1KX4C

X-ray structure of the nucleosome core particle, ncp146b, at 2.6 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTAT
total genus 30
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx4C00
1F66B 3O62B 1P3OA 3LJAD 5CP6B 5FUGB 1H3OB 3AZGD 5AV8C 4CSRA 3WAAC 3C1CC 3KSYA 3X1SC 1M1AC 3KXBD 3LZ1B 5B2JB 3UTBB 4EO5C 3W99A 5G49B 5B2IA 4R8PC 3MGPA 1ID3A 4X23C 3O62C 5B31G 1TAFB 2BYMB 4CSRB 3AV2B 2CWEA 3AZJB 2YFWB 5GT3C 3W96C 5CPJD 1P3LA 3REIC 3REHD 3LELC 3AZEA 1ID3D 3RELD 4KGCC 1TAFA 3VH6W 3VH5T 2BYMA 5AV6D 3UT9B 3LZ0B 4J8XD 3REIA 4DRBA 5B0ZA 1P3MD 3W96A 3MGQB 4AWLB 2F8NG 3AFAB 1KX5A 1P3KB 1P3LB 3WKJC 3C1BD 5GT3A 1U35A 5F99C 3X1SB 3TU4C 3WTPD 4WU8C 5B2IC 3MGPC 1P3MB 3REIB 3X1UA 5B0ZB 5GSUB 3O62A 5B0ZD 5E5AB 5BNXB 1P3OB 3AZND 5GT3D 2AROC 3AZNB 3X1SA 3REHB 1F1EA 2AROD 3C1CA 3WAAA 1P3MA 3X1UB 5BNXA 2LY8A 3VH6T 5AVBC 1TZYD 5B2JA 3UTBA 3VH5W 5E5AC 3W99B 5B0YB 5GT0D 5B2IB 3MGPB 3AZNA 1ID3B 3B0DB 3REHA 1P34A 3C1BB 4Z66A 3C1CB 3WAAB 1P3FB 3AZJA 3AZGC 3MGQD 5B1LC 3W97B 5GT0C 3AV2D 1WWIA 5B31B 1P3PA 3UT9C 3LZ0C 4J8WD 3AZEB 3C1BA 1P3IC 4XZQC 4Z66B 5CPJB 1U35D 3MNNB 4XZQA 3LZ0A 2HIOC 3W96D 5AY8D 3MGQA 3AYWB 3W97A 3V9RA 3W96B 3WTPA 1EQZB 1P3KA 5GT3B 4Z66D 1U35B 5B0YD 5CP6D 1S32C 3MNNA 4G91C 4XZQB 4R8PD 1R4VA 5GSUA 3AYWA 3MGRC 5E5AA 4J8VA 3WTPB 3REKD 4H9SC 5BNVB 4J8XC 4J8WB 1BH9A 3KWQA 3AZMD 1TZYC 5CPKB 4J8VB 4J8VD 5AV9C 1KX4C 4NFTA 5AV5A 3B0CW 3AZGA 3A6ND 5B0YA 1P34B 4J8WA 1M19C 3AZNC 1BH9B 5GT0B 3KWQB 1P3FA 5F99A 3TU4A 4EO5B 1U35C 2NZDA 5CPKA 1HTAA 3X1TC 3AZKD 2RVQD 3LZ0D 5B31A 4J8XB 4J8WC 3B6FC 2IO5C 5B1MB 1P3PB 1M1AD 5CPJA 1P3LD 5AV5C 5F99B 3TU4B 3AN2D 2NZDB 3WKJB 5AV5D 3V9RB 5AVCC 4HGAB 4E44A 5BO0A 4J8XA 1EQZA 2NQBC 5B1MA 4WU8A 5AV6C 3AZED 3REKA 3LELD 3AZFC 2YFVA 1HQ3C 3KUYD 3WKJA 3AYWC 5B1MC 1M19D 1EQZC 5BT1D 5BO0B 5AY8B 3AYWD 3X1VB 2HIOD 1AOID 4WU8B 3B6GD 5AV9D 5BNVA 3W99D 4WU9C 5B2ID 3MGPD 1M18D 3LZ1D 5AVCD 2JSSA 3AZKB 3X1UD 1AOIB 2NZDD 3X1VA 5AV5B 1P3FD 3AZGB 3X1TA 2NZDC 4DRAA 1P3FC 3MVDD 3MGSB 5B33A 5GT0A 3W99C 4WU9D 5B0YC 2RVQC 4KGCD 4WZSB 3AZKA 3WA9B 1AOIA 1P3BD 3B6GC 5GXQA 3REID 4Z66C 4Z5TA 1P34C 2HUEC 5JRGB 3AV1B 4G92C 5B33B 1P34D 5B1MD 1M1AB 1P3OC 5CHLB 3AZMC 3UT9D 5GSUC 2F8ND 5B33D 2AROA 3REJA 3AV2C 3AN2C 5GXQC 3REKB 3MGSD 2YFVB 1P3KD 3AZHC 5GXQD 1WWSA 3W98A 5AY8A 3LZ1C 5B33C 4G91B 5CPKD 5BS7A 3MNND 2FJ7C 3AZID 3REJB 3NQUA 5AVBD 3LJAC 4ZBJC 4CAYB 5AV9B 5JRGD 3AV1D 4WNNA 3W98B 4NE3A 5B40B 2PYOA 3W98D 3A6NC 3KUYC 3X1TB 3AZJD 1F66C 1BH8A 3AZEC 3NQUB 3MGSA 4JJND 2FJ7B 4LD9D 4JJNB 1P3AA 1ZLAA 2FJ7D 4KUDD 4KUDB 3MVDB 2F8NH 4WNNB 5B1LD 4J8UD 3WA9A 3AZFA 5GXQB 3REKC 3WKJD 1P3BA 3C1CD 1M19A 3WAAD 4Z5TB 1P3MC 4R8PA 4NE5A 5JRGA 3AV1A 4JJNA 1P3AB 1JFIA 1ZLAB 2NQBA 4KUDA 1M1AA 4KUDC 4H9RA 3MGRB 3AZFB 4H9NB 5CPJC 4WV4B 5C3IC 2AROB 1ULYA 4H9SA 1KX3A 5B32B 1B67A 1KX5D 1P3PD 1TZYB 1P3ID 4H9RB 3MGRA 4J8VC 4H9NA 4YS3D 4QLCB 4Z2MH 3AZIC 4H9PA 4H9OB 3R45A 3KUYA 5DNNA 5B32G 3KXBC 3UTAB 1KX3B 1KX4A 4CAYA 5AV9A 3A6NA 3AFAD 1TZYA 3NQJA 3VH6A 1P3LC 5B40A 2PYOB 3KWQC 4QLCA 1M18C 3R45B 4J8UA 1BH8B 3WA9D 5DNNB 3UTAA 1P3AD 5CPIA 1P3GA 1ZLAD 2FJ7A 5DNMD 2IO5B 4YM6D 3AZLA 1P3PC 1KX4B 2F8NK 4LD9A 3MVDA 5B2JD 3NQJB 3UTBD 3W98C 1EQZD 2HUEB 1P3BB 1S32A 1M19B 3AN2A 4J8UB 1M18B 5AV6B 5AVCB 4XZQD 4R8PB 1KX4D 5CPIB 1P3GB 2NQBB 1JFIB 3WTPC 4LD9B 5AVBA 3WTPE 1BFMA 3W97D 3AN2B 3C1BC 1P3IA 3LELB 4ZUXA 5B24C 4Z5TC 1KX3D 5B32A 5AVBB 3B6GA 4YM6B 5DNMB 3REJD 1P3OD 4LD9C 3AZKC 5CP6C 1S32D 3AZLC 5CPIC 1P3GC 3UTAC 1F66D 5C3IB 4H9PB 1P3IB 4H9OA 3REHC 2BYKB 1N1JB 5B40D 3KUYB 4ZUXB 5BT1C 5B2JC 3UTBC 5B40C 3X1VC 3A6NB 5DNMA 4YM6A 3AZLD 3UTAD 5B0ZC 3O62D 3KXBA 5DNNC 3LJAB 4YS3B 3B0DC 4QLCD 1B6WA 4WU9A 1N1JA 2PYOD 4KGCA 5F99D 5JA4B 3TU4D 3X1SD 3AZLB 4Z2MG 3AZHD 2CV5B 4HGAC 1HQ3A 2CV5D 3X1UC 5KDMA 1S32B 4WU9B 1M18A 4KGCB 4YS3C 5AV6A 3VH5A 5AVCA 5JA4A 3AZMB 1ID3C 3RELA 1Q9CA 1KX5C 1HQ3B 2F8NA 4M6BA 5KDMB 5JRGC 3AV1C 3AZFD 5AV8A 5B31C 3B6FA 3LELA 5DNMC 4YM6C 1P3BC 3RELB 5B1LB 1KU5A 1A7WA 5CPKC 2NQBD 3WA9C 4H9QA 4WU8D 5B32D 3B6GB 4Z5TD 1KX3C 4ZBJB 3MGSC 5AV8B 5AV8D 4X23A 1F66A 2BYKA 3MGRD 5B32C 5FUGA 2PYOC 4H9QB 4KHAB 5DNND 4JJNC 3X1TD 3X1VD 4E45A 5B31D 3KXBB 3LJAA 3RELC 4YS3A 2L5AA 5AY8C 3LZ1A 5G49A 1HQ3D 2CV5A 4KHAA 3AZHA 1P3AC 1ZLAC 5CPID 1P3GD 4XUJC 4X23D 3AV2A 3REJC 3MNNC 2YFWA 4XUJA 5B24D 4NE6A 3KWQD 3MVDC 3AZMA 3MGQC 4AWLC 2CV5C 3AFAC 1P3KC 3AZHB 3W97C 2F8NB 4J8UC 4UUZB 2HIOA 3B0CT 4QLCC 3AZIB 5B24B 3UT9A 5GSUD 5BS7C 4XUJB 3B6FD 5E5AD 4XUJD 3B6FB 5B1LA 3AFAA 1KX5B 5CP6A 3B0BA 1H3OA 1AOIC 3AZJC 4ZUXD 4UUZA 4G92B 2HIOB 3AZIA 4ZUXC 5B24A 4X23B
chains in the Genus database with same CATH superfamily
1F66B 3O62B 1P3OA 3LJAD 5CP6B 5FUGB 1H3OB 3AZGD 5AV8C 4CSRA 3WAAC 3C1CC 3KSYA 3X1SC 1M1AC 3KXBD 3LZ1B 5B2JB 3UTBB 4EO5C 3W99A 5G49B 5B2IA 4R8PC 3MGPA 1ID3A 4X23C 3O62C 5B31G 1TAFB 2DF4C 2BYMB 4DQYB 4CSRB 3AV2B 2CWEA 3AZJB 2YFWB 2J8PA 2Y2KA 2UWXA 5GT3C 3W96C 5CPJD 1P3LA 3REIC 3REHD 3LELC 3AZEA 1ID3D 3RELD 4KGCC 3A1KA 1TAFA 2Y2IA 3VH5T 2BYMA 3VH6W 5AV6D 3UT9B 3LZ0B 4J8XD 3REIA 4DRBA 5B0ZA 2XD1A 3F6TA 1P3MD 3W96A 3MGQB 4AWLB 2F8NG 3AFAB 1KX5A 1P3KB 1P3LB 3WKJC 3C1BD 2JE5A 5GT3A 1U35A 5F99C 3X1SB 3TU4C 3WTPD 4WU8C 5B2IC 3MGPC 1P3MB 3REIB 3X1UA 5B0ZB 5GSUB 3O62A 5B0ZD 5E5AB 5BNXB 1P3OB 3AZND 5GT3D 2AROC 3AZNB 3X1SA 3REHB 1F1EA 2AROD 3C1CA 3WAAA 1P3MA 3X1UB 5BNXA 2LY8A 3VH6T 5AVBC 1TZYD 5B2JA 3UTBA 3VH5W 5E5AC 3IP4C 3W99B 5B0YB 5GT0D 5B2IB 3MGPB 3AZNA 1ID3B 3B0DB 3REHA 1P34A 3C1BB 4Z66A 3C1CB 3WAAB 1P3FB 3AZJA 3AZGC 3MGQD 5B1LC 3W97B 5GT0C 3AV2D 1WWIA 5B31B 1P3PA 3UT9C 3LZ0C 4J8WD 3AZEB 3C1BA 1P3IC 4XZQC 4Z66B 5CPJB 1U35D 3MNNB 4XZQA 3LZ0A 2HIOC 3W96D 5AY8D 3MGQA 3AYWB 3W97A 3V9RA 3W96B 3WTPA 1EQZB 1P3KA 5GT3B 4Z66D 1U35B 1Z2CB 5B0YD 5CP6D 1S32C 3MNNA 4G91C 4XZQB 4R8PD 2Y2HA 1R4VA 5GSUA 3AYWA 3MGRC 5E5AA 4J8VA 3WTPB 3H0MC 3REKD 4H9SC 5BNVB 2FFFB 4J8XC 4J8WB 1BH9A 3KWQA 3AZMD 1TZYC 5CPKB 4J8VB 4J8VD 5AV9C 1KX4C 4NFTA 5AV5A 3B0CW 3AZGA 3A6ND 5B0YA 1P34B 4J8WA 1M19C 3AZNC 1BH9B 5GT0B 3KWQB 1P3FA 5F99A 3TU4A 4EO5B 1U35C 2NZDA 5CPKA 1HTAA 3X1TC 3AZKD 2RVQD 3LZ0D 5B31A 4J8XB 4J8WC 3B6FC 2IO5C 5B1MB 1P3PB 3H0RC 1M1AD 5CPJA 1P3LD 5AV5C 5F99B 3TU4B 3AN2D 2NZDB 3WKJB 2G5HC 5AV5D 2Y2OA 3V9RB 5AVCC 4HGAB 4E44A 5BO0A 4J8XA 1EQZA 2NQBC 5B1MA 4WU8A 5AV6C 3AZED 3REKA 3LELD 3AZFC 2YFVA 1HQ3C 3KUYD 3WKJA 3AYWC 5B1MC 1M19D 1EQZC 2ZY5A 5BT1D 5BO0B 5AY8B 3AYWD 3X1VB 2HIOD 1AOID 2JCHA 4WU8B 3B6GD 5AV9D 5BNVA 3W99D 4WU9C 5B2ID 3MGPD 4WJ3C 1T3UA 1M18D 3LZ1D 5AVCD 2JSSA 3EPKA 3X1UD 3AZKB 1AOIB 2XD5A 2NZDD 3X1VA 5AV5B 1P3FD 3AZGB 3X1TA 2NZDC 4DRAA 2Y2JA 1P3FC 3MVDD 3MGSB 5B33A 5GT0A 3W99C 4WU9D 5B0YC 2RVQC 4KGCD 4WZSB 3AZKA 2RIQA 1AOIA 3WA9B 1P3BD 3B6GC 5GXQA 3REID 3P5JB 4Z66C 4Z5TA 1P34C 2HUEC 5JRGB 3AV1B 4G92C 5B33B 1P34D 2G5IC 5B1MD 1M1AB 3AL0C 1P3OC 5CHLB 3AZMC 3UT9D 5GSUC 2F8ND 2DQNC 5B33D 2AROA 3REJA 3AV2C 3AN2C 1PZRA 5GXQC 3REKB 3MGSD 2YFVB 1P3KD 3AZHC 5GXQD 1WWSA 3W98A 5AY8A 3LZ1C 5B33C 4G91B 5CPKD 5BS7A 3MNND 2FJ7C 3AZID 3REJB 3NQUA 5AVBD 3LJAC 2Y2LA 4ZBJC 3EPLA 4CAYB 5AV9B 5JRGD 3EPJA 3AV1D 4UPKA 4WNNA 3W98B 4NE3A 5B40B 2PYOA 3W98D 3A6NC 3KUYC 3X1TB 3AZJD 1F66C 1BH8A 3AZEC 3NQUB 3MGSA 4JJND 2FJ7B 4LD9D 4JJNB 1P3AA 1ZLAA 2FJ7D 4KUDD 4KUDB 3MVDB 2F8NH 4WNNB 5B1LD 4J8UD 3WA9A 3AZFA 5GXQB 2ZY2A 3REKC 3WKJD 1P3BA 3C1CD 1M19A 3WAAD 4Z5TB 1P3MC 4R8PA 3EG5B 4NE5A 5JRGA 3AV1A 4JJNA 1P3AB 1JFIA 1ZLAB 2NQBA 4KUDA 1M1AA 4KUDC 4H9RA 3MGRB 3KFUG 3AZFB 4H9NB 2BG1A 5CPJC 4WV4B 5C3IC 2AROB 2Y2GA 1ULYA 4H9SA 1KX3A 5B32B 1B67A 1KX5D 1P3PD 1TZYB 1P3ID 4H9RB 3MGRA 4J8VC 4H9NA 4YS3D 4QLCB 4Z2MH 3AZIC 4H9PA 4H9OB 3R45A 3KUYA 5DNNA 5B32G 3KXBC 3UTAB 1KX3B 1KX4A 4CAYA 5AV9A 3A6NA 3AFAD 1TZYA 3NQJA 3VH6A 1P3LC 5B40A 2PYOB 3KWQC 4QLCA 1M18C 3R45B 4J8UA 1BH8B 3WA9D 5DNNB 3UTAA 1P3AD 5CPIA 1P3GA 1ZLAD 2FJ7A 5DNMD 2IO5B 4YM6D 3AZLA 1P3PC 1KX4B 2F8NK 4LD9A 3MVDA 5B2JD 3NQJB 3UTBD 3W98C 1EQZD 2HUEB 1P3BB 1S32A 1M19B 3AN2A 4J8UB 1M18B 5AV6B 5AVCB 4XZQD 4R8PB 1KX4D 5CPIB 1P3GB 2NQBB 1JFIB 3WTPC 4LD9B 5AVBA 3WTPE 1BFMA 3W97D 3AN2B 3C1BC 1P3IA 3LELB 4ZUXA 5B24C 4Z5TC 1KX3D 5B32A 2ZY3A 5AVBB 3B6GA 4YM6B 5DNMB 3REJD 1P3OD 4LD9C 3AZKC 5CP6C 1S32D 3AZLC 5CPIC 1P3GC 3UTAC 1F66D 5C3IB 2Y2MA 4H9PB 1P3IB 4H9OA 3REHC 2BYKB 1N1JB 5B40D 3KUYB 4ZUXB 5BT1C 5B2JC 3UTBC 5B40C 3X1VC 3A6NB 5DNMA 4YM6A 3AZLD 3UTAD 5B0ZC 3O62D 3KXBA 5DNNC 3LJAB 4YS3B 3A1IA 3B0DC 1B6WA 4QLCD 4WU9A 1N1JA 2PYOD 4KGCA 5F99D 5JA4B 3TU4D 3X1SD 2F2AC 3AZLB 4Z2MG 3AZHD 2CV5B 4HGAC 1HQ3A 2CV5D 3X1UC 5KDMA 3FDDA 1S32B 1W2EA 4WU9B 1M18A 4KGCB 4YS3C 5AV6A 3VH5A 5AVCA 5JA4A 3AZMB 1ID3C 3RELA 1Q9CA 1KX5C 2VQRA 1HQ3B 2F8NA 4M6BA 5KDMB 2W8SA 5JRGC 3AV1C 3AZFD 5AV8A 2ZY4A 5B31C 3B6FA 3LELA 5DNMC 4YM6C 1P3BC 3RELB 5B1LB 1KU5A 1A7WA 5CPKC 2NQBD 3WA9C 4H9QA 4WU8D 5B32D 3B6GB 4Z5TD 1KX3C 2Y2NA 4ZBJB 3MGSC 5AV8B 5AV8D 4X23A 2Y2QA 1F66A 2BYKA 3MGRD 5B32C 5FUGA 2PYOC 4H9QB 4KHAB 5DNND 4JJNC 3X1TD 3X1VD 4E45A 5B31D 3KXBB 3LJAA 3RELC 4YS3A 2L5AA 5AY8C 3LZ1A 3EPHA 2Y2PA 5G49A 1HQ3D 2CV5A 4KHAA 3AZHA 1P3AC 1ZLAC 5CPID 1P3GD 4XUJC 4X23D 3AV2A 3REJC 3MNNC 2YFWA 4XUJA 5B24D 4NE6A 3KWQD 3MVDC 2ZM5A 3AZMA 3MGQC 4AWLC 2CV5C 3AFAC 1P3KC 3AZHB 3W97C 2F8NB 4J8UC 4UUZB 2HIOA 3B0CT 4QLCC 3AZIB 5B24B 3UT9A 5GSUD 5BS7C 4XUJB 3B6FD 5E5AD 4XUJD 3B6FB 5B1LA 3AFAA 1KX5B 3H0LC 5CP6A 3B0BA 1H3OA 1AOIC 3AZJC 4ZUXD 4UUZA 4G92B 2HIOB 3AZIA 4ZUXC 5B24A 4X23B
chains in the Genus database with same CATH topology
1F66B 3O62B 1P3OA 3LJAD 5CP6B 5FUGB 1H3OB 3AZGD 5AV8C 4CSRA 3WAAC 3C1CC 3KSYA 3X1SC 1M1AC 3KXBD 3LZ1B 5B2JB 3UTBB 4EO5C 3W99A 5G49B 5B2IA 4R8PC 3MGPA 1ID3A 4X23C 3O62C 5B31G 1TAFB 2DF4C 2BYMB 4DQYB 4CSRB 3AV2B 2CWEA 3AZJB 2YFWB 2J8PA 2Y2KA 2UWXA 5GT3C 3W96C 5CPJD 1P3LA 3REIC 3REHD 3LELC 3AZEA 1ID3D 3RELD 4KGCC 3A1KA 1TAFA 2Y2IA 3VH5T 2BYMA 3VH6W 5AV6D 3UT9B 3LZ0B 4J8XD 3REIA 4DRBA 5B0ZA 2XD1A 3F6TA 1P3MD 3W96A 3MGQB 4AWLB 2F8NG 3AFAB 1KX5A 1P3KB 1P3LB 3WKJC 3C1BD 2JE5A 5GT3A 1U35A 5F99C 3X1SB 3TU4C 3WTPD 4WU8C 5B2IC 3MGPC 1P3MB 3REIB 3X1UA 5B0ZB 5GSUB 3O62A 5B0ZD 5E5AB 5BNXB 1P3OB 3AZND 5GT3D 2AROC 3AZNB 3X1SA 3REHB 1F1EA 2AROD 3C1CA 3WAAA 1P3MA 3X1UB 5BNXA 2LY8A 3VH6T 5AVBC 1TZYD 5B2JA 3UTBA 3VH5W 5E5AC 3IP4C 3W99B 5B0YB 5GT0D 5B2IB 3MGPB 3AZNA 1ID3B 3B0DB 3REHA 1P34A 3C1BB 4Z66A 3C1CB 3WAAB 1P3FB 3AZJA 3AZGC 3MGQD 5B1LC 3W97B 5GT0C 3AV2D 1WWIA 5B31B 1P3PA 3UT9C 3LZ0C 4J8WD 3AZEB 3C1BA 1P3IC 4XZQC 4Z66B 5CPJB 1U35D 3MNNB 4XZQA 3LZ0A 2HIOC 3W96D 5AY8D 3MGQA 3AYWB 3W97A 3V9RA 3W96B 3WTPA 1EQZB 1P3KA 5GT3B 4Z66D 1U35B 1Z2CB 5B0YD 5CP6D 1S32C 3MNNA 4G91C 4XZQB 4R8PD 2Y2HA 1R4VA 5GSUA 3AYWA 3MGRC 5E5AA 4J8VA 3WTPB 3H0MC 3REKD 4H9SC 5BNVB 2FFFB 4J8XC 4J8WB 1BH9A 3KWQA 3AZMD 1TZYC 5CPKB 4J8VB 4J8VD 5AV9C 1KX4C 4NFTA 5AV5A 3B0CW 3AZGA 3A6ND 5B0YA 1P34B 4J8WA 1M19C 3AZNC 1BH9B 5GT0B 3KWQB 1P3FA 5F99A 3TU4A 4EO5B 1U35C 2NZDA 5CPKA 1HTAA 3X1TC 3AZKD 2RVQD 3LZ0D 5B31A 4J8XB 4J8WC 3B6FC 2IO5C 5B1MB 1P3PB 3H0RC 1M1AD 5CPJA 1P3LD 5AV5C 5F99B 3TU4B 3AN2D 2NZDB 3WKJB 2G5HC 5AV5D 2Y2OA 3V9RB 5AVCC 4HGAB 4E44A 5BO0A 4J8XA 1EQZA 2NQBC 5B1MA 4WU8A 5AV6C 3AZED 3REKA 3LELD 3AZFC 2YFVA 1HQ3C 3KUYD 3WKJA 3AYWC 5B1MC 1M19D 1EQZC 2ZY5A 5BT1D 5BO0B 5AY8B 3AYWD 3X1VB 2HIOD 1AOID 2JCHA 4WU8B 3B6GD 5AV9D 5BNVA 3W99D 4WU9C 5B2ID 3MGPD 4WJ3C 1T3UA 1M18D 3LZ1D 5AVCD 2JSSA 3EPKA 3X1UD 3AZKB 1AOIB 2XD5A 2NZDD 3X1VA 5AV5B 1P3FD 3AZGB 3X1TA 2NZDC 4DRAA 2Y2JA 1P3FC 3MVDD 3MGSB 5B33A 5GT0A 3W99C 4WU9D 5B0YC 2RVQC 4KGCD 4WZSB 3AZKA 2RIQA 1AOIA 3WA9B 1P3BD 3B6GC 5GXQA 3REID 3P5JB 4Z66C 4Z5TA 1P34C 2HUEC 5JRGB 3AV1B 4G92C 5B33B 1P34D 2G5IC 5B1MD 1M1AB 3AL0C 1P3OC 5CHLB 3AZMC 3UT9D 5GSUC 2F8ND 2DQNC 5B33D 2AROA 3REJA 3AV2C 3AN2C 1PZRA 5GXQC 3REKB 3MGSD 2YFVB 1P3KD 3AZHC 5GXQD 1WWSA 3W98A 5AY8A 3LZ1C 5B33C 4G91B 5CPKD 5BS7A 3MNND 2FJ7C 3AZID 3REJB 3NQUA 5AVBD 3LJAC 2Y2LA 4ZBJC 3EPLA 4CAYB 5AV9B 5JRGD 3EPJA 3AV1D 4UPKA 4WNNA 3W98B 4NE3A 5B40B 2PYOA 3W98D 3A6NC 3KUYC 3X1TB 3AZJD 1F66C 1BH8A 3AZEC 3NQUB 3MGSA 4JJND 2FJ7B 4LD9D 4JJNB 1P3AA 1ZLAA 2FJ7D 4KUDD 4KUDB 3MVDB 2F8NH 4WNNB 5B1LD 4J8UD 3WA9A 3AZFA 5GXQB 2ZY2A 3REKC 3WKJD 1P3BA 3C1CD 1M19A 3WAAD 4Z5TB 1P3MC 4R8PA 3EG5B 4NE5A 5JRGA 3AV1A 4JJNA 1P3AB 1JFIA 1ZLAB 2NQBA 4KUDA 1M1AA 4KUDC 4H9RA 3MGRB 3KFUG 3AZFB 4H9NB 2BG1A 5CPJC 4WV4B 5C3IC 2AROB 2Y2GA 1ULYA 4H9SA 1KX3A 5B32B 1B67A 1KX5D 1P3PD 1TZYB 1P3ID 4H9RB 3MGRA 4J8VC 4H9NA 4YS3D 4QLCB 4Z2MH 3AZIC 4H9PA 4H9OB 3R45A 3KUYA 5DNNA 5B32G 3KXBC 3UTAB 1KX3B 1KX4A 4CAYA 5AV9A 3A6NA 3AFAD 1TZYA 3NQJA 3VH6A 1P3LC 5B40A 2PYOB 3KWQC 4QLCA 1M18C 3R45B 4J8UA 1BH8B 3WA9D 5DNNB 3UTAA 1P3AD 5CPIA 1P3GA 1ZLAD 2FJ7A 5DNMD 2IO5B 4YM6D 3AZLA 1P3PC 1KX4B 2F8NK 4LD9A 3MVDA 5B2JD 3NQJB 3UTBD 3W98C 1EQZD 2HUEB 1P3BB 1S32A 1M19B 3AN2A 4J8UB 1M18B 5AV6B 5AVCB 4XZQD 4R8PB 1KX4D 5CPIB 1P3GB 2NQBB 1JFIB 3WTPC 4LD9B 5AVBA 3WTPE 1BFMA 3W97D 3AN2B 3C1BC 1P3IA 3LELB 4ZUXA 5B24C 4Z5TC 1KX3D 5B32A 2ZY3A 5AVBB 3B6GA 4YM6B 5DNMB 3REJD 1P3OD 4LD9C 3AZKC 5CP6C 1S32D 3AZLC 5CPIC 1P3GC 3UTAC 1F66D 5C3IB 2Y2MA 4H9PB 1P3IB 4H9OA 3REHC 2BYKB 1N1JB 5B40D 3KUYB 4ZUXB 5BT1C 5B2JC 3UTBC 5B40C 3X1VC 3A6NB 5DNMA 4YM6A 3AZLD 3UTAD 5B0ZC 3O62D 3KXBA 5DNNC 3LJAB 4YS3B 3A1IA 3B0DC 1B6WA 4QLCD 4WU9A 1N1JA 2PYOD 4KGCA 5F99D 5JA4B 3TU4D 3X1SD 2F2AC 3AZLB 4Z2MG 3AZHD 2CV5B 4HGAC 1HQ3A 2CV5D 3X1UC 5KDMA 3FDDA 1S32B 1W2EA 4WU9B 1M18A 4KGCB 4YS3C 5AV6A 3VH5A 5AVCA 5JA4A 3AZMB 1ID3C 3RELA 1Q9CA 1KX5C 2VQRA 1HQ3B 2F8NA 4M6BA 5KDMB 2W8SA 5JRGC 3AV1C 3AZFD 5AV8A 2ZY4A 5B31C 3B6FA 3LELA 5DNMC 4YM6C 1P3BC 3RELB 5B1LB 1KU5A 1A7WA 5CPKC 2NQBD 3WA9C 4H9QA 4WU8D 5B32D 3B6GB 4Z5TD 1KX3C 2Y2NA 4ZBJB 3MGSC 5AV8B 5AV8D 4X23A 2Y2QA 1F66A 2BYKA 3MGRD 5B32C 5FUGA 2PYOC 4H9QB 4KHAB 5DNND 4JJNC 3X1TD 3X1VD 4E45A 5B31D 3KXBB 3LJAA 3RELC 4YS3A 2L5AA 5AY8C 3LZ1A 3EPHA 2Y2PA 5G49A 1HQ3D 2CV5A 4KHAA 3AZHA 1P3AC 1ZLAC 5CPID 1P3GD 4XUJC 4X23D 3AV2A 3REJC 3MNNC 2YFWA 4XUJA 5B24D 4NE6A 3KWQD 3MVDC 2ZM5A 3AZMA 3MGQC 4AWLC 2CV5C 3AFAC 1P3KC 3AZHB 3W97C 2F8NB 4J8UC 4UUZB 2HIOA 3B0CT 4QLCC 3AZIB 5B24B 3UT9A 5GSUD 5BS7C 4XUJB 3B6FD 5E5AD 4XUJD 3B6FB 5B1LA 3AFAA 1KX5B 3H0LC 5CP6A 3B0BA 1H3OA 1AOIC 3AZJC 4ZUXD 4UUZA 4G92B 2HIOB 3AZIA 4ZUXC 5B24A 4X23B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F66 B;  3O62 B;  1P3O A;  3LJA D;  5CP6 B;  5FUG B;  1H3O B;  3AZG D;  5AV8 C;  4CSR A;  3WAA C;  3C1C C;  3KSY A;  3X1S C;  1M1A C;  3KXB D;  3LZ1 B;  5B2J B;  3UTB B;  4EO5 C;  3W99 A;  5G49 B;  5B2I A;  4R8P C;  3MGP A;  1ID3 A;  4X23 C;  3O62 C;  5B31 G;  1TAF B;  2BYM B;  4CSR B;  3AV2 B;  2CWE A;  3AZJ B;  2YFW B;  5GT3 C;  3W96 C;  5CPJ D;  1P3L A;  3REI C;  3REH D;  3LEL C;  3AZE A;  1ID3 D;  3REL D;  4KGC C;  1TAF A;  3VH6 W;  3VH5 T;  2BYM A;  5AV6 D;  3UT9 B;  3LZ0 B;  4J8X D;  3REI A;  4DRB A;  5B0Z A;  1P3M D;  3W96 A;  3MGQ B;  4AWL B;  2F8N G;  3AFA B;  1KX5 A;  1P3K B;  1P3L B;  3WKJ C;  3C1B D;  5GT3 A;  1U35 A;  5F99 C;  3X1S B;  3TU4 C;  3WTP D;  4WU8 C;  5B2I C;  3MGP C;  1P3M B;  3REI B;  3X1U A;  5B0Z B;  5GSU B;  3O62 A;  5B0Z D;  5E5A B;  5BNX B;  1P3O B;  3AZN D;  5GT3 D;  2ARO C;  3AZN B;  3X1S A;  3REH B;  1F1E A;  2ARO D;  3C1C A;  3WAA A;  1P3M A;  3X1U B;  5BNX A;  2LY8 A;  3VH6 T;  5AVB C;  1TZY D;  5B2J A;  3UTB A;  3VH5 W;  5E5A C;  3W99 B;  5B0Y B;  5GT0 D;  5B2I B;  3MGP B;  3AZN A;  1ID3 B;  3B0D B;  3REH A;  1P34 A;  3C1B B;  4Z66 A;  3C1C B;  3WAA B;  1P3F B;  3AZJ A;  3AZG C;  3MGQ D;  5B1L C;  3W97 B;  5GT0 C;  3AV2 D;  1WWI A;  5B31 B;  1P3P A;  3UT9 C;  3LZ0 C;  4J8W D;  3AZE B;  3C1B A;  1P3I C;  4XZQ C;  4Z66 B;  5CPJ B;  1U35 D;  3MNN B;  4XZQ A;  3LZ0 A;  2HIO C;  3W96 D;  5AY8 D;  3MGQ A;  3AYW B;  3W97 A;  3V9R A;  3W96 B;  3WTP A;  1EQZ B;  1P3K A;  5GT3 B;  4Z66 D;  1U35 B;  5B0Y D;  5CP6 D;  1S32 C;  3MNN A;  4G91 C;  4XZQ B;  4R8P D;  1R4V A;  5GSU A;  3AYW A;  3MGR C;  5E5A A;  4J8V A;  3WTP B;  3REK D;  4H9S C;  5BNV B;  4J8X C;  4J8W B;  1BH9 A;  3KWQ A;  3AZM D;  1TZY C;  5CPK B;  4J8V B;  4J8V D;  5AV9 C;  1KX4 C;  4NFT A;  5AV5 A;  3B0C W;  3AZG A;  3A6N D;  5B0Y A;  1P34 B;  4J8W A;  1M19 C;  3AZN C;  1BH9 B;  5GT0 B;  3KWQ B;  1P3F A;  5F99 A;  3TU4 A;  4EO5 B;  1U35 C;  2NZD A;  5CPK A;  1HTA A;  3X1T C;  3AZK D;  2RVQ D;  3LZ0 D;  5B31 A;  4J8X B;  4J8W C;  3B6F C;  2IO5 C;  5B1M B;  1P3P B;  1M1A D;  5CPJ A;  1P3L D;  5AV5 C;  5F99 B;  3TU4 B;  3AN2 D;  2NZD B;  3WKJ B;  5AV5 D;  3V9R B;  5AVC C;  4HGA B;  4E44 A;  5BO0 A;  4J8X A;  1EQZ A;  2NQB C;  5B1M A;  4WU8 A;  5AV6 C;  3AZE D;  3REK A;  3LEL D;  3AZF C;  2YFV A;  1HQ3 C;  3KUY D;  3WKJ A;  3AYW C;  5B1M C;  1M19 D;  1EQZ C;  5BT1 D;  5BO0 B;  5AY8 B;  3AYW D;  3X1V B;  2HIO D;  1AOI D;  4WU8 B;  3B6G D;  5AV9 D;  5BNV A;  3W99 D;  4WU9 C;  5B2I D;  3MGP D;  1M18 D;  3LZ1 D;  5AVC D;  2JSS A;  3AZK B;  3X1U D;  1AOI B;  2NZD D;  3X1V A;  5AV5 B;  1P3F D;  3AZG B;  3X1T A;  2NZD C;  4DRA A;  1P3F C;  3MVD D;  3MGS B;  5B33 A;  5GT0 A;  3W99 C;  4WU9 D;  5B0Y C;  2RVQ C;  4KGC D;  4WZS B;  3AZK A;  3WA9 B;  1AOI A;  1P3B D;  3B6G C;  5GXQ A;  3REI D;  4Z66 C;  4Z5T A;  1P34 C;  2HUE C;  5JRG B;  3AV1 B;  4G92 C;  5B33 B;  1P34 D;  5B1M D;  1M1A B;  1P3O C;  5CHL B;  3AZM C;  3UT9 D;  5GSU C;  2F8N D;  5B33 D;  2ARO A;  3REJ A;  3AV2 C;  3AN2 C;  5GXQ C;  3REK B;  3MGS D;  2YFV B;  1P3K D;  3AZH C;  5GXQ D;  1WWS A;  3W98 A;  5AY8 A;  3LZ1 C;  5B33 C;  4G91 B;  5CPK D;  5BS7 A;  3MNN D;  2FJ7 C;  3AZI D;  3REJ B;  3NQU A;  5AVB D;  3LJA C;  4ZBJ C;  4CAY B;  5AV9 B;  5JRG D;  3AV1 D;  4WNN A;  3W98 B;  4NE3 A;  5B40 B;  2PYO A;  3W98 D;  3A6N C;  3KUY C;  3X1T B;  3AZJ D;  1F66 C;  1BH8 A;  3AZE C;  3NQU B;  3MGS A;  4JJN D;  2FJ7 B;  4LD9 D;  4JJN B;  1P3A A;  1ZLA A;  2FJ7 D;  4KUD D;  4KUD B;  3MVD B;  2F8N H;  4WNN B;  5B1L D;  4J8U D;  3WA9 A;  3AZF A;  5GXQ B;  3REK C;  3WKJ D;  1P3B A;  3C1C D;  1M19 A;  3WAA D;  4Z5T B;  1P3M C;  4R8P A;  4NE5 A;  5JRG A;  3AV1 A;  4JJN A;  1P3A B;  1JFI A;  1ZLA B;  2NQB A;  4KUD A;  1M1A A;  4KUD C;  4H9R A;  3MGR B;  3AZF B;  4H9N B;  5CPJ C;  4WV4 B;  5C3I C;  2ARO B;  1ULY A;  4H9S A;  1KX3 A;  5B32 B;  1B67 A;  1KX5 D;  1P3P D;  1TZY B;  1P3I D;  4H9R B;  3MGR A;  4J8V C;  4H9N A;  4YS3 D;  4QLC B;  4Z2M H;  3AZI C;  4H9P A;  4H9O B;  3R45 A;  3KUY A;  5DNN A;  5B32 G;  3KXB C;  3UTA B;  1KX3 B;  1KX4 A;  4CAY A;  5AV9 A;  3A6N A;  3AFA D;  1TZY A;  3NQJ A;  3VH6 A;  1P3L C;  5B40 A;  2PYO B;  3KWQ C;  4QLC A;  1M18 C;  3R45 B;  4J8U A;  1BH8 B;  3WA9 D;  5DNN B;  3UTA A;  1P3A D;  5CPI A;  1P3G A;  1ZLA D;  2FJ7 A;  5DNM D;  2IO5 B;  4YM6 D;  3AZL A;  1P3P C;  1KX4 B;  2F8N K;  4LD9 A;  3MVD A;  5B2J D;  3NQJ B;  3UTB D;  3W98 C;  1EQZ D;  2HUE B;  1P3B B;  1S32 A;  1M19 B;  3AN2 A;  4J8U B;  1M18 B;  5AV6 B;  5AVC B;  4XZQ D;  4R8P B;  1KX4 D;  5CPI B;  1P3G B;  2NQB B;  1JFI B;  3WTP C;  4LD9 B;  5AVB A;  3WTP E;  1BFM A;  3W97 D;  3AN2 B;  3C1B C;  1P3I A;  3LEL B;  4ZUX A;  5B24 C;  4Z5T C;  1KX3 D;  5B32 A;  5AVB B;  3B6G A;  4YM6 B;  5DNM B;  3REJ D;  1P3O D;  4LD9 C;  3AZK C;  5CP6 C;  1S32 D;  3AZL C;  5CPI C;  1P3G C;  3UTA C;  1F66 D;  5C3I B;  4H9P B;  1P3I B;  4H9O A;  3REH C;  2BYK B;  1N1J B;  5B40 D;  3KUY B;  4ZUX B;  5BT1 C;  5B2J C;  3UTB C;  5B40 C;  3X1V C;  3A6N B;  5DNM A;  4YM6 A;  3AZL D;  3UTA D;  5B0Z C;  3O62 D;  3KXB A;  5DNN C;  3LJA B;  4YS3 B;  3B0D C;  4QLC D;  1B6W A;  4WU9 A;  1N1J A;  2PYO D;  4KGC A;  5F99 D;  5JA4 B;  3TU4 D;  3X1S D;  3AZL B;  4Z2M G;  3AZH D;  2CV5 B;  4HGA C;  1HQ3 A;  2CV5 D;  3X1U C;  5KDM A;  1S32 B;  4WU9 B;  1M18 A;  4KGC B;  4YS3 C;  5AV6 A;  3VH5 A;  5AVC A;  5JA4 A;  3AZM B;  1ID3 C;  3REL A;  1Q9C A;  1KX5 C;  1HQ3 B;  2F8N A;  4M6B A;  5KDM B;  5JRG C;  3AV1 C;  3AZF D;  5AV8 A;  5B31 C;  3B6F A;  3LEL A;  5DNM C;  4YM6 C;  1P3B C;  3REL B;  5B1L B;  1KU5 A;  1A7W A;  5CPK C;  2NQB D;  3WA9 C;  4H9Q A;  4WU8 D;  5B32 D;  3B6G B;  4Z5T D;  1KX3 C;  4ZBJ B;  3MGS C;  5AV8 B;  5AV8 D;  4X23 A;  1F66 A;  2BYK A;  3MGR D;  5B32 C;  5FUG A;  2PYO C;  4H9Q B;  4KHA B;  5DNN D;  4JJN C;  3X1T D;  3X1V D;  4E45 A;  5B31 D;  3KXB B;  3LJA A;  3REL C;  4YS3 A;  2L5A A;  5AY8 C;  3LZ1 A;  5G49 A;  1HQ3 D;  2CV5 A;  4KHA A;  3AZH A;  1P3A C;  1ZLA C;  5CPI D;  1P3G D;  4XUJ C;  4X23 D;  3AV2 A;  3REJ C;  3MNN C;  2YFW A;  4XUJ A;  5B24 D;  4NE6 A;  3KWQ D;  3MVD C;  3AZM A;  3MGQ C;  4AWL C;  2CV5 C;  3AFA C;  1P3K C;  3AZH B;  3W97 C;  2F8N B;  4J8U C;  4UUZ B;  2HIO A;  3B0C T;  4QLC C;  3AZI B;  5B24 B;  3UT9 A;  5GSU D;  5BS7 C;  4XUJ B;  3B6F D;  5E5A D;  4XUJ D;  3B6F B;  5B1L A;  3AFA A;  1KX5 B;  5CP6 A;  3B0B A;  1H3O A;  1AOI C;  3AZJ C;  4ZUX D;  4UUZ A;  4G92 B;  2HIO B;  3AZI A;  4ZUX C;  5B24 A;  4X23 B; 
#chains in the Genus database with same CATH topology
 1F66 B;  3O62 B;  1P3O A;  3LJA D;  5CP6 B;  5FUG B;  1H3O B;  3AZG D;  5AV8 C;  4CSR A;  3WAA C;  3C1C C;  3KSY A;  3X1S C;  1M1A C;  3KXB D;  3LZ1 B;  5B2J B;  3UTB B;  4EO5 C;  3W99 A;  5G49 B;  5B2I A;  4R8P C;  3MGP A;  1ID3 A;  4X23 C;  3O62 C;  5B31 G;  1TAF B;  2DF4 C;  2BYM B;  4DQY B;  4CSR B;  3AV2 B;  2CWE A;  3AZJ B;  2YFW B;  2J8P A;  2Y2K A;  2UWX A;  5GT3 C;  3W96 C;  5CPJ D;  1P3L A;  3REI C;  3REH D;  3LEL C;  3AZE A;  1ID3 D;  3REL D;  4KGC C;  3A1K A;  1TAF A;  2Y2I A;  3VH5 T;  2BYM A;  3VH6 W;  5AV6 D;  3UT9 B;  3LZ0 B;  4J8X D;  3REI A;  4DRB A;  5B0Z A;  2XD1 A;  3F6T A;  1P3M D;  3W96 A;  3MGQ B;  4AWL B;  2F8N G;  3AFA B;  1KX5 A;  1P3K B;  1P3L B;  3WKJ C;  3C1B D;  2JE5 A;  5GT3 A;  1U35 A;  5F99 C;  3X1S B;  3TU4 C;  3WTP D;  4WU8 C;  5B2I C;  3MGP C;  1P3M B;  3REI B;  3X1U A;  5B0Z B;  5GSU B;  3O62 A;  5B0Z D;  5E5A B;  5BNX B;  1P3O B;  3AZN D;  5GT3 D;  2ARO C;  3AZN B;  3X1S A;  3REH B;  1F1E A;  2ARO D;  3C1C A;  3WAA A;  1P3M A;  3X1U B;  5BNX A;  2LY8 A;  3VH6 T;  5AVB C;  1TZY D;  5B2J A;  3UTB A;  3VH5 W;  5E5A C;  3IP4 C;  3W99 B;  5B0Y B;  5GT0 D;  5B2I B;  3MGP B;  3AZN A;  1ID3 B;  3B0D B;  3REH A;  1P34 A;  3C1B B;  4Z66 A;  3C1C B;  3WAA B;  1P3F B;  3AZJ A;  3AZG C;  3MGQ D;  5B1L C;  3W97 B;  5GT0 C;  3AV2 D;  1WWI A;  5B31 B;  1P3P A;  3UT9 C;  3LZ0 C;  4J8W D;  3AZE B;  3C1B A;  1P3I C;  4XZQ C;  4Z66 B;  5CPJ B;  1U35 D;  3MNN B;  4XZQ A;  3LZ0 A;  2HIO C;  3W96 D;  5AY8 D;  3MGQ A;  3AYW B;  3W97 A;  3V9R A;  3W96 B;  3WTP A;  1EQZ B;  1P3K A;  5GT3 B;  4Z66 D;  1U35 B;  1Z2C B;  5B0Y D;  5CP6 D;  1S32 C;  3MNN A;  4G91 C;  4XZQ B;  4R8P D;  2Y2H A;  1R4V A;  5GSU A;  3AYW A;  3MGR C;  5E5A A;  4J8V A;  3WTP B;  3H0M C;  3REK D;  4H9S C;  5BNV B;  2FFF B;  4J8X C;  4J8W B;  1BH9 A;  3KWQ A;  3AZM D;  1TZY C;  5CPK B;  4J8V B;  4J8V D;  5AV9 C;  1KX4 C;  4NFT A;  5AV5 A;  3B0C W;  3AZG A;  3A6N D;  5B0Y A;  1P34 B;  4J8W A;  1M19 C;  3AZN C;  1BH9 B;  5GT0 B;  3KWQ B;  1P3F A;  5F99 A;  3TU4 A;  4EO5 B;  1U35 C;  2NZD A;  5CPK A;  1HTA A;  3X1T C;  3AZK D;  2RVQ D;  3LZ0 D;  5B31 A;  4J8X B;  4J8W C;  3B6F C;  2IO5 C;  5B1M B;  1P3P B;  3H0R C;  1M1A D;  5CPJ A;  1P3L D;  5AV5 C;  5F99 B;  3TU4 B;  3AN2 D;  2NZD B;  3WKJ B;  2G5H C;  5AV5 D;  2Y2O A;  3V9R B;  5AVC C;  4HGA B;  4E44 A;  5BO0 A;  4J8X A;  1EQZ A;  2NQB C;  5B1M A;  4WU8 A;  5AV6 C;  3AZE D;  3REK A;  3LEL D;  3AZF C;  2YFV A;  1HQ3 C;  3KUY D;  3WKJ A;  3AYW C;  5B1M C;  1M19 D;  1EQZ C;  2ZY5 A;  5BT1 D;  5BO0 B;  5AY8 B;  3AYW D;  3X1V B;  2HIO D;  1AOI D;  2JCH A;  4WU8 B;  3B6G D;  5AV9 D;  5BNV A;  3W99 D;  4WU9 C;  5B2I D;  3MGP D;  4WJ3 C;  1T3U A;  1M18 D;  3LZ1 D;  5AVC D;  2JSS A;  3EPK A;  3X1U D;  3AZK B;  1AOI B;  2XD5 A;  2NZD D;  3X1V A;  5AV5 B;  1P3F D;  3AZG B;  3X1T A;  2NZD C;  4DRA A;  2Y2J A;  1P3F C;  3MVD D;  3MGS B;  5B33 A;  5GT0 A;  3W99 C;  4WU9 D;  5B0Y C;  2RVQ C;  4KGC D;  4WZS B;  3AZK A;  2RIQ A;  1AOI A;  3WA9 B;  1P3B D;  3B6G C;  5GXQ A;  3REI D;  3P5J B;  4Z66 C;  4Z5T A;  1P34 C;  2HUE C;  5JRG B;  3AV1 B;  4G92 C;  5B33 B;  1P34 D;  2G5I C;  5B1M D;  1M1A B;  3AL0 C;  1P3O C;  5CHL B;  3AZM C;  3UT9 D;  5GSU C;  2F8N D;  2DQN C;  5B33 D;  2ARO A;  3REJ A;  3AV2 C;  3AN2 C;  1PZR A;  5GXQ C;  3REK B;  3MGS D;  2YFV B;  1P3K D;  3AZH C;  5GXQ D;  1WWS A;  3W98 A;  5AY8 A;  3LZ1 C;  5B33 C;  4G91 B;  5CPK D;  5BS7 A;  3MNN D;  2FJ7 C;  3AZI D;  3REJ B;  3NQU A;  5AVB D;  3LJA C;  2Y2L A;  4ZBJ C;  3EPL A;  4CAY B;  5AV9 B;  5JRG D;  3EPJ A;  3AV1 D;  4UPK A;  4WNN A;  3W98 B;  4NE3 A;  5B40 B;  2PYO A;  3W98 D;  3A6N C;  3KUY C;  3X1T B;  3AZJ D;  1F66 C;  1BH8 A;  3AZE C;  3NQU B;  3MGS A;  4JJN D;  2FJ7 B;  4LD9 D;  4JJN B;  1P3A A;  1ZLA A;  2FJ7 D;  4KUD D;  4KUD B;  3MVD B;  2F8N H;  4WNN B;  5B1L D;  4J8U D;  3WA9 A;  3AZF A;  5GXQ B;  2ZY2 A;  3REK C;  3WKJ D;  1P3B A;  3C1C D;  1M19 A;  3WAA D;  4Z5T B;  1P3M C;  4R8P A;  3EG5 B;  4NE5 A;  5JRG A;  3AV1 A;  4JJN A;  1P3A B;  1JFI A;  1ZLA B;  2NQB A;  4KUD A;  1M1A A;  4KUD C;  4H9R A;  3MGR B;  3KFU G;  3AZF B;  4H9N B;  2BG1 A;  5CPJ C;  4WV4 B;  5C3I C;  2ARO B;  2Y2G A;  1ULY A;  4H9S A;  1KX3 A;  5B32 B;  1B67 A;  1KX5 D;  1P3P D;  1TZY B;  1P3I D;  4H9R B;  3MGR A;  4J8V C;  4H9N A;  4YS3 D;  4QLC B;  4Z2M H;  3AZI C;  4H9P A;  4H9O B;  3R45 A;  3KUY A;  5DNN A;  5B32 G;  3KXB C;  3UTA B;  1KX3 B;  1KX4 A;  4CAY A;  5AV9 A;  3A6N A;  3AFA D;  1TZY A;  3NQJ A;  3VH6 A;  1P3L C;  5B40 A;  2PYO B;  3KWQ C;  4QLC A;  1M18 C;  3R45 B;  4J8U A;  1BH8 B;  3WA9 D;  5DNN B;  3UTA A;  1P3A D;  5CPI A;  1P3G A;  1ZLA D;  2FJ7 A;  5DNM D;  2IO5 B;  4YM6 D;  3AZL A;  1P3P C;  1KX4 B;  2F8N K;  4LD9 A;  3MVD A;  5B2J D;  3NQJ B;  3UTB D;  3W98 C;  1EQZ D;  2HUE B;  1P3B B;  1S32 A;  1M19 B;  3AN2 A;  4J8U B;  1M18 B;  5AV6 B;  5AVC B;  4XZQ D;  4R8P B;  1KX4 D;  5CPI B;  1P3G B;  2NQB B;  1JFI B;  3WTP C;  4LD9 B;  5AVB A;  3WTP E;  1BFM A;  3W97 D;  3AN2 B;  3C1B C;  1P3I A;  3LEL B;  4ZUX A;  5B24 C;  4Z5T C;  1KX3 D;  5B32 A;  2ZY3 A;  5AVB B;  3B6G A;  4YM6 B;  5DNM B;  3REJ D;  1P3O D;  4LD9 C;  3AZK C;  5CP6 C;  1S32 D;  3AZL C;  5CPI C;  1P3G C;  3UTA C;  1F66 D;  5C3I B;  2Y2M A;  4H9P B;  1P3I B;  4H9O A;  3REH C;  2BYK B;  1N1J B;  5B40 D;  3KUY B;  4ZUX B;  5BT1 C;  5B2J C;  3UTB C;  5B40 C;  3X1V C;  3A6N B;  5DNM A;  4YM6 A;  3AZL D;  3UTA D;  5B0Z C;  3O62 D;  3KXB A;  5DNN C;  3LJA B;  4YS3 B;  3A1I A;  3B0D C;  1B6W A;  4QLC D;  4WU9 A;  1N1J A;  2PYO D;  4KGC A;  5F99 D;  5JA4 B;  3TU4 D;  3X1S D;  2F2A C;  3AZL B;  4Z2M G;  3AZH D;  2CV5 B;  4HGA C;  1HQ3 A;  2CV5 D;  3X1U C;  5KDM A;  3FDD A;  1S32 B;  1W2E A;  4WU9 B;  1M18 A;  4KGC B;  4YS3 C;  5AV6 A;  3VH5 A;  5AVC A;  5JA4 A;  3AZM B;  1ID3 C;  3REL A;  1Q9C A;  1KX5 C;  2VQR A;  1HQ3 B;  2F8N A;  4M6B A;  5KDM B;  2W8S A;  5JRG C;  3AV1 C;  3AZF D;  5AV8 A;  2ZY4 A;  5B31 C;  3B6F A;  3LEL A;  5DNM C;  4YM6 C;  1P3B C;  3REL B;  5B1L B;  1KU5 A;  1A7W A;  5CPK C;  2NQB D;  3WA9 C;  4H9Q A;  4WU8 D;  5B32 D;  3B6G B;  4Z5T D;  1KX3 C;  2Y2N A;  4ZBJ B;  3MGS C;  5AV8 B;  5AV8 D;  4X23 A;  2Y2Q A;  1F66 A;  2BYK A;  3MGR D;  5B32 C;  5FUG A;  2PYO C;  4H9Q B;  4KHA B;  5DNN D;  4JJN C;  3X1T D;  3X1V D;  4E45 A;  5B31 D;  3KXB B;  3LJA A;  3REL C;  4YS3 A;  2L5A A;  5AY8 C;  3LZ1 A;  3EPH A;  2Y2P A;  5G49 A;  1HQ3 D;  2CV5 A;  4KHA A;  3AZH A;  1P3A C;  1ZLA C;  5CPI D;  1P3G D;  4XUJ C;  4X23 D;  3AV2 A;  3REJ C;  3MNN C;  2YFW A;  4XUJ A;  5B24 D;  4NE6 A;  3KWQ D;  3MVD C;  2ZM5 A;  3AZM A;  3MGQ C;  4AWL C;  2CV5 C;  3AFA C;  1P3K C;  3AZH B;  3W97 C;  2F8N B;  4J8U C;  4UUZ B;  2HIO A;  3B0C T;  4QLC C;  3AZI B;  5B24 B;  3UT9 A;  5GSU D;  5BS7 C;  4XUJ B;  3B6F D;  5E5A D;  4XUJ D;  3B6F B;  5B1L A;  3AFA A;  1KX5 B;  3H0L C;  5CP6 A;  3B0B A;  1H3O A;  1AOI C;  3AZJ C;  4ZUX D;  4UUZ A;  4G92 B;  2HIO B;  3AZI A;  4ZUX C;  5B24 A;  4X23 B; 
#chains in the Genus database with same CATH homology
 1F66 B;  3O62 B;  1P3O A;  3LJA D;  5CP6 B;  5FUG B;  1H3O B;  3AZG D;  5AV8 C;  4CSR A;  3WAA C;  3C1C C;  3KSY A;  3X1S C;  1M1A C;  3KXB D;  3LZ1 B;  5B2J B;  3UTB B;  4EO5 C;  3W99 A;  5G49 B;  5B2I A;  4R8P C;  3MGP A;  1ID3 A;  4X23 C;  3O62 C;  5B31 G;  1TAF B;  2DF4 C;  2BYM B;  4DQY B;  4CSR B;  3AV2 B;  2CWE A;  3AZJ B;  2YFW B;  2J8P A;  2Y2K A;  2UWX A;  5GT3 C;  3W96 C;  5CPJ D;  1P3L A;  3REI C;  3REH D;  3LEL C;  3AZE A;  1ID3 D;  3REL D;  4KGC C;  3A1K A;  1TAF A;  2Y2I A;  3VH5 T;  2BYM A;  3VH6 W;  5AV6 D;  3UT9 B;  3LZ0 B;  4J8X D;  3REI A;  4DRB A;  5B0Z A;  2XD1 A;  3F6T A;  1P3M D;  3W96 A;  3MGQ B;  4AWL B;  2F8N G;  3AFA B;  1KX5 A;  1P3K B;  1P3L B;  3WKJ C;  3C1B D;  2JE5 A;  5GT3 A;  1U35 A;  5F99 C;  3X1S B;  3TU4 C;  3WTP D;  4WU8 C;  5B2I C;  3MGP C;  1P3M B;  3REI B;  3X1U A;  5B0Z B;  5GSU B;  3O62 A;  5B0Z D;  5E5A B;  5BNX B;  1P3O B;  3AZN D;  5GT3 D;  2ARO C;  3AZN B;  3X1S A;  3REH B;  1F1E A;  2ARO D;  3C1C A;  3WAA A;  1P3M A;  3X1U B;  5BNX A;  2LY8 A;  3VH6 T;  5AVB C;  1TZY D;  5B2J A;  3UTB A;  3VH5 W;  5E5A C;  3IP4 C;  3W99 B;  5B0Y B;  5GT0 D;  5B2I B;  3MGP B;  3AZN A;  1ID3 B;  3B0D B;  3REH A;  1P34 A;  3C1B B;  4Z66 A;  3C1C B;  3WAA B;  1P3F B;  3AZJ A;  3AZG C;  3MGQ D;  5B1L C;  3W97 B;  5GT0 C;  3AV2 D;  1WWI A;  5B31 B;  1P3P A;  3UT9 C;  3LZ0 C;  4J8W D;  3AZE B;  3C1B A;  1P3I C;  4XZQ C;  4Z66 B;  5CPJ B;  1U35 D;  3MNN B;  4XZQ A;  3LZ0 A;  2HIO C;  3W96 D;  5AY8 D;  3MGQ A;  3AYW B;  3W97 A;  3V9R A;  3W96 B;  3WTP A;  1EQZ B;  1P3K A;  5GT3 B;  4Z66 D;  1U35 B;  1Z2C B;  5B0Y D;  5CP6 D;  1S32 C;  3MNN A;  4G91 C;  4XZQ B;  4R8P D;  2Y2H A;  1R4V A;  5GSU A;  3AYW A;  3MGR C;  5E5A A;  4J8V A;  3WTP B;  3H0M C;  3REK D;  4H9S C;  5BNV B;  2FFF B;  4J8X C;  4J8W B;  1BH9 A;  3KWQ A;  3AZM D;  1TZY C;  5CPK B;  4J8V B;  4J8V D;  5AV9 C;  1KX4 C;  4NFT A;  5AV5 A;  3B0C W;  3AZG A;  3A6N D;  5B0Y A;  1P34 B;  4J8W A;  1M19 C;  3AZN C;  1BH9 B;  5GT0 B;  3KWQ B;  1P3F A;  5F99 A;  3TU4 A;  4EO5 B;  1U35 C;  2NZD A;  5CPK A;  1HTA A;  3X1T C;  3AZK D;  2RVQ D;  3LZ0 D;  5B31 A;  4J8X B;  4J8W C;  3B6F C;  2IO5 C;  5B1M B;  1P3P B;  3H0R C;  1M1A D;  5CPJ A;  1P3L D;  5AV5 C;  5F99 B;  3TU4 B;  3AN2 D;  2NZD B;  3WKJ B;  2G5H C;  5AV5 D;  2Y2O A;  3V9R B;  5AVC C;  4HGA B;  4E44 A;  5BO0 A;  4J8X A;  1EQZ A;  2NQB C;  5B1M A;  4WU8 A;  5AV6 C;  3AZE D;  3REK A;  3LEL D;  3AZF C;  2YFV A;  1HQ3 C;  3KUY D;  3WKJ A;  3AYW C;  5B1M C;  1M19 D;  1EQZ C;  2ZY5 A;  5BT1 D;  5BO0 B;  5AY8 B;  3AYW D;  3X1V B;  2HIO D;  1AOI D;  2JCH A;  4WU8 B;  3B6G D;  5AV9 D;  5BNV A;  3W99 D;  4WU9 C;  5B2I D;  3MGP D;  4WJ3 C;  1T3U A;  1M18 D;  3LZ1 D;  5AVC D;  2JSS A;  3EPK A;  3X1U D;  3AZK B;  1AOI B;  2XD5 A;  2NZD D;  3X1V A;  5AV5 B;  1P3F D;  3AZG B;  3X1T A;  2NZD C;  4DRA A;  2Y2J A;  1P3F C;  3MVD D;  3MGS B;  5B33 A;  5GT0 A;  3W99 C;  4WU9 D;  5B0Y C;  2RVQ C;  4KGC D;  4WZS B;  3AZK A;  2RIQ A;  1AOI A;  3WA9 B;  1P3B D;  3B6G C;  5GXQ A;  3REI D;  3P5J B;  4Z66 C;  4Z5T A;  1P34 C;  2HUE C;  5JRG B;  3AV1 B;  4G92 C;  5B33 B;  1P34 D;  2G5I C;  5B1M D;  1M1A B;  3AL0 C;  1P3O C;  5CHL B;  3AZM C;  3UT9 D;  5GSU C;  2F8N D;  2DQN C;  5B33 D;  2ARO A;  3REJ A;  3AV2 C;  3AN2 C;  1PZR A;  5GXQ C;  3REK B;  3MGS D;  2YFV B;  1P3K D;  3AZH C;  5GXQ D;  1WWS A;  3W98 A;  5AY8 A;  3LZ1 C;  5B33 C;  4G91 B;  5CPK D;  5BS7 A;  3MNN D;  2FJ7 C;  3AZI D;  3REJ B;  3NQU A;  5AVB D;  3LJA C;  2Y2L A;  4ZBJ C;  3EPL A;  4CAY B;  5AV9 B;  5JRG D;  3EPJ A;  3AV1 D;  4UPK A;  4WNN A;  3W98 B;  4NE3 A;  5B40 B;  2PYO A;  3W98 D;  3A6N C;  3KUY C;  3X1T B;  3AZJ D;  1F66 C;  1BH8 A;  3AZE C;  3NQU B;  3MGS A;  4JJN D;  2FJ7 B;  4LD9 D;  4JJN B;  1P3A A;  1ZLA A;  2FJ7 D;  4KUD D;  4KUD B;  3MVD B;  2F8N H;  4WNN B;  5B1L D;  4J8U D;  3WA9 A;  3AZF A;  5GXQ B;  2ZY2 A;  3REK C;  3WKJ D;  1P3B A;  3C1C D;  1M19 A;  3WAA D;  4Z5T B;  1P3M C;  4R8P A;  3EG5 B;  4NE5 A;  5JRG A;  3AV1 A;  4JJN A;  1P3A B;  1JFI A;  1ZLA B;  2NQB A;  4KUD A;  1M1A A;  4KUD C;  4H9R A;  3MGR B;  3KFU G;  3AZF B;  4H9N B;  2BG1 A;  5CPJ C;  4WV4 B;  5C3I C;  2ARO B;  2Y2G A;  1ULY A;  4H9S A;  1KX3 A;  5B32 B;  1B67 A;  1KX5 D;  1P3P D;  1TZY B;  1P3I D;  4H9R B;  3MGR A;  4J8V C;  4H9N A;  4YS3 D;  4QLC B;  4Z2M H;  3AZI C;  4H9P A;  4H9O B;  3R45 A;  3KUY A;  5DNN A;  5B32 G;  3KXB C;  3UTA B;  1KX3 B;  1KX4 A;  4CAY A;  5AV9 A;  3A6N A;  3AFA D;  1TZY A;  3NQJ A;  3VH6 A;  1P3L C;  5B40 A;  2PYO B;  3KWQ C;  4QLC A;  1M18 C;  3R45 B;  4J8U A;  1BH8 B;  3WA9 D;  5DNN B;  3UTA A;  1P3A D;  5CPI A;  1P3G A;  1ZLA D;  2FJ7 A;  5DNM D;  2IO5 B;  4YM6 D;  3AZL A;  1P3P C;  1KX4 B;  2F8N K;  4LD9 A;  3MVD A;  5B2J D;  3NQJ B;  3UTB D;  3W98 C;  1EQZ D;  2HUE B;  1P3B B;  1S32 A;  1M19 B;  3AN2 A;  4J8U B;  1M18 B;  5AV6 B;  5AVC B;  4XZQ D;  4R8P B;  1KX4 D;  5CPI B;  1P3G B;  2NQB B;  1JFI B;  3WTP C;  4LD9 B;  5AVB A;  3WTP E;  1BFM A;  3W97 D;  3AN2 B;  3C1B C;  1P3I A;  3LEL B;  4ZUX A;  5B24 C;  4Z5T C;  1KX3 D;  5B32 A;  2ZY3 A;  5AVB B;  3B6G A;  4YM6 B;  5DNM B;  3REJ D;  1P3O D;  4LD9 C;  3AZK C;  5CP6 C;  1S32 D;  3AZL C;  5CPI C;  1P3G C;  3UTA C;  1F66 D;  5C3I B;  2Y2M A;  4H9P B;  1P3I B;  4H9O A;  3REH C;  2BYK B;  1N1J B;  5B40 D;  3KUY B;  4ZUX B;  5BT1 C;  5B2J C;  3UTB C;  5B40 C;  3X1V C;  3A6N B;  5DNM A;  4YM6 A;  3AZL D;  3UTA D;  5B0Z C;  3O62 D;  3KXB A;  5DNN C;  3LJA B;  4YS3 B;  3A1I A;  3B0D C;  1B6W A;  4QLC D;  4WU9 A;  1N1J A;  2PYO D;  4KGC A;  5F99 D;  5JA4 B;  3TU4 D;  3X1S D;  2F2A C;  3AZL B;  4Z2M G;  3AZH D;  2CV5 B;  4HGA C;  1HQ3 A;  2CV5 D;  3X1U C;  5KDM A;  3FDD A;  1S32 B;  1W2E A;  4WU9 B;  1M18 A;  4KGC B;  4YS3 C;  5AV6 A;  3VH5 A;  5AVC A;  5JA4 A;  3AZM B;  1ID3 C;  3REL A;  1Q9C A;  1KX5 C;  2VQR A;  1HQ3 B;  2F8N A;  4M6B A;  5KDM B;  2W8S A;  5JRG C;  3AV1 C;  3AZF D;  5AV8 A;  2ZY4 A;  5B31 C;  3B6F A;  3LEL A;  5DNM C;  4YM6 C;  1P3B C;  3REL B;  5B1L B;  1KU5 A;  1A7W A;  5CPK C;  2NQB D;  3WA9 C;  4H9Q A;  4WU8 D;  5B32 D;  3B6G B;  4Z5T D;  1KX3 C;  2Y2N A;  4ZBJ B;  3MGS C;  5AV8 B;  5AV8 D;  4X23 A;  2Y2Q A;  1F66 A;  2BYK A;  3MGR D;  5B32 C;  5FUG A;  2PYO C;  4H9Q B;  4KHA B;  5DNN D;  4JJN C;  3X1T D;  3X1V D;  4E45 A;  5B31 D;  3KXB B;  3LJA A;  3REL C;  4YS3 A;  2L5A A;  5AY8 C;  3LZ1 A;  3EPH A;  2Y2P A;  5G49 A;  1HQ3 D;  2CV5 A;  4KHA A;  3AZH A;  1P3A C;  1ZLA C;  5CPI D;  1P3G D;  4XUJ C;  4X23 D;  3AV2 A;  3REJ C;  3MNN C;  2YFW A;  4XUJ A;  5B24 D;  4NE6 A;  3KWQ D;  3MVD C;  2ZM5 A;  3AZM A;  3MGQ C;  4AWL C;  2CV5 C;  3AFA C;  1P3K C;  3AZH B;  3W97 C;  2F8N B;  4J8U C;  4UUZ B;  2HIO A;  3B0C T;  4QLC C;  3AZI B;  5B24 B;  3UT9 A;  5GSU D;  5BS7 C;  4XUJ B;  3B6F D;  5E5A D;  4XUJ D;  3B6F B;  5B1L A;  3AFA A;  1KX5 B;  3H0L C;  5CP6 A;  3B0B A;  1H3O A;  1AOI C;  3AZJ C;  4ZUX D;  4UUZ A;  4G92 B;  2HIO B;  3AZI A;  4ZUX C;  5B24 A;  4X23 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...