3X1SD

Crystal structure of the nucleosome core particle
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1sD00
3NQJB 1M18C 5FUGB 4WU8A 1ULYA 5GSUD 3WKJA 3WAAB 2NZDC 5B24C 4Z2MG 1P3PC 5C3IC 5B0ZB 4H9NB 4ZUXD 1P3FD 3O62D 4HGAC 4J8UA 4ZBJC 5AV8C 3AZEB 3MGRB 3B6FA 2PYOD 3C1BB 3W97D 1ID3B 5B0YD 5AVCB 5CPIC 4H9SA 5DNND 1P3OC 1JFIA 3X1UD 5CPJD 2BYKA 4X23C 4G92B 3UT9B 5AY8D 5CPKA 4UUZA 3REKD 3AZGB 4JJNB 4Z5TB 3KXBB 4J8WD 3AZNA 5B2IB 5B32G 5AVBA 3C1CA 3REHD 4NE6A 5GXQD 5E5AC 1P34C 1B67A 1HTAA 1P3KA 4J8XA 2AROB 2RVQC 1P3IB 1P3GD 3AZIC 3AZLB 1S32D 3LZ0C 1BH9A 5F99A 3MGPC 3X1TA 5B33A 3AZKB 3TU4B 3LELD 5B32C 5JRGB 5AV9D 3AN2C 4R8PC 5B31B 1A7WA 1P3BC 3MGQA 5KDMA 1F66C 3AZHA 5AV5C 1TZYC 1WWSA 4YM6C 3X1VD 1P3KD 3REJA 1AOIA 4WU8D 3LJAB 1P3MA 4LD9A 3REIA 3WKJD 3WAAC 1P3FB 1P3LA 5BT1D 4KGCA 4NFTA 5B0ZC 5B1LB 4H9RA 3MGSA 3UTAA 2YFWA 3UTBA 4J8UD 2HIOA 2PYOB 1N1JA 4H9QA 3AZEC 4WU9B 3MGRC 3B6FD 3C1BC 4CSRA 5B0YB 3AYWB 5DNNB 3W97A 4QLCA 3AV1B 1ID3C 5BS7C 1M18A 3B0CW 5AVCC 3X1UB 5CPJB 2FJ7B 3REKB 4G92C 3UT9C 4YS3A 2NZDA 5CPKD 3AZGC 4JJNC 4Z5TC 3WA9A 3REHB 3KXBC 3R45A 3WTPA 5GXQB 3AZND 5B2IC 1Q9CA 5AVBD 3C1CD 1U35A 3KUYA 3MVDA 5B31G 2BYMB 1P3GB 4H9OB 1S32B 5B40A 4J8XD 2AROC 1P3IC 5BO0B 3AZLC 5F99D 3X1TD 3LELB 5B33D 3AFAA 5CPIA 3AZFA 4XUJA 3TU4C 3AZKC 1P3OA 3KWQA 5JRGC 3A6NB 5DNMA 5B31C 2L5AA 4H9PB 3MGQD 3X1VB 1P3KB 3AZHD 1ZLAA 4WU8B 5B1MA 3REJD 1AOID 4KUDA 3LJAC 2NQBA 1P3MD 4LD9D 3REID 1P3FC 1P3LD 5BNVA 4KGCD 4WNNB 3LZ0A 4KHAA 5B1LC 4J8UB 3MGPA 1F1EA 1KX3B 2LY8A 3MGSD 3W96B 5CP6B 3UTAD 3UTBD 3B6FB 2HIOD 2PYOC 2F8NH 4R8PA 4WU9C 5GT3C 5B0YC 3AYWC 5DNNC 4QLCD 3AV1C 1M19A 1M1AA 2F8NA 3AZJA 3NQJA 1M18D 1JFIB 5FUGA 3X1UC 5CPJC 2FJ7C 3W99B 3VH5T 4J8VA 5CPKB 4YS3D 2NZDD 3AZNB 5AVBB 3WA9D 3REHC 1KX4A 3WTPD 3V9RA 5GXQC 1U35D 4J8XB 3RELA 3KUYD 3MVDD 3MNNA 3X1SB 4CAYB 1P3GC 1S32C 5B40D 3MGRA 3B6GA 5B33B 5GT0B 4XZQB 3AV2B 3LELC 1ID3A 3AFAD 5CPID 5AVCA 3AZFD 4XUJD 1P3OD 3B0DB 3KWQD 5KDMB 1TAFA 5DNMD 3A6NC 1HQ3A 1KX5A 4DRBA 3X1VC 1P3KC 3AZGA 5B2JA 1AOIB 4E45A 4JJNA 1ZLAD 3VH6T 4WU8C 5B1MD 3LZ1A 5B2IA 1P3MB 3W98A 1EQZA 3REIB 4KUDD 5GSUB 2NQBD 2YFVB 5E5AD 4ZUXB 3AZMA 4H9RB 5AV6A 3O62B 3MGSB 3B0BA 3LZ0D 3UTAB 3UTBB 4J8UC 3MGPD 2CV5A 1KX3C 2HIOB 1N1JB 4H9QB 3W96C 5CP6C 3AZKA 1B6WA 4E44A 4Z66A 3B6FC 4R8PD 3W97B 4QLCB 1P3AA 4H9SC 1M19D 1M1AD 2F8ND 3AZJD 4YS3B 3LJAA 3W99C 4J8VD 5AY8B 5CPKC 3WA9B 5B24A 1P3PA 3R45B 3WTPB 4J8WB 3AZNC 5AVBC 5B1LA 1U35B 1KU5A 1KX4D 3KUYB 3MVDB 1H3OB 4AWLB 5B40B 4J8XC 3RELD 4Z2MH 3MNND 3X1SC 5AV8A 5JA4A 3MGRD 4WU9A 3B6GD 5GT3A 2CWEA 3AFAB 5B33C 5GT0C 4XZQC 3AYWA 3AV2C 3AZFB 4XUJB 3AV1A 3KWQB 1ID3D 5AV9B 5AVCD 5DNMB 2FJ7A 3B0DC 4EO5B 3VH5A 1HQ3D 4WV4B 4X23A 1KX5D 1ZLAB 5B1MB 3AZGD 5B2JD 1AOIC 4JJND 4KUDB 2NQBB 3LZ1D 5B2ID 1P3MC 3W98D 1EQZD 5G49A 3REIC 5GSUC 3WKJB 5E5AA 3KSYA 1P34A 4KHAB 3AZMD 4ZUXC 4G91B 5AV6D 3O62C 3MGSC 3AZIA 3AZLD 3UTAC 1BH8A 3UTBC 2CV5D 3VH5W 2HIOC 3AZKD 4Z66D 5B32A 3AN2A 3A6NA 1P3BA 1M1AB 1M19B 4QLCC 4H9PA 1P3AD 2F8NB 3W97C 1F66A 3AZJB 5AV5A 1TZYA 5BNXA 4YM6A 3NQUA 4J8VB 3VH6A 2BYKB 4YS3C 3LJAD 5AY8C 2IO5B 4UUZB 3REKC 3WA9C 3WAAA 5B24D 1P3PD 1KX4B 3WTPC 3V9RB 4J8WC 4WNNA 5B0ZA 4H9NA 5B1LD 3C1CB 1U35C 3RELB 3KUYC 3MVDC 1KX3A 3MNNB 3W96A 5CP6A 4AWLC 5B40C 3B6GB 5AV8D 3AZEA 1BH9B 4WU9D 5F99B 3X1TB 5GT3D 3VH6W 3AFAC 3C1BA 3AYWD 3AZFC 3AV1D 4XUJC 1BFMA 3KWQC 5BS7A 5AV9C 4NE3A 1TAFB 5DNMC 1HQ3B 1KX5B 2FJ7D 3W99A 4DRAA 4EO5C 3MGQB 3AZHB 5B2JB 4X23D 3UT9A 1ZLAC 5B1MC 3LZ1B 3W98B 3REJB 1EQZB 4Z5TA 4KUDC 3KXBA 2NQBC 1WWIA 4LD9B 3AZMB 3WKJC 3X1SA 5AV6B 5BT1C 4CAYA 4M6BA 1P34D 1P3LB 2F8NG 4KGCB 4WZSB 2AROA 2RVQD 2CV5B 1P3IA 4G91C 4XZQA 5GT0A 3AZID 3AZLA 3AV2A 2YFWB 4Z66B 2HUEB 3TU4A 5B32D 3AN2D 5JRGA 1P3AB 3A6ND 4CSRB 4NE5A 5B31A 1P3BD 1M19C 1M1AC 1F66D 5AV5D 3AZJC 1TZYD 1M18B 4YM6D 2JSSA 4J8VC 5GSUA 2NZDB 2YFVA 5B24B 1P3PB 5C3IB 2IO5C 4ZUXA 3WAAD 1P3FA 1KX4C 3O62A 4HGAB 5B0ZD 3C1CC 4ZBJB 3RELC 1KX3D 3MNNC 3W96D 5CP6D 5AV8B 5JA4B 3B6GC 5GT3B 2PYOA 3AZED 5F99C 3X1TC 3C1BD 5B0YA 5CPIB 5DNNA 1P3OB 1HQ3C 3X1UA 4X23B 5CPJA 1KX5C 3W99D 5AY8A 3MGQC 3AZHC 3REKA 5B2JC 3UT9D 4J8WA 3LZ1C 3W98C 3REJC 5G49B 1EQZC 4Z5TD 3REHA 3KXBD 5E5AB 1H3OA 3B0CT 5GXQA 4LD9C 1P34B 5CHLB 3AZMC 1R4VA 3X1SD 5AV6C 2BYMA 5BNVB 3AZIB 1P3LC 4H9OA 1P3GA 3LZ0B 1S32A 3WTPE 1BH8B 4KGCC 2AROD 3MGPB 2CV5C 1P3ID 5GT0D 4XZQD 5BO0A 3AV2D 2F8NK 4Z66C 3LELA 5B32B 5AV9A 2HUEC 3AN2B 4R8PB 3TU4D 1P3BB 5JRGD 1P3AC 1F66B 5AV5B 1TZYB 5BNXB 4YM6B 3NQUB 5B31D 3X1VA
chains in the Genus database with same CATH superfamily
3NQJB 1M18C 5FUGB 4WU8A 1ULYA 5GSUD 3WKJA 3WAAB 2NZDC 5B24C 4Z2MG 1P3PC 5C3IC 2XD1A 5B0ZB 4H9NB 4ZUXD 1P3FD 3O62D 4HGAC 4J8UA 4ZBJC 5AV8C 3AZEB 3MGRB 3B6FA 3P5JB 2PYOD 3C1BB 3W97D 2ZM5A 1ID3B 5B0YD 5AVCB 5CPIC 2BG1A 4H9SA 2JCHA 5DNND 1P3OC 1JFIA 3X1UD 5CPJD 2BYKA 4X23C 4G92B 3UT9B 5AY8D 5CPKA 4UUZA 3REKD 3AZGB 4JJNB 4Z5TB 3KXBB 4J8WD 3AZNA 5B2IB 5B32G 5AVBA 3C1CA 1W2EA 3REHD 4NE6A 5GXQD 5E5AC 1P34C 1B67A 1HTAA 1P3KA 4J8XA 2AROB 2RVQC 1P3IB 1P3GD 3AZIC 2ZY5A 3AZLB 1S32D 3LZ0C 1BH9A 2Y2GA 5F99A 3MGPC 3X1TA 5B33A 3AZKB 3TU4B 3LELD 5B32C 5JRGB 5AV9D 3AN2C 2Y2LA 4R8PC 5B31B 1A7WA 1P3BC 3MGQA 5KDMA 1F66C 3AZHA 5AV5C 1TZYC 1WWSA 4YM6C 3X1VD 1P3KD 3REJA 1AOIA 4WU8D 3LJAB 1P3MA 4LD9A 3REIA 3WKJD 3WAAC 1P3FB 1P3LA 5BT1D 2ZY3A 3H0RC 4NFTA 4KGCA 5B0ZC 5B1LB 4H9RA 3MGSA 3UTAA 2YFWA 3UTBA 4J8UD 2HIOA 2PYOB 1N1JA 4H9QA 3AZEC 4WU9B 3MGRC 3B6FD 3C1BC 4CSRA 5B0YB 3AYWB 5DNNB 3W97A 4QLCA 3AV1B 1ID3C 5BS7C 1M18A 3B0CW 5AVCC 3X1UB 5CPJB 2FJ7B 3REKB 4G92C 2F2AC 3UT9C 4YS3A 2NZDA 5CPKD 1T3UA 3AZGC 1PZRA 4JJNC 4Z5TC 2G5IC 3REHB 3WA9A 3KXBC 3R45A 3WTPA 5GXQB 3AZND 5B2IC 1Q9CA 5AVBD 3C1CD 3FDDA 1U35A 3KUYA 3MVDA 5B31G 2BYMB 1P3GB 4H9OB 1S32B 5B40A 4J8XD 2AROC 1P3IC 5BO0B 3AZLC 5F99D 3X1TD 3LELB 5B33D 3AFAA 5CPIA 3AZFA 4XUJA 3TU4C 3AZKC 1P3OA 3KWQA 5JRGC 3A6NB 5DNMA 5B31C 2L5AA 4H9PB 3MGQD 3X1VB 1P3KB 2Y2IA 3AZHD 1ZLAA 4WU8B 5B1MA 3REJD 4UPKA 1AOID 4KUDA 3LJAC 2NQBA 1P3MD 4LD9D 3REID 1P3FC 1P3LD 5BNVA 4KGCD 4WNNB 4DQYB 3LZ0A 4KHAA 5B1LC 4J8UB 3MGPA 1F1EA 1KX3B 3IP4C 2LY8A 3MGSD 3W96B 5CP6B 3UTAD 3UTBD 3B6FB 2HIOD 2PYOC 2F8NH 4R8PA 4WU9C 5GT3C 5B0YC 3EPJA 3AYWC 1Z2CB 5DNNC 4QLCD 3AV1C 1M19A 1M1AA 2F8NA 3AZJA 3NQJA 1M18D 2J8PA 1JFIB 5FUGA 2Y2HA 3X1UC 5CPJC 2FJ7C 3W99B 3VH5T 4J8VA 2VQRA 5CPKB 4YS3D 2NZDD 3AZNB 5AVBB 3WA9D 3REHC 1KX4A 3WTPD 3V9RA 5GXQC 2Y2MA 1U35D 4J8XB 3RELA 3KUYD 3MVDD 3MNNA 3X1SB 4CAYB 1P3GC 1S32C 5B40D 3MGRA 4WJ3C 3B6GA 2ZY2A 5B33B 5GT0B 4XZQB 3AV2B 3LELC 1ID3A 3AFAD 5CPID 5AVCA 3AZFD 4XUJD 2Y2QA 3B0DB 3KWQD 1P3OD 5KDMB 1TAFA 5DNMD 3A6NC 1HQ3A 1KX5A 4DRBA 3X1VC 1P3KC 3AZGA 5B2JA 1AOIB 4E45A 4JJNA 1ZLAD 3VH6T 4WU8C 5B1MD 3LZ1A 5B2IA 1P3MB 3W98A 1EQZA 3REIB 4KUDD 2G5HC 3EPKA 5GSUB 2NQBD 2YFVB 2Y2NA 5E5AD 4ZUXB 3AZMA 4H9RB 5AV6A 3O62B 3MGSB 3B0BA 3LZ0D 3UTAB 3UTBB 4J8UC 3MGPD 2Y2OA 2CV5A 1KX3C 2HIOB 1N1JB 4H9QB 3W96C 5CP6C 3AZKA 1B6WA 4E44A 4Z66A 3B6FC 4R8PD 3H0MC 3W97B 4QLCB 1P3AA 4H9SC 1M19D 1M1AD 2F8ND 3AZJD 4YS3B 3LJAA 3W99C 4J8VD 5AY8B 5CPKC 3WA9B 5B24A 1P3PA 3R45B 3WTPB 4J8WB 3AZNC 5AVBC 5B1LA 1U35B 1KU5A 1KX4D 3KUYB 3MVDB 1H3OB 2DF4C 4AWLB 5B40B 4J8XC 3RELD 4Z2MH 3MNND 3X1SC 5AV8A 5JA4A 3EPLA 3MGRD 4WU9A 3B6GD 5GT3A 2CWEA 3AFAB 5B33C 5GT0C 4XZQC 3AYWA 3AV2C 3AZFB 4XUJB 3AV1A 3KWQB 1ID3D 5AV9B 5AVCD 5DNMB 2FJ7A 3B0DC 4EO5B 3VH5A 1HQ3D 4WV4B 4X23A 1KX5D 1ZLAB 5B1MB 3AZGD 5B2JD 1AOIC 4JJND 4KUDB 2NQBB 3LZ1D 5B2ID 1P3MC 3W98D 1EQZD 5G49A 3REIC 5GSUC 3WKJB 2Y2JA 5E5AA 3KSYA 1P34A 4KHAB 2DQNC 3AZMD 4ZUXC 4G91B 5AV6D 3O62C 3MGSC 3AZIA 3AZLD 3UTAC 1BH8A 3UTBC 3AL0C 2CV5D 3VH5W 3KFUG 2HIOC 3AZKD 4Z66D 5B32A 3AN2A 3A6NA 1P3BA 1M1AB 1M19B 4QLCC 4H9PA 1P3AD 2F8NB 3W97C 1F66A 3AZJB 5AV5A 1TZYA 5BNXA 4YM6A 3NQUA 4J8VB 3VH6A 2BYKB 4YS3C 3LJAD 5AY8C 2IO5B 4UUZB 3REKC 3WA9C 3WAAA 5B24D 2Y2KA 1P3PD 1KX4B 3WTPC 3V9RB 4J8WC 4WNNA 5B0ZA 4H9NA 5B1LD 3C1CB 1U35C 3RELB 3KUYC 3MVDC 1KX3A 3MNNB 3W96A 5CP6A 4AWLC 5B40C 3B6GB 5AV8D 3AZEA 1BH9B 4WU9D 5F99B 3X1TB 5GT3D 3VH6W 3AFAC 3C1BA 3AYWD 3AZFC 3AV1D 4XUJC 1BFMA 3KWQC 5BS7A 5AV9C 4NE3A 1TAFB 5DNMC 1HQ3B 1KX5B 2FJ7D 3W99A 4DRAA 4EO5C 3MGQB 3AZHB 5B2JB 4X23D 3UT9A 1ZLAC 5B1MC 3LZ1B 3W98B 3REJB 1EQZB 2JE5A 4Z5TA 4KUDC 3KXBA 2NQBC 3F6TA 1WWIA 4LD9B 2ZY4A 3AZMB 3WKJC 3X1SA 5AV6B 5BT1C 4CAYA 4M6BA 1P34D 1P3LB 2F8NG 4KGCB 4WZSB 2AROA 2RVQD 2CV5B 1P3IA 4G91C 4XZQA 5GT0A 3AZID 3AZLA 3AV2A 2W8SA 2YFWB 2XD5A 4Z66B 2HUEB 3TU4A 5B32D 3AN2D 5JRGA 1P3AB 3A6ND 4CSRB 4NE5A 5B31A 1P3BD 3A1KA 1M19C 1M1AC 1F66D 5AV5D 3AZJC 1TZYD 1M18B 4YM6D 2JSSA 4J8VC 5GSUA 2NZDB 2YFVA 5B24B 1P3PB 5C3IB 2IO5C 4ZUXA 3WAAD 1P3FA 1KX4C 3O62A 4HGAB 5B0ZD 3C1CC 4ZBJB 3RELC 1KX3D 3MNNC 3W96D 5CP6D 5AV8B 5JA4B 3EPHA 3B6GC 5GT3B 3A1IA 2PYOA 3AZED 5F99C 3X1TC 3C1BD 5B0YA 5CPIB 5DNNA 1P3OB 3H0LC 1HQ3C 3X1UA 4X23B 5CPJA 1KX5C 3W99D 5AY8A 3MGQC 3AZHC 3REKA 5B2JC 3UT9D 4J8WA 3LZ1C 3W98C 3REJC 5G49B 1EQZC 3EG5B 4Z5TD 3REHA 3KXBD 5E5AB 1H3OA 3B0CT 5GXQA 4LD9C 1P34B 5CHLB 3AZMC 1R4VA 3X1SD 5AV6C 2BYMA 5BNVB 3AZIB 1P3LC 4H9OA 1P3GA 3LZ0B 1S32A 3WTPE 1BH8B 4KGCC 2AROD 3MGPB 2FFFB 2Y2PA 2CV5C 1P3ID 5GT0D 2RIQA 5BO0A 4XZQD 3AV2D 2F8NK 4Z66C 3LELA 5B32B 5AV9A 2HUEC 3AN2B 4R8PB 3TU4D 2UWXA 1P3BB 5JRGD 1P3AC 1F66B 5AV5B 1TZYB 5BNXB 4YM6B 3NQUB 5B31D 3X1VA
chains in the Genus database with same CATH topology
3NQJB 1M18C 5FUGB 4WU8A 1ULYA 5GSUD 3WKJA 3WAAB 2NZDC 5B24C 4Z2MG 1P3PC 5C3IC 2XD1A 5B0ZB 4H9NB 4ZUXD 1P3FD 3O62D 4HGAC 4J8UA 4ZBJC 5AV8C 3AZEB 3MGRB 3B6FA 3P5JB 2PYOD 3C1BB 3W97D 2ZM5A 1ID3B 5B0YD 5AVCB 5CPIC 2BG1A 4H9SA 2JCHA 5DNND 1P3OC 1JFIA 3X1UD 5CPJD 2BYKA 4X23C 4G92B 3UT9B 5AY8D 5CPKA 4UUZA 3REKD 3AZGB 4JJNB 4Z5TB 3KXBB 4J8WD 3AZNA 5B2IB 5B32G 5AVBA 3C1CA 1W2EA 3REHD 4NE6A 5GXQD 5E5AC 1P34C 1B67A 1HTAA 1P3KA 4J8XA 2AROB 2RVQC 1P3IB 1P3GD 3AZIC 2ZY5A 3AZLB 1S32D 3LZ0C 1BH9A 2Y2GA 5F99A 3MGPC 3X1TA 5B33A 3AZKB 3TU4B 3LELD 5B32C 5JRGB 5AV9D 3AN2C 2Y2LA 4R8PC 5B31B 1A7WA 1P3BC 3MGQA 5KDMA 1F66C 3AZHA 5AV5C 1TZYC 1WWSA 4YM6C 3X1VD 1P3KD 3REJA 1AOIA 4WU8D 3LJAB 1P3MA 4LD9A 3REIA 3WKJD 3WAAC 1P3FB 1P3LA 5BT1D 2ZY3A 3H0RC 4NFTA 4KGCA 5B0ZC 5B1LB 4H9RA 3MGSA 3UTAA 2YFWA 3UTBA 4J8UD 2HIOA 2PYOB 1N1JA 4H9QA 3AZEC 4WU9B 3MGRC 3B6FD 3C1BC 4CSRA 5B0YB 3AYWB 5DNNB 3W97A 4QLCA 3AV1B 1ID3C 5BS7C 1M18A 3B0CW 5AVCC 3X1UB 5CPJB 2FJ7B 3REKB 4G92C 2F2AC 3UT9C 4YS3A 2NZDA 5CPKD 1T3UA 3AZGC 1PZRA 4JJNC 4Z5TC 2G5IC 3REHB 3WA9A 3KXBC 3R45A 3WTPA 5GXQB 3AZND 5B2IC 1Q9CA 5AVBD 3C1CD 3FDDA 1U35A 3KUYA 3MVDA 5B31G 2BYMB 1P3GB 4H9OB 1S32B 5B40A 4J8XD 2AROC 1P3IC 5BO0B 3AZLC 5F99D 3X1TD 3LELB 5B33D 3AFAA 5CPIA 3AZFA 4XUJA 3TU4C 3AZKC 1P3OA 3KWQA 5JRGC 3A6NB 5DNMA 5B31C 2L5AA 4H9PB 3MGQD 3X1VB 1P3KB 2Y2IA 3AZHD 1ZLAA 4WU8B 5B1MA 3REJD 4UPKA 1AOID 4KUDA 3LJAC 2NQBA 1P3MD 4LD9D 3REID 1P3FC 1P3LD 5BNVA 4KGCD 4WNNB 4DQYB 3LZ0A 4KHAA 5B1LC 4J8UB 3MGPA 1F1EA 1KX3B 3IP4C 2LY8A 3MGSD 3W96B 5CP6B 3UTAD 3UTBD 3B6FB 2HIOD 2PYOC 2F8NH 4R8PA 4WU9C 5GT3C 5B0YC 3EPJA 3AYWC 1Z2CB 5DNNC 4QLCD 3AV1C 1M19A 1M1AA 2F8NA 3AZJA 3NQJA 1M18D 2J8PA 1JFIB 5FUGA 2Y2HA 3X1UC 5CPJC 2FJ7C 3W99B 3VH5T 4J8VA 2VQRA 5CPKB 4YS3D 2NZDD 3AZNB 5AVBB 3WA9D 3REHC 1KX4A 3WTPD 3V9RA 5GXQC 2Y2MA 1U35D 4J8XB 3RELA 3KUYD 3MVDD 3MNNA 3X1SB 4CAYB 1P3GC 1S32C 5B40D 3MGRA 4WJ3C 3B6GA 2ZY2A 5B33B 5GT0B 4XZQB 3AV2B 3LELC 1ID3A 3AFAD 5CPID 5AVCA 3AZFD 4XUJD 2Y2QA 3B0DB 3KWQD 1P3OD 5KDMB 1TAFA 5DNMD 3A6NC 1HQ3A 1KX5A 4DRBA 3X1VC 1P3KC 3AZGA 5B2JA 1AOIB 4E45A 4JJNA 1ZLAD 3VH6T 4WU8C 5B1MD 3LZ1A 5B2IA 1P3MB 3W98A 1EQZA 3REIB 4KUDD 2G5HC 3EPKA 5GSUB 2NQBD 2YFVB 2Y2NA 5E5AD 4ZUXB 3AZMA 4H9RB 5AV6A 3O62B 3MGSB 3B0BA 3LZ0D 3UTAB 3UTBB 4J8UC 3MGPD 2Y2OA 2CV5A 1KX3C 2HIOB 1N1JB 4H9QB 3W96C 5CP6C 3AZKA 1B6WA 4E44A 4Z66A 3B6FC 4R8PD 3H0MC 3W97B 4QLCB 1P3AA 4H9SC 1M19D 1M1AD 2F8ND 3AZJD 4YS3B 3LJAA 3W99C 4J8VD 5AY8B 5CPKC 3WA9B 5B24A 1P3PA 3R45B 3WTPB 4J8WB 3AZNC 5AVBC 5B1LA 1U35B 1KU5A 1KX4D 3KUYB 3MVDB 1H3OB 2DF4C 4AWLB 5B40B 4J8XC 3RELD 4Z2MH 3MNND 3X1SC 5AV8A 5JA4A 3EPLA 3MGRD 4WU9A 3B6GD 5GT3A 2CWEA 3AFAB 5B33C 5GT0C 4XZQC 3AYWA 3AV2C 3AZFB 4XUJB 3AV1A 3KWQB 1ID3D 5AV9B 5AVCD 5DNMB 2FJ7A 3B0DC 4EO5B 3VH5A 1HQ3D 4WV4B 4X23A 1KX5D 1ZLAB 5B1MB 3AZGD 5B2JD 1AOIC 4JJND 4KUDB 2NQBB 3LZ1D 5B2ID 1P3MC 3W98D 1EQZD 5G49A 3REIC 5GSUC 3WKJB 2Y2JA 5E5AA 3KSYA 1P34A 4KHAB 2DQNC 3AZMD 4ZUXC 4G91B 5AV6D 3O62C 3MGSC 3AZIA 3AZLD 3UTAC 1BH8A 3UTBC 3AL0C 2CV5D 3VH5W 3KFUG 2HIOC 3AZKD 4Z66D 5B32A 3AN2A 3A6NA 1P3BA 1M1AB 1M19B 4QLCC 4H9PA 1P3AD 2F8NB 3W97C 1F66A 3AZJB 5AV5A 1TZYA 5BNXA 4YM6A 3NQUA 4J8VB 3VH6A 2BYKB 4YS3C 3LJAD 5AY8C 2IO5B 4UUZB 3REKC 3WA9C 3WAAA 5B24D 2Y2KA 1P3PD 1KX4B 3WTPC 3V9RB 4J8WC 4WNNA 5B0ZA 4H9NA 5B1LD 3C1CB 1U35C 3RELB 3KUYC 3MVDC 1KX3A 3MNNB 3W96A 5CP6A 4AWLC 5B40C 3B6GB 5AV8D 3AZEA 1BH9B 4WU9D 5F99B 3X1TB 5GT3D 3VH6W 3AFAC 3C1BA 3AYWD 3AZFC 3AV1D 4XUJC 1BFMA 3KWQC 5BS7A 5AV9C 4NE3A 1TAFB 5DNMC 1HQ3B 1KX5B 2FJ7D 3W99A 4DRAA 4EO5C 3MGQB 3AZHB 5B2JB 4X23D 3UT9A 1ZLAC 5B1MC 3LZ1B 3W98B 3REJB 1EQZB 2JE5A 4Z5TA 4KUDC 3KXBA 2NQBC 3F6TA 1WWIA 4LD9B 2ZY4A 3AZMB 3WKJC 3X1SA 5AV6B 5BT1C 4CAYA 4M6BA 1P34D 1P3LB 2F8NG 4KGCB 4WZSB 2AROA 2RVQD 2CV5B 1P3IA 4G91C 4XZQA 5GT0A 3AZID 3AZLA 3AV2A 2W8SA 2YFWB 2XD5A 4Z66B 2HUEB 3TU4A 5B32D 3AN2D 5JRGA 1P3AB 3A6ND 4CSRB 4NE5A 5B31A 1P3BD 3A1KA 1M19C 1M1AC 1F66D 5AV5D 3AZJC 1TZYD 1M18B 4YM6D 2JSSA 4J8VC 5GSUA 2NZDB 2YFVA 5B24B 1P3PB 5C3IB 2IO5C 4ZUXA 3WAAD 1P3FA 1KX4C 3O62A 4HGAB 5B0ZD 3C1CC 4ZBJB 3RELC 1KX3D 3MNNC 3W96D 5CP6D 5AV8B 5JA4B 3EPHA 3B6GC 5GT3B 3A1IA 2PYOA 3AZED 5F99C 3X1TC 3C1BD 5B0YA 5CPIB 5DNNA 1P3OB 3H0LC 1HQ3C 3X1UA 4X23B 5CPJA 1KX5C 3W99D 5AY8A 3MGQC 3AZHC 3REKA 5B2JC 3UT9D 4J8WA 3LZ1C 3W98C 3REJC 5G49B 1EQZC 3EG5B 4Z5TD 3REHA 3KXBD 5E5AB 1H3OA 3B0CT 5GXQA 4LD9C 1P34B 5CHLB 3AZMC 1R4VA 3X1SD 5AV6C 2BYMA 5BNVB 3AZIB 1P3LC 4H9OA 1P3GA 3LZ0B 1S32A 3WTPE 1BH8B 4KGCC 2AROD 3MGPB 2FFFB 2Y2PA 2CV5C 1P3ID 5GT0D 2RIQA 5BO0A 4XZQD 3AV2D 2F8NK 4Z66C 3LELA 5B32B 5AV9A 2HUEC 3AN2B 4R8PB 3TU4D 2UWXA 1P3BB 5JRGD 1P3AC 1F66B 5AV5B 1TZYB 5BNXB 4YM6B 3NQUB 5B31D 3X1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQJ B;  1M18 C;  5FUG B;  4WU8 A;  1ULY A;  5GSU D;  3WKJ A;  3WAA B;  2NZD C;  5B24 C;  4Z2M G;  1P3P C;  5C3I C;  5B0Z B;  4H9N B;  4ZUX D;  1P3F D;  3O62 D;  4HGA C;  4J8U A;  4ZBJ C;  5AV8 C;  3AZE B;  3MGR B;  3B6F A;  2PYO D;  3C1B B;  3W97 D;  1ID3 B;  5B0Y D;  5AVC B;  5CPI C;  4H9S A;  5DNN D;  1P3O C;  1JFI A;  3X1U D;  5CPJ D;  2BYK A;  4X23 C;  4G92 B;  3UT9 B;  5AY8 D;  5CPK A;  4UUZ A;  3REK D;  3AZG B;  4JJN B;  4Z5T B;  3KXB B;  4J8W D;  3AZN A;  5B2I B;  5B32 G;  5AVB A;  3C1C A;  3REH D;  4NE6 A;  5GXQ D;  5E5A C;  1P34 C;  1B67 A;  1HTA A;  1P3K A;  4J8X A;  2ARO B;  2RVQ C;  1P3I B;  1P3G D;  3AZI C;  3AZL B;  1S32 D;  3LZ0 C;  1BH9 A;  5F99 A;  3MGP C;  3X1T A;  5B33 A;  3AZK B;  3TU4 B;  3LEL D;  5B32 C;  5JRG B;  5AV9 D;  3AN2 C;  4R8P C;  5B31 B;  1A7W A;  1P3B C;  3MGQ A;  5KDM A;  1F66 C;  3AZH A;  5AV5 C;  1TZY C;  1WWS A;  4YM6 C;  3X1V D;  1P3K D;  3REJ A;  1AOI A;  4WU8 D;  3LJA B;  1P3M A;  4LD9 A;  3REI A;  3WKJ D;  3WAA C;  1P3F B;  1P3L A;  5BT1 D;  4KGC A;  4NFT A;  5B0Z C;  5B1L B;  4H9R A;  3MGS A;  3UTA A;  2YFW A;  3UTB A;  4J8U D;  2HIO A;  2PYO B;  1N1J A;  4H9Q A;  3AZE C;  4WU9 B;  3MGR C;  3B6F D;  3C1B C;  4CSR A;  5B0Y B;  3AYW B;  5DNN B;  3W97 A;  4QLC A;  3AV1 B;  1ID3 C;  5BS7 C;  1M18 A;  3B0C W;  5AVC C;  3X1U B;  5CPJ B;  2FJ7 B;  3REK B;  4G92 C;  3UT9 C;  4YS3 A;  2NZD A;  5CPK D;  3AZG C;  4JJN C;  4Z5T C;  3WA9 A;  3REH B;  3KXB C;  3R45 A;  3WTP A;  5GXQ B;  3AZN D;  5B2I C;  1Q9C A;  5AVB D;  3C1C D;  1U35 A;  3KUY A;  3MVD A;  5B31 G;  2BYM B;  1P3G B;  4H9O B;  1S32 B;  5B40 A;  4J8X D;  2ARO C;  1P3I C;  5BO0 B;  3AZL C;  5F99 D;  3X1T D;  3LEL B;  5B33 D;  3AFA A;  5CPI A;  3AZF A;  4XUJ A;  3TU4 C;  3AZK C;  1P3O A;  3KWQ A;  5JRG C;  3A6N B;  5DNM A;  5B31 C;  2L5A A;  4H9P B;  3MGQ D;  3X1V B;  1P3K B;  3AZH D;  1ZLA A;  4WU8 B;  5B1M A;  3REJ D;  1AOI D;  4KUD A;  3LJA C;  2NQB A;  1P3M D;  4LD9 D;  3REI D;  1P3F C;  1P3L D;  5BNV A;  4KGC D;  4WNN B;  3LZ0 A;  4KHA A;  5B1L C;  4J8U B;  3MGP A;  1F1E A;  1KX3 B;  2LY8 A;  3MGS D;  3W96 B;  5CP6 B;  3UTA D;  3UTB D;  3B6F B;  2HIO D;  2PYO C;  2F8N H;  4R8P A;  4WU9 C;  5GT3 C;  5B0Y C;  3AYW C;  5DNN C;  4QLC D;  3AV1 C;  1M19 A;  1M1A A;  2F8N A;  3AZJ A;  3NQJ A;  1M18 D;  1JFI B;  5FUG A;  3X1U C;  5CPJ C;  2FJ7 C;  3W99 B;  3VH5 T;  4J8V A;  5CPK B;  4YS3 D;  2NZD D;  3AZN B;  5AVB B;  3WA9 D;  3REH C;  1KX4 A;  3WTP D;  3V9R A;  5GXQ C;  1U35 D;  4J8X B;  3REL A;  3KUY D;  3MVD D;  3MNN A;  3X1S B;  4CAY B;  1P3G C;  1S32 C;  5B40 D;  3MGR A;  3B6G A;  5B33 B;  5GT0 B;  4XZQ B;  3AV2 B;  3LEL C;  1ID3 A;  3AFA D;  5CPI D;  5AVC A;  3AZF D;  4XUJ D;  1P3O D;  3B0D B;  3KWQ D;  5KDM B;  1TAF A;  5DNM D;  3A6N C;  1HQ3 A;  1KX5 A;  4DRB A;  3X1V C;  1P3K C;  3AZG A;  5B2J A;  1AOI B;  4E45 A;  4JJN A;  1ZLA D;  3VH6 T;  4WU8 C;  5B1M D;  3LZ1 A;  5B2I A;  1P3M B;  3W98 A;  1EQZ A;  3REI B;  4KUD D;  5GSU B;  2NQB D;  2YFV B;  5E5A D;  4ZUX B;  3AZM A;  4H9R B;  5AV6 A;  3O62 B;  3MGS B;  3B0B A;  3LZ0 D;  3UTA B;  3UTB B;  4J8U C;  3MGP D;  2CV5 A;  1KX3 C;  2HIO B;  1N1J B;  4H9Q B;  3W96 C;  5CP6 C;  3AZK A;  1B6W A;  4E44 A;  4Z66 A;  3B6F C;  4R8P D;  3W97 B;  4QLC B;  1P3A A;  4H9S C;  1M19 D;  1M1A D;  2F8N D;  3AZJ D;  4YS3 B;  3LJA A;  3W99 C;  4J8V D;  5AY8 B;  5CPK C;  3WA9 B;  5B24 A;  1P3P A;  3R45 B;  3WTP B;  4J8W B;  3AZN C;  5AVB C;  5B1L A;  1U35 B;  1KU5 A;  1KX4 D;  3KUY B;  3MVD B;  1H3O B;  4AWL B;  5B40 B;  4J8X C;  3REL D;  4Z2M H;  3MNN D;  3X1S C;  5AV8 A;  5JA4 A;  3MGR D;  4WU9 A;  3B6G D;  5GT3 A;  2CWE A;  3AFA B;  5B33 C;  5GT0 C;  4XZQ C;  3AYW A;  3AV2 C;  3AZF B;  4XUJ B;  3AV1 A;  3KWQ B;  1ID3 D;  5AV9 B;  5AVC D;  5DNM B;  2FJ7 A;  3B0D C;  4EO5 B;  3VH5 A;  1HQ3 D;  4WV4 B;  4X23 A;  1KX5 D;  1ZLA B;  5B1M B;  3AZG D;  5B2J D;  1AOI C;  4JJN D;  4KUD B;  2NQB B;  3LZ1 D;  5B2I D;  1P3M C;  3W98 D;  1EQZ D;  5G49 A;  3REI C;  5GSU C;  3WKJ B;  5E5A A;  3KSY A;  1P34 A;  4KHA B;  3AZM D;  4ZUX C;  4G91 B;  5AV6 D;  3O62 C;  3MGS C;  3AZI A;  3AZL D;  3UTA C;  1BH8 A;  3UTB C;  2CV5 D;  3VH5 W;  2HIO C;  3AZK D;  4Z66 D;  5B32 A;  3AN2 A;  3A6N A;  1P3B A;  1M1A B;  1M19 B;  4QLC C;  4H9P A;  1P3A D;  2F8N B;  3W97 C;  1F66 A;  3AZJ B;  5AV5 A;  1TZY A;  5BNX A;  4YM6 A;  3NQU A;  4J8V B;  3VH6 A;  2BYK B;  4YS3 C;  3LJA D;  5AY8 C;  2IO5 B;  4UUZ B;  3REK C;  3WA9 C;  3WAA A;  5B24 D;  1P3P D;  1KX4 B;  3WTP C;  3V9R B;  4J8W C;  4WNN A;  5B0Z A;  4H9N A;  5B1L D;  3C1C B;  1U35 C;  3REL B;  3KUY C;  3MVD C;  1KX3 A;  3MNN B;  3W96 A;  5CP6 A;  4AWL C;  5B40 C;  3B6G B;  5AV8 D;  3AZE A;  1BH9 B;  4WU9 D;  5F99 B;  3X1T B;  5GT3 D;  3VH6 W;  3AFA C;  3C1B A;  3AYW D;  3AZF C;  3AV1 D;  4XUJ C;  1BFM A;  3KWQ C;  5BS7 A;  5AV9 C;  4NE3 A;  1TAF B;  5DNM C;  1HQ3 B;  1KX5 B;  2FJ7 D;  3W99 A;  4DRA A;  4EO5 C;  3MGQ B;  3AZH B;  5B2J B;  4X23 D;  3UT9 A;  1ZLA C;  5B1M C;  3LZ1 B;  3W98 B;  3REJ B;  1EQZ B;  4Z5T A;  4KUD C;  3KXB A;  2NQB C;  1WWI A;  4LD9 B;  3AZM B;  3WKJ C;  3X1S A;  5AV6 B;  5BT1 C;  4CAY A;  4M6B A;  1P34 D;  1P3L B;  2F8N G;  4KGC B;  4WZS B;  2ARO A;  2RVQ D;  2CV5 B;  1P3I A;  4G91 C;  4XZQ A;  5GT0 A;  3AZI D;  3AZL A;  3AV2 A;  2YFW B;  4Z66 B;  2HUE B;  3TU4 A;  5B32 D;  3AN2 D;  5JRG A;  1P3A B;  3A6N D;  4CSR B;  4NE5 A;  5B31 A;  1P3B D;  1M19 C;  1M1A C;  1F66 D;  5AV5 D;  3AZJ C;  1TZY D;  1M18 B;  4YM6 D;  2JSS A;  4J8V C;  5GSU A;  2NZD B;  2YFV A;  5B24 B;  1P3P B;  5C3I B;  2IO5 C;  4ZUX A;  3WAA D;  1P3F A;  1KX4 C;  3O62 A;  4HGA B;  5B0Z D;  3C1C C;  4ZBJ B;  3REL C;  1KX3 D;  3MNN C;  3W96 D;  5CP6 D;  5AV8 B;  5JA4 B;  3B6G C;  5GT3 B;  2PYO A;  3AZE D;  5F99 C;  3X1T C;  3C1B D;  5B0Y A;  5CPI B;  5DNN A;  1P3O B;  1HQ3 C;  3X1U A;  4X23 B;  5CPJ A;  1KX5 C;  3W99 D;  5AY8 A;  3MGQ C;  3AZH C;  3REK A;  5B2J C;  3UT9 D;  4J8W A;  3LZ1 C;  3W98 C;  3REJ C;  5G49 B;  1EQZ C;  4Z5T D;  3REH A;  3KXB D;  5E5A B;  1H3O A;  3B0C T;  5GXQ A;  4LD9 C;  1P34 B;  5CHL B;  3AZM C;  1R4V A;  3X1S D;  5AV6 C;  2BYM A;  5BNV B;  3AZI B;  1P3L C;  4H9O A;  1P3G A;  3LZ0 B;  1S32 A;  3WTP E;  1BH8 B;  4KGC C;  2ARO D;  3MGP B;  2CV5 C;  1P3I D;  5GT0 D;  4XZQ D;  5BO0 A;  3AV2 D;  2F8N K;  4Z66 C;  3LEL A;  5B32 B;  5AV9 A;  2HUE C;  3AN2 B;  4R8P B;  3TU4 D;  1P3B B;  5JRG D;  1P3A C;  1F66 B;  5AV5 B;  1TZY B;  5BNX B;  4YM6 B;  3NQU B;  5B31 D;  3X1V A; 
#chains in the Genus database with same CATH topology
 3NQJ B;  1M18 C;  5FUG B;  4WU8 A;  1ULY A;  5GSU D;  3WKJ A;  3WAA B;  2NZD C;  5B24 C;  4Z2M G;  1P3P C;  5C3I C;  2XD1 A;  5B0Z B;  4H9N B;  4ZUX D;  1P3F D;  3O62 D;  4HGA C;  4J8U A;  4ZBJ C;  5AV8 C;  3AZE B;  3MGR B;  3B6F A;  3P5J B;  2PYO D;  3C1B B;  3W97 D;  2ZM5 A;  1ID3 B;  5B0Y D;  5AVC B;  5CPI C;  2BG1 A;  4H9S A;  2JCH A;  5DNN D;  1P3O C;  1JFI A;  3X1U D;  5CPJ D;  2BYK A;  4X23 C;  4G92 B;  3UT9 B;  5AY8 D;  5CPK A;  4UUZ A;  3REK D;  3AZG B;  4JJN B;  4Z5T B;  3KXB B;  4J8W D;  3AZN A;  5B2I B;  5B32 G;  5AVB A;  3C1C A;  1W2E A;  3REH D;  4NE6 A;  5GXQ D;  5E5A C;  1P34 C;  1B67 A;  1HTA A;  1P3K A;  4J8X A;  2ARO B;  2RVQ C;  1P3I B;  1P3G D;  3AZI C;  2ZY5 A;  3AZL B;  1S32 D;  3LZ0 C;  1BH9 A;  2Y2G A;  5F99 A;  3MGP C;  3X1T A;  5B33 A;  3AZK B;  3TU4 B;  3LEL D;  5B32 C;  5JRG B;  5AV9 D;  3AN2 C;  2Y2L A;  4R8P C;  5B31 B;  1A7W A;  1P3B C;  3MGQ A;  5KDM A;  1F66 C;  3AZH A;  5AV5 C;  1TZY C;  1WWS A;  4YM6 C;  3X1V D;  1P3K D;  3REJ A;  1AOI A;  4WU8 D;  3LJA B;  1P3M A;  4LD9 A;  3REI A;  3WKJ D;  3WAA C;  1P3F B;  1P3L A;  5BT1 D;  2ZY3 A;  3H0R C;  4NFT A;  4KGC A;  5B0Z C;  5B1L B;  4H9R A;  3MGS A;  3UTA A;  2YFW A;  3UTB A;  4J8U D;  2HIO A;  2PYO B;  1N1J A;  4H9Q A;  3AZE C;  4WU9 B;  3MGR C;  3B6F D;  3C1B C;  4CSR A;  5B0Y B;  3AYW B;  5DNN B;  3W97 A;  4QLC A;  3AV1 B;  1ID3 C;  5BS7 C;  1M18 A;  3B0C W;  5AVC C;  3X1U B;  5CPJ B;  2FJ7 B;  3REK B;  4G92 C;  2F2A C;  3UT9 C;  4YS3 A;  2NZD A;  5CPK D;  1T3U A;  3AZG C;  1PZR A;  4JJN C;  4Z5T C;  2G5I C;  3REH B;  3WA9 A;  3KXB C;  3R45 A;  3WTP A;  5GXQ B;  3AZN D;  5B2I C;  1Q9C A;  5AVB D;  3C1C D;  3FDD A;  1U35 A;  3KUY A;  3MVD A;  5B31 G;  2BYM B;  1P3G B;  4H9O B;  1S32 B;  5B40 A;  4J8X D;  2ARO C;  1P3I C;  5BO0 B;  3AZL C;  5F99 D;  3X1T D;  3LEL B;  5B33 D;  3AFA A;  5CPI A;  3AZF A;  4XUJ A;  3TU4 C;  3AZK C;  1P3O A;  3KWQ A;  5JRG C;  3A6N B;  5DNM A;  5B31 C;  2L5A A;  4H9P B;  3MGQ D;  3X1V B;  1P3K B;  2Y2I A;  3AZH D;  1ZLA A;  4WU8 B;  5B1M A;  3REJ D;  4UPK A;  1AOI D;  4KUD A;  3LJA C;  2NQB A;  1P3M D;  4LD9 D;  3REI D;  1P3F C;  1P3L D;  5BNV A;  4KGC D;  4WNN B;  4DQY B;  3LZ0 A;  4KHA A;  5B1L C;  4J8U B;  3MGP A;  1F1E A;  1KX3 B;  3IP4 C;  2LY8 A;  3MGS D;  3W96 B;  5CP6 B;  3UTA D;  3UTB D;  3B6F B;  2HIO D;  2PYO C;  2F8N H;  4R8P A;  4WU9 C;  5GT3 C;  5B0Y C;  3EPJ A;  3AYW C;  1Z2C B;  5DNN C;  4QLC D;  3AV1 C;  1M19 A;  1M1A A;  2F8N A;  3AZJ A;  3NQJ A;  1M18 D;  2J8P A;  1JFI B;  5FUG A;  2Y2H A;  3X1U C;  5CPJ C;  2FJ7 C;  3W99 B;  3VH5 T;  4J8V A;  2VQR A;  5CPK B;  4YS3 D;  2NZD D;  3AZN B;  5AVB B;  3WA9 D;  3REH C;  1KX4 A;  3WTP D;  3V9R A;  5GXQ C;  2Y2M A;  1U35 D;  4J8X B;  3REL A;  3KUY D;  3MVD D;  3MNN A;  3X1S B;  4CAY B;  1P3G C;  1S32 C;  5B40 D;  3MGR A;  4WJ3 C;  3B6G A;  2ZY2 A;  5B33 B;  5GT0 B;  4XZQ B;  3AV2 B;  3LEL C;  1ID3 A;  3AFA D;  5CPI D;  5AVC A;  3AZF D;  4XUJ D;  2Y2Q A;  3B0D B;  3KWQ D;  1P3O D;  5KDM B;  1TAF A;  5DNM D;  3A6N C;  1HQ3 A;  1KX5 A;  4DRB A;  3X1V C;  1P3K C;  3AZG A;  5B2J A;  1AOI B;  4E45 A;  4JJN A;  1ZLA D;  3VH6 T;  4WU8 C;  5B1M D;  3LZ1 A;  5B2I A;  1P3M B;  3W98 A;  1EQZ A;  3REI B;  4KUD D;  2G5H C;  3EPK A;  5GSU B;  2NQB D;  2YFV B;  2Y2N A;  5E5A D;  4ZUX B;  3AZM A;  4H9R B;  5AV6 A;  3O62 B;  3MGS B;  3B0B A;  3LZ0 D;  3UTA B;  3UTB B;  4J8U C;  3MGP D;  2Y2O A;  2CV5 A;  1KX3 C;  2HIO B;  1N1J B;  4H9Q B;  3W96 C;  5CP6 C;  3AZK A;  1B6W A;  4E44 A;  4Z66 A;  3B6F C;  4R8P D;  3H0M C;  3W97 B;  4QLC B;  1P3A A;  4H9S C;  1M19 D;  1M1A D;  2F8N D;  3AZJ D;  4YS3 B;  3LJA A;  3W99 C;  4J8V D;  5AY8 B;  5CPK C;  3WA9 B;  5B24 A;  1P3P A;  3R45 B;  3WTP B;  4J8W B;  3AZN C;  5AVB C;  5B1L A;  1U35 B;  1KU5 A;  1KX4 D;  3KUY B;  3MVD B;  1H3O B;  2DF4 C;  4AWL B;  5B40 B;  4J8X C;  3REL D;  4Z2M H;  3MNN D;  3X1S C;  5AV8 A;  5JA4 A;  3EPL A;  3MGR D;  4WU9 A;  3B6G D;  5GT3 A;  2CWE A;  3AFA B;  5B33 C;  5GT0 C;  4XZQ C;  3AYW A;  3AV2 C;  3AZF B;  4XUJ B;  3AV1 A;  3KWQ B;  1ID3 D;  5AV9 B;  5AVC D;  5DNM B;  2FJ7 A;  3B0D C;  4EO5 B;  3VH5 A;  1HQ3 D;  4WV4 B;  4X23 A;  1KX5 D;  1ZLA B;  5B1M B;  3AZG D;  5B2J D;  1AOI C;  4JJN D;  4KUD B;  2NQB B;  3LZ1 D;  5B2I D;  1P3M C;  3W98 D;  1EQZ D;  5G49 A;  3REI C;  5GSU C;  3WKJ B;  2Y2J A;  5E5A A;  3KSY A;  1P34 A;  4KHA B;  2DQN C;  3AZM D;  4ZUX C;  4G91 B;  5AV6 D;  3O62 C;  3MGS C;  3AZI A;  3AZL D;  3UTA C;  1BH8 A;  3UTB C;  3AL0 C;  2CV5 D;  3VH5 W;  3KFU G;  2HIO C;  3AZK D;  4Z66 D;  5B32 A;  3AN2 A;  3A6N A;  1P3B A;  1M1A B;  1M19 B;  4QLC C;  4H9P A;  1P3A D;  2F8N B;  3W97 C;  1F66 A;  3AZJ B;  5AV5 A;  1TZY A;  5BNX A;  4YM6 A;  3NQU A;  4J8V B;  3VH6 A;  2BYK B;  4YS3 C;  3LJA D;  5AY8 C;  2IO5 B;  4UUZ B;  3REK C;  3WA9 C;  3WAA A;  5B24 D;  2Y2K A;  1P3P D;  1KX4 B;  3WTP C;  3V9R B;  4J8W C;  4WNN A;  5B0Z A;  4H9N A;  5B1L D;  3C1C B;  1U35 C;  3REL B;  3KUY C;  3MVD C;  1KX3 A;  3MNN B;  3W96 A;  5CP6 A;  4AWL C;  5B40 C;  3B6G B;  5AV8 D;  3AZE A;  1BH9 B;  4WU9 D;  5F99 B;  3X1T B;  5GT3 D;  3VH6 W;  3AFA C;  3C1B A;  3AYW D;  3AZF C;  3AV1 D;  4XUJ C;  1BFM A;  3KWQ C;  5BS7 A;  5AV9 C;  4NE3 A;  1TAF B;  5DNM C;  1HQ3 B;  1KX5 B;  2FJ7 D;  3W99 A;  4DRA A;  4EO5 C;  3MGQ B;  3AZH B;  5B2J B;  4X23 D;  3UT9 A;  1ZLA C;  5B1M C;  3LZ1 B;  3W98 B;  3REJ B;  1EQZ B;  2JE5 A;  4Z5T A;  4KUD C;  3KXB A;  2NQB C;  3F6T A;  1WWI A;  4LD9 B;  2ZY4 A;  3AZM B;  3WKJ C;  3X1S A;  5AV6 B;  5BT1 C;  4CAY A;  4M6B A;  1P34 D;  1P3L B;  2F8N G;  4KGC B;  4WZS B;  2ARO A;  2RVQ D;  2CV5 B;  1P3I A;  4G91 C;  4XZQ A;  5GT0 A;  3AZI D;  3AZL A;  3AV2 A;  2W8S A;  2YFW B;  2XD5 A;  4Z66 B;  2HUE B;  3TU4 A;  5B32 D;  3AN2 D;  5JRG A;  1P3A B;  3A6N D;  4CSR B;  4NE5 A;  5B31 A;  1P3B D;  3A1K A;  1M19 C;  1M1A C;  1F66 D;  5AV5 D;  3AZJ C;  1TZY D;  1M18 B;  4YM6 D;  2JSS A;  4J8V C;  5GSU A;  2NZD B;  2YFV A;  5B24 B;  1P3P B;  5C3I B;  2IO5 C;  4ZUX A;  3WAA D;  1P3F A;  1KX4 C;  3O62 A;  4HGA B;  5B0Z D;  3C1C C;  4ZBJ B;  3REL C;  1KX3 D;  3MNN C;  3W96 D;  5CP6 D;  5AV8 B;  5JA4 B;  3EPH A;  3B6G C;  5GT3 B;  3A1I A;  2PYO A;  3AZE D;  5F99 C;  3X1T C;  3C1B D;  5B0Y A;  5CPI B;  5DNN A;  1P3O B;  3H0L C;  1HQ3 C;  3X1U A;  4X23 B;  5CPJ A;  1KX5 C;  3W99 D;  5AY8 A;  3MGQ C;  3AZH C;  3REK A;  5B2J C;  3UT9 D;  4J8W A;  3LZ1 C;  3W98 C;  3REJ C;  5G49 B;  1EQZ C;  3EG5 B;  4Z5T D;  3REH A;  3KXB D;  5E5A B;  1H3O A;  3B0C T;  5GXQ A;  4LD9 C;  1P34 B;  5CHL B;  3AZM C;  1R4V A;  3X1S D;  5AV6 C;  2BYM A;  5BNV B;  3AZI B;  1P3L C;  4H9O A;  1P3G A;  3LZ0 B;  1S32 A;  3WTP E;  1BH8 B;  4KGC C;  2ARO D;  3MGP B;  2FFF B;  2Y2P A;  2CV5 C;  1P3I D;  5GT0 D;  2RIQ A;  5BO0 A;  4XZQ D;  3AV2 D;  2F8N K;  4Z66 C;  3LEL A;  5B32 B;  5AV9 A;  2HUE C;  3AN2 B;  4R8P B;  3TU4 D;  2UWX A;  1P3B B;  5JRG D;  1P3A C;  1F66 B;  5AV5 B;  1TZY B;  5BNX B;  4YM6 B;  3NQU B;  5B31 D;  3X1V A; 
#chains in the Genus database with same CATH homology
 3NQJ B;  1M18 C;  5FUG B;  4WU8 A;  1ULY A;  5GSU D;  3WKJ A;  3WAA B;  2NZD C;  5B24 C;  4Z2M G;  1P3P C;  5C3I C;  2XD1 A;  5B0Z B;  4H9N B;  4ZUX D;  1P3F D;  3O62 D;  4HGA C;  4J8U A;  4ZBJ C;  5AV8 C;  3AZE B;  3MGR B;  3B6F A;  3P5J B;  2PYO D;  3C1B B;  3W97 D;  2ZM5 A;  1ID3 B;  5B0Y D;  5AVC B;  5CPI C;  2BG1 A;  4H9S A;  2JCH A;  5DNN D;  1P3O C;  1JFI A;  3X1U D;  5CPJ D;  2BYK A;  4X23 C;  4G92 B;  3UT9 B;  5AY8 D;  5CPK A;  4UUZ A;  3REK D;  3AZG B;  4JJN B;  4Z5T B;  3KXB B;  4J8W D;  3AZN A;  5B2I B;  5B32 G;  5AVB A;  3C1C A;  1W2E A;  3REH D;  4NE6 A;  5GXQ D;  5E5A C;  1P34 C;  1B67 A;  1HTA A;  1P3K A;  4J8X A;  2ARO B;  2RVQ C;  1P3I B;  1P3G D;  3AZI C;  2ZY5 A;  3AZL B;  1S32 D;  3LZ0 C;  1BH9 A;  2Y2G A;  5F99 A;  3MGP C;  3X1T A;  5B33 A;  3AZK B;  3TU4 B;  3LEL D;  5B32 C;  5JRG B;  5AV9 D;  3AN2 C;  2Y2L A;  4R8P C;  5B31 B;  1A7W A;  1P3B C;  3MGQ A;  5KDM A;  1F66 C;  3AZH A;  5AV5 C;  1TZY C;  1WWS A;  4YM6 C;  3X1V D;  1P3K D;  3REJ A;  1AOI A;  4WU8 D;  3LJA B;  1P3M A;  4LD9 A;  3REI A;  3WKJ D;  3WAA C;  1P3F B;  1P3L A;  5BT1 D;  2ZY3 A;  3H0R C;  4NFT A;  4KGC A;  5B0Z C;  5B1L B;  4H9R A;  3MGS A;  3UTA A;  2YFW A;  3UTB A;  4J8U D;  2HIO A;  2PYO B;  1N1J A;  4H9Q A;  3AZE C;  4WU9 B;  3MGR C;  3B6F D;  3C1B C;  4CSR A;  5B0Y B;  3AYW B;  5DNN B;  3W97 A;  4QLC A;  3AV1 B;  1ID3 C;  5BS7 C;  1M18 A;  3B0C W;  5AVC C;  3X1U B;  5CPJ B;  2FJ7 B;  3REK B;  4G92 C;  2F2A C;  3UT9 C;  4YS3 A;  2NZD A;  5CPK D;  1T3U A;  3AZG C;  1PZR A;  4JJN C;  4Z5T C;  2G5I C;  3REH B;  3WA9 A;  3KXB C;  3R45 A;  3WTP A;  5GXQ B;  3AZN D;  5B2I C;  1Q9C A;  5AVB D;  3C1C D;  3FDD A;  1U35 A;  3KUY A;  3MVD A;  5B31 G;  2BYM B;  1P3G B;  4H9O B;  1S32 B;  5B40 A;  4J8X D;  2ARO C;  1P3I C;  5BO0 B;  3AZL C;  5F99 D;  3X1T D;  3LEL B;  5B33 D;  3AFA A;  5CPI A;  3AZF A;  4XUJ A;  3TU4 C;  3AZK C;  1P3O A;  3KWQ A;  5JRG C;  3A6N B;  5DNM A;  5B31 C;  2L5A A;  4H9P B;  3MGQ D;  3X1V B;  1P3K B;  2Y2I A;  3AZH D;  1ZLA A;  4WU8 B;  5B1M A;  3REJ D;  4UPK A;  1AOI D;  4KUD A;  3LJA C;  2NQB A;  1P3M D;  4LD9 D;  3REI D;  1P3F C;  1P3L D;  5BNV A;  4KGC D;  4WNN B;  4DQY B;  3LZ0 A;  4KHA A;  5B1L C;  4J8U B;  3MGP A;  1F1E A;  1KX3 B;  3IP4 C;  2LY8 A;  3MGS D;  3W96 B;  5CP6 B;  3UTA D;  3UTB D;  3B6F B;  2HIO D;  2PYO C;  2F8N H;  4R8P A;  4WU9 C;  5GT3 C;  5B0Y C;  3EPJ A;  3AYW C;  1Z2C B;  5DNN C;  4QLC D;  3AV1 C;  1M19 A;  1M1A A;  2F8N A;  3AZJ A;  3NQJ A;  1M18 D;  2J8P A;  1JFI B;  5FUG A;  2Y2H A;  3X1U C;  5CPJ C;  2FJ7 C;  3W99 B;  3VH5 T;  4J8V A;  2VQR A;  5CPK B;  4YS3 D;  2NZD D;  3AZN B;  5AVB B;  3WA9 D;  3REH C;  1KX4 A;  3WTP D;  3V9R A;  5GXQ C;  2Y2M A;  1U35 D;  4J8X B;  3REL A;  3KUY D;  3MVD D;  3MNN A;  3X1S B;  4CAY B;  1P3G C;  1S32 C;  5B40 D;  3MGR A;  4WJ3 C;  3B6G A;  2ZY2 A;  5B33 B;  5GT0 B;  4XZQ B;  3AV2 B;  3LEL C;  1ID3 A;  3AFA D;  5CPI D;  5AVC A;  3AZF D;  4XUJ D;  2Y2Q A;  3B0D B;  3KWQ D;  1P3O D;  5KDM B;  1TAF A;  5DNM D;  3A6N C;  1HQ3 A;  1KX5 A;  4DRB A;  3X1V C;  1P3K C;  3AZG A;  5B2J A;  1AOI B;  4E45 A;  4JJN A;  1ZLA D;  3VH6 T;  4WU8 C;  5B1M D;  3LZ1 A;  5B2I A;  1P3M B;  3W98 A;  1EQZ A;  3REI B;  4KUD D;  2G5H C;  3EPK A;  5GSU B;  2NQB D;  2YFV B;  2Y2N A;  5E5A D;  4ZUX B;  3AZM A;  4H9R B;  5AV6 A;  3O62 B;  3MGS B;  3B0B A;  3LZ0 D;  3UTA B;  3UTB B;  4J8U C;  3MGP D;  2Y2O A;  2CV5 A;  1KX3 C;  2HIO B;  1N1J B;  4H9Q B;  3W96 C;  5CP6 C;  3AZK A;  1B6W A;  4E44 A;  4Z66 A;  3B6F C;  4R8P D;  3H0M C;  3W97 B;  4QLC B;  1P3A A;  4H9S C;  1M19 D;  1M1A D;  2F8N D;  3AZJ D;  4YS3 B;  3LJA A;  3W99 C;  4J8V D;  5AY8 B;  5CPK C;  3WA9 B;  5B24 A;  1P3P A;  3R45 B;  3WTP B;  4J8W B;  3AZN C;  5AVB C;  5B1L A;  1U35 B;  1KU5 A;  1KX4 D;  3KUY B;  3MVD B;  1H3O B;  2DF4 C;  4AWL B;  5B40 B;  4J8X C;  3REL D;  4Z2M H;  3MNN D;  3X1S C;  5AV8 A;  5JA4 A;  3EPL A;  3MGR D;  4WU9 A;  3B6G D;  5GT3 A;  2CWE A;  3AFA B;  5B33 C;  5GT0 C;  4XZQ C;  3AYW A;  3AV2 C;  3AZF B;  4XUJ B;  3AV1 A;  3KWQ B;  1ID3 D;  5AV9 B;  5AVC D;  5DNM B;  2FJ7 A;  3B0D C;  4EO5 B;  3VH5 A;  1HQ3 D;  4WV4 B;  4X23 A;  1KX5 D;  1ZLA B;  5B1M B;  3AZG D;  5B2J D;  1AOI C;  4JJN D;  4KUD B;  2NQB B;  3LZ1 D;  5B2I D;  1P3M C;  3W98 D;  1EQZ D;  5G49 A;  3REI C;  5GSU C;  3WKJ B;  2Y2J A;  5E5A A;  3KSY A;  1P34 A;  4KHA B;  2DQN C;  3AZM D;  4ZUX C;  4G91 B;  5AV6 D;  3O62 C;  3MGS C;  3AZI A;  3AZL D;  3UTA C;  1BH8 A;  3UTB C;  3AL0 C;  2CV5 D;  3VH5 W;  3KFU G;  2HIO C;  3AZK D;  4Z66 D;  5B32 A;  3AN2 A;  3A6N A;  1P3B A;  1M1A B;  1M19 B;  4QLC C;  4H9P A;  1P3A D;  2F8N B;  3W97 C;  1F66 A;  3AZJ B;  5AV5 A;  1TZY A;  5BNX A;  4YM6 A;  3NQU A;  4J8V B;  3VH6 A;  2BYK B;  4YS3 C;  3LJA D;  5AY8 C;  2IO5 B;  4UUZ B;  3REK C;  3WA9 C;  3WAA A;  5B24 D;  2Y2K A;  1P3P D;  1KX4 B;  3WTP C;  3V9R B;  4J8W C;  4WNN A;  5B0Z A;  4H9N A;  5B1L D;  3C1C B;  1U35 C;  3REL B;  3KUY C;  3MVD C;  1KX3 A;  3MNN B;  3W96 A;  5CP6 A;  4AWL C;  5B40 C;  3B6G B;  5AV8 D;  3AZE A;  1BH9 B;  4WU9 D;  5F99 B;  3X1T B;  5GT3 D;  3VH6 W;  3AFA C;  3C1B A;  3AYW D;  3AZF C;  3AV1 D;  4XUJ C;  1BFM A;  3KWQ C;  5BS7 A;  5AV9 C;  4NE3 A;  1TAF B;  5DNM C;  1HQ3 B;  1KX5 B;  2FJ7 D;  3W99 A;  4DRA A;  4EO5 C;  3MGQ B;  3AZH B;  5B2J B;  4X23 D;  3UT9 A;  1ZLA C;  5B1M C;  3LZ1 B;  3W98 B;  3REJ B;  1EQZ B;  2JE5 A;  4Z5T A;  4KUD C;  3KXB A;  2NQB C;  3F6T A;  1WWI A;  4LD9 B;  2ZY4 A;  3AZM B;  3WKJ C;  3X1S A;  5AV6 B;  5BT1 C;  4CAY A;  4M6B A;  1P34 D;  1P3L B;  2F8N G;  4KGC B;  4WZS B;  2ARO A;  2RVQ D;  2CV5 B;  1P3I A;  4G91 C;  4XZQ A;  5GT0 A;  3AZI D;  3AZL A;  3AV2 A;  2W8S A;  2YFW B;  2XD5 A;  4Z66 B;  2HUE B;  3TU4 A;  5B32 D;  3AN2 D;  5JRG A;  1P3A B;  3A6N D;  4CSR B;  4NE5 A;  5B31 A;  1P3B D;  3A1K A;  1M19 C;  1M1A C;  1F66 D;  5AV5 D;  3AZJ C;  1TZY D;  1M18 B;  4YM6 D;  2JSS A;  4J8V C;  5GSU A;  2NZD B;  2YFV A;  5B24 B;  1P3P B;  5C3I B;  2IO5 C;  4ZUX A;  3WAA D;  1P3F A;  1KX4 C;  3O62 A;  4HGA B;  5B0Z D;  3C1C C;  4ZBJ B;  3REL C;  1KX3 D;  3MNN C;  3W96 D;  5CP6 D;  5AV8 B;  5JA4 B;  3EPH A;  3B6G C;  5GT3 B;  3A1I A;  2PYO A;  3AZE D;  5F99 C;  3X1T C;  3C1B D;  5B0Y A;  5CPI B;  5DNN A;  1P3O B;  3H0L C;  1HQ3 C;  3X1U A;  4X23 B;  5CPJ A;  1KX5 C;  3W99 D;  5AY8 A;  3MGQ C;  3AZH C;  3REK A;  5B2J C;  3UT9 D;  4J8W A;  3LZ1 C;  3W98 C;  3REJ C;  5G49 B;  1EQZ C;  3EG5 B;  4Z5T D;  3REH A;  3KXB D;  5E5A B;  1H3O A;  3B0C T;  5GXQ A;  4LD9 C;  1P34 B;  5CHL B;  3AZM C;  1R4V A;  3X1S D;  5AV6 C;  2BYM A;  5BNV B;  3AZI B;  1P3L C;  4H9O A;  1P3G A;  3LZ0 B;  1S32 A;  3WTP E;  1BH8 B;  4KGC C;  2ARO D;  3MGP B;  2FFF B;  2Y2P A;  2CV5 C;  1P3I D;  5GT0 D;  2RIQ A;  5BO0 A;  4XZQ D;  3AV2 D;  2F8N K;  4Z66 C;  3LEL A;  5B32 B;  5AV9 A;  2HUE C;  3AN2 B;  4R8P B;  3TU4 D;  2UWX A;  1P3B B;  5JRG D;  1P3A C;  1F66 B;  5AV5 B;  1TZY B;  5BNX B;  4YM6 B;  3NQU B;  5B31 D;  3X1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...