3X1SD

Crystal structure of the nucleosome core particle
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1sD00
5GT3C 1M19B 5AVCB 1P3BC 3LJAB 3W97C 5JRGD 4J8WB 3LZ0A 2HIOB 2F8NH 4G91C 5B1LD 3WKJC 3TU4B 1P34D 4R8PB 4H9RA 3AZGB 3KWQA 3UTBB 4WU8C 4YS3C 3MVDD 3O62D 3W99C 4YM6B 3AYWA 1P3MD 1F66A 1WWIA 2AROD 5KDMA 3X1SA 5DNNA 1P3IC 4H9SC 3A6NB 3AZMA 3AZEB 3VH5T 3WTPC 1ID3A 3REKD 5FUGB 1AOID 1BH9B 3X1TA 3AZJD 2FJ7B 1P3KA 5B40B 2IO5B 3VH6T 3REIA 5F99B 1P34C 3LZ0D 1P3LD 4J8UA 2PYOA 3AZLB 4H9QA 1P3GA 5GSUA 5BNVA 5BO0A 4Z5TA 2YFVB 5GXQB 3VH5A 5B31B 5AVBB 3O62C 4EO5B 1P3MC 4J8XD 4KGCB 1KX4C 2AROC 3AFAB 3AYWD 1F66D 3W96D 4QLCB 4E44A 4KHAA 5AV8A 3VH6A 3AZNA 3AZFA 2NZDA 4NE5A 3REJB 3WAAB 4DRBA 5CP6C 5DNND 3X1SD 1KX3A 3LELD 1AOIC 3REKC 3AN2B 1M1AC 1ID3D 1Q9CA 1B67A 2YFWA 5B24C 3X1TD 1N1JB 2BYKB 1U35C 1P3KD 3AZKA 3B6FA 4G92C 5AV9B 5AV5B 3X1UC 1P3LC 3KXBA 4Z2MG 3UT9B 2CWEA 4UUZA 4X23B 1HTAA 5GSUD 3KUYA 5B2JA 1S32B 5B0ZC 1P3PA 1P3OA 3WA9B 5B1MB 4J8XC 5B2IB 3R45A 4XUJA 3W96C 5GT3A 4XZQA 3MNNB 3AZHB 3W97A 3AZND 3AZFD 3LELC 5G49B 1KX3D 3WKJA 2L5AA 4ZBJB 5CPJB 3C1CC 1TZYB 1WWSA 1P3KC 1KX5B 5CPIC 4ZUXA 3MGPA 4WU8A 4YS3A 1A7WA 3W99A 1P3FC 4WNNB 3KXBD 3W98D 5AV6A 4KUDA 2NQBC 5JA4B 3NQUB 5B33A 3KUYD 1P3IA 4CSRA 5B2JD 4HGAC 1HQ3D 4H9SA 1P3OD 1JFIB 1ZLAB 3MGRD 3WTPA 4Z66B 5GT3D 4XZQD 3W97D 1BH8B 1P34A 4H9NB 1H3OB 3WKJD 4H9OB 3REHB 4H9PB 4ZUXD 3O62A 3MGPD 1P3MA 1M18B 5B32B 4YS3D 3V9RB 1KX4A 3W99D 2AROA 5E5AD 5DNMC 3C1BB 3B6GB 5B0YD 3W98C 5AV6D 1EQZC 4KUDD 3KUYC 3LZ1B 5B33D 1HQ3C 5CP6A 1P3ID 3MGSB 3MGRC 1AOIA 3REKA 1M1AA 3WTPD 4XZQC 3AZIB 5AVCD 5B24A 1U35A 4J8WD 1TAFB 3X1UA 1P3LA 3TU4D 4CAYA 4R8PD 3AV1C 3MGQC 4JJNC 4LD9B 3UTBD 1R4VA 5GT0A 5B0ZA 4ZUXC 3MGPC 4J8XA 2CV5B 5E5AC 3W96A 4QLCA 5B0YC 3UTAB 5BNXA 1KX4D 3AV2B 4WU9C 5AV6C 4KUDC 5B33C 3LELA 5CP6D 5CPKB 1P3AB 1M19C 5C3IB 5JRGB 2FJ7D 5AVCC 1M1AD 3LJAC 3C1CA 5B1LB 5B24D 4J8WC 5CPIA 2HIOC 1U35D 3TU4C 3RELA 4R8PC 3X1UD 2BYMA 1P3FA 5AY8B 4X23A 3MVDB 3AZGC 2NQBA 3UTBC 5B31D 5GT0D 3B0DB 3NQJB 5B0ZD 4YM6C 4J8VB 3AFAD 4QLCD 4AWLB 4M6BA 3A6NC 3AZJB 3AZEC 2FJ7C 3B0CW 5B40C 3LZ0B 1KU5A 3C1CD 5F99C 2HUEB 4H9RB 5CPID 2F8NA 5AV9D 5AV5D 2F8NG 3AZLC 3RELD 3W98A 5DNMA 3KWQB 5JA4A 3UT9D 1P3FD 4X23D 1EQZA 5GXQC 1S32D 5B31C 3AYWB 1F66B 2NQBD 5GT0C 5AVBC 1HQ3A 5B1MD 4EO5C 4KGCC 3MGRA 3AFAC 4Z66A 3X1VA 4QLCC 3X1SB 5DNNB 3REJC 3WAAC 3AZMB 1ID3B 3X1TB 3AN2C 3AV1A 1P3KB 3MGQA 4JJNA 3REIB 4J8UB 2PYOB 5AV9C 5AV5C 3V9RA 4H9QB 1P3GB 2F8ND 5GSUB 5E5AA 3RELC 5B0YA 5BNVB 5BO0B 4Z5TB 3UT9C 5DNMD 4WU9A 4X23C 1ULYA 1S32C 1EQZD 5B1MC 3WA9C 5B2IC 3AZNB 4KHAB 5AV8B 1ZLAD 3AZFB 1M19A 2NZDB 3MNNC 3AZHC 4E45A 2LY8A 3B0CT 4Z66D 5AVCA 3X1VD 3LJAA 1KX3B 4J8WA 2HIOA 3TU4A 4R8PA 2YFWB 4ZBJC 3AV1D 5CPJC 3MGQD 3AZKB 4JJND 1TZYC 3AZGA 1KX5C 3UTBA 3B6FB 5BS7C 3KXBB 4YM6A 3UTAA 4UUZB 3B6GD 5B2JB 1P3PB 1P3OB 4WU9D 3R45B 4XUJB 3A6NA 3AZEA 5CPKA 5GT3B 4XZQB 1P3AA 1ZLAC 5FUGA 1P3BB 3W97B 1BH9A 4Z66C 3X1VC 2FJ7A 1M19D 3VH5W 5B40A 4WV4B 3LJAD 4G91B 3WKJB 4DRAA 5F99A 5BT1C 2HIOD 3AZLA 3VH6W 4LD9D 4WU8B 3REHC 4YS3B 3B0BA 2YFVA 5GXQA 3AZGD 5B31A 3W99B 5AVBA 5B31G 1M18C 5B32C 4KGCA 4NFTA 4YM6D 3AFAA 3C1BC 3UTAD 3B6GC 1P3IB 3REJA 3WAAA 3LZ1C 3WTPB 3MGSC 3A6ND 3AN2A 3AZED 5CPKD 1P3AD 3AZIC 1N1JA 2BYKA 5B40D 4Z2MH 1P34B 5AV9A 5AV5A 5F99D 5CHLB 5AY8D 3UT9A 3AZLD 4LD9C 3O62B 1S32A 1P3MB 3WA9A 5B1MA 1KX4B 5GXQD 2AROB 5B2IA 2CV5C 5AVBD 4J8VD 4KGCD 3UTAC 3MNNA 3AZHA 3AV2C 5CP6B 2JSSA 3REJD 1AOIB 3REKB 2F8NK 3WAAD 1M1AB 5G49A 5CPKC 1P3AC 5B24B 3AN2D 5C3IC 5JRGC 1U35B 5CPJA 1TZYA 5B1LC 1KX5A 4G92B 3X1UB 1P3LB 1F1EA 2IO5C 4CAYB 5BS7A 4WNNA 5AY8C 3KWQD 3MVDC 5GT0B 5B0ZB 3NQUA 4J8XB 3B0DC 3W96B 4J8VC 1JFIA 5BNXB 3WA9D 1ZLAA 5B2ID 4NE6A 5KDMB 3KSYA 3MNND 4AWLC 3AZHD 3LELB 3AZMD 1BFMA 1BH8A 3AZJC 4H9NA 1H3OA 3C1CB 4H9OA 5CPIB 3REID 3LZ0C 3REHA 5CPJD 4H9PA 1TZYD 3RELB 1KX5D 2HUEC 4J8UD 2PYOD 1M18A 2BYMB 1P3FB 5B32A 1P3GD 5B32G 3C1BA 2NQBB 3KWQC 3B6GA 4Z5TD 4HGAB 3AYWC 1F66C 3LZ1A 3MGSA 1P3BA 5AV8D 2NZDD 5DNNC 3X1SC 3AZIA 3AZMC 1ID3C 1TAFA 3X1TC 4NE3A 5BT1D 4LD9A 1B6WA 3REIC 3AZKD 2F8NB 3B6FD 3REHD 2RVQD 4J8UC 2PYOC 3W98B 5DNMB 1P3GC 2CV5A 5GSUC 1M18D 5B32D 4Z5TC 4WZSB 3C1BD 3AV2A 3KUYB 1EQZB 1P3PD 1HQ3B 4XUJD 3MGRB 3LZ1D 3X1VB 3AZNC 5AV8C 3MGSD 3AZFC 2NZDC 1P3BD 5JRGA 1KX3C 5B1LA 3AZID 3AV1B 3MGQB 4JJNB 5AY8A 3AZKC 3MVDA 3B6FC 4ZUXB 3MGPB 4WU8D 2RVQC 3KXBC 5E5AB 3NQJA 5B0YB 4J8VA 4WU9B 5AV6B 2CV5D 4KUDB 5B2JC 1P3PC 1P3OC 5B33B 3AV2D 4CSRB 3WTPE 4XUJC 3AZJA
chains in the Genus database with same CATH superfamily
5GT3C 1M19B 5AVCB 1P3BC 3LJAB 3W97C 5JRGD 4J8WB 3LZ0A 2HIOB 2F8NH 4G91C 5B1LD 3WKJC 3TU4B 1P34D 4R8PB 4H9RA 3AZGB 3KWQA 3UTBB 2VQRA 4YS3C 4WU8C 3MVDD 3O62D 3W99C 3P5JB 4YM6B 3AYWA 1P3MD 1F66A 1WWIA 2AROD 3EPHA 5KDMA 2Y2OA 3H0LC 3X1SA 5DNNA 1P3IC 4H9SC 3A6NB 3AZMA 3AZEB 2ZY3A 3VH5T 3WTPC 1ID3A 3REKD 5FUGB 1AOID 3AL0C 1BH9B 3X1TA 3AZJD 2FJ7B 2UWXA 1P3KA 5B40B 2IO5B 3VH6T 3REIA 2FFFB 5F99B 1P34C 3LZ0D 1P3LD 4J8UA 2PYOA 3AZLB 4H9QA 1P3GA 5GSUA 5BNVA 5BO0A 4Z5TA 3FDDA 2YFVB 5GXQB 3VH5A 5B31B 5AVBB 2Y2LA 4EO5B 3O62C 1P3MC 4J8XD 4KGCB 2DF4C 1KX4C 2AROC 3AFAB 3AYWD 1F66D 3W96D 4QLCB 4E44A 4KHAA 5AV8A 3VH6A 3AZNA 3AZFA 2NZDA 4NE5A 3REJB 3WAAB 4DRBA 5CP6C 5DNND 3X1SD 1KX3A 3LELD 1AOIC 3REKC 3AN2B 1M1AC 1ID3D 1Q9CA 1B67A 2YFWA 5B24C 3X1TD 1N1JB 2BYKB 1U35C 1P3KD 3AZKA 3B6FA 4G92C 5AV9B 5AV5B 4UPKA 3X1UC 1P3LC 3KXBA 4Z2MG 3A1IA 3UT9B 2CWEA 4UUZA 4X23B 1HTAA 2J8PA 5GSUD 5B2JA 3KUYA 1S32B 5B0ZC 1P3PA 1P3OA 3WA9B 5B1MB 4J8XC 5B2IB 3R45A 4XUJA 3W96C 5GT3A 4XZQA 3MNNB 3AZHB 2Y2QA 3W97A 3AZND 3AZFD 3LELC 5G49B 1KX3D 3WKJA 2L5AA 4ZBJB 5CPJB 3C1CC 1TZYB 1WWSA 1P3KC 1KX5B 5CPIC 4ZUXA 3MGPA 4WU8A 4YS3A 1A7WA 2Y2PA 3W99A 1P3FC 4WNNB 3KXBD 3W98D 5AV6A 4KUDA 2NQBC 5JA4B 3NQUB 2F2AC 5B33A 3KUYD 1P3IA 4CSRA 5B2JD 4HGAC 1HQ3D 4H9SA 1P3OD 1JFIB 1ZLAB 3MGRD 3WTPA 4Z66B 1Z2CB 5GT3D 4XZQD 3W97D 1BH8B 2Y2JA 1P34A 4H9NB 3H0RC 1H3OB 3EPJA 3WKJD 4H9OB 2Y2KA 3REHB 4H9PB 4ZUXD 3O62A 3MGPD 1P3MA 1M18B 5B32B 4YS3D 3V9RB 1KX4A 3W99D 2AROA 5E5AD 5DNMC 3C1BB 3B6GB 5B0YD 3W98C 5AV6D 1EQZC 4KUDD 3KUYC 3LZ1B 5B33D 1HQ3C 5CP6A 1P3ID 3MGSB 3MGRC 1AOIA 3REKA 1M1AA 3WTPD 4XZQC 3AZIB 5AVCD 5B24A 2G5IC 1U35A 4J8WD 1TAFB 3X1UA 1P3LA 3TU4D 4CAYA 4R8PD 3AV1C 3MGQC 4JJNC 4LD9B 2Y2HA 3UTBD 1R4VA 5B0ZA 5GT0A 4ZUXC 3MGPC 4J8XA 2CV5B 5E5AC 3W96A 4QLCA 5B0YC 3UTAB 5BNXA 1KX4D 3AV2B 4WU9C 5AV6C 4KUDC 3EG5B 5B33C 3LELA 5CP6D 5CPKB 1P3AB 1M19C 5C3IB 5JRGB 2FJ7D 5AVCC 1M1AD 3LJAC 3C1CA 5B1LB 5B24D 4J8WC 5CPIA 2HIOC 1U35D 3TU4C 3RELA 4R8PC 3X1UD 2BYMA 1P3FA 5AY8B 4X23A 3MVDB 2ZM5A 3AZGC 2NQBA 3UTBC 5B31D 3B0DB 3NQJB 5B0ZD 4YM6C 5GT0D 4J8VB 3AFAD 2ZY2A 4QLCD 4AWLB 4M6BA 3A6NC 3AZJB 3AZEC 2FJ7C 3B0CW 2ZY4A 5B40C 3LZ0B 1KU5A 3C1CD 5F99C 2HUEB 4H9RB 5CPID 2F8NA 5AV9D 5AV5D 2F8NG 3AZLC 3RELD 3W98A 5DNMA 3KWQB 5JA4A 3UT9D 1P3FD 4X23D 1EQZA 5GXQC 1S32D 5B31C 3AYWB 1F66B 2NQBD 5GT0C 5AVBC 1HQ3A 5B1MD 4EO5C 4KGCC 3MGRA 3AFAC 4Z66A 3X1VA 4QLCC 5DNNB 3X1SB 3REJC 3WAAC 3AZMB 1ID3B 3F6TA 3X1TB 3AN2C 3AV1A 1P3KB 3MGQA 4JJNA 2ZY5A 3REIB 4J8UB 2PYOB 5AV9C 5AV5C 3V9RA 4H9QB 1P3GB 2F8ND 5GSUB 5E5AA 3RELC 5B0YA 5BNVB 5BO0B 4Z5TB 3UT9C 5DNMD 4WU9A 4X23C 1ULYA 1S32C 1EQZD 5B1MC 3WA9C 5B2IC 3AZNB 4KHAB 5AV8B 1ZLAD 3AZFB 1M19A 2NZDB 3MNNC 3AZHC 4E45A 2LY8A 3B0CT 4Z66D 5AVCA 3X1VD 3LJAA 1KX3B 4J8WA 2HIOA 3TU4A 4R8PA 2YFWB 4ZBJC 3AV1D 5CPJC 3MGQD 3AZKB 4JJND 1TZYC 3AZGA 1KX5C 3UTBA 3B6FB 5BS7C 3KXBB 4YM6A 2Y2NA 3UTAA 3IP4C 2JE5A 4UUZB 3B6GD 5B2JB 1P3PB 1P3OB 4WU9D 3R45B 4XUJB 3A6NA 2XD1A 3AZEA 5CPKA 5GT3B 4XZQB 1P3AA 1ZLAC 5FUGA 1P3BB 3W97B 1BH9A 4Z66C 3X1VC 2FJ7A 1M19D 3VH5W 5B40A 4WV4B 3LJAD 4G91B 4WJ3C 3WKJB 4DRAA 5F99A 5BT1C 1W2EA 2HIOD 3AZLA 3VH6W 4LD9D 4WU8B 3REHC 4YS3B 3B0BA 2YFVA 5GXQA 3AZGD 5B31A 3W99B 5AVBA 5B31G 1M18C 1T3UA 5B32C 4KGCA 4NFTA 4YM6D 3AFAA 3C1BC 3UTAD 3B6GC 1P3IB 3REJA 3WAAA 3LZ1C 2JCHA 3WTPB 2DQNC 3MGSC 3A6ND 3AN2A 3AZED 5CPKD 1P3AD 3AZIC 2Y2GA 1N1JA 2BYKA 5B40D 4Z2MH 1P34B 5AV9A 5AV5A 5F99D 5CHLB 5AY8D 3UT9A 3AZLD 4LD9C 3O62B 1S32A 1P3MB 3WA9A 5B1MA 1KX4B 5GXQD 2AROB 5B2IA 2BG1A 2CV5C 5AVBD 4J8VD 4KGCD 3UTAC 3KFUG 3MNNA 3AZHA 3AV2C 5CP6B 2JSSA 3EPLA 3REJD 3REKB 1AOIB 2F8NK 3WAAD 1M1AB 5G49A 5CPKC 1P3AC 5B24B 3AN2D 5C3IC 2RIQA 5JRGC 1U35B 5CPJA 1TZYA 5B1LC 1KX5A 4G92B 3X1UB 1P3LB 1F1EA 2IO5C 4CAYB 5BS7A 4WNNA 5AY8C 3A1KA 3KWQD 3MVDC 5GT0B 5B0ZB 3NQUA 4J8XB 3B0DC 3W96B 4J8VC 1JFIA 5BNXB 3WA9D 1ZLAA 5B2ID 4NE6A 5KDMB 3KSYA 3MNND 4AWLC 3AZHD 3LELB 3AZMD 1BFMA 1BH8A 3AZJC 4H9NA 1H3OA 3C1CB 4H9OA 5CPIB 3REID 3LZ0C 3REHA 5CPJD 4H9PA 1TZYD 4DQYB 3RELB 1KX5D 2HUEC 4J8UD 2PYOD 1M18A 2BYMB 1P3FB 5B32A 2Y2MA 1P3GD 5B32G 3C1BA 2NQBB 3KWQC 3B6GA 4Z5TD 4HGAB 3AYWC 1F66C 3LZ1A 3MGSA 1P3BA 5AV8D 2NZDD 5DNNC 3X1SC 3AZIA 3AZMC 1ID3C 1TAFA 3X1TC 4NE3A 5BT1D 3EPKA 4LD9A 1B6WA 3REIC 3AZKD 1PZRA 2F8NB 3B6FD 3REHD 2RVQD 4J8UC 2PYOC 3W98B 5DNMB 1P3GC 2CV5A 5GSUC 1M18D 5B32D 4Z5TC 4WZSB 3C1BD 3AV2A 3KUYB 1EQZB 1P3PD 1HQ3B 3H0MC 2Y2IA 4XUJD 3MGRB 3LZ1D 3X1VB 3AZNC 5AV8C 3MGSD 3AZFC 2NZDC 1P3BD 5JRGA 1KX3C 5B1LA 3AZID 3AV1B 3MGQB 4JJNB 5AY8A 3AZKC 2G5HC 3MVDA 3B6FC 4ZUXB 3MGPB 4WU8D 2RVQC 3KXBC 5E5AB 3NQJA 2XD5A 5B0YB 4J8VA 2W8SA 4WU9B 5AV6B 2CV5D 4KUDB 5B2JC 1P3PC 1P3OC 5B33B 3AV2D 4CSRB 3WTPE 4XUJC 3AZJA
chains in the Genus database with same CATH topology
5GT3C 1M19B 5AVCB 1P3BC 3LJAB 3W97C 5JRGD 4J8WB 3LZ0A 2HIOB 2F8NH 4G91C 5B1LD 3WKJC 3TU4B 1P34D 4R8PB 4H9RA 3AZGB 3KWQA 3UTBB 2VQRA 4YS3C 4WU8C 3MVDD 3O62D 3W99C 3P5JB 4YM6B 3AYWA 1P3MD 1F66A 1WWIA 2AROD 3EPHA 5KDMA 2Y2OA 3H0LC 3X1SA 5DNNA 1P3IC 4H9SC 3A6NB 3AZMA 3AZEB 2ZY3A 3VH5T 3WTPC 1ID3A 3REKD 5FUGB 1AOID 3AL0C 1BH9B 3X1TA 3AZJD 2FJ7B 2UWXA 1P3KA 5B40B 2IO5B 3VH6T 3REIA 2FFFB 5F99B 1P34C 3LZ0D 1P3LD 4J8UA 2PYOA 3AZLB 4H9QA 1P3GA 5GSUA 5BNVA 5BO0A 4Z5TA 3FDDA 2YFVB 5GXQB 3VH5A 5B31B 5AVBB 2Y2LA 4EO5B 3O62C 1P3MC 4J8XD 4KGCB 2DF4C 1KX4C 2AROC 3AFAB 3AYWD 1F66D 3W96D 4QLCB 4E44A 4KHAA 5AV8A 3VH6A 3AZNA 3AZFA 2NZDA 4NE5A 3REJB 3WAAB 4DRBA 5CP6C 5DNND 3X1SD 1KX3A 3LELD 1AOIC 3REKC 3AN2B 1M1AC 1ID3D 1Q9CA 1B67A 2YFWA 5B24C 3X1TD 1N1JB 2BYKB 1U35C 1P3KD 3AZKA 3B6FA 4G92C 5AV9B 5AV5B 4UPKA 3X1UC 1P3LC 3KXBA 4Z2MG 3A1IA 3UT9B 2CWEA 4UUZA 4X23B 1HTAA 2J8PA 5GSUD 5B2JA 3KUYA 1S32B 5B0ZC 1P3PA 1P3OA 3WA9B 5B1MB 4J8XC 5B2IB 3R45A 4XUJA 3W96C 5GT3A 4XZQA 3MNNB 3AZHB 2Y2QA 3W97A 3AZND 3AZFD 3LELC 5G49B 1KX3D 3WKJA 2L5AA 4ZBJB 5CPJB 3C1CC 1TZYB 1WWSA 1P3KC 1KX5B 5CPIC 4ZUXA 3MGPA 4WU8A 4YS3A 1A7WA 2Y2PA 3W99A 1P3FC 4WNNB 3KXBD 3W98D 5AV6A 4KUDA 2NQBC 5JA4B 3NQUB 2F2AC 5B33A 3KUYD 1P3IA 4CSRA 5B2JD 4HGAC 1HQ3D 4H9SA 1P3OD 1JFIB 1ZLAB 3MGRD 3WTPA 4Z66B 1Z2CB 5GT3D 4XZQD 3W97D 1BH8B 2Y2JA 1P34A 4H9NB 3H0RC 1H3OB 3EPJA 3WKJD 4H9OB 2Y2KA 3REHB 4H9PB 4ZUXD 3O62A 3MGPD 1P3MA 1M18B 5B32B 4YS3D 3V9RB 1KX4A 3W99D 2AROA 5E5AD 5DNMC 3C1BB 3B6GB 5B0YD 3W98C 5AV6D 1EQZC 4KUDD 3KUYC 3LZ1B 5B33D 1HQ3C 5CP6A 1P3ID 3MGSB 3MGRC 1AOIA 3REKA 1M1AA 3WTPD 4XZQC 3AZIB 5AVCD 5B24A 2G5IC 1U35A 4J8WD 1TAFB 3X1UA 1P3LA 3TU4D 4CAYA 4R8PD 3AV1C 3MGQC 4JJNC 4LD9B 2Y2HA 3UTBD 1R4VA 5B0ZA 5GT0A 4ZUXC 3MGPC 4J8XA 2CV5B 5E5AC 3W96A 4QLCA 5B0YC 3UTAB 5BNXA 1KX4D 3AV2B 4WU9C 5AV6C 4KUDC 3EG5B 5B33C 3LELA 5CP6D 5CPKB 1P3AB 1M19C 5C3IB 5JRGB 2FJ7D 5AVCC 1M1AD 3LJAC 3C1CA 5B1LB 5B24D 4J8WC 5CPIA 2HIOC 1U35D 3TU4C 3RELA 4R8PC 3X1UD 2BYMA 1P3FA 5AY8B 4X23A 3MVDB 2ZM5A 3AZGC 2NQBA 3UTBC 5B31D 3B0DB 3NQJB 5B0ZD 4YM6C 5GT0D 4J8VB 3AFAD 2ZY2A 4QLCD 4AWLB 4M6BA 3A6NC 3AZJB 3AZEC 2FJ7C 3B0CW 2ZY4A 5B40C 3LZ0B 1KU5A 3C1CD 5F99C 2HUEB 4H9RB 5CPID 2F8NA 5AV9D 5AV5D 2F8NG 3AZLC 3RELD 3W98A 5DNMA 3KWQB 5JA4A 3UT9D 1P3FD 4X23D 1EQZA 5GXQC 1S32D 5B31C 3AYWB 1F66B 2NQBD 5GT0C 5AVBC 1HQ3A 5B1MD 4EO5C 4KGCC 3MGRA 3AFAC 4Z66A 3X1VA 4QLCC 5DNNB 3X1SB 3REJC 3WAAC 3AZMB 1ID3B 3F6TA 3X1TB 3AN2C 3AV1A 1P3KB 3MGQA 4JJNA 2ZY5A 3REIB 4J8UB 2PYOB 5AV9C 5AV5C 3V9RA 4H9QB 1P3GB 2F8ND 5GSUB 5E5AA 3RELC 5B0YA 5BNVB 5BO0B 4Z5TB 3UT9C 5DNMD 4WU9A 4X23C 1ULYA 1S32C 1EQZD 5B1MC 3WA9C 5B2IC 3AZNB 4KHAB 5AV8B 1ZLAD 3AZFB 1M19A 2NZDB 3MNNC 3AZHC 4E45A 2LY8A 3B0CT 4Z66D 5AVCA 3X1VD 3LJAA 1KX3B 4J8WA 2HIOA 3TU4A 4R8PA 2YFWB 4ZBJC 3AV1D 5CPJC 3MGQD 3AZKB 4JJND 1TZYC 3AZGA 1KX5C 3UTBA 3B6FB 5BS7C 3KXBB 4YM6A 2Y2NA 3UTAA 3IP4C 2JE5A 4UUZB 3B6GD 5B2JB 1P3PB 1P3OB 4WU9D 3R45B 4XUJB 3A6NA 2XD1A 3AZEA 5CPKA 5GT3B 4XZQB 1P3AA 1ZLAC 5FUGA 1P3BB 3W97B 1BH9A 4Z66C 3X1VC 2FJ7A 1M19D 3VH5W 5B40A 4WV4B 3LJAD 4G91B 4WJ3C 3WKJB 4DRAA 5F99A 5BT1C 1W2EA 2HIOD 3AZLA 3VH6W 4LD9D 4WU8B 3REHC 4YS3B 3B0BA 2YFVA 5GXQA 3AZGD 5B31A 3W99B 5AVBA 5B31G 1M18C 1T3UA 5B32C 4KGCA 4NFTA 4YM6D 3AFAA 3C1BC 3UTAD 3B6GC 1P3IB 3REJA 3WAAA 3LZ1C 2JCHA 3WTPB 2DQNC 3MGSC 3A6ND 3AN2A 3AZED 5CPKD 1P3AD 3AZIC 2Y2GA 1N1JA 2BYKA 5B40D 4Z2MH 1P34B 5AV9A 5AV5A 5F99D 5CHLB 5AY8D 3UT9A 3AZLD 4LD9C 3O62B 1S32A 1P3MB 3WA9A 5B1MA 1KX4B 5GXQD 2AROB 5B2IA 2BG1A 2CV5C 5AVBD 4J8VD 4KGCD 3UTAC 3KFUG 3MNNA 3AZHA 3AV2C 5CP6B 2JSSA 3EPLA 3REJD 3REKB 1AOIB 2F8NK 3WAAD 1M1AB 5G49A 5CPKC 1P3AC 5B24B 3AN2D 5C3IC 2RIQA 5JRGC 1U35B 5CPJA 1TZYA 5B1LC 1KX5A 4G92B 3X1UB 1P3LB 1F1EA 2IO5C 4CAYB 5BS7A 4WNNA 5AY8C 3A1KA 3KWQD 3MVDC 5GT0B 5B0ZB 3NQUA 4J8XB 3B0DC 3W96B 4J8VC 1JFIA 5BNXB 3WA9D 1ZLAA 5B2ID 4NE6A 5KDMB 3KSYA 3MNND 4AWLC 3AZHD 3LELB 3AZMD 1BFMA 1BH8A 3AZJC 4H9NA 1H3OA 3C1CB 4H9OA 5CPIB 3REID 3LZ0C 3REHA 5CPJD 4H9PA 1TZYD 4DQYB 3RELB 1KX5D 2HUEC 4J8UD 2PYOD 1M18A 2BYMB 1P3FB 5B32A 2Y2MA 1P3GD 5B32G 3C1BA 2NQBB 3KWQC 3B6GA 4Z5TD 4HGAB 3AYWC 1F66C 3LZ1A 3MGSA 1P3BA 5AV8D 2NZDD 5DNNC 3X1SC 3AZIA 3AZMC 1ID3C 1TAFA 3X1TC 4NE3A 5BT1D 3EPKA 4LD9A 1B6WA 3REIC 3AZKD 1PZRA 2F8NB 3B6FD 3REHD 2RVQD 4J8UC 2PYOC 3W98B 5DNMB 1P3GC 2CV5A 5GSUC 1M18D 5B32D 4Z5TC 4WZSB 3C1BD 3AV2A 3KUYB 1EQZB 1P3PD 1HQ3B 3H0MC 2Y2IA 4XUJD 3MGRB 3LZ1D 3X1VB 3AZNC 5AV8C 3MGSD 3AZFC 2NZDC 1P3BD 5JRGA 1KX3C 5B1LA 3AZID 3AV1B 3MGQB 4JJNB 5AY8A 3AZKC 2G5HC 3MVDA 3B6FC 4ZUXB 3MGPB 4WU8D 2RVQC 3KXBC 5E5AB 3NQJA 2XD5A 5B0YB 4J8VA 2W8SA 4WU9B 5AV6B 2CV5D 4KUDB 5B2JC 1P3PC 1P3OC 5B33B 3AV2D 4CSRB 3WTPE 4XUJC 3AZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT3 C;  1M19 B;  5AVC B;  1P3B C;  3LJA B;  3W97 C;  5JRG D;  4J8W B;  3LZ0 A;  2HIO B;  2F8N H;  4G91 C;  5B1L D;  3WKJ C;  3TU4 B;  1P34 D;  4R8P B;  4H9R A;  3AZG B;  3KWQ A;  3UTB B;  4WU8 C;  4YS3 C;  3MVD D;  3O62 D;  3W99 C;  4YM6 B;  3AYW A;  1P3M D;  1F66 A;  1WWI A;  2ARO D;  5KDM A;  3X1S A;  5DNN A;  1P3I C;  4H9S C;  3A6N B;  3AZM A;  3AZE B;  3VH5 T;  3WTP C;  1ID3 A;  3REK D;  5FUG B;  1AOI D;  1BH9 B;  3X1T A;  3AZJ D;  2FJ7 B;  1P3K A;  5B40 B;  2IO5 B;  3VH6 T;  3REI A;  5F99 B;  1P34 C;  3LZ0 D;  1P3L D;  4J8U A;  2PYO A;  3AZL B;  4H9Q A;  1P3G A;  5GSU A;  5BNV A;  5BO0 A;  4Z5T A;  2YFV B;  5GXQ B;  3VH5 A;  5B31 B;  5AVB B;  3O62 C;  4EO5 B;  1P3M C;  4J8X D;  4KGC B;  1KX4 C;  2ARO C;  3AFA B;  3AYW D;  1F66 D;  3W96 D;  4QLC B;  4E44 A;  4KHA A;  5AV8 A;  3VH6 A;  3AZN A;  3AZF A;  2NZD A;  4NE5 A;  3REJ B;  3WAA B;  4DRB A;  5CP6 C;  5DNN D;  3X1S D;  1KX3 A;  3LEL D;  1AOI C;  3REK C;  3AN2 B;  1M1A C;  1ID3 D;  1Q9C A;  1B67 A;  2YFW A;  5B24 C;  3X1T D;  1N1J B;  2BYK B;  1U35 C;  1P3K D;  3AZK A;  3B6F A;  4G92 C;  5AV9 B;  5AV5 B;  3X1U C;  1P3L C;  3KXB A;  4Z2M G;  3UT9 B;  2CWE A;  4UUZ A;  4X23 B;  1HTA A;  5GSU D;  3KUY A;  5B2J A;  1S32 B;  5B0Z C;  1P3P A;  1P3O A;  3WA9 B;  5B1M B;  4J8X C;  5B2I B;  3R45 A;  4XUJ A;  3W96 C;  5GT3 A;  4XZQ A;  3MNN B;  3AZH B;  3W97 A;  3AZN D;  3AZF D;  3LEL C;  5G49 B;  1KX3 D;  3WKJ A;  2L5A A;  4ZBJ B;  5CPJ B;  3C1C C;  1TZY B;  1WWS A;  1P3K C;  1KX5 B;  5CPI C;  4ZUX A;  3MGP A;  4WU8 A;  4YS3 A;  1A7W A;  3W99 A;  1P3F C;  4WNN B;  3KXB D;  3W98 D;  5AV6 A;  4KUD A;  2NQB C;  5JA4 B;  3NQU B;  5B33 A;  3KUY D;  1P3I A;  4CSR A;  5B2J D;  4HGA C;  1HQ3 D;  4H9S A;  1P3O D;  1JFI B;  1ZLA B;  3MGR D;  3WTP A;  4Z66 B;  5GT3 D;  4XZQ D;  3W97 D;  1BH8 B;  1P34 A;  4H9N B;  1H3O B;  3WKJ D;  4H9O B;  3REH B;  4H9P B;  4ZUX D;  3O62 A;  3MGP D;  1P3M A;  1M18 B;  5B32 B;  4YS3 D;  3V9R B;  1KX4 A;  3W99 D;  2ARO A;  5E5A D;  5DNM C;  3C1B B;  3B6G B;  5B0Y D;  3W98 C;  5AV6 D;  1EQZ C;  4KUD D;  3KUY C;  3LZ1 B;  5B33 D;  1HQ3 C;  5CP6 A;  1P3I D;  3MGS B;  3MGR C;  1AOI A;  3REK A;  1M1A A;  3WTP D;  4XZQ C;  3AZI B;  5AVC D;  5B24 A;  1U35 A;  4J8W D;  1TAF B;  3X1U A;  1P3L A;  3TU4 D;  4CAY A;  4R8P D;  3AV1 C;  3MGQ C;  4JJN C;  4LD9 B;  3UTB D;  1R4V A;  5GT0 A;  5B0Z A;  4ZUX C;  3MGP C;  4J8X A;  2CV5 B;  5E5A C;  3W96 A;  4QLC A;  5B0Y C;  3UTA B;  5BNX A;  1KX4 D;  3AV2 B;  4WU9 C;  5AV6 C;  4KUD C;  5B33 C;  3LEL A;  5CP6 D;  5CPK B;  1P3A B;  1M19 C;  5C3I B;  5JRG B;  2FJ7 D;  5AVC C;  1M1A D;  3LJA C;  3C1C A;  5B1L B;  5B24 D;  4J8W C;  5CPI A;  2HIO C;  1U35 D;  3TU4 C;  3REL A;  4R8P C;  3X1U D;  2BYM A;  1P3F A;  5AY8 B;  4X23 A;  3MVD B;  3AZG C;  2NQB A;  3UTB C;  5B31 D;  5GT0 D;  3B0D B;  3NQJ B;  5B0Z D;  4YM6 C;  4J8V B;  3AFA D;  4QLC D;  4AWL B;  4M6B A;  3A6N C;  3AZJ B;  3AZE C;  2FJ7 C;  3B0C W;  5B40 C;  3LZ0 B;  1KU5 A;  3C1C D;  5F99 C;  2HUE B;  4H9R B;  5CPI D;  2F8N A;  5AV9 D;  5AV5 D;  2F8N G;  3AZL C;  3REL D;  3W98 A;  5DNM A;  3KWQ B;  5JA4 A;  3UT9 D;  1P3F D;  4X23 D;  1EQZ A;  5GXQ C;  1S32 D;  5B31 C;  3AYW B;  1F66 B;  2NQB D;  5GT0 C;  5AVB C;  1HQ3 A;  5B1M D;  4EO5 C;  4KGC C;  3MGR A;  3AFA C;  4Z66 A;  3X1V A;  4QLC C;  3X1S B;  5DNN B;  3REJ C;  3WAA C;  3AZM B;  1ID3 B;  3X1T B;  3AN2 C;  3AV1 A;  1P3K B;  3MGQ A;  4JJN A;  3REI B;  4J8U B;  2PYO B;  5AV9 C;  5AV5 C;  3V9R A;  4H9Q B;  1P3G B;  2F8N D;  5GSU B;  5E5A A;  3REL C;  5B0Y A;  5BNV B;  5BO0 B;  4Z5T B;  3UT9 C;  5DNM D;  4WU9 A;  4X23 C;  1ULY A;  1S32 C;  1EQZ D;  5B1M C;  3WA9 C;  5B2I C;  3AZN B;  4KHA B;  5AV8 B;  1ZLA D;  3AZF B;  1M19 A;  2NZD B;  3MNN C;  3AZH C;  4E45 A;  2LY8 A;  3B0C T;  4Z66 D;  5AVC A;  3X1V D;  3LJA A;  1KX3 B;  4J8W A;  2HIO A;  3TU4 A;  4R8P A;  2YFW B;  4ZBJ C;  3AV1 D;  5CPJ C;  3MGQ D;  3AZK B;  4JJN D;  1TZY C;  3AZG A;  1KX5 C;  3UTB A;  3B6F B;  5BS7 C;  3KXB B;  4YM6 A;  3UTA A;  4UUZ B;  3B6G D;  5B2J B;  1P3P B;  1P3O B;  4WU9 D;  3R45 B;  4XUJ B;  3A6N A;  3AZE A;  5CPK A;  5GT3 B;  4XZQ B;  1P3A A;  1ZLA C;  5FUG A;  1P3B B;  3W97 B;  1BH9 A;  4Z66 C;  3X1V C;  2FJ7 A;  1M19 D;  3VH5 W;  5B40 A;  4WV4 B;  3LJA D;  4G91 B;  3WKJ B;  4DRA A;  5F99 A;  5BT1 C;  2HIO D;  3AZL A;  3VH6 W;  4LD9 D;  4WU8 B;  3REH C;  4YS3 B;  3B0B A;  2YFV A;  5GXQ A;  3AZG D;  5B31 A;  3W99 B;  5AVB A;  5B31 G;  1M18 C;  5B32 C;  4KGC A;  4NFT A;  4YM6 D;  3AFA A;  3C1B C;  3UTA D;  3B6G C;  1P3I B;  3REJ A;  3WAA A;  3LZ1 C;  3WTP B;  3MGS C;  3A6N D;  3AN2 A;  3AZE D;  5CPK D;  1P3A D;  3AZI C;  1N1J A;  2BYK A;  5B40 D;  4Z2M H;  1P34 B;  5AV9 A;  5AV5 A;  5F99 D;  5CHL B;  5AY8 D;  3UT9 A;  3AZL D;  4LD9 C;  3O62 B;  1S32 A;  1P3M B;  3WA9 A;  5B1M A;  1KX4 B;  5GXQ D;  2ARO B;  5B2I A;  2CV5 C;  5AVB D;  4J8V D;  4KGC D;  3UTA C;  3MNN A;  3AZH A;  3AV2 C;  5CP6 B;  2JSS A;  3REJ D;  1AOI B;  3REK B;  2F8N K;  3WAA D;  1M1A B;  5G49 A;  5CPK C;  1P3A C;  5B24 B;  3AN2 D;  5C3I C;  5JRG C;  1U35 B;  5CPJ A;  1TZY A;  5B1L C;  1KX5 A;  4G92 B;  3X1U B;  1P3L B;  1F1E A;  2IO5 C;  4CAY B;  5BS7 A;  4WNN A;  5AY8 C;  3KWQ D;  3MVD C;  5GT0 B;  5B0Z B;  3NQU A;  4J8X B;  3B0D C;  3W96 B;  4J8V C;  1JFI A;  5BNX B;  3WA9 D;  1ZLA A;  5B2I D;  4NE6 A;  5KDM B;  3KSY A;  3MNN D;  4AWL C;  3AZH D;  3LEL B;  3AZM D;  1BFM A;  1BH8 A;  3AZJ C;  4H9N A;  1H3O A;  3C1C B;  4H9O A;  5CPI B;  3REI D;  3LZ0 C;  3REH A;  5CPJ D;  4H9P A;  1TZY D;  3REL B;  1KX5 D;  2HUE C;  4J8U D;  2PYO D;  1M18 A;  2BYM B;  1P3F B;  5B32 A;  1P3G D;  5B32 G;  3C1B A;  2NQB B;  3KWQ C;  3B6G A;  4Z5T D;  4HGA B;  3AYW C;  1F66 C;  3LZ1 A;  3MGS A;  1P3B A;  5AV8 D;  2NZD D;  5DNN C;  3X1S C;  3AZI A;  3AZM C;  1ID3 C;  1TAF A;  3X1T C;  4NE3 A;  5BT1 D;  4LD9 A;  1B6W A;  3REI C;  3AZK D;  2F8N B;  3B6F D;  3REH D;  2RVQ D;  4J8U C;  2PYO C;  3W98 B;  5DNM B;  1P3G C;  2CV5 A;  5GSU C;  1M18 D;  5B32 D;  4Z5T C;  4WZS B;  3C1B D;  3AV2 A;  3KUY B;  1EQZ B;  1P3P D;  1HQ3 B;  4XUJ D;  3MGR B;  3LZ1 D;  3X1V B;  3AZN C;  5AV8 C;  3MGS D;  3AZF C;  2NZD C;  1P3B D;  5JRG A;  1KX3 C;  5B1L A;  3AZI D;  3AV1 B;  3MGQ B;  4JJN B;  5AY8 A;  3AZK C;  3MVD A;  3B6F C;  4ZUX B;  3MGP B;  4WU8 D;  2RVQ C;  3KXB C;  5E5A B;  3NQJ A;  5B0Y B;  4J8V A;  4WU9 B;  5AV6 B;  2CV5 D;  4KUD B;  5B2J C;  1P3P C;  1P3O C;  5B33 B;  3AV2 D;  4CSR B;  3WTP E;  4XUJ C;  3AZJ A; 
#chains in the Genus database with same CATH topology
 5GT3 C;  1M19 B;  5AVC B;  1P3B C;  3LJA B;  3W97 C;  5JRG D;  4J8W B;  3LZ0 A;  2HIO B;  2F8N H;  4G91 C;  5B1L D;  3WKJ C;  3TU4 B;  1P34 D;  4R8P B;  4H9R A;  3AZG B;  3KWQ A;  3UTB B;  2VQR A;  4YS3 C;  4WU8 C;  3MVD D;  3O62 D;  3W99 C;  3P5J B;  4YM6 B;  3AYW A;  1P3M D;  1F66 A;  1WWI A;  2ARO D;  3EPH A;  5KDM A;  2Y2O A;  3H0L C;  3X1S A;  5DNN A;  1P3I C;  4H9S C;  3A6N B;  3AZM A;  3AZE B;  2ZY3 A;  3VH5 T;  3WTP C;  1ID3 A;  3REK D;  5FUG B;  1AOI D;  3AL0 C;  1BH9 B;  3X1T A;  3AZJ D;  2FJ7 B;  2UWX A;  1P3K A;  5B40 B;  2IO5 B;  3VH6 T;  3REI A;  2FFF B;  5F99 B;  1P34 C;  3LZ0 D;  1P3L D;  4J8U A;  2PYO A;  3AZL B;  4H9Q A;  1P3G A;  5GSU A;  5BNV A;  5BO0 A;  4Z5T A;  3FDD A;  2YFV B;  5GXQ B;  3VH5 A;  5B31 B;  5AVB B;  2Y2L A;  4EO5 B;  3O62 C;  1P3M C;  4J8X D;  4KGC B;  2DF4 C;  1KX4 C;  2ARO C;  3AFA B;  3AYW D;  1F66 D;  3W96 D;  4QLC B;  4E44 A;  4KHA A;  5AV8 A;  3VH6 A;  3AZN A;  3AZF A;  2NZD A;  4NE5 A;  3REJ B;  3WAA B;  4DRB A;  5CP6 C;  5DNN D;  3X1S D;  1KX3 A;  3LEL D;  1AOI C;  3REK C;  3AN2 B;  1M1A C;  1ID3 D;  1Q9C A;  1B67 A;  2YFW A;  5B24 C;  3X1T D;  1N1J B;  2BYK B;  1U35 C;  1P3K D;  3AZK A;  3B6F A;  4G92 C;  5AV9 B;  5AV5 B;  4UPK A;  3X1U C;  1P3L C;  3KXB A;  4Z2M G;  3A1I A;  3UT9 B;  2CWE A;  4UUZ A;  4X23 B;  1HTA A;  2J8P A;  5GSU D;  5B2J A;  3KUY A;  1S32 B;  5B0Z C;  1P3P A;  1P3O A;  3WA9 B;  5B1M B;  4J8X C;  5B2I B;  3R45 A;  4XUJ A;  3W96 C;  5GT3 A;  4XZQ A;  3MNN B;  3AZH B;  2Y2Q A;  3W97 A;  3AZN D;  3AZF D;  3LEL C;  5G49 B;  1KX3 D;  3WKJ A;  2L5A A;  4ZBJ B;  5CPJ B;  3C1C C;  1TZY B;  1WWS A;  1P3K C;  1KX5 B;  5CPI C;  4ZUX A;  3MGP A;  4WU8 A;  4YS3 A;  1A7W A;  2Y2P A;  3W99 A;  1P3F C;  4WNN B;  3KXB D;  3W98 D;  5AV6 A;  4KUD A;  2NQB C;  5JA4 B;  3NQU B;  2F2A C;  5B33 A;  3KUY D;  1P3I A;  4CSR A;  5B2J D;  4HGA C;  1HQ3 D;  4H9S A;  1P3O D;  1JFI B;  1ZLA B;  3MGR D;  3WTP A;  4Z66 B;  1Z2C B;  5GT3 D;  4XZQ D;  3W97 D;  1BH8 B;  2Y2J A;  1P34 A;  4H9N B;  3H0R C;  1H3O B;  3EPJ A;  3WKJ D;  4H9O B;  2Y2K A;  3REH B;  4H9P B;  4ZUX D;  3O62 A;  3MGP D;  1P3M A;  1M18 B;  5B32 B;  4YS3 D;  3V9R B;  1KX4 A;  3W99 D;  2ARO A;  5E5A D;  5DNM C;  3C1B B;  3B6G B;  5B0Y D;  3W98 C;  5AV6 D;  1EQZ C;  4KUD D;  3KUY C;  3LZ1 B;  5B33 D;  1HQ3 C;  5CP6 A;  1P3I D;  3MGS B;  3MGR C;  1AOI A;  3REK A;  1M1A A;  3WTP D;  4XZQ C;  3AZI B;  5AVC D;  5B24 A;  2G5I C;  1U35 A;  4J8W D;  1TAF B;  3X1U A;  1P3L A;  3TU4 D;  4CAY A;  4R8P D;  3AV1 C;  3MGQ C;  4JJN C;  4LD9 B;  2Y2H A;  3UTB D;  1R4V A;  5B0Z A;  5GT0 A;  4ZUX C;  3MGP C;  4J8X A;  2CV5 B;  5E5A C;  3W96 A;  4QLC A;  5B0Y C;  3UTA B;  5BNX A;  1KX4 D;  3AV2 B;  4WU9 C;  5AV6 C;  4KUD C;  3EG5 B;  5B33 C;  3LEL A;  5CP6 D;  5CPK B;  1P3A B;  1M19 C;  5C3I B;  5JRG B;  2FJ7 D;  5AVC C;  1M1A D;  3LJA C;  3C1C A;  5B1L B;  5B24 D;  4J8W C;  5CPI A;  2HIO C;  1U35 D;  3TU4 C;  3REL A;  4R8P C;  3X1U D;  2BYM A;  1P3F A;  5AY8 B;  4X23 A;  3MVD B;  2ZM5 A;  3AZG C;  2NQB A;  3UTB C;  5B31 D;  3B0D B;  3NQJ B;  5B0Z D;  4YM6 C;  5GT0 D;  4J8V B;  3AFA D;  2ZY2 A;  4QLC D;  4AWL B;  4M6B A;  3A6N C;  3AZJ B;  3AZE C;  2FJ7 C;  3B0C W;  2ZY4 A;  5B40 C;  3LZ0 B;  1KU5 A;  3C1C D;  5F99 C;  2HUE B;  4H9R B;  5CPI D;  2F8N A;  5AV9 D;  5AV5 D;  2F8N G;  3AZL C;  3REL D;  3W98 A;  5DNM A;  3KWQ B;  5JA4 A;  3UT9 D;  1P3F D;  4X23 D;  1EQZ A;  5GXQ C;  1S32 D;  5B31 C;  3AYW B;  1F66 B;  2NQB D;  5GT0 C;  5AVB C;  1HQ3 A;  5B1M D;  4EO5 C;  4KGC C;  3MGR A;  3AFA C;  4Z66 A;  3X1V A;  4QLC C;  5DNN B;  3X1S B;  3REJ C;  3WAA C;  3AZM B;  1ID3 B;  3F6T A;  3X1T B;  3AN2 C;  3AV1 A;  1P3K B;  3MGQ A;  4JJN A;  2ZY5 A;  3REI B;  4J8U B;  2PYO B;  5AV9 C;  5AV5 C;  3V9R A;  4H9Q B;  1P3G B;  2F8N D;  5GSU B;  5E5A A;  3REL C;  5B0Y A;  5BNV B;  5BO0 B;  4Z5T B;  3UT9 C;  5DNM D;  4WU9 A;  4X23 C;  1ULY A;  1S32 C;  1EQZ D;  5B1M C;  3WA9 C;  5B2I C;  3AZN B;  4KHA B;  5AV8 B;  1ZLA D;  3AZF B;  1M19 A;  2NZD B;  3MNN C;  3AZH C;  4E45 A;  2LY8 A;  3B0C T;  4Z66 D;  5AVC A;  3X1V D;  3LJA A;  1KX3 B;  4J8W A;  2HIO A;  3TU4 A;  4R8P A;  2YFW B;  4ZBJ C;  3AV1 D;  5CPJ C;  3MGQ D;  3AZK B;  4JJN D;  1TZY C;  3AZG A;  1KX5 C;  3UTB A;  3B6F B;  5BS7 C;  3KXB B;  4YM6 A;  2Y2N A;  3UTA A;  3IP4 C;  2JE5 A;  4UUZ B;  3B6G D;  5B2J B;  1P3P B;  1P3O B;  4WU9 D;  3R45 B;  4XUJ B;  3A6N A;  2XD1 A;  3AZE A;  5CPK A;  5GT3 B;  4XZQ B;  1P3A A;  1ZLA C;  5FUG A;  1P3B B;  3W97 B;  1BH9 A;  4Z66 C;  3X1V C;  2FJ7 A;  1M19 D;  3VH5 W;  5B40 A;  4WV4 B;  3LJA D;  4G91 B;  4WJ3 C;  3WKJ B;  4DRA A;  5F99 A;  5BT1 C;  1W2E A;  2HIO D;  3AZL A;  3VH6 W;  4LD9 D;  4WU8 B;  3REH C;  4YS3 B;  3B0B A;  2YFV A;  5GXQ A;  3AZG D;  5B31 A;  3W99 B;  5AVB A;  5B31 G;  1M18 C;  1T3U A;  5B32 C;  4KGC A;  4NFT A;  4YM6 D;  3AFA A;  3C1B C;  3UTA D;  3B6G C;  1P3I B;  3REJ A;  3WAA A;  3LZ1 C;  2JCH A;  3WTP B;  2DQN C;  3MGS C;  3A6N D;  3AN2 A;  3AZE D;  5CPK D;  1P3A D;  3AZI C;  2Y2G A;  1N1J A;  2BYK A;  5B40 D;  4Z2M H;  1P34 B;  5AV9 A;  5AV5 A;  5F99 D;  5CHL B;  5AY8 D;  3UT9 A;  3AZL D;  4LD9 C;  3O62 B;  1S32 A;  1P3M B;  3WA9 A;  5B1M A;  1KX4 B;  5GXQ D;  2ARO B;  5B2I A;  2BG1 A;  2CV5 C;  5AVB D;  4J8V D;  4KGC D;  3UTA C;  3KFU G;  3MNN A;  3AZH A;  3AV2 C;  5CP6 B;  2JSS A;  3EPL A;  3REJ D;  3REK B;  1AOI B;  2F8N K;  3WAA D;  1M1A B;  5G49 A;  5CPK C;  1P3A C;  5B24 B;  3AN2 D;  5C3I C;  2RIQ A;  5JRG C;  1U35 B;  5CPJ A;  1TZY A;  5B1L C;  1KX5 A;  4G92 B;  3X1U B;  1P3L B;  1F1E A;  2IO5 C;  4CAY B;  5BS7 A;  4WNN A;  5AY8 C;  3A1K A;  3KWQ D;  3MVD C;  5GT0 B;  5B0Z B;  3NQU A;  4J8X B;  3B0D C;  3W96 B;  4J8V C;  1JFI A;  5BNX B;  3WA9 D;  1ZLA A;  5B2I D;  4NE6 A;  5KDM B;  3KSY A;  3MNN D;  4AWL C;  3AZH D;  3LEL B;  3AZM D;  1BFM A;  1BH8 A;  3AZJ C;  4H9N A;  1H3O A;  3C1C B;  4H9O A;  5CPI B;  3REI D;  3LZ0 C;  3REH A;  5CPJ D;  4H9P A;  1TZY D;  4DQY B;  3REL B;  1KX5 D;  2HUE C;  4J8U D;  2PYO D;  1M18 A;  2BYM B;  1P3F B;  5B32 A;  2Y2M A;  1P3G D;  5B32 G;  3C1B A;  2NQB B;  3KWQ C;  3B6G A;  4Z5T D;  4HGA B;  3AYW C;  1F66 C;  3LZ1 A;  3MGS A;  1P3B A;  5AV8 D;  2NZD D;  5DNN C;  3X1S C;  3AZI A;  3AZM C;  1ID3 C;  1TAF A;  3X1T C;  4NE3 A;  5BT1 D;  3EPK A;  4LD9 A;  1B6W A;  3REI C;  3AZK D;  1PZR A;  2F8N B;  3B6F D;  3REH D;  2RVQ D;  4J8U C;  2PYO C;  3W98 B;  5DNM B;  1P3G C;  2CV5 A;  5GSU C;  1M18 D;  5B32 D;  4Z5T C;  4WZS B;  3C1B D;  3AV2 A;  3KUY B;  1EQZ B;  1P3P D;  1HQ3 B;  3H0M C;  2Y2I A;  4XUJ D;  3MGR B;  3LZ1 D;  3X1V B;  3AZN C;  5AV8 C;  3MGS D;  3AZF C;  2NZD C;  1P3B D;  5JRG A;  1KX3 C;  5B1L A;  3AZI D;  3AV1 B;  3MGQ B;  4JJN B;  5AY8 A;  3AZK C;  2G5H C;  3MVD A;  3B6F C;  4ZUX B;  3MGP B;  4WU8 D;  2RVQ C;  3KXB C;  5E5A B;  3NQJ A;  2XD5 A;  5B0Y B;  4J8V A;  2W8S A;  4WU9 B;  5AV6 B;  2CV5 D;  4KUD B;  5B2J C;  1P3P C;  1P3O C;  5B33 B;  3AV2 D;  4CSR B;  3WTP E;  4XUJ C;  3AZJ A; 
#chains in the Genus database with same CATH homology
 5GT3 C;  1M19 B;  5AVC B;  1P3B C;  3LJA B;  3W97 C;  5JRG D;  4J8W B;  3LZ0 A;  2HIO B;  2F8N H;  4G91 C;  5B1L D;  3WKJ C;  3TU4 B;  1P34 D;  4R8P B;  4H9R A;  3AZG B;  3KWQ A;  3UTB B;  2VQR A;  4YS3 C;  4WU8 C;  3MVD D;  3O62 D;  3W99 C;  3P5J B;  4YM6 B;  3AYW A;  1P3M D;  1F66 A;  1WWI A;  2ARO D;  3EPH A;  5KDM A;  2Y2O A;  3H0L C;  3X1S A;  5DNN A;  1P3I C;  4H9S C;  3A6N B;  3AZM A;  3AZE B;  2ZY3 A;  3VH5 T;  3WTP C;  1ID3 A;  3REK D;  5FUG B;  1AOI D;  3AL0 C;  1BH9 B;  3X1T A;  3AZJ D;  2FJ7 B;  2UWX A;  1P3K A;  5B40 B;  2IO5 B;  3VH6 T;  3REI A;  2FFF B;  5F99 B;  1P34 C;  3LZ0 D;  1P3L D;  4J8U A;  2PYO A;  3AZL B;  4H9Q A;  1P3G A;  5GSU A;  5BNV A;  5BO0 A;  4Z5T A;  3FDD A;  2YFV B;  5GXQ B;  3VH5 A;  5B31 B;  5AVB B;  2Y2L A;  4EO5 B;  3O62 C;  1P3M C;  4J8X D;  4KGC B;  2DF4 C;  1KX4 C;  2ARO C;  3AFA B;  3AYW D;  1F66 D;  3W96 D;  4QLC B;  4E44 A;  4KHA A;  5AV8 A;  3VH6 A;  3AZN A;  3AZF A;  2NZD A;  4NE5 A;  3REJ B;  3WAA B;  4DRB A;  5CP6 C;  5DNN D;  3X1S D;  1KX3 A;  3LEL D;  1AOI C;  3REK C;  3AN2 B;  1M1A C;  1ID3 D;  1Q9C A;  1B67 A;  2YFW A;  5B24 C;  3X1T D;  1N1J B;  2BYK B;  1U35 C;  1P3K D;  3AZK A;  3B6F A;  4G92 C;  5AV9 B;  5AV5 B;  4UPK A;  3X1U C;  1P3L C;  3KXB A;  4Z2M G;  3A1I A;  3UT9 B;  2CWE A;  4UUZ A;  4X23 B;  1HTA A;  2J8P A;  5GSU D;  5B2J A;  3KUY A;  1S32 B;  5B0Z C;  1P3P A;  1P3O A;  3WA9 B;  5B1M B;  4J8X C;  5B2I B;  3R45 A;  4XUJ A;  3W96 C;  5GT3 A;  4XZQ A;  3MNN B;  3AZH B;  2Y2Q A;  3W97 A;  3AZN D;  3AZF D;  3LEL C;  5G49 B;  1KX3 D;  3WKJ A;  2L5A A;  4ZBJ B;  5CPJ B;  3C1C C;  1TZY B;  1WWS A;  1P3K C;  1KX5 B;  5CPI C;  4ZUX A;  3MGP A;  4WU8 A;  4YS3 A;  1A7W A;  2Y2P A;  3W99 A;  1P3F C;  4WNN B;  3KXB D;  3W98 D;  5AV6 A;  4KUD A;  2NQB C;  5JA4 B;  3NQU B;  2F2A C;  5B33 A;  3KUY D;  1P3I A;  4CSR A;  5B2J D;  4HGA C;  1HQ3 D;  4H9S A;  1P3O D;  1JFI B;  1ZLA B;  3MGR D;  3WTP A;  4Z66 B;  1Z2C B;  5GT3 D;  4XZQ D;  3W97 D;  1BH8 B;  2Y2J A;  1P34 A;  4H9N B;  3H0R C;  1H3O B;  3EPJ A;  3WKJ D;  4H9O B;  2Y2K A;  3REH B;  4H9P B;  4ZUX D;  3O62 A;  3MGP D;  1P3M A;  1M18 B;  5B32 B;  4YS3 D;  3V9R B;  1KX4 A;  3W99 D;  2ARO A;  5E5A D;  5DNM C;  3C1B B;  3B6G B;  5B0Y D;  3W98 C;  5AV6 D;  1EQZ C;  4KUD D;  3KUY C;  3LZ1 B;  5B33 D;  1HQ3 C;  5CP6 A;  1P3I D;  3MGS B;  3MGR C;  1AOI A;  3REK A;  1M1A A;  3WTP D;  4XZQ C;  3AZI B;  5AVC D;  5B24 A;  2G5I C;  1U35 A;  4J8W D;  1TAF B;  3X1U A;  1P3L A;  3TU4 D;  4CAY A;  4R8P D;  3AV1 C;  3MGQ C;  4JJN C;  4LD9 B;  2Y2H A;  3UTB D;  1R4V A;  5B0Z A;  5GT0 A;  4ZUX C;  3MGP C;  4J8X A;  2CV5 B;  5E5A C;  3W96 A;  4QLC A;  5B0Y C;  3UTA B;  5BNX A;  1KX4 D;  3AV2 B;  4WU9 C;  5AV6 C;  4KUD C;  3EG5 B;  5B33 C;  3LEL A;  5CP6 D;  5CPK B;  1P3A B;  1M19 C;  5C3I B;  5JRG B;  2FJ7 D;  5AVC C;  1M1A D;  3LJA C;  3C1C A;  5B1L B;  5B24 D;  4J8W C;  5CPI A;  2HIO C;  1U35 D;  3TU4 C;  3REL A;  4R8P C;  3X1U D;  2BYM A;  1P3F A;  5AY8 B;  4X23 A;  3MVD B;  2ZM5 A;  3AZG C;  2NQB A;  3UTB C;  5B31 D;  3B0D B;  3NQJ B;  5B0Z D;  4YM6 C;  5GT0 D;  4J8V B;  3AFA D;  2ZY2 A;  4QLC D;  4AWL B;  4M6B A;  3A6N C;  3AZJ B;  3AZE C;  2FJ7 C;  3B0C W;  2ZY4 A;  5B40 C;  3LZ0 B;  1KU5 A;  3C1C D;  5F99 C;  2HUE B;  4H9R B;  5CPI D;  2F8N A;  5AV9 D;  5AV5 D;  2F8N G;  3AZL C;  3REL D;  3W98 A;  5DNM A;  3KWQ B;  5JA4 A;  3UT9 D;  1P3F D;  4X23 D;  1EQZ A;  5GXQ C;  1S32 D;  5B31 C;  3AYW B;  1F66 B;  2NQB D;  5GT0 C;  5AVB C;  1HQ3 A;  5B1M D;  4EO5 C;  4KGC C;  3MGR A;  3AFA C;  4Z66 A;  3X1V A;  4QLC C;  5DNN B;  3X1S B;  3REJ C;  3WAA C;  3AZM B;  1ID3 B;  3F6T A;  3X1T B;  3AN2 C;  3AV1 A;  1P3K B;  3MGQ A;  4JJN A;  2ZY5 A;  3REI B;  4J8U B;  2PYO B;  5AV9 C;  5AV5 C;  3V9R A;  4H9Q B;  1P3G B;  2F8N D;  5GSU B;  5E5A A;  3REL C;  5B0Y A;  5BNV B;  5BO0 B;  4Z5T B;  3UT9 C;  5DNM D;  4WU9 A;  4X23 C;  1ULY A;  1S32 C;  1EQZ D;  5B1M C;  3WA9 C;  5B2I C;  3AZN B;  4KHA B;  5AV8 B;  1ZLA D;  3AZF B;  1M19 A;  2NZD B;  3MNN C;  3AZH C;  4E45 A;  2LY8 A;  3B0C T;  4Z66 D;  5AVC A;  3X1V D;  3LJA A;  1KX3 B;  4J8W A;  2HIO A;  3TU4 A;  4R8P A;  2YFW B;  4ZBJ C;  3AV1 D;  5CPJ C;  3MGQ D;  3AZK B;  4JJN D;  1TZY C;  3AZG A;  1KX5 C;  3UTB A;  3B6F B;  5BS7 C;  3KXB B;  4YM6 A;  2Y2N A;  3UTA A;  3IP4 C;  2JE5 A;  4UUZ B;  3B6G D;  5B2J B;  1P3P B;  1P3O B;  4WU9 D;  3R45 B;  4XUJ B;  3A6N A;  2XD1 A;  3AZE A;  5CPK A;  5GT3 B;  4XZQ B;  1P3A A;  1ZLA C;  5FUG A;  1P3B B;  3W97 B;  1BH9 A;  4Z66 C;  3X1V C;  2FJ7 A;  1M19 D;  3VH5 W;  5B40 A;  4WV4 B;  3LJA D;  4G91 B;  4WJ3 C;  3WKJ B;  4DRA A;  5F99 A;  5BT1 C;  1W2E A;  2HIO D;  3AZL A;  3VH6 W;  4LD9 D;  4WU8 B;  3REH C;  4YS3 B;  3B0B A;  2YFV A;  5GXQ A;  3AZG D;  5B31 A;  3W99 B;  5AVB A;  5B31 G;  1M18 C;  1T3U A;  5B32 C;  4KGC A;  4NFT A;  4YM6 D;  3AFA A;  3C1B C;  3UTA D;  3B6G C;  1P3I B;  3REJ A;  3WAA A;  3LZ1 C;  2JCH A;  3WTP B;  2DQN C;  3MGS C;  3A6N D;  3AN2 A;  3AZE D;  5CPK D;  1P3A D;  3AZI C;  2Y2G A;  1N1J A;  2BYK A;  5B40 D;  4Z2M H;  1P34 B;  5AV9 A;  5AV5 A;  5F99 D;  5CHL B;  5AY8 D;  3UT9 A;  3AZL D;  4LD9 C;  3O62 B;  1S32 A;  1P3M B;  3WA9 A;  5B1M A;  1KX4 B;  5GXQ D;  2ARO B;  5B2I A;  2BG1 A;  2CV5 C;  5AVB D;  4J8V D;  4KGC D;  3UTA C;  3KFU G;  3MNN A;  3AZH A;  3AV2 C;  5CP6 B;  2JSS A;  3EPL A;  3REJ D;  3REK B;  1AOI B;  2F8N K;  3WAA D;  1M1A B;  5G49 A;  5CPK C;  1P3A C;  5B24 B;  3AN2 D;  5C3I C;  2RIQ A;  5JRG C;  1U35 B;  5CPJ A;  1TZY A;  5B1L C;  1KX5 A;  4G92 B;  3X1U B;  1P3L B;  1F1E A;  2IO5 C;  4CAY B;  5BS7 A;  4WNN A;  5AY8 C;  3A1K A;  3KWQ D;  3MVD C;  5GT0 B;  5B0Z B;  3NQU A;  4J8X B;  3B0D C;  3W96 B;  4J8V C;  1JFI A;  5BNX B;  3WA9 D;  1ZLA A;  5B2I D;  4NE6 A;  5KDM B;  3KSY A;  3MNN D;  4AWL C;  3AZH D;  3LEL B;  3AZM D;  1BFM A;  1BH8 A;  3AZJ C;  4H9N A;  1H3O A;  3C1C B;  4H9O A;  5CPI B;  3REI D;  3LZ0 C;  3REH A;  5CPJ D;  4H9P A;  1TZY D;  4DQY B;  3REL B;  1KX5 D;  2HUE C;  4J8U D;  2PYO D;  1M18 A;  2BYM B;  1P3F B;  5B32 A;  2Y2M A;  1P3G D;  5B32 G;  3C1B A;  2NQB B;  3KWQ C;  3B6G A;  4Z5T D;  4HGA B;  3AYW C;  1F66 C;  3LZ1 A;  3MGS A;  1P3B A;  5AV8 D;  2NZD D;  5DNN C;  3X1S C;  3AZI A;  3AZM C;  1ID3 C;  1TAF A;  3X1T C;  4NE3 A;  5BT1 D;  3EPK A;  4LD9 A;  1B6W A;  3REI C;  3AZK D;  1PZR A;  2F8N B;  3B6F D;  3REH D;  2RVQ D;  4J8U C;  2PYO C;  3W98 B;  5DNM B;  1P3G C;  2CV5 A;  5GSU C;  1M18 D;  5B32 D;  4Z5T C;  4WZS B;  3C1B D;  3AV2 A;  3KUY B;  1EQZ B;  1P3P D;  1HQ3 B;  3H0M C;  2Y2I A;  4XUJ D;  3MGR B;  3LZ1 D;  3X1V B;  3AZN C;  5AV8 C;  3MGS D;  3AZF C;  2NZD C;  1P3B D;  5JRG A;  1KX3 C;  5B1L A;  3AZI D;  3AV1 B;  3MGQ B;  4JJN B;  5AY8 A;  3AZK C;  2G5H C;  3MVD A;  3B6F C;  4ZUX B;  3MGP B;  4WU8 D;  2RVQ C;  3KXB C;  5E5A B;  3NQJ A;  2XD5 A;  5B0Y B;  4J8V A;  2W8S A;  4WU9 B;  5AV6 B;  2CV5 D;  4KUD B;  5B2J C;  1P3P C;  1P3O C;  5B33 B;  3AV2 D;  4CSR B;  3WTP E;  4XUJ C;  3AZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...