1KX4C

X-ray structure of the nucleosome core particle, ncp146b, at 2.6 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx4C00
5AV9B 3AZGA 3C1CC 3C1CD 3AV2A 5DNNC 2F8NG 3AN2D 3REHB 1P3BA 5B1LC 4NE5A 5GXQA 5B31A 3AZEA 4G92C 3A6NC 3AFAD 3AZFB 4KGCB 3LELD 5GT0C 4WU8B 1KX5C 1KX5D 1H3OA 1WWSA 1U35A 3O62C 2F8NA 1P3OC 5G49A 3AYWD 4AWLB 3KUYA 3KXBA 3AZLC 3AFAA 4LD9A 3B6GB 5FUGB 3MGPA 5BNXA 4R8PD 2NZDB 5B1MB 1KU5A 5AV8C 5AV8D 3LZ0C 3KWQA 4JJNA 4Z5TC 3X1SC 3WAAA 1P3AA 1ZLAD 3UTBC 3UTBD 3MNNC 3AZNA 1EQZC 5B0ZA 4X23A 2NQBD 4YS3B 5GT3C 5GT3D 1P34A 5JRGB 5AY8C 5AY8D 1P3ID 4J8WC 4J8WD 2YFWB 3REHA 4ZUXC 1KX4D 4H9SA 1F66B 3KSYA 3MGSA 1ID3A 1TZYC 1P3MB 5AVCB 4H9NB 4Z2MG 1P3GB 1M1AD 5E5AC 5E5AD 5F99B 3AZFA 4KGCA 4WU8A 3AZHC 5B40C 3C1BB 2FJ7A 4NFTA 1P3KD 3B6GA 5FUGA 3UT9A 5B0YD 3AZJD 3X1TC 1S32C 1S32D 1JFIB 3B0CW 2NZDA 5B33A 3AZKB 3TU4B 3WKJC 5B2JB 3X1VB 5CPJB 2HUEB 3WKJD 3REJB 4H9RA 4H9QB 3RELD 1HQ3C 3MGQB 1ULYA 4KUDB 1M19C 3VH5T 4J8XB 3VH5W 4QLCD 5CPID 3WTPD 2PYOA 1KX3C 3W99D 4HGAC 4DRAA 3UTAC 1P3PC 4YM6D 1P3PD 5B2IB 5AVBB 1TAFB 2AROD 4XUJC 4J8VC 5B24A 3MVDB 3LJAA 3AZMB 2LY8A 3AV1A 2YFWA 4XZQB 2BYKB 3W97B 3V9RB 2BYMB 3B6FB 1P3MA 3W99A 4E45A 4H9NA 3LZ1A 4Z66B 5AV5C 3MGRB 1P3FA 5AV6B 1AOIC 1AOID 3C1BA 4J8UC 4J8UD 1F1EA 4WU9B 1M18B 5CP6A 3AZGC 3AZGD 3AV2D 2HIOB 2CV5B 3W98B 1P3LA 5CPKA 1B6WA 3C1CB 1JFIA 5DNNB 5BT1D 1P3BC 1P3BD 4CSRB 3REKC 3AZKA 3TU4A 5B2JA 5GXQD 5B31D 3AZED 3X1VA 3REJA 3AN2B 5CPJA 2YFVA 3X1UC 2RVQC 2RVQD 5B1LB 3MGQA 4KHAA 4KUDA 4J8XA 4G92B 5JA4B 3A6NB 5DNMD 3AN2C 1U35C 1U35D 5B2IA 5AVBA 1TAFA 2F8ND 4UUZB 3AZID 5GT0B 1KX5B 3W96D 3AZMA 3KUYC 3KXBC 3O62B 3KXBD 3KUYD 3REID 1P3OB 1BH9B 5GSUD 3AFAC 4ZBJC 4XZQA 2BYKA 2F8NH 4LD9D 3MGPD 4H9PA 3AZLB 3V9RA 5DNMA 2BYMA 3LELC 5B32G 4R8PB 3KWQD 3AZIA 3AYWC 4Z66A 3W96A 4JJND 3REIA 5AV8B 3LZ0B 5GSUA 3WAAC 3WAAD 4Z5TB 1P3AD 5AV6A 3X1SB 3AZND 5BNVA 4R8PC 5BO0A 5B0ZD 4X23D 4WU9A 1M18A 5AV9D 3UTBB 3W98A 1P34C 1P34D 3MNNB 1EQZB 1N1JB 5GT3B 4G91C 5DNNA 5B32A 3REHD 5AY8B 3VH6A 4CSRA 3WA9A 4J8WB 4H9OA 3MGSC 3MGSD 1ID3C 1ID3D 1ZLAC 5B1LA 4ZUXB 2NQBC 5AV9A 1TZYB 3AZFD 1P3IC 4KGCD 4WU8D 5E5AB 4UUZA 1KX4C 5GT0A 2FJ7C 3AZHB 2FJ7D 3B0DC 3O62A 1P3OA 1BH9A 2IO5C 5B40B 5CHLB 1M1AC 3B6GD 3UT9C 3UT9D 2NZDD 5B33C 5B33D 1S32B 3X1TB 3WKJB 2JSSA 4NE3A 3LZ0A 1HQ3B 4WNNB 1M19B 1P3KC 2PYOC 3X1SA 3AZJC 5B0YC 2PYOD 3B0CT 5B1MA 3MNNA 5JRGD 1KX3B 3UTAB 4HGAB 5B24C 5B24D 1N1JA 3LJAD 3LJAC 3RELC 1P3PB 3AV1C 1BH8B 3NQUB 3AV1D 4XUJB 4J8VB 4QLCC 5CPIC 5C3IC 3WTPC 1BFMA 4ZUXA 1P3MD 3W99C 2L5AA 3LZ1C 4YM6C 3LZ1D 1P3GD 4YS3A 2AROC 5JRGA 5AV5B 4EO5C 1P3FC 1P3FD 5KDMB 3AZHA 3C1BD 1F66A 5CP6C 5CP6D 1AOIB 5AVCA 4J8UB 3VH6W 1P3LC 1P3LD 1P3GA 4M6BA 3AZGB 5CPKC 5CPKD 5F99A 3AZKD 3TU4D 5B2JD 3X1VD 5CPJD 3X1TA 3REJD 1P3BB 1B67A 1A7WA 3REKB 3MGQD 4KUDD 4J8XD 3X1UB 3AV2C 1HQ3A 4WNNA 1M19A 5BT1C 5B2ID 5AVBD 5GXQC 5B31C 3UTAA 3AZEC 1H3OB 3AZMD 1U35B 4H9QA 2F8NB 5G49B 4J8VA 3KUYB 3KXBB 4XZQD 3W97D 3AFAB 4ZBJB 5DNMC 3AZIC 3LELB 3W96C 4Z66D 3MVDA 3REIC 3AYWB 5GSUC 5AV5A 4LD9C 5KDMA 5AV6D 3MGPC 3W97A 3WAAB 4E44A 4WU9D 1M18D 3B6FA 3W98D 3KWQC 1P34B 5B32C 5DNND 5B32D 4JJNC 1KX3D 1HTAA 3WA9C 3MGRA 5BS7A 3WA9D 4G91B 1P3AC 5B1LD 3REKA 3AZNC 5B0ZB 5B0ZC 4X23C 3MGSB 1ID3B 1ZLAB 5AV9C 3X1UA 2CV5A 2HIOA 3A6ND 2NQBB 3C1CA 3REHC 1P3IB 4H9SC 3VH5A 5GT0D 3AN2A 3O62D 1P3OD 1KX4B 3R45B 2FJ7B 3B0DB 5JA4A 3A6NA 2IO5B 3AZLD 3AZFC 1M1AB 4KGCC 4WU8C 3UT9B 5B33B 3LELA 1KX5A 4AWLC 4H9RB 3LZ0D 3AYWA 4Z5TD 2F8NK 3B6GC 3X1SD 3AZLA 2NZDC 1P3KB 5B1MC 5B1MD 2PYOB 3MNND 3AZJB 5B0YB 4CAYB 4R8PA 1EQZD 3B0BA 4DRBA 5B24B 3LJAB 5AV8A 3RELB 4Z2MH 3AV1B 4Z5TA 4ZUXD 4QLCB 5CPIB 1ZLAA 4YS3C 4YS3D 3UTBA 5C3IB 3WTPB 1TZYD 5JRGC 3W99B 1EQZA 3LZ1B 3NQJB 4YM6B 2NQBA 2AROB 5GT3A 5AY8A 1P3IA 4J8WA 1F66C 3AZHD 1F66D 1P3MC 4EO5B 1KX4A 1P3FB 3R45A 5AVCC 5AVCD 5B40D 1P3GC 1TZYA 5CP6B 5F99C 5F99D 4X23B 1P3LB 1M1AA 5CPKB 1WWIA 5E5AA 3X1TD 1R4VA 3C1BC 2YFVB 1HQ3D 4KHAB 3VH6T 5B40A 1M19D 1Q9CA 3AV2B 1P3KA 3AZKC 2CWEA 3TU4C 5B2JC 5B0YA 3X1VC 2HUEC 3UTAD 4CAYA 3REJC 3AZJA 5CPJC 1S32A 3MGQC 3WKJA 4KUDC 5GXQB 5B31B 3AZEB 4XUJD 4J8XC 4J8VD 3RELA 4QLCA 4H9PB 5AVBC 5B2IC 5CPIA 5DNMB 3WTPA 1KX3A 3AZMC 3NQJA 4YM6A 3MVDD 3MVDC 1P3PA 3AZIB 1BH8A 2AROA 3NQUA 4WZSB 3W96B 4XUJA 4XZQC 5AV5D 3REIB 3W97C 5GSUB 3B6FC 3B6FD 4LD9B 3MGPB 5BNVB 5BNXB 5BO0B 4NE6A 4Z66C 3KWQB 3MGRC 5BS7C 3MGRD 5B31G 5B32B 4JJNB 5AV6C 3REKD 3WA9B 4H9OB 4WU9C 1P3AB 1M18C 3X1UD 2CV5C 3WTPE 2CV5D 2HIOC 2HIOD 3AZNB 1AOIA 3W98C 4J8UA 4WV4B
chains in the Genus database with same CATH superfamily
5AV9B 3AZGA 3C1CC 3C1CD 3AV2A 5DNNC 2F8NG 3AN2D 3REHB 1P3BA 5B1LC 4NE5A 5GXQA 5B31A 3AZEA 4G92C 3A6NC 3AFAD 2G5HC 3AZFB 4KGCB 3LELD 5GT0C 4WU8B 1KX5C 1KX5D 1H3OA 1WWSA 1U35A 3O62C 2F8NA 1P3OC 5G49A 3AYWD 4AWLB 3KUYA 3KXBA 5CPJA 3AZLC 2ZY5A 3AFAA 4LD9A 3B6GB 5FUGB 3MGPA 5BNXA 4R8PD 2NZDB 5B1MB 1KU5A 5AV8C 5AV8D 3LZ0C 3KWQA 2DF4C 2Y2NA 4Z5TC 4JJNA 3X1SC 3WAAA 1P3AA 1ZLAD 3UTBC 3UTBD 3MNNC 3AZNA 1EQZC 5B0ZA 4X23A 2NQBD 4YS3B 5GT3C 5GT3D 2Y2MA 1P34A 5JRGB 5AY8C 5AY8D 1P3ID 4J8WC 4J8WD 2YFWB 3REHA 4ZUXC 1KX4D 4H9SA 1F66B 3KSYA 3MGSA 1ID3A 1TZYC 1P3MB 5AVCB 4H9NB 4Z2MG 1P3GB 1M1AD 5E5AC 5E5AD 5F99B 2FFFB 3AZFA 4KGCA 4WU8A 3AZHC 5B40C 3C1BB 2FJ7A 4NFTA 1P3KD 3B6GA 5FUGA 3UT9A 5B0YD 3AZJD 3X1TC 1S32C 1S32D 1JFIB 3B0CW 2NZDA 5B33A 3AZKB 3TU4B 3WKJC 5B2JB 3X1VB 5CPJB 2HUEB 3WKJD 3REJB 4H9RA 2ZY4A 3F6TA 4H9QB 3RELD 1HQ3C 3MGQB 1ULYA 4KUDB 1M19C 3VH5T 4J8XB 3VH5W 4QLCD 2JE5A 5CPID 2ZY3A 3WTPD 2PYOA 1KX3C 3W99D 4HGAC 4DRAA 3UTAC 1P3PC 4YM6D 1P3PD 5B2IB 5AVBB 1TAFB 2AROD 4XUJC 4J8VC 5B24A 3MVDB 3LJAA 3AZMB 2LY8A 3AV1A 2YFWA 4XZQB 2BYKB 3W97B 3V9RB 2BYMB 3B6FB 1P3MA 3W99A 4E45A 4H9NA 3LZ1A 4Z66B 2DQNC 1W2EA 5AV5C 3MGRB 1P3FA 5AV6B 1AOIC 1AOID 3C1BA 4J8UC 4J8UD 1F1EA 4WU9B 1M18B 5CP6A 3AZGC 3AZGD 3AV2D 2HIOB 2CV5B 3W98B 1P3LA 5CPKA 1B6WA 3C1CB 1JFIA 5DNNB 5BT1D 1P3BC 1P3BD 4CSRB 3REKC 3AZKA 3TU4A 5B2JA 5GXQD 5B31D 2RIQA 3AZED 3REJA 3AN2B 3X1VA 2YFVA 3X1UC 2RVQC 2RVQD 5B1LB 3MGQA 4KHAA 4KUDA 4J8XA 4G92B 5JA4B 3A6NB 5DNMD 3AN2C 1U35C 1U35D 2JCHA 5B2IA 1TAFA 5AVBA 2F8ND 4UUZB 3AZID 5GT0B 1KX5B 3W96D 3AZMA 3KUYC 3KXBC 3O62B 3KXBD 3KUYD 3REID 1P3OB 1BH9B 5GSUD 3AFAC 4ZBJC 4XZQA 2BYKA 2F8NH 4LD9D 3MGPD 4H9PA 3AZLB 3V9RA 5DNMA 2BYMA 3LELC 5B32G 4R8PB 3KWQD 3AZIA 3AYWC 2Y2LA 4Z66A 3W96A 4JJND 3REIA 5AV8B 3LZ0B 5GSUA 3WAAC 3WAAD 4Z5TB 1P3AD 5AV6A 3X1SB 3AZND 5BNVA 4R8PC 5BO0A 5B0ZD 4X23D 4WU9A 1M18A 5AV9D 3UTBB 3W98A 2Y2OA 1P34C 3MNNB 1P34D 1EQZB 3KFUG 1N1JB 5GT3B 2Y2JA 4G91C 5DNNA 5B32A 3REHD 5AY8B 3VH6A 4CSRA 3WA9A 4J8WB 4H9OA 3MGSC 3MGSD 1ID3C 1ID3D 1ZLAC 5B1LA 4ZUXB 2NQBC 5AV9A 1TZYB 1PZRA 3AZFD 1P3IC 4KGCD 4WU8D 5E5AB 2ZY2A 4UUZA 2F2AC 1KX4C 2VQRA 5GT0A 2FJ7C 3AZHB 2FJ7D 3B0DC 3O62A 1P3OA 1BH9A 2IO5C 3P5JB 5B40B 5CHLB 1M1AC 3EPKA 3B6GD 3UT9C 3UT9D 2NZDD 5B33C 5B33D 1S32B 3X1TB 3WKJB 2JSSA 4NE3A 3LZ0A 1HQ3B 4WNNB 1M19B 1P3KC 2UWXA 3X1SA 3AZJC 5B0YC 2PYOC 2PYOD 2G5IC 3B0CT 4WJ3C 5B1MA 3MNNA 5JRGD 1KX3B 3UTAB 4HGAB 5B24C 5B24D 1N1JA 3LJAD 3LJAC 3RELC 1P3PB 3AV1C 1BH8B 3NQUB 3AV1D 4XUJB 4J8VB 4QLCC 5CPIC 5C3IC 3WTPC 1BFMA 4ZUXA 1P3MD 3W99C 2Y2KA 2L5AA 3LZ1C 4YM6C 3LZ1D 1P3GD 4YS3A 2AROC 5JRGA 2Y2IA 3A1IA 5AV5B 4EO5C 1P3FC 1P3FD 5KDMB 3AZHA 3C1BD 1F66A 5CP6C 5CP6D 1AOIB 5AVCA 4J8UB 3VH6W 1P3LC 1P3LD 1P3GA 2Y2PA 4M6BA 3AZGB 5CPKC 5CPKD 5F99A 3AZKD 3TU4D 5B2JD 3X1VD 5CPJD 3X1TA 3REJD 1P3BB 3H0RC 1B67A 1A7WA 3REKB 3MGQD 4KUDD 4J8XD 3X1UB 3AV2C 1HQ3A 4WNNA 1M19A 2J8PA 5BT1C 1T3UA 4UPKA 5B2ID 5AVBD 5GXQC 5B31C 3UTAA 3AZEC 1H3OB 3AZMD 1U35B 4H9QA 2F8NB 5G49B 4J8VA 3KUYB 3KXBB 4XZQD 3FDDA 3W97D 3AFAB 4ZBJB 5DNMC 3AZIC 3LELB 3IP4C 3W96C 4Z66D 2XD5A 3MVDA 3REIC 3AYWB 5GSUC 5AV5A 4LD9C 5KDMA 5AV6D 3MGPC 3W97A 3WAAB 4E44A 4WU9D 1M18D 3B6FA 3W98D 3KWQC 1P34B 5B32C 5DNND 5B32D 4JJNC 1KX3D 1HTAA 3WA9C 3MGRA 5BS7A 3WA9D 4G91B 1P3AC 5B1LD 3REKA 3AZNC 5B0ZB 5B0ZC 4X23C 3MGSB 1ID3B 1ZLAB 5AV9C 3X1UA 4DQYB 2CV5A 2HIOA 3A6ND 2NQBB 3C1CA 3REHC 1P3IB 4H9SC 3VH5A 5GT0D 3AN2A 3O62D 1P3OD 1KX4B 3R45B 2FJ7B 3B0DB 5JA4A 3A6NA 2IO5B 3AZLD 3AZFC 1M1AB 3EPHA 4KGCC 4WU8C 2Y2QA 3UT9B 5B33B 3LELA 1KX5A 4AWLC 4H9RB 3LZ0D 3AYWA 4Z5TD 2F8NK 2ZM5A 3B6GC 3X1SD 3AZLA 2NZDC 1P3KB 5B1MC 5B1MD 2PYOB 3MNND 3AZJB 5B0YB 4CAYB 4R8PA 1EQZD 2BG1A 3B0BA 4DRBA 5B24B 3LJAB 5AV8A 3RELB 4Z2MH 3AV1B 2W8SA 4Z5TA 4ZUXD 4QLCB 5CPIB 1ZLAA 4YS3C 4YS3D 3UTBA 5C3IB 3WTPB 1TZYD 5JRGC 3W99B 1EQZA 3LZ1B 3NQJB 4YM6B 2NQBA 2AROB 5GT3A 5AY8A 1P3IA 4J8WA 1F66C 3AZHD 2Y2HA 1F66D 1P3MC 4EO5B 1KX4A 1Z2CB 3R45A 1P3FB 5AVCC 5AVCD 5B40D 1P3GC 3H0MC 1TZYA 5CP6B 3H0LC 5F99C 5F99D 4X23B 1P3LB 1M1AA 5CPKB 1WWIA 5E5AA 3X1TD 1R4VA 3C1BC 3EG5B 2YFVB 1HQ3D 4KHAB 3VH6T 5B40A 1M19D 1Q9CA 3AV2B 1P3KA 3AZKC 2CWEA 3TU4C 5B2JC 5B0YA 3X1VC 2HUEC 2Y2GA 4CAYA 3REJC 3UTAD 3AZJA 5CPJC 1S32A 3MGQC 3WKJA 4KUDC 5GXQB 5B31B 3AZEB 4XUJD 4J8XC 4J8VD 3RELA 4QLCA 4H9PB 5AVBC 5B2IC 5CPIA 3AL0C 5DNMB 3WTPA 1KX3A 3AZMC 3NQJA 4YM6A 3MVDD 3MVDC 1P3PA 3AZIB 1BH8A 2AROA 3NQUA 4WZSB 3W96B 4XUJA 4XZQC 5AV5D 3REIB 3W97C 5GSUB 3B6FC 3B6FD 4LD9B 3MGPB 3EPJA 3A1KA 5BNVB 5BNXB 5BO0B 4NE6A 4Z66C 2XD1A 3EPLA 3KWQB 3MGRC 5BS7C 3MGRD 5B31G 5B32B 4JJNB 5AV6C 3REKD 3WA9B 4H9OB 4WU9C 1P3AB 1M18C 3X1UD 2CV5C 3WTPE 2CV5D 2HIOC 2HIOD 3AZNB 1AOIA 3W98C 4J8UA 4WV4B
chains in the Genus database with same CATH topology
5AV9B 3AZGA 3C1CC 3C1CD 3AV2A 5DNNC 2F8NG 3AN2D 3REHB 1P3BA 5B1LC 4NE5A 5GXQA 5B31A 3AZEA 4G92C 3A6NC 3AFAD 2G5HC 3AZFB 4KGCB 3LELD 5GT0C 4WU8B 1KX5C 1KX5D 1H3OA 1WWSA 1U35A 3O62C 2F8NA 1P3OC 5G49A 3AYWD 4AWLB 3KUYA 3KXBA 5CPJA 3AZLC 2ZY5A 3AFAA 4LD9A 3B6GB 5FUGB 3MGPA 5BNXA 4R8PD 2NZDB 5B1MB 1KU5A 5AV8C 5AV8D 3LZ0C 3KWQA 2DF4C 2Y2NA 4Z5TC 4JJNA 3X1SC 3WAAA 1P3AA 1ZLAD 3UTBC 3UTBD 3MNNC 3AZNA 1EQZC 5B0ZA 4X23A 2NQBD 4YS3B 5GT3C 5GT3D 2Y2MA 1P34A 5JRGB 5AY8C 5AY8D 1P3ID 4J8WC 4J8WD 2YFWB 3REHA 4ZUXC 1KX4D 4H9SA 1F66B 3KSYA 3MGSA 1ID3A 1TZYC 1P3MB 5AVCB 4H9NB 4Z2MG 1P3GB 1M1AD 5E5AC 5E5AD 5F99B 2FFFB 3AZFA 4KGCA 4WU8A 3AZHC 5B40C 3C1BB 2FJ7A 4NFTA 1P3KD 3B6GA 5FUGA 3UT9A 5B0YD 3AZJD 3X1TC 1S32C 1S32D 1JFIB 3B0CW 2NZDA 5B33A 3AZKB 3TU4B 3WKJC 5B2JB 3X1VB 5CPJB 2HUEB 3WKJD 3REJB 4H9RA 2ZY4A 3F6TA 4H9QB 3RELD 1HQ3C 3MGQB 1ULYA 4KUDB 1M19C 3VH5T 4J8XB 3VH5W 4QLCD 2JE5A 5CPID 2ZY3A 3WTPD 2PYOA 1KX3C 3W99D 4HGAC 4DRAA 3UTAC 1P3PC 4YM6D 1P3PD 5B2IB 5AVBB 1TAFB 2AROD 4XUJC 4J8VC 5B24A 3MVDB 3LJAA 3AZMB 2LY8A 3AV1A 2YFWA 4XZQB 2BYKB 3W97B 3V9RB 2BYMB 3B6FB 1P3MA 3W99A 4E45A 4H9NA 3LZ1A 4Z66B 2DQNC 1W2EA 5AV5C 3MGRB 1P3FA 5AV6B 1AOIC 1AOID 3C1BA 4J8UC 4J8UD 1F1EA 4WU9B 1M18B 5CP6A 3AZGC 3AZGD 3AV2D 2HIOB 2CV5B 3W98B 1P3LA 5CPKA 1B6WA 3C1CB 1JFIA 5DNNB 5BT1D 1P3BC 1P3BD 4CSRB 3REKC 3AZKA 3TU4A 5B2JA 5GXQD 5B31D 2RIQA 3AZED 3REJA 3AN2B 3X1VA 2YFVA 3X1UC 2RVQC 2RVQD 5B1LB 3MGQA 4KHAA 4KUDA 4J8XA 4G92B 5JA4B 3A6NB 5DNMD 3AN2C 1U35C 1U35D 2JCHA 5B2IA 1TAFA 5AVBA 2F8ND 4UUZB 3AZID 5GT0B 1KX5B 3W96D 3AZMA 3KUYC 3KXBC 3O62B 3KXBD 3KUYD 3REID 1P3OB 1BH9B 5GSUD 3AFAC 4ZBJC 4XZQA 2BYKA 2F8NH 4LD9D 3MGPD 4H9PA 3AZLB 3V9RA 5DNMA 2BYMA 3LELC 5B32G 4R8PB 3KWQD 3AZIA 3AYWC 2Y2LA 4Z66A 3W96A 4JJND 3REIA 5AV8B 3LZ0B 5GSUA 3WAAC 3WAAD 4Z5TB 1P3AD 5AV6A 3X1SB 3AZND 5BNVA 4R8PC 5BO0A 5B0ZD 4X23D 4WU9A 1M18A 5AV9D 3UTBB 3W98A 2Y2OA 1P34C 3MNNB 1P34D 1EQZB 3KFUG 1N1JB 5GT3B 2Y2JA 4G91C 5DNNA 5B32A 3REHD 5AY8B 3VH6A 4CSRA 3WA9A 4J8WB 4H9OA 3MGSC 3MGSD 1ID3C 1ID3D 1ZLAC 5B1LA 4ZUXB 2NQBC 5AV9A 1TZYB 1PZRA 3AZFD 1P3IC 4KGCD 4WU8D 5E5AB 2ZY2A 4UUZA 2F2AC 1KX4C 2VQRA 5GT0A 2FJ7C 3AZHB 2FJ7D 3B0DC 3O62A 1P3OA 1BH9A 2IO5C 3P5JB 5B40B 5CHLB 1M1AC 3EPKA 3B6GD 3UT9C 3UT9D 2NZDD 5B33C 5B33D 1S32B 3X1TB 3WKJB 2JSSA 4NE3A 3LZ0A 1HQ3B 4WNNB 1M19B 1P3KC 2UWXA 3X1SA 3AZJC 5B0YC 2PYOC 2PYOD 2G5IC 3B0CT 4WJ3C 5B1MA 3MNNA 5JRGD 1KX3B 3UTAB 4HGAB 5B24C 5B24D 1N1JA 3LJAD 3LJAC 3RELC 1P3PB 3AV1C 1BH8B 3NQUB 3AV1D 4XUJB 4J8VB 4QLCC 5CPIC 5C3IC 3WTPC 1BFMA 4ZUXA 1P3MD 3W99C 2Y2KA 2L5AA 3LZ1C 4YM6C 3LZ1D 1P3GD 4YS3A 2AROC 5JRGA 2Y2IA 3A1IA 5AV5B 4EO5C 1P3FC 1P3FD 5KDMB 3AZHA 3C1BD 1F66A 5CP6C 5CP6D 1AOIB 5AVCA 4J8UB 3VH6W 1P3LC 1P3LD 1P3GA 2Y2PA 4M6BA 3AZGB 5CPKC 5CPKD 5F99A 3AZKD 3TU4D 5B2JD 3X1VD 5CPJD 3X1TA 3REJD 1P3BB 3H0RC 1B67A 1A7WA 3REKB 3MGQD 4KUDD 4J8XD 3X1UB 3AV2C 1HQ3A 4WNNA 1M19A 2J8PA 5BT1C 1T3UA 4UPKA 5B2ID 5AVBD 5GXQC 5B31C 3UTAA 3AZEC 1H3OB 3AZMD 1U35B 4H9QA 2F8NB 5G49B 4J8VA 3KUYB 3KXBB 4XZQD 3FDDA 3W97D 3AFAB 4ZBJB 5DNMC 3AZIC 3LELB 3IP4C 3W96C 4Z66D 2XD5A 3MVDA 3REIC 3AYWB 5GSUC 5AV5A 4LD9C 5KDMA 5AV6D 3MGPC 3W97A 3WAAB 4E44A 4WU9D 1M18D 3B6FA 3W98D 3KWQC 1P34B 5B32C 5DNND 5B32D 4JJNC 1KX3D 1HTAA 3WA9C 3MGRA 5BS7A 3WA9D 4G91B 1P3AC 5B1LD 3REKA 3AZNC 5B0ZB 5B0ZC 4X23C 3MGSB 1ID3B 1ZLAB 5AV9C 3X1UA 4DQYB 2CV5A 2HIOA 3A6ND 2NQBB 3C1CA 3REHC 1P3IB 4H9SC 3VH5A 5GT0D 3AN2A 3O62D 1P3OD 1KX4B 3R45B 2FJ7B 3B0DB 5JA4A 3A6NA 2IO5B 3AZLD 3AZFC 1M1AB 3EPHA 4KGCC 4WU8C 2Y2QA 3UT9B 5B33B 3LELA 1KX5A 4AWLC 4H9RB 3LZ0D 3AYWA 4Z5TD 2F8NK 2ZM5A 3B6GC 3X1SD 3AZLA 2NZDC 1P3KB 5B1MC 5B1MD 2PYOB 3MNND 3AZJB 5B0YB 4CAYB 4R8PA 1EQZD 2BG1A 3B0BA 4DRBA 5B24B 3LJAB 5AV8A 3RELB 4Z2MH 3AV1B 2W8SA 4Z5TA 4ZUXD 4QLCB 5CPIB 1ZLAA 4YS3C 4YS3D 3UTBA 5C3IB 3WTPB 1TZYD 5JRGC 3W99B 1EQZA 3LZ1B 3NQJB 4YM6B 2NQBA 2AROB 5GT3A 5AY8A 1P3IA 4J8WA 1F66C 3AZHD 2Y2HA 1F66D 1P3MC 4EO5B 1KX4A 1Z2CB 3R45A 1P3FB 5AVCC 5AVCD 5B40D 1P3GC 3H0MC 1TZYA 5CP6B 3H0LC 5F99C 5F99D 4X23B 1P3LB 1M1AA 5CPKB 1WWIA 5E5AA 3X1TD 1R4VA 3C1BC 3EG5B 2YFVB 1HQ3D 4KHAB 3VH6T 5B40A 1M19D 1Q9CA 3AV2B 1P3KA 3AZKC 2CWEA 3TU4C 5B2JC 5B0YA 3X1VC 2HUEC 2Y2GA 4CAYA 3REJC 3UTAD 3AZJA 5CPJC 1S32A 3MGQC 3WKJA 4KUDC 5GXQB 5B31B 3AZEB 4XUJD 4J8XC 4J8VD 3RELA 4QLCA 4H9PB 5AVBC 5B2IC 5CPIA 3AL0C 5DNMB 3WTPA 1KX3A 3AZMC 3NQJA 4YM6A 3MVDD 3MVDC 1P3PA 3AZIB 1BH8A 2AROA 3NQUA 4WZSB 3W96B 4XUJA 4XZQC 5AV5D 3REIB 3W97C 5GSUB 3B6FC 3B6FD 4LD9B 3MGPB 3EPJA 3A1KA 5BNVB 5BNXB 5BO0B 4NE6A 4Z66C 2XD1A 3EPLA 3KWQB 3MGRC 5BS7C 3MGRD 5B31G 5B32B 4JJNB 5AV6C 3REKD 3WA9B 4H9OB 4WU9C 1P3AB 1M18C 3X1UD 2CV5C 3WTPE 2CV5D 2HIOC 2HIOD 3AZNB 1AOIA 3W98C 4J8UA 4WV4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 B;  3AZG A;  3C1C C;  3C1C D;  3AV2 A;  5DNN C;  2F8N G;  3AN2 D;  3REH B;  1P3B A;  5B1L C;  4NE5 A;  5GXQ A;  5B31 A;  3AZE A;  4G92 C;  3A6N C;  3AFA D;  3AZF B;  4KGC B;  3LEL D;  5GT0 C;  4WU8 B;  1KX5 C;  1KX5 D;  1H3O A;  1WWS A;  1U35 A;  3O62 C;  2F8N A;  1P3O C;  5G49 A;  3AYW D;  4AWL B;  3KUY A;  3KXB A;  3AZL C;  3AFA A;  4LD9 A;  3B6G B;  5FUG B;  3MGP A;  5BNX A;  4R8P D;  2NZD B;  5B1M B;  1KU5 A;  5AV8 C;  5AV8 D;  3LZ0 C;  3KWQ A;  4JJN A;  4Z5T C;  3X1S C;  3WAA A;  1P3A A;  1ZLA D;  3UTB C;  3UTB D;  3MNN C;  3AZN A;  1EQZ C;  5B0Z A;  4X23 A;  2NQB D;  4YS3 B;  5GT3 C;  5GT3 D;  1P34 A;  5JRG B;  5AY8 C;  5AY8 D;  1P3I D;  4J8W C;  4J8W D;  2YFW B;  3REH A;  4ZUX C;  1KX4 D;  4H9S A;  1F66 B;  3KSY A;  3MGS A;  1ID3 A;  1TZY C;  1P3M B;  5AVC B;  4H9N B;  4Z2M G;  1P3G B;  1M1A D;  5E5A C;  5E5A D;  5F99 B;  3AZF A;  4KGC A;  4WU8 A;  3AZH C;  5B40 C;  3C1B B;  2FJ7 A;  4NFT A;  1P3K D;  3B6G A;  5FUG A;  3UT9 A;  5B0Y D;  3AZJ D;  3X1T C;  1S32 C;  1S32 D;  1JFI B;  3B0C W;  2NZD A;  5B33 A;  3AZK B;  3TU4 B;  3WKJ C;  5B2J B;  3X1V B;  5CPJ B;  2HUE B;  3WKJ D;  3REJ B;  4H9R A;  4H9Q B;  3REL D;  1HQ3 C;  3MGQ B;  1ULY A;  4KUD B;  1M19 C;  3VH5 T;  4J8X B;  3VH5 W;  4QLC D;  5CPI D;  3WTP D;  2PYO A;  1KX3 C;  3W99 D;  4HGA C;  4DRA A;  3UTA C;  1P3P C;  4YM6 D;  1P3P D;  5B2I B;  5AVB B;  1TAF B;  2ARO D;  4XUJ C;  4J8V C;  5B24 A;  3MVD B;  3LJA A;  3AZM B;  2LY8 A;  3AV1 A;  2YFW A;  4XZQ B;  2BYK B;  3W97 B;  3V9R B;  2BYM B;  3B6F B;  1P3M A;  3W99 A;  4E45 A;  4H9N A;  3LZ1 A;  4Z66 B;  5AV5 C;  3MGR B;  1P3F A;  5AV6 B;  1AOI C;  1AOI D;  3C1B A;  4J8U C;  4J8U D;  1F1E A;  4WU9 B;  1M18 B;  5CP6 A;  3AZG C;  3AZG D;  3AV2 D;  2HIO B;  2CV5 B;  3W98 B;  1P3L A;  5CPK A;  1B6W A;  3C1C B;  1JFI A;  5DNN B;  5BT1 D;  1P3B C;  1P3B D;  4CSR B;  3REK C;  3AZK A;  3TU4 A;  5B2J A;  5GXQ D;  5B31 D;  3AZE D;  3X1V A;  3REJ A;  3AN2 B;  5CPJ A;  2YFV A;  3X1U C;  2RVQ C;  2RVQ D;  5B1L B;  3MGQ A;  4KHA A;  4KUD A;  4J8X A;  4G92 B;  5JA4 B;  3A6N B;  5DNM D;  3AN2 C;  1U35 C;  1U35 D;  5B2I A;  5AVB A;  1TAF A;  2F8N D;  4UUZ B;  3AZI D;  5GT0 B;  1KX5 B;  3W96 D;  3AZM A;  3KUY C;  3KXB C;  3O62 B;  3KXB D;  3KUY D;  3REI D;  1P3O B;  1BH9 B;  5GSU D;  3AFA C;  4ZBJ C;  4XZQ A;  2BYK A;  2F8N H;  4LD9 D;  3MGP D;  4H9P A;  3AZL B;  3V9R A;  5DNM A;  2BYM A;  3LEL C;  5B32 G;  4R8P B;  3KWQ D;  3AZI A;  3AYW C;  4Z66 A;  3W96 A;  4JJN D;  3REI A;  5AV8 B;  3LZ0 B;  5GSU A;  3WAA C;  3WAA D;  4Z5T B;  1P3A D;  5AV6 A;  3X1S B;  3AZN D;  5BNV A;  4R8P C;  5BO0 A;  5B0Z D;  4X23 D;  4WU9 A;  1M18 A;  5AV9 D;  3UTB B;  3W98 A;  1P34 C;  1P34 D;  3MNN B;  1EQZ B;  1N1J B;  5GT3 B;  4G91 C;  5DNN A;  5B32 A;  3REH D;  5AY8 B;  3VH6 A;  4CSR A;  3WA9 A;  4J8W B;  4H9O A;  3MGS C;  3MGS D;  1ID3 C;  1ID3 D;  1ZLA C;  5B1L A;  4ZUX B;  2NQB C;  5AV9 A;  1TZY B;  3AZF D;  1P3I C;  4KGC D;  4WU8 D;  5E5A B;  4UUZ A;  1KX4 C;  5GT0 A;  2FJ7 C;  3AZH B;  2FJ7 D;  3B0D C;  3O62 A;  1P3O A;  1BH9 A;  2IO5 C;  5B40 B;  5CHL B;  1M1A C;  3B6G D;  3UT9 C;  3UT9 D;  2NZD D;  5B33 C;  5B33 D;  1S32 B;  3X1T B;  3WKJ B;  2JSS A;  4NE3 A;  3LZ0 A;  1HQ3 B;  4WNN B;  1M19 B;  1P3K C;  2PYO C;  3X1S A;  3AZJ C;  5B0Y C;  2PYO D;  3B0C T;  5B1M A;  3MNN A;  5JRG D;  1KX3 B;  3UTA B;  4HGA B;  5B24 C;  5B24 D;  1N1J A;  3LJA D;  3LJA C;  3REL C;  1P3P B;  3AV1 C;  1BH8 B;  3NQU B;  3AV1 D;  4XUJ B;  4J8V B;  4QLC C;  5CPI C;  5C3I C;  3WTP C;  1BFM A;  4ZUX A;  1P3M D;  3W99 C;  2L5A A;  3LZ1 C;  4YM6 C;  3LZ1 D;  1P3G D;  4YS3 A;  2ARO C;  5JRG A;  5AV5 B;  4EO5 C;  1P3F C;  1P3F D;  5KDM B;  3AZH A;  3C1B D;  1F66 A;  5CP6 C;  5CP6 D;  1AOI B;  5AVC A;  4J8U B;  3VH6 W;  1P3L C;  1P3L D;  1P3G A;  4M6B A;  3AZG B;  5CPK C;  5CPK D;  5F99 A;  3AZK D;  3TU4 D;  5B2J D;  3X1V D;  5CPJ D;  3X1T A;  3REJ D;  1P3B B;  1B67 A;  1A7W A;  3REK B;  3MGQ D;  4KUD D;  4J8X D;  3X1U B;  3AV2 C;  1HQ3 A;  4WNN A;  1M19 A;  5BT1 C;  5B2I D;  5AVB D;  5GXQ C;  5B31 C;  3UTA A;  3AZE C;  1H3O B;  3AZM D;  1U35 B;  4H9Q A;  2F8N B;  5G49 B;  4J8V A;  3KUY B;  3KXB B;  4XZQ D;  3W97 D;  3AFA B;  4ZBJ B;  5DNM C;  3AZI C;  3LEL B;  3W96 C;  4Z66 D;  3MVD A;  3REI C;  3AYW B;  5GSU C;  5AV5 A;  4LD9 C;  5KDM A;  5AV6 D;  3MGP C;  3W97 A;  3WAA B;  4E44 A;  4WU9 D;  1M18 D;  3B6F A;  3W98 D;  3KWQ C;  1P34 B;  5B32 C;  5DNN D;  5B32 D;  4JJN C;  1KX3 D;  1HTA A;  3WA9 C;  3MGR A;  5BS7 A;  3WA9 D;  4G91 B;  1P3A C;  5B1L D;  3REK A;  3AZN C;  5B0Z B;  5B0Z C;  4X23 C;  3MGS B;  1ID3 B;  1ZLA B;  5AV9 C;  3X1U A;  2CV5 A;  2HIO A;  3A6N D;  2NQB B;  3C1C A;  3REH C;  1P3I B;  4H9S C;  3VH5 A;  5GT0 D;  3AN2 A;  3O62 D;  1P3O D;  1KX4 B;  3R45 B;  2FJ7 B;  3B0D B;  5JA4 A;  3A6N A;  2IO5 B;  3AZL D;  3AZF C;  1M1A B;  4KGC C;  4WU8 C;  3UT9 B;  5B33 B;  3LEL A;  1KX5 A;  4AWL C;  4H9R B;  3LZ0 D;  3AYW A;  4Z5T D;  2F8N K;  3B6G C;  3X1S D;  3AZL A;  2NZD C;  1P3K B;  5B1M C;  5B1M D;  2PYO B;  3MNN D;  3AZJ B;  5B0Y B;  4CAY B;  4R8P A;  1EQZ D;  3B0B A;  4DRB A;  5B24 B;  3LJA B;  5AV8 A;  3REL B;  4Z2M H;  3AV1 B;  4Z5T A;  4ZUX D;  4QLC B;  5CPI B;  1ZLA A;  4YS3 C;  4YS3 D;  3UTB A;  5C3I B;  3WTP B;  1TZY D;  5JRG C;  3W99 B;  1EQZ A;  3LZ1 B;  3NQJ B;  4YM6 B;  2NQB A;  2ARO B;  5GT3 A;  5AY8 A;  1P3I A;  4J8W A;  1F66 C;  3AZH D;  1F66 D;  1P3M C;  4EO5 B;  1KX4 A;  1P3F B;  3R45 A;  5AVC C;  5AVC D;  5B40 D;  1P3G C;  1TZY A;  5CP6 B;  5F99 C;  5F99 D;  4X23 B;  1P3L B;  1M1A A;  5CPK B;  1WWI A;  5E5A A;  3X1T D;  1R4V A;  3C1B C;  2YFV B;  1HQ3 D;  4KHA B;  3VH6 T;  5B40 A;  1M19 D;  1Q9C A;  3AV2 B;  1P3K A;  3AZK C;  2CWE A;  3TU4 C;  5B2J C;  5B0Y A;  3X1V C;  2HUE C;  3UTA D;  4CAY A;  3REJ C;  3AZJ A;  5CPJ C;  1S32 A;  3MGQ C;  3WKJ A;  4KUD C;  5GXQ B;  5B31 B;  3AZE B;  4XUJ D;  4J8X C;  4J8V D;  3REL A;  4QLC A;  4H9P B;  5AVB C;  5B2I C;  5CPI A;  5DNM B;  3WTP A;  1KX3 A;  3AZM C;  3NQJ A;  4YM6 A;  3MVD D;  3MVD C;  1P3P A;  3AZI B;  1BH8 A;  2ARO A;  3NQU A;  4WZS B;  3W96 B;  4XUJ A;  4XZQ C;  5AV5 D;  3REI B;  3W97 C;  5GSU B;  3B6F C;  3B6F D;  4LD9 B;  3MGP B;  5BNV B;  5BNX B;  5BO0 B;  4NE6 A;  4Z66 C;  3KWQ B;  3MGR C;  5BS7 C;  3MGR D;  5B31 G;  5B32 B;  4JJN B;  5AV6 C;  3REK D;  3WA9 B;  4H9O B;  4WU9 C;  1P3A B;  1M18 C;  3X1U D;  2CV5 C;  3WTP E;  2CV5 D;  2HIO C;  2HIO D;  3AZN B;  1AOI A;  3W98 C;  4J8U A;  4WV4 B; 
#chains in the Genus database with same CATH topology
 5AV9 B;  3AZG A;  3C1C C;  3C1C D;  3AV2 A;  5DNN C;  2F8N G;  3AN2 D;  3REH B;  1P3B A;  5B1L C;  4NE5 A;  5GXQ A;  5B31 A;  3AZE A;  4G92 C;  3A6N C;  3AFA D;  2G5H C;  3AZF B;  4KGC B;  3LEL D;  5GT0 C;  4WU8 B;  1KX5 C;  1KX5 D;  1H3O A;  1WWS A;  1U35 A;  3O62 C;  2F8N A;  1P3O C;  5G49 A;  3AYW D;  4AWL B;  3KUY A;  3KXB A;  5CPJ A;  3AZL C;  2ZY5 A;  3AFA A;  4LD9 A;  3B6G B;  5FUG B;  3MGP A;  5BNX A;  4R8P D;  2NZD B;  5B1M B;  1KU5 A;  5AV8 C;  5AV8 D;  3LZ0 C;  3KWQ A;  2DF4 C;  2Y2N A;  4Z5T C;  4JJN A;  3X1S C;  3WAA A;  1P3A A;  1ZLA D;  3UTB C;  3UTB D;  3MNN C;  3AZN A;  1EQZ C;  5B0Z A;  4X23 A;  2NQB D;  4YS3 B;  5GT3 C;  5GT3 D;  2Y2M A;  1P34 A;  5JRG B;  5AY8 C;  5AY8 D;  1P3I D;  4J8W C;  4J8W D;  2YFW B;  3REH A;  4ZUX C;  1KX4 D;  4H9S A;  1F66 B;  3KSY A;  3MGS A;  1ID3 A;  1TZY C;  1P3M B;  5AVC B;  4H9N B;  4Z2M G;  1P3G B;  1M1A D;  5E5A C;  5E5A D;  5F99 B;  2FFF B;  3AZF A;  4KGC A;  4WU8 A;  3AZH C;  5B40 C;  3C1B B;  2FJ7 A;  4NFT A;  1P3K D;  3B6G A;  5FUG A;  3UT9 A;  5B0Y D;  3AZJ D;  3X1T C;  1S32 C;  1S32 D;  1JFI B;  3B0C W;  2NZD A;  5B33 A;  3AZK B;  3TU4 B;  3WKJ C;  5B2J B;  3X1V B;  5CPJ B;  2HUE B;  3WKJ D;  3REJ B;  4H9R A;  2ZY4 A;  3F6T A;  4H9Q B;  3REL D;  1HQ3 C;  3MGQ B;  1ULY A;  4KUD B;  1M19 C;  3VH5 T;  4J8X B;  3VH5 W;  4QLC D;  2JE5 A;  5CPI D;  2ZY3 A;  3WTP D;  2PYO A;  1KX3 C;  3W99 D;  4HGA C;  4DRA A;  3UTA C;  1P3P C;  4YM6 D;  1P3P D;  5B2I B;  5AVB B;  1TAF B;  2ARO D;  4XUJ C;  4J8V C;  5B24 A;  3MVD B;  3LJA A;  3AZM B;  2LY8 A;  3AV1 A;  2YFW A;  4XZQ B;  2BYK B;  3W97 B;  3V9R B;  2BYM B;  3B6F B;  1P3M A;  3W99 A;  4E45 A;  4H9N A;  3LZ1 A;  4Z66 B;  2DQN C;  1W2E A;  5AV5 C;  3MGR B;  1P3F A;  5AV6 B;  1AOI C;  1AOI D;  3C1B A;  4J8U C;  4J8U D;  1F1E A;  4WU9 B;  1M18 B;  5CP6 A;  3AZG C;  3AZG D;  3AV2 D;  2HIO B;  2CV5 B;  3W98 B;  1P3L A;  5CPK A;  1B6W A;  3C1C B;  1JFI A;  5DNN B;  5BT1 D;  1P3B C;  1P3B D;  4CSR B;  3REK C;  3AZK A;  3TU4 A;  5B2J A;  5GXQ D;  5B31 D;  2RIQ A;  3AZE D;  3REJ A;  3AN2 B;  3X1V A;  2YFV A;  3X1U C;  2RVQ C;  2RVQ D;  5B1L B;  3MGQ A;  4KHA A;  4KUD A;  4J8X A;  4G92 B;  5JA4 B;  3A6N B;  5DNM D;  3AN2 C;  1U35 C;  1U35 D;  2JCH A;  5B2I A;  1TAF A;  5AVB A;  2F8N D;  4UUZ B;  3AZI D;  5GT0 B;  1KX5 B;  3W96 D;  3AZM A;  3KUY C;  3KXB C;  3O62 B;  3KXB D;  3KUY D;  3REI D;  1P3O B;  1BH9 B;  5GSU D;  3AFA C;  4ZBJ C;  4XZQ A;  2BYK A;  2F8N H;  4LD9 D;  3MGP D;  4H9P A;  3AZL B;  3V9R A;  5DNM A;  2BYM A;  3LEL C;  5B32 G;  4R8P B;  3KWQ D;  3AZI A;  3AYW C;  2Y2L A;  4Z66 A;  3W96 A;  4JJN D;  3REI A;  5AV8 B;  3LZ0 B;  5GSU A;  3WAA C;  3WAA D;  4Z5T B;  1P3A D;  5AV6 A;  3X1S B;  3AZN D;  5BNV A;  4R8P C;  5BO0 A;  5B0Z D;  4X23 D;  4WU9 A;  1M18 A;  5AV9 D;  3UTB B;  3W98 A;  2Y2O A;  1P34 C;  3MNN B;  1P34 D;  1EQZ B;  3KFU G;  1N1J B;  5GT3 B;  2Y2J A;  4G91 C;  5DNN A;  5B32 A;  3REH D;  5AY8 B;  3VH6 A;  4CSR A;  3WA9 A;  4J8W B;  4H9O A;  3MGS C;  3MGS D;  1ID3 C;  1ID3 D;  1ZLA C;  5B1L A;  4ZUX B;  2NQB C;  5AV9 A;  1TZY B;  1PZR A;  3AZF D;  1P3I C;  4KGC D;  4WU8 D;  5E5A B;  2ZY2 A;  4UUZ A;  2F2A C;  1KX4 C;  2VQR A;  5GT0 A;  2FJ7 C;  3AZH B;  2FJ7 D;  3B0D C;  3O62 A;  1P3O A;  1BH9 A;  2IO5 C;  3P5J B;  5B40 B;  5CHL B;  1M1A C;  3EPK A;  3B6G D;  3UT9 C;  3UT9 D;  2NZD D;  5B33 C;  5B33 D;  1S32 B;  3X1T B;  3WKJ B;  2JSS A;  4NE3 A;  3LZ0 A;  1HQ3 B;  4WNN B;  1M19 B;  1P3K C;  2UWX A;  3X1S A;  3AZJ C;  5B0Y C;  2PYO C;  2PYO D;  2G5I C;  3B0C T;  4WJ3 C;  5B1M A;  3MNN A;  5JRG D;  1KX3 B;  3UTA B;  4HGA B;  5B24 C;  5B24 D;  1N1J A;  3LJA D;  3LJA C;  3REL C;  1P3P B;  3AV1 C;  1BH8 B;  3NQU B;  3AV1 D;  4XUJ B;  4J8V B;  4QLC C;  5CPI C;  5C3I C;  3WTP C;  1BFM A;  4ZUX A;  1P3M D;  3W99 C;  2Y2K A;  2L5A A;  3LZ1 C;  4YM6 C;  3LZ1 D;  1P3G D;  4YS3 A;  2ARO C;  5JRG A;  2Y2I A;  3A1I A;  5AV5 B;  4EO5 C;  1P3F C;  1P3F D;  5KDM B;  3AZH A;  3C1B D;  1F66 A;  5CP6 C;  5CP6 D;  1AOI B;  5AVC A;  4J8U B;  3VH6 W;  1P3L C;  1P3L D;  1P3G A;  2Y2P A;  4M6B A;  3AZG B;  5CPK C;  5CPK D;  5F99 A;  3AZK D;  3TU4 D;  5B2J D;  3X1V D;  5CPJ D;  3X1T A;  3REJ D;  1P3B B;  3H0R C;  1B67 A;  1A7W A;  3REK B;  3MGQ D;  4KUD D;  4J8X D;  3X1U B;  3AV2 C;  1HQ3 A;  4WNN A;  1M19 A;  2J8P A;  5BT1 C;  1T3U A;  4UPK A;  5B2I D;  5AVB D;  5GXQ C;  5B31 C;  3UTA A;  3AZE C;  1H3O B;  3AZM D;  1U35 B;  4H9Q A;  2F8N B;  5G49 B;  4J8V A;  3KUY B;  3KXB B;  4XZQ D;  3FDD A;  3W97 D;  3AFA B;  4ZBJ B;  5DNM C;  3AZI C;  3LEL B;  3IP4 C;  3W96 C;  4Z66 D;  2XD5 A;  3MVD A;  3REI C;  3AYW B;  5GSU C;  5AV5 A;  4LD9 C;  5KDM A;  5AV6 D;  3MGP C;  3W97 A;  3WAA B;  4E44 A;  4WU9 D;  1M18 D;  3B6F A;  3W98 D;  3KWQ C;  1P34 B;  5B32 C;  5DNN D;  5B32 D;  4JJN C;  1KX3 D;  1HTA A;  3WA9 C;  3MGR A;  5BS7 A;  3WA9 D;  4G91 B;  1P3A C;  5B1L D;  3REK A;  3AZN C;  5B0Z B;  5B0Z C;  4X23 C;  3MGS B;  1ID3 B;  1ZLA B;  5AV9 C;  3X1U A;  4DQY B;  2CV5 A;  2HIO A;  3A6N D;  2NQB B;  3C1C A;  3REH C;  1P3I B;  4H9S C;  3VH5 A;  5GT0 D;  3AN2 A;  3O62 D;  1P3O D;  1KX4 B;  3R45 B;  2FJ7 B;  3B0D B;  5JA4 A;  3A6N A;  2IO5 B;  3AZL D;  3AZF C;  1M1A B;  3EPH A;  4KGC C;  4WU8 C;  2Y2Q A;  3UT9 B;  5B33 B;  3LEL A;  1KX5 A;  4AWL C;  4H9R B;  3LZ0 D;  3AYW A;  4Z5T D;  2F8N K;  2ZM5 A;  3B6G C;  3X1S D;  3AZL A;  2NZD C;  1P3K B;  5B1M C;  5B1M D;  2PYO B;  3MNN D;  3AZJ B;  5B0Y B;  4CAY B;  4R8P A;  1EQZ D;  2BG1 A;  3B0B A;  4DRB A;  5B24 B;  3LJA B;  5AV8 A;  3REL B;  4Z2M H;  3AV1 B;  2W8S A;  4Z5T A;  4ZUX D;  4QLC B;  5CPI B;  1ZLA A;  4YS3 C;  4YS3 D;  3UTB A;  5C3I B;  3WTP B;  1TZY D;  5JRG C;  3W99 B;  1EQZ A;  3LZ1 B;  3NQJ B;  4YM6 B;  2NQB A;  2ARO B;  5GT3 A;  5AY8 A;  1P3I A;  4J8W A;  1F66 C;  3AZH D;  2Y2H A;  1F66 D;  1P3M C;  4EO5 B;  1KX4 A;  1Z2C B;  3R45 A;  1P3F B;  5AVC C;  5AVC D;  5B40 D;  1P3G C;  3H0M C;  1TZY A;  5CP6 B;  3H0L C;  5F99 C;  5F99 D;  4X23 B;  1P3L B;  1M1A A;  5CPK B;  1WWI A;  5E5A A;  3X1T D;  1R4V A;  3C1B C;  3EG5 B;  2YFV B;  1HQ3 D;  4KHA B;  3VH6 T;  5B40 A;  1M19 D;  1Q9C A;  3AV2 B;  1P3K A;  3AZK C;  2CWE A;  3TU4 C;  5B2J C;  5B0Y A;  3X1V C;  2HUE C;  2Y2G A;  4CAY A;  3REJ C;  3UTA D;  3AZJ A;  5CPJ C;  1S32 A;  3MGQ C;  3WKJ A;  4KUD C;  5GXQ B;  5B31 B;  3AZE B;  4XUJ D;  4J8X C;  4J8V D;  3REL A;  4QLC A;  4H9P B;  5AVB C;  5B2I C;  5CPI A;  3AL0 C;  5DNM B;  3WTP A;  1KX3 A;  3AZM C;  3NQJ A;  4YM6 A;  3MVD D;  3MVD C;  1P3P A;  3AZI B;  1BH8 A;  2ARO A;  3NQU A;  4WZS B;  3W96 B;  4XUJ A;  4XZQ C;  5AV5 D;  3REI B;  3W97 C;  5GSU B;  3B6F C;  3B6F D;  4LD9 B;  3MGP B;  3EPJ A;  3A1K A;  5BNV B;  5BNX B;  5BO0 B;  4NE6 A;  4Z66 C;  2XD1 A;  3EPL A;  3KWQ B;  3MGR C;  5BS7 C;  3MGR D;  5B31 G;  5B32 B;  4JJN B;  5AV6 C;  3REK D;  3WA9 B;  4H9O B;  4WU9 C;  1P3A B;  1M18 C;  3X1U D;  2CV5 C;  3WTP E;  2CV5 D;  2HIO C;  2HIO D;  3AZN B;  1AOI A;  3W98 C;  4J8U A;  4WV4 B; 
#chains in the Genus database with same CATH homology
 5AV9 B;  3AZG A;  3C1C C;  3C1C D;  3AV2 A;  5DNN C;  2F8N G;  3AN2 D;  3REH B;  1P3B A;  5B1L C;  4NE5 A;  5GXQ A;  5B31 A;  3AZE A;  4G92 C;  3A6N C;  3AFA D;  2G5H C;  3AZF B;  4KGC B;  3LEL D;  5GT0 C;  4WU8 B;  1KX5 C;  1KX5 D;  1H3O A;  1WWS A;  1U35 A;  3O62 C;  2F8N A;  1P3O C;  5G49 A;  3AYW D;  4AWL B;  3KUY A;  3KXB A;  5CPJ A;  3AZL C;  2ZY5 A;  3AFA A;  4LD9 A;  3B6G B;  5FUG B;  3MGP A;  5BNX A;  4R8P D;  2NZD B;  5B1M B;  1KU5 A;  5AV8 C;  5AV8 D;  3LZ0 C;  3KWQ A;  2DF4 C;  2Y2N A;  4Z5T C;  4JJN A;  3X1S C;  3WAA A;  1P3A A;  1ZLA D;  3UTB C;  3UTB D;  3MNN C;  3AZN A;  1EQZ C;  5B0Z A;  4X23 A;  2NQB D;  4YS3 B;  5GT3 C;  5GT3 D;  2Y2M A;  1P34 A;  5JRG B;  5AY8 C;  5AY8 D;  1P3I D;  4J8W C;  4J8W D;  2YFW B;  3REH A;  4ZUX C;  1KX4 D;  4H9S A;  1F66 B;  3KSY A;  3MGS A;  1ID3 A;  1TZY C;  1P3M B;  5AVC B;  4H9N B;  4Z2M G;  1P3G B;  1M1A D;  5E5A C;  5E5A D;  5F99 B;  2FFF B;  3AZF A;  4KGC A;  4WU8 A;  3AZH C;  5B40 C;  3C1B B;  2FJ7 A;  4NFT A;  1P3K D;  3B6G A;  5FUG A;  3UT9 A;  5B0Y D;  3AZJ D;  3X1T C;  1S32 C;  1S32 D;  1JFI B;  3B0C W;  2NZD A;  5B33 A;  3AZK B;  3TU4 B;  3WKJ C;  5B2J B;  3X1V B;  5CPJ B;  2HUE B;  3WKJ D;  3REJ B;  4H9R A;  2ZY4 A;  3F6T A;  4H9Q B;  3REL D;  1HQ3 C;  3MGQ B;  1ULY A;  4KUD B;  1M19 C;  3VH5 T;  4J8X B;  3VH5 W;  4QLC D;  2JE5 A;  5CPI D;  2ZY3 A;  3WTP D;  2PYO A;  1KX3 C;  3W99 D;  4HGA C;  4DRA A;  3UTA C;  1P3P C;  4YM6 D;  1P3P D;  5B2I B;  5AVB B;  1TAF B;  2ARO D;  4XUJ C;  4J8V C;  5B24 A;  3MVD B;  3LJA A;  3AZM B;  2LY8 A;  3AV1 A;  2YFW A;  4XZQ B;  2BYK B;  3W97 B;  3V9R B;  2BYM B;  3B6F B;  1P3M A;  3W99 A;  4E45 A;  4H9N A;  3LZ1 A;  4Z66 B;  2DQN C;  1W2E A;  5AV5 C;  3MGR B;  1P3F A;  5AV6 B;  1AOI C;  1AOI D;  3C1B A;  4J8U C;  4J8U D;  1F1E A;  4WU9 B;  1M18 B;  5CP6 A;  3AZG C;  3AZG D;  3AV2 D;  2HIO B;  2CV5 B;  3W98 B;  1P3L A;  5CPK A;  1B6W A;  3C1C B;  1JFI A;  5DNN B;  5BT1 D;  1P3B C;  1P3B D;  4CSR B;  3REK C;  3AZK A;  3TU4 A;  5B2J A;  5GXQ D;  5B31 D;  2RIQ A;  3AZE D;  3REJ A;  3AN2 B;  3X1V A;  2YFV A;  3X1U C;  2RVQ C;  2RVQ D;  5B1L B;  3MGQ A;  4KHA A;  4KUD A;  4J8X A;  4G92 B;  5JA4 B;  3A6N B;  5DNM D;  3AN2 C;  1U35 C;  1U35 D;  2JCH A;  5B2I A;  1TAF A;  5AVB A;  2F8N D;  4UUZ B;  3AZI D;  5GT0 B;  1KX5 B;  3W96 D;  3AZM A;  3KUY C;  3KXB C;  3O62 B;  3KXB D;  3KUY D;  3REI D;  1P3O B;  1BH9 B;  5GSU D;  3AFA C;  4ZBJ C;  4XZQ A;  2BYK A;  2F8N H;  4LD9 D;  3MGP D;  4H9P A;  3AZL B;  3V9R A;  5DNM A;  2BYM A;  3LEL C;  5B32 G;  4R8P B;  3KWQ D;  3AZI A;  3AYW C;  2Y2L A;  4Z66 A;  3W96 A;  4JJN D;  3REI A;  5AV8 B;  3LZ0 B;  5GSU A;  3WAA C;  3WAA D;  4Z5T B;  1P3A D;  5AV6 A;  3X1S B;  3AZN D;  5BNV A;  4R8P C;  5BO0 A;  5B0Z D;  4X23 D;  4WU9 A;  1M18 A;  5AV9 D;  3UTB B;  3W98 A;  2Y2O A;  1P34 C;  3MNN B;  1P34 D;  1EQZ B;  3KFU G;  1N1J B;  5GT3 B;  2Y2J A;  4G91 C;  5DNN A;  5B32 A;  3REH D;  5AY8 B;  3VH6 A;  4CSR A;  3WA9 A;  4J8W B;  4H9O A;  3MGS C;  3MGS D;  1ID3 C;  1ID3 D;  1ZLA C;  5B1L A;  4ZUX B;  2NQB C;  5AV9 A;  1TZY B;  1PZR A;  3AZF D;  1P3I C;  4KGC D;  4WU8 D;  5E5A B;  2ZY2 A;  4UUZ A;  2F2A C;  1KX4 C;  2VQR A;  5GT0 A;  2FJ7 C;  3AZH B;  2FJ7 D;  3B0D C;  3O62 A;  1P3O A;  1BH9 A;  2IO5 C;  3P5J B;  5B40 B;  5CHL B;  1M1A C;  3EPK A;  3B6G D;  3UT9 C;  3UT9 D;  2NZD D;  5B33 C;  5B33 D;  1S32 B;  3X1T B;  3WKJ B;  2JSS A;  4NE3 A;  3LZ0 A;  1HQ3 B;  4WNN B;  1M19 B;  1P3K C;  2UWX A;  3X1S A;  3AZJ C;  5B0Y C;  2PYO C;  2PYO D;  2G5I C;  3B0C T;  4WJ3 C;  5B1M A;  3MNN A;  5JRG D;  1KX3 B;  3UTA B;  4HGA B;  5B24 C;  5B24 D;  1N1J A;  3LJA D;  3LJA C;  3REL C;  1P3P B;  3AV1 C;  1BH8 B;  3NQU B;  3AV1 D;  4XUJ B;  4J8V B;  4QLC C;  5CPI C;  5C3I C;  3WTP C;  1BFM A;  4ZUX A;  1P3M D;  3W99 C;  2Y2K A;  2L5A A;  3LZ1 C;  4YM6 C;  3LZ1 D;  1P3G D;  4YS3 A;  2ARO C;  5JRG A;  2Y2I A;  3A1I A;  5AV5 B;  4EO5 C;  1P3F C;  1P3F D;  5KDM B;  3AZH A;  3C1B D;  1F66 A;  5CP6 C;  5CP6 D;  1AOI B;  5AVC A;  4J8U B;  3VH6 W;  1P3L C;  1P3L D;  1P3G A;  2Y2P A;  4M6B A;  3AZG B;  5CPK C;  5CPK D;  5F99 A;  3AZK D;  3TU4 D;  5B2J D;  3X1V D;  5CPJ D;  3X1T A;  3REJ D;  1P3B B;  3H0R C;  1B67 A;  1A7W A;  3REK B;  3MGQ D;  4KUD D;  4J8X D;  3X1U B;  3AV2 C;  1HQ3 A;  4WNN A;  1M19 A;  2J8P A;  5BT1 C;  1T3U A;  4UPK A;  5B2I D;  5AVB D;  5GXQ C;  5B31 C;  3UTA A;  3AZE C;  1H3O B;  3AZM D;  1U35 B;  4H9Q A;  2F8N B;  5G49 B;  4J8V A;  3KUY B;  3KXB B;  4XZQ D;  3FDD A;  3W97 D;  3AFA B;  4ZBJ B;  5DNM C;  3AZI C;  3LEL B;  3IP4 C;  3W96 C;  4Z66 D;  2XD5 A;  3MVD A;  3REI C;  3AYW B;  5GSU C;  5AV5 A;  4LD9 C;  5KDM A;  5AV6 D;  3MGP C;  3W97 A;  3WAA B;  4E44 A;  4WU9 D;  1M18 D;  3B6F A;  3W98 D;  3KWQ C;  1P34 B;  5B32 C;  5DNN D;  5B32 D;  4JJN C;  1KX3 D;  1HTA A;  3WA9 C;  3MGR A;  5BS7 A;  3WA9 D;  4G91 B;  1P3A C;  5B1L D;  3REK A;  3AZN C;  5B0Z B;  5B0Z C;  4X23 C;  3MGS B;  1ID3 B;  1ZLA B;  5AV9 C;  3X1U A;  4DQY B;  2CV5 A;  2HIO A;  3A6N D;  2NQB B;  3C1C A;  3REH C;  1P3I B;  4H9S C;  3VH5 A;  5GT0 D;  3AN2 A;  3O62 D;  1P3O D;  1KX4 B;  3R45 B;  2FJ7 B;  3B0D B;  5JA4 A;  3A6N A;  2IO5 B;  3AZL D;  3AZF C;  1M1A B;  3EPH A;  4KGC C;  4WU8 C;  2Y2Q A;  3UT9 B;  5B33 B;  3LEL A;  1KX5 A;  4AWL C;  4H9R B;  3LZ0 D;  3AYW A;  4Z5T D;  2F8N K;  2ZM5 A;  3B6G C;  3X1S D;  3AZL A;  2NZD C;  1P3K B;  5B1M C;  5B1M D;  2PYO B;  3MNN D;  3AZJ B;  5B0Y B;  4CAY B;  4R8P A;  1EQZ D;  2BG1 A;  3B0B A;  4DRB A;  5B24 B;  3LJA B;  5AV8 A;  3REL B;  4Z2M H;  3AV1 B;  2W8S A;  4Z5T A;  4ZUX D;  4QLC B;  5CPI B;  1ZLA A;  4YS3 C;  4YS3 D;  3UTB A;  5C3I B;  3WTP B;  1TZY D;  5JRG C;  3W99 B;  1EQZ A;  3LZ1 B;  3NQJ B;  4YM6 B;  2NQB A;  2ARO B;  5GT3 A;  5AY8 A;  1P3I A;  4J8W A;  1F66 C;  3AZH D;  2Y2H A;  1F66 D;  1P3M C;  4EO5 B;  1KX4 A;  1Z2C B;  3R45 A;  1P3F B;  5AVC C;  5AVC D;  5B40 D;  1P3G C;  3H0M C;  1TZY A;  5CP6 B;  3H0L C;  5F99 C;  5F99 D;  4X23 B;  1P3L B;  1M1A A;  5CPK B;  1WWI A;  5E5A A;  3X1T D;  1R4V A;  3C1B C;  3EG5 B;  2YFV B;  1HQ3 D;  4KHA B;  3VH6 T;  5B40 A;  1M19 D;  1Q9C A;  3AV2 B;  1P3K A;  3AZK C;  2CWE A;  3TU4 C;  5B2J C;  5B0Y A;  3X1V C;  2HUE C;  2Y2G A;  4CAY A;  3REJ C;  3UTA D;  3AZJ A;  5CPJ C;  1S32 A;  3MGQ C;  3WKJ A;  4KUD C;  5GXQ B;  5B31 B;  3AZE B;  4XUJ D;  4J8X C;  4J8V D;  3REL A;  4QLC A;  4H9P B;  5AVB C;  5B2I C;  5CPI A;  3AL0 C;  5DNM B;  3WTP A;  1KX3 A;  3AZM C;  3NQJ A;  4YM6 A;  3MVD D;  3MVD C;  1P3P A;  3AZI B;  1BH8 A;  2ARO A;  3NQU A;  4WZS B;  3W96 B;  4XUJ A;  4XZQ C;  5AV5 D;  3REI B;  3W97 C;  5GSU B;  3B6F C;  3B6F D;  4LD9 B;  3MGP B;  3EPJ A;  3A1K A;  5BNV B;  5BNX B;  5BO0 B;  4NE6 A;  4Z66 C;  2XD1 A;  3EPL A;  3KWQ B;  3MGR C;  5BS7 C;  3MGR D;  5B31 G;  5B32 B;  4JJN B;  5AV6 C;  3REK D;  3WA9 B;  4H9O B;  4WU9 C;  1P3A B;  1M18 C;  3X1U D;  2CV5 C;  3WTP E;  2CV5 D;  2HIO C;  2HIO D;  3AZN B;  1AOI A;  3W98 C;  4J8U A;  4WV4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...