J8X D;  2FFF B;  1KX4 D;  4X23 B;  5AVB C;  3REL B;  2CV5 C;  3AYW A;  2NQB A;  5AV9 B;  3O62 A;  3H0M C;  4KGC D;  5AV8 B;  3LEL C;  4WJ3 C;  3LZ0 D;  1H3O A;  3MGQ C;  3UT9 B;  4LD9 A;  3VH6 T;  3KWQ D;  3NQJ B;  3W96 A;  1P3L C;  3B6F B;  1BH8 A;  3AZE A;  4KUD C;  1AOI A;  5DNN C;  1TAF B;  1P3I B;  3AZH C;  2NZD C;  4WV4 B;  3AZG D;  3TU4 A;  1P3B A;  3REI D;  4XUJ A;  2JSS A;  5AVB B;  2CV5 B;  2G5I C;  1F66 A;  4CSR B;  5AVC C;  5AV6 A;  5B2J A;  4Z66 A;  5GSU A;  4YS3 C;  3LEL B;  5CPJ C;  4H9S A;  3LZ1 C;  3MGQ B;  1TZY A;  3UTA C;  4XZQ D;  3KXB D;  2Y2L A;  1P3L B;  4KUD B;  2IO5 C;  3AZH B;  2NZD B;  1WWI A;  2XD5 A;  4H9R B;  3R45 A;  3AYW D;  1BH9 B;  2NQB D;  3O62 D;  1M19 C;  3VH5 A;  4WNN A;  3MGS C;  1M1A D;  5AVC B;  5B2I C;  4UUZ A;  4YS3 B;  4J8U A;  5B31 A;  3LZ1 B;  3W99 D;  3AZE D;  3UTA B;  1AOI D;  2Y2J A;  5KDM A;  3C1B A;  2FJ7 A;  5CP6 C;  2PYO A;  3X1T D;  5B0Z A;  5BNV B;  3TU4 D;  4J8W C;  1P3B D;  3X1S C;  2IO5 B;  4XUJ D;  1P3P A;  3MNN C;  5BNX A;  3C1C A;  4ZUX A;  1F66 D;  3EPH A;  5AV6 D;  5B32 A;  1M19 B;  4Z66 D;  5GSU D;  5DNM A;  4J8V C;  1ZLA C;  5B2I B;  3WTP D;  1TZY D;  3W98 A;  2BYK A;  4QLC A;  2F8N B;  3AZK A;  3MVD A;  4Z2M H;  3B6G A;  1P34 A;  3LJA A;  3AZI C;  2Y2N A;  5F99 C;  3AZF D;  1KX3 A;  2J8P A;  4J8W B;  3X1S B;  3AZN A;  2Y2M A;  4YM6 C;  2Y2I A;  4J8V B;  1ID3 C;  1ZLA B;  4J8U D;  5B31 D;  1P3K A;  1S32 C;  4WU9 C;  5CPK C; 
#chains in the Genus database with same CATH homology
 3C1B D;  2FJ7 D;  1P3G A;  1P3M A;  1P3O A;  5E5A C;  3REJ C;  4KGC C;  5AY8 C;  3AZI B;  1HTA A;  4CAY B;  1EQZ A;  3LZ0 C;  1P3P D;  3MGR C;  2RVQ C;  1JFI B;  5F99 B;  3C1C D;  2ARO C;  5AV9 C;  4ZUX D;  2L5A A;  3X1V B;  1M18 C;  1HQ3 D;  5B32 D;  5AV8 C;  1P3A A;  3WKJ C;  5DNM D;  4HGA B;  2YFW B;  4NFT A;  4YM6 B;  4X23 A;  3REL A;  3W98 D;  2Y2P A;  4E44 A;  5B40 C;  2RIQ A;  3AZJ D;  4QLC D;  5JRG C;  1N1J B;  1ID3 B;  3NQU A;  3W97 A;  3MVD D;  2F8N H;  3REI C;  1S32 B;  3B6G D;  5CPK B;  1P34 D;  3LJA D;  1W2E A;  5AV5 D;  3UT9 A;  1KX3 D;  2BYM B;  5E5A B;  2JCH A;  3NQJ A;  3REJ B;  4KGC B;  5AY8 B;  3B6F A;  3LZ0 B;  3AZN D;  4DRB A;  3MGR B;  4H9Q A;  3AL0 C;  2ARO B;  2LY8 A;  1Z2C B;  5GXQ A;  3IP4 C;  4XZQ C;  3A6N C;  1M18 B;  1B6W A;  5BT1 D;  3WKJ B;  3WA9 D;  4WU8 A;  5AVB A;  4CSR A;  5B40 B;  5JRG B;  1P3G D;  3AYW C;  1P3M D;  1P3O D;  1KX5 C;  3REI B;  3LEL A;  3AFA D;  1U35 A;  3MGQ A;  1M1A C;  2Y2G A;  2VQR A;  3AN2 A;  1P3L A;  2BG1 A;  4KUD A;  1P3A D;  5DNN A;  3W99 C;  3EPK A;  3AZH A;  3KUY C;  5GT0 A;  5B0Y C;  2NZD A;  4XZQ B;  4X23 D;  3A6N B;  3X1T C;  4H9R A;  3TU4 C;  3W97 D;  5B1M C;  4DQY B;  5AVC A;  4G92 C;  2HIO C;  3AYW B;  2W8S A;  1KX5 B;  4YS3 A;  5CPJ A;  3P5J B;  3V9R B;  4H9P B;  3B6F D;  1M1A B;  3WAA C;  5B31 G;  3UTA A;  3WTP C;  4KHA B;  5BS7 C;  4Z5T C;  3REH C;  3B0C W;  5GXQ D;  2ZY4 A;  2YFV A;  4G91 C;  5BNV A;  3W99 B;  2G5H C;  5B24 C;  3KUY B;  5GT3 A;  5B0Y B;  4JJN C;  3X1U C;  4WU8 D;  5AVB D;  4LD9 D;  3X1T B;  3AZF C;  3W96 D;  3TU4 B;  1M19 A;  1A7W A;  5B1M B;  5B32 G;  3MGS A;  1U35 D;  2Y2O A;  3AZM C;  5B2I A;  3MGQ D;  4G92 B;  2HIO B;  3REK C;  2F8N A;  4UPK A;  3AN2 D;  3WAA B;  5DNN D;  3AV1 C;  3WTP B;  4H9O B;  4Z5T B;  5CP6 A;  3REH B;  3AZH D;  5B2J D;  1R4V A;  5GT0 D;  3C1B C;  2NZD D;  4G91 B;  3AV2 C;  4NE3 A;  3F6T A;  4J8W A;  3X1S A;  5B24 B;  3MNN A;  5CPI C;  3X1U B;  4JJN B;  3C1C C;  3AZF B;  2ZY5 A;  4M6B A;  1HQ3 C;  5CPJ D;  4J8V A;  1P3F C;  1ZLA A;  3MGP C;  2F2A C;  5DNM C;  3AZM B;  1WWS A;  3UTA D;  2F8N K;  3X1V C;  3REK B;  3AZL C;  5BO0 B;  3AZJ C;  3MVD C;  5B31 B;  3AV1 B;  4HGA C;  4R8P A;  3AZI A;  3UTB C;  4CAY A;  4NE5 A;  5GT3 D;  1JFI A;  3C1B B;  5AV5 C;  5B33 C;  3AV2 B;  1KU5 A;  4J8X C;  1M19 D;  5CPI B;  1KX4 C;  5JA4 B;  1P3P B;  3MGS D;  2YFW A;  2PYO D;  3B0D C;  3C1C B;  5B2I D;  5B1L A;  3B0B A;  5B0Z D;  1HQ3 B;  5G49 A;  1P3F B;  1ULY A;  1N1J A;  3MGP B;  2Y2H A;  2DQN C;  1ID3 A;  2F8N D;  5DNM B;  3WA9 C;  1S32 A;  4WU9 A;  5CHL B;  5CPK A;  4H9N B;  3AZL B;  5CP6 D;  3WTP E;  3KWQ C;  3AZJ B;  2BYM A;  5E5A A;  3MVD B;  3REJ A;  4KGC A;  4J8W D;  5AY8 A;  3UTB B;  3X1S D;  3LZ0 A;  3AFA C;  3MGR A;  3MNN D;  2ARO A;  5AV5 B;  5B33 B;  5AV9 A;  3AZG C;  5FUG B;  3AZK D;  4J8X B;  1M18 A;  5AV8 A;  3WKJ A;  1KX4 B;  4J8V D;  1ZLA D;  3B0D B;  5B40 A;  5JRG A;  3WA9 B;  2HUE C;  3W97 C;  1TAF A;  1P3I A;  4R8P D;  3AZI D;  3KWQ B;  3KXB C;  4DRA A;  1PZR A;  1BFM A;  1P3O B;  2Y2Q A;  1P3K D;  3AFA B;  2CV5 A;  4Z2M G;  3AZG B;  3VH6 W;  2NQB C;  4XZQ A;  3A6N A;  5B1L D;  3O62 C;  3EPL A;  1P3A B;  1ID3 D;  1EQZ D;  4NE6 A;  4EO5 C;  1S32 D;  4WU9 D;  5CPK D;  4WU8 C;  4LD9 C;  3W96 C;  1KX5 A;  5E5A D;  2HUE B;  3NQU B;  3AZE C;  3REJ D;  3W97 B;  1AOI C;  5AY8 D;  4H9P A;  3V9R A;  1T3U A;  3REL D;  3KXB B;  1U35 C;  3MGR D;  2RVQ D;  3A1I A;  1M1A A;  4KHA A;  1BH9 A;  2ARO D;  5AV9 D;  1P3B C;  1M18 D;  2Y2K A;  5AV8 D;  4XUJ C;  3AN2 C;  3WKJ D;  3W99 A;  4H9Q B;  5B0Y A;  3KUY A;  3UT9 D;  1F66 C;  2NQB B;  5AV6 C;  3X1T A;  5GXQ B;  5GT0 C;  5B2J C;  5B40 D;  3O62 B;  4Z66 C;  5GSU C;  5JRG D;  3LZ1 A;  4H9S C;  4EO5 B;  5B1M A;  1H3O B;  1TZY C;  1P3I D;  3EG5 B;  4WU8 B;  4LD9 B;  2HIO A;  3W96 B;  1BH8 B;  3AZE B;  1AOI B;  3H0L C;  2F8N G;  1Q9C A;  1U35 B;  2CV5 D;  3WAA A;  3WTP A;  4H9O A;  3KSY A;  2ZY3 A;  4Z5T A;  5BS7 A;  3REH A;  1P3B B;  3A6N D;  3A1K A;  3LEL D;  4XUJ B;  3AN2 B;  5B24 A;  5DNN B;  4JJN A;  1F66 B;  3X1U A;  5AV6 B;  5GT0 B;  5GT3 C;  5B2J B;  3AZF A;  4Z66 B;  5GSU B;  3B0C T;  1P3L D;  4KUD D;  4ZBJ C;  4J8U C;  1KX5 D;  5B31 C;  1TZY B;  3AZM A;  2FJ7 C;  2PYO C;  3REK A;  5B0Z C;  5BO0 A;  5CPJ B;  1P3P C;  3AV1 A;  5AVC D;  4ZUX C;  3KUY D;  5B0Y D;  3R45 B;  5B32 C;  4YS3 D;  3AV2 A;  2YFV B;  2XD1 A;  3LZ1 D;  4WNN B;  5CPI A;  5B1M D;  5JA4 A;  1F1E A;  4UUZ B;  2UWX A;  5GT3 B;  3W98 C;  3H0R C;  4QLC C;  2HIO D;  4ZBJ B;  4J8U B;  3AZK C;  1HQ3 A;  2CWE A;  1P3F A;  3B6G C;  3MGP A;  1P34 C;  3LJA C;  5KDM B;  5F99 A;  2FJ7 B;  3MGS B;  2PYO B;  2DF4 C;  3WAA D;  4H9N A;  3AZL A;  3X1V A;  4AWL C;  5B0Z B;  1KX3 C;  4Z5T D;  3REH D;  3AZJ A;  3AZN C;  5BNX B;  3VH6 A;  5B24 D;  4YM6 A;  3UTB A;  4ZUX B;  4R8P C;  4JJN D;  3X1U D;  5CP6 B;  5AV5 A;  3KFU G;  5B33 A;  5B32 B;  5BT1 C;  5FUG A;  2ZY2 A;  4J8X A;  1P3K C;  1KX4 A;  3VH5 W;  3MNN B;  3W98 B;  3AZM D;  2BYK B;  4WZS B;  5C3I C;  4QLC B;  1P3G C;  3AZK B;  1P3M C;  1P3O C;  3REK D;  5B1L C;  3B6G B;  1P34 B;  3LJA B;  3WA9 A;  1EQZ C;  3AV1 D;  1KX3 B;  4AWL B;  3KWQ A;  3AV2 D;  1P3A C;  3AZN B;  2JE5 A;  3AFA A;  4R8P B;  5CPI D;  4X23 C;  3REL C;  3AZG A;  3VH5 T;  1B67 A;  3REI A;  2ZM5 A;  1P3K B;  1P3F D;  3MGP D;  3EPJ A;  5F99 D;  5C3I B;  1P3G B;  3UT9 C;  1P3M B;  3AZL D;  3X1V D;  5B1L B;  3FDD A;  5G49 B;  3B6F C;  1EQZ B;  4WU9 B;  3UTB D;  4YM6 D;  1P3I C;  3KXB A;  5GXQ C;  5B33 D;  4E45 A;  4J8X D;  2FFF B;  1KX4 D;  4X23 B;  5AVB C;  3REL B;  2CV5 C;  3AYW A;  2NQB A;  5AV9 B;  3O62 A;  3H0M C;  4KGC D;  5AV8 B;  3LEL C;  4WJ3 C;  3LZ0 D;  1H3O A;  3MGQ C;  3UT9 B;  4LD9 A;  3VH6 T;  3KWQ D;  3NQJ B;  3W96 A;  1P3L C;  3B6F B;  1BH8 A;  3AZE A;  4KUD C;  1AOI A;  5DNN C;  1TAF B;  1P3I B;  3AZH C;  2NZD C;  4WV4 B;  3AZG D;  3TU4 A;  1P3B A;  3REI D;  4XUJ A;  2JSS A;  5AVB B;  2CV5 B;  2G5I C;  1F66 A;  4CSR B;  5AVC C;  5AV6 A;  5B2J A;  4Z66 A;  5GSU A;  4YS3 C;  3LEL B;  5CPJ C;  4H9S A;  3LZ1 C;  3MGQ B;  1TZY A;  3UTA C;  4XZQ D;  3KXB D;  2Y2L A;  1P3L B;  4KUD B;  2IO5 C;  3AZH B;  2NZD B;  1WWI A;  2XD5 A;  4H9R B;  3R45 A;  3AYW D;  1BH9 B;  2NQB D;  3O62 D;  1M19 C;  3VH5 A;  4WNN A;  3MGS C;  1M1A D;  5AVC B;  5B2I C;  4UUZ A;  4YS3 B;  4J8U A;  5B31 A;  3LZ1 B;  3W99 D;  3AZE D;  3UTA B;  1AOI D;  2Y2J A;  5KDM A;  3C1B A;  2FJ7 A;  5CP6 C;  2PYO A;  3X1T D;  5B0Z A;  5BNV B;  3TU4 D;  4J8W C;  1P3B D;  3X1S C;  2IO5 B;  4XUJ D;  1P3P A;  3MNN C;  5BNX A;  3C1C A;  4ZUX A;  1F66 D;  3EPH A;  5AV6 D;  5B32 A;  1M19 B;  4Z66 D;  5GSU D;  5DNM A;  4J8V C;  1ZLA C;  5B2I B;  3WTP D;  1TZY D;  3W98 A;  2BYK A;  4QLC A;  2F8N B;  3AZK A;  3MVD A;  4Z2M H;  3B6G A;  1P34 A;  3LJA A;  3AZI C;  2Y2N A;  5F99 C;  3AZF D;  1KX3 A;  2J8P A;  4J8W B;  3X1S B;  3AZN A;  2Y2M A;  4YM6 C;  2Y2I A;  4J8V B;  1ID3 C;  1ZLA B;  4J8U D;  5B31 D;  1P3K A;  1S32 C;  4WU9 C;  5CPK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...