1P3AB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3aB00
1P34B 1P3ID 1ULYA 5CPJC 5B31G 3WTPA 4J8WA 5BS7C 1BH8B 4G92C 2NQBB 3AZGA 3X1VD 1P3AD 3REKC 3AN2A 5B2JB 5B24A 3REKB 3MGSC 3MGQC 4LD9A 4YM6C 4WU8B 4J8XB 4YM6B 1S32D 5CPIC 5GXQA 3RELB 3REHC 3B6GA 4ZUXB 3AZHA 4X23C 1P3BA 2YFWB 3X1UD 3AZEC 3LZ1C 3WTPC 3WTPB 5B0ZA 4J8WB 2F8ND 3VH5A 1ZLAC 4YS3A 3AN2C 3AZGB 5B24C 3W97C 5GT0C 5CP6A 5B1MA 5AV5A 3AN2B 5B24B 5JRGA 2FJ7A 4LD9B 5AY8D 5B40C 1P3GA 5DNMA 5GXQC 5GSUC 1M19C 1KX4D 3AYWA 5F99A 2CV5A 5GXQB 3AZKA 1P3KD 4Z5TC 2IO5B 3B6GB 3X1SD 5AV6D 3AZHB 5B32D 3REJA 1P3BB 3WA9B 1KX5D 2NZDC 2HUEC 4H9QA 3AZNC 3REIA 4KUDD 4G91B 3W99A 5B0ZC 4XUJA 5B0ZB 4CAYA 1P34D 3KSYA 4YS3B 5B1MC 5CPJD 5CP6B 5JRGC 5AV5B 3X1TA 1P3IC 5JRGB 5CPKA 2FJ7B 4Z2MG 1P3GB 1P3OC 5DNMB 5F99C 2AROC 3REKD 3AYWB 2CV5B 3AZKB 3W98C 5E5AA 3MGQD 4J8XD 3NQUA 4WU8D 3REJC 2HIOA 4YM6D 3REJB 3RELD 4H9QB 1P3MA 4R8PC 4E45A 3REIC 5AVCB 3W99B 4XUJB 3UTBA 4DRBA 3AV2A 4CAYB 3AZED 3WKJA 3LZ1D 1B6WA 3WTPD 3B6FC 1WWSA 3AZJA 3TU4A 3X1TB 3W96C 5CPKB 4DRAA 3MVDA 3LZ0A 1TZYB 3AN2D 3W97D 5B24D 5BO0A 5E5AC 5E5AB 2HIOC 3NQUB 2HIOB 3MNNA 3AFAC 5GXQD 3B0DB 1P3MB 4QLCA 4NE3A 4H9SA 4JJNA 4EO5B 3KWQA 3UTBB 3AV2B 3WKJC 3B0CW 5B0YA 5B32C 1R4VA 3WKJB 4NE6A 5B0ZD 3TU4C 3AZJB 1P3LC 3TU4B 4YS3D 3MVDB 3LZ0B 5B1MD 4HGAB 5B2IA 1P34C 5JRGD 2FJ7D 5BO0B 4Z66A 5DNMD 1F66A 3MNNB 4KHAA 1P3OD 1AOIA 3KUYA 5F99D 2AROD 4QLCC 3MGRA 2NQBC 3W98D 4QLCB 3VH5T 3AZFA 5B2JC 3REJD 3KWQC 4JJNB 3KWQB 4J8XC 4WU8C 5B0YB 4R8PD 3REID 3W99D 1JFIA 3RELC 4XUJD 3UT9A 4ZUXC 3AZIA 3WA9A 2PYOA 4UUZA 3B6FD 5B2IB 4Z66C 3LJAA 4WU9A 3W96D 4WV4B 4Z66B 1F66C 1AOIC 4J8WC 1F66B 4KHAB 1AOIB 2CWEA 3KUYB 4XZQA 5E5AD 3MGRB 3AZGC 2HIOD 3AZFB 1U35A 4LD9C 3A6NA 1H3OA 3AFAD 1P3MD 3UTAA 1JFIB 1P3FA 5B31A 3UT9C 3AV2D 1P3PA 2F8NK 2IO5C 3B6GC 3UT9B 1EQZA 3AZHC 3AZIB 1P3BC 3WKJD 3WA9C 2PYOB 4UUZB 3AZJD 3TU4D 3LJAC 4WU9C 2F8NG 4ZBJB 4G91C 1P3LD 3LJAB 4WU9B 3KXBA 5AVCA 4J8VB 1BFMA 3MVDD 1WWIA 3VH6T 4XZQB 4YS3C 5GT3A 5CP6C 4NE5A 5AV5C 3A6NC 1U35B 2FJ7C 3A6NB 1H3OB 1P3GC 3C1BB 4QLCD 5B32G 2YFVA 5DNMC 3AV1A 2NQBD 1P3FC 3AZLA 1TZYA 3UTAB 4CSRA 5B2JD 3AYWC 3X1VA 2CV5C 3AZKC 5B31B 3KWQD 1P3FB 1P3PB 1KX3A 1EQZB 3O62A 1ID3A 4E44A 4J8UA 3WAAA 5AVCC 3W99C 3B0BA 4ZUXD 4XUJC 3KXBB 4NFTA 5GT3C 4Z66D 3R45A 5GT3B 1F66D 5BNVA 3X1TC 1AOID 4J8WD 5CPKC 2F8NH 3MGRD 2F8NA 1TZYC 2YFVB 3AZGD 3AV1B 3AZLB 3X1VB 4CSRB 4LD9D 1HQ3A 1KX3B 5AVBA 3O62C 1M1AA 3O62B 3B0DC 1S32B 1ID3C 1P3MC 1KX4A 3WAAC 3UT9D 3LELA 3MGPA 1P3KA 1ID3B 3B6GD 2BYKA 4J8UB 3WAAB 4Z2MH 3AZHD 4EO5C 5AV6A 3UTBC 3AV2C 1P3BD 3WA9D 1KX5A 3LJAD 4WU9D 2LY8A 3R45B 3AZJC 5B33A 5BNVB 3NQJA 3AZMA 2F8NB 3MVDC 3LZ0C 4HGAC 5CP6D 5CPJA 5AV5D 3A6ND 4AWLC 4AWLB 4KGCA 1HQ3B 1P3GD 3MNNC 5AVBB 3UTAD 5BS7A 1M1AB 1P3FD 5B31D 3AYWD 1P3PD 3MGPC 3B0CT 2CV5D 1KU5A 3AZKD 1KX4B 3LELB 3MGPB 1P3KB 1EQZD 2BYKB 3MGSA 3MGQA 4H9SC 2RVQC 5BNXA 4JJNC 5AV6B 2BYMA 1KX5B 5BT1C 5B0YC 5CPIA 3KXBD 5AVCD 3REHA 1BH9A 5B33C 4X23A 5B33B 1M18A 5CHLB 5AV8A 3NQJB 3AZMC 3AZMB 5GT3D 3AZEA 3LZ1A 5B2IC 5CPJB 3X1TD 5CPKD 4KGCC 4J8VA 4KGCB 3AV1D 1ZLAA 3AZLD 1TZYD 5AV9A 3KUYC 4G92B 4H9PA 3W97A 3MGRC 5GT0A 1KX3D 3AZFC 3MGSB 3MGQB 5B40A 5BNXB 3O62D 2BYMB 5GSUA 1M19A 1ID3D 5FUGA 3C1BA 4J8UD 3WAAD 5CPIB 4Z5TA 3REHB 1BH9B 3UTBD 1Q9CA 4X23B 1M18C 5AV8C 3AZIC 1M18B 5AV8B 2NZDA 3AZNA 3AZEB 2PYOC 3LZ1B 5B1LA 4ZBJC 5KDMA 5DNNA 4J8VC 5AV9C 3C1CA 1ZLAB 3LZ0D 5AV9B 4H9PB 4XZQC 3W97B 5GT0B 1HQ3D 1A7WA 1P3IA 1HTAA 3VH6W 5AVBD 1U35C 5B40B 3MNND 1M1AD 1P3OA 3C1BC 3LELD 3MGPD 2AROA 5GSUB 4H9OA 1M19B 5FUGB 1TAFA 3UTAC 1F1EA 3W98A 4Z5TB 4H9RA 5B31C 1P3PC 2RVQD 1P3AA 4JJND 1EQZC 5BT1D 5B0YD 2NZDB 2HUEB 3AZNB 4R8PA 4H9NA 5B1LC 1S32A 5B33D 5B1LB 5DNNC 5KDMB 5DNNB 3KXBC 3V9RA 3AZMD 3C1CC 3C1CB 5B2ID 5B1MB 3B6FA 3X1UA 4KGCD 3W96A 1P3IB 4WZSB 3KUYD 1P3OB 2L5AA 5F99B 2AROB 3AV1C 4H9OB 1N1JA 2JSSA 1TAFB 3X1VC 3MGSD 3AZLC 3AZFD 1P3AC 3W98B 4H9RB 1P3AB 1KX3C 3AFAA 5CPID 5JA4A 5AY8A 3REHD 4R8PB 3REIB 1S32C 4H9NB 4WNNA 4X23D 3VH6A 4J8UC 1M18D 5AV8D 5G49A 3AZID 3V9RB 3X1SA 5B32A 2PYOD 3X1UC 1B67A 3B6FB 3X1UB 1P3LA 4J8VD 4KUDA 3W96B 1ZLAD 5AV9D 5GT0D 4XZQD 1P34A 1N1JB 5B40D 1U35D 5C3IC 5GSUD 1HQ3C 5C3IB 5AY8C 1M19D 3AFAB 5AVBC 3C1BD 5JA4B 5AY8B 4Z5TD 1BH8A 1M1AC 2NQBA 4M6BA 1KX4C 4WNNB 5B2JA 3LELC 1P3KC 3REKA 3WTPE 5G49B 3X1SC 2NZDD 3AZND 5AV6C 4WU8A 4J8XA 3X1SB 4YM6A 5B32B 1KX5C 3VH5W 5B1LD 3RELA 5DNND 4KUDC 1P3LB 4ZUXA 3C1CD 4KUDB 2YFWA
chains in the Genus database with same CATH superfamily
1P34B 1P3ID 1ULYA 5CPJC 5B31G 2XD5A 3WTPA 4J8WA 5BS7C 3H0RC 1BH8B 4G92C 2NQBB 3AZGA 3X1VD 3EPKA 1P3AD 3REKC 2Y2QA 3AN2A 5B2JB 5B24A 3H0MC 3REKB 3MGSC 3MGQC 4LD9A 4YM6C 4WU8B 4J8XB 4YM6B 1S32D 5CPIC 5GXQA 2Y2KA 3RELB 2Y2OA 3REHC 3B6GA 4ZUXB 3AZHA 4X23C 1P3BA 2YFWB 3KFUG 3X1UD 3AZEC 3LZ1C 3WTPC 3WTPB 5B0ZA 4J8WB 2F8ND 3VH5A 1ZLAC 2BG1A 4YS3A 3AN2C 3AZGB 5B24C 3W97C 5GT0C 5CP6A 5B1MA 5AV5A 3AN2B 5B24B 5JRGA 2FJ7A 4LD9B 5AY8D 5B40C 1P3GA 5DNMA 5GXQC 5GSUC 1M19C 1KX4D 3AYWA 5F99A 2CV5A 5GXQB 3AZKA 1P3KD 4Z5TC 2IO5B 3B6GB 3X1SD 5AV6D 3AZHB 5B32D 3REJA 1P3BB 3WA9B 1KX5D 2NZDC 2HUEC 4H9QA 3AZNC 3REIA 4KUDD 4G91B 3W99A 5B0ZC 4XUJA 2G5IC 5B0ZB 3EPLA 4CAYA 1P34D 1Z2CB 3KSYA 4YS3B 5B1MC 5CPJD 5CP6B 5JRGC 5AV5B 3X1TA 1P3IC 5JRGB 5CPKA 2FJ7B 4Z2MG 1P3GB 2Y2JA 5DNMB 1P3OC 5F99C 2AROC 3REKD 3AYWB 2CV5B 3AZKB 3W98C 5E5AA 3MGQD 4J8XD 3NQUA 3EPJA 3REJC 4WU8D 2HIOA 4YM6D 3REJB 2JCHA 3RELD 4H9QB 1P3MA 4R8PC 4E45A 3REIC 5AVCB 3W99B 4XUJB 3UTBA 4DRBA 3AV2A 1PZRA 4CAYB 3AZED 3WKJA 3LZ1D 1B6WA 3WTPD 3B6FC 1WWSA 3AZJA 2Y2LA 3TU4A 3X1TB 3W96C 5CPKB 4DRAA 2ZY5A 3MVDA 3LZ0A 1TZYB 3AN2D 3W97D 5B24D 2JE5A 5BO0A 5E5AC 5E5AB 2HIOC 3NQUB 2HIOB 3MNNA 3AFAC 5GXQD 4UPKA 3B0DB 1P3MB 4QLCA 4NE3A 4H9SA 4JJNA 4EO5B 3KWQA 3UTBB 3AV2B 3WKJC 3B0CW 5B0YA 5B32C 1R4VA 3WKJB 4NE6A 5B0ZD 3TU4C 3AZJB 1P3LC 3TU4B 3AL0C 4YS3D 3MVDB 3LZ0B 5B1MD 4HGAB 5B2IA 1P34C 5JRGD 2FJ7D 5BO0B 4Z66A 5DNMD 1F66A 3MNNB 4KHAA 1P3OD 1AOIA 3KUYA 5F99D 2AROD 4QLCC 3MGRA 2NQBC 3W98D 4QLCB 3VH5T 3AZFA 5B2JC 3REJD 3KWQC 4JJNB 3KWQB 4J8XC 4WU8C 5B0YB 4R8PD 3REID 3W99D 1JFIA 3RELC 4XUJD 3UT9A 4ZUXC 3AZIA 3WA9A 2PYOA 4UUZA 2Y2PA 3B6FD 5B2IB 4Z66C 3LJAA 4WU9A 3W96D 4WV4B 4Z66B 1F66C 4WJ3C 1AOIC 4J8WC 1F66B 4KHAB 1AOIB 2CWEA 3KUYB 4XZQA 5E5AD 3MGRB 3AZGC 2HIOD 3AZFB 1U35A 4LD9C 3A6NA 1H3OA 3AFAD 1P3MD 3UTAA 3A1KA 1JFIB 1P3FA 5B31A 3UT9C 3AV2D 1P3PA 2F8NK 2IO5C 3B6GC 3UT9B 1EQZA 3AZHC 2DQNC 3AZIB 1P3BC 3WKJD 3WA9C 2PYOB 4UUZB 3AZJD 3F6TA 3TU4D 3LJAC 4WU9C 2F8NG 4ZBJB 4G91C 1P3LD 3LJAB 4WU9B 3KXBA 5AVCA 4J8VB 1BFMA 1W2EA 3MVDD 1WWIA 2Y2GA 3VH6T 4XZQB 4YS3C 2J8PA 5GT3A 5CP6C 4NE5A 5AV5C 3A6NC 1U35B 2FJ7C 3A6NB 1H3OB 2FFFB 1P3GC 3C1BB 4QLCD 5B32G 2YFVA 5DNMC 3AV1A 2NQBD 1P3FC 3AZLA 1TZYA 3UTAB 4CSRA 5B2JD 3AYWC 3X1VA 2CV5C 3AZKC 5B31B 3KWQD 1P3FB 1P3PB 1KX3A 1EQZB 3O62A 3H0LC 1ID3A 3P5JB 4E44A 4J8UA 3WAAA 5AVCC 3W99C 3B0BA 4ZUXD 4XUJC 3KXBB 4NFTA 2G5HC 5GT3C 4Z66D 3R45A 5GT3B 1F66D 5BNVA 3X1TC 1AOID 4J8WD 4DQYB 5CPKC 2F8NH 3MGRD 3FDDA 2F8NA 1TZYC 2YFVB 3AZGD 3AV1B 3AZLB 3X1VB 4CSRB 4LD9D 1HQ3A 1KX3B 5AVBA 3O62C 2DF4C 1M1AA 3O62B 3B0DC 1S32B 1ID3C 1P3MC 1KX4A 3WAAC 3UT9D 3LELA 3MGPA 1P3KA 1ID3B 3B6GD 2BYKA 4J8UB 3WAAB 4Z2MH 3AZHD 4EO5C 5AV6A 3UTBC 3AV2C 1P3BD 3WA9D 1KX5A 3LJAD 4WU9D 2LY8A 3R45B 3AZJC 5B33A 5BNVB 3NQJA 3AZMA 2F2AC 2F8NB 3MVDC 3LZ0C 4HGAC 2ZY3A 5CP6D 2ZM5A 5CPJA 3EPHA 5AV5D 3A1IA 3A6ND 4AWLC 4AWLB 4KGCA 1HQ3B 1P3GD 3MNNC 5AVBB 3UTAD 5BS7A 1M1AB 1P3FD 5B31D 3AYWD 1P3PD 3MGPC 3B0CT 2CV5D 1KU5A 3AZKD 1KX4B 3LELB 3MGPB 1P3KB 1EQZD 2BYKB 3MGSA 3MGQA 4H9SC 2RVQC 5BNXA 4JJNC 5AV6B 2BYMA 1KX5B 5BT1C 5B0YC 5CPIA 3KXBD 5AVCD 3REHA 1BH9A 5B33C 4X23A 5B33B 1M18A 5CHLB 5AV8A 3NQJB 3AZMC 3AZMB 5GT3D 1T3UA 3AZEA 3LZ1A 5B2IC 5CPJB 3X1TD 2UWXA 5CPKD 4KGCC 4J8VA 4KGCB 3AV1D 1ZLAA 3AZLD 1TZYD 5AV9A 3KUYC 4G92B 4H9PA 3W97A 3MGRC 5GT0A 1KX3D 3AZFC 3MGSB 3MGQB 5B40A 5BNXB 3O62D 2BYMB 5GSUA 1M19A 1ID3D 5FUGA 3C1BA 4J8UD 3WAAD 5CPIB 4Z5TA 3REHB 1BH9B 3UTBD 1Q9CA 4X23B 1M18C 5AV8C 3AZIC 1M18B 5AV8B 2NZDA 3AZNA 3AZEB 2PYOC 3LZ1B 2XD1A 5B1LA 4ZBJC 5KDMA 5DNNA 4J8VC 2W8SA 5AV9C 3C1CA 1ZLAB 3LZ0D 5AV9B 4H9PB 4XZQC 3W97B 5GT0B 1HQ3D 1A7WA 1P3IA 1HTAA 3VH6W 5AVBD 1U35C 5B40B 3MNND 1M1AD 1P3OA 3C1BC 3LELD 3MGPD 2AROA 5GSUB 4H9OA 1M19B 5FUGB 1TAFA 3UTAC 1F1EA 2Y2HA 4Z5TB 3W98A 4H9RA 5B31C 1P3PC 2RVQD 1P3AA 4JJND 1EQZC 5BT1D 5B0YD 2NZDB 2HUEB 3AZNB 4R8PA 4H9NA 5B1LC 1S32A 5B33D 5B1LB 5DNNC 5KDMB 5DNNB 3KXBC 3V9RA 3AZMD 3C1CC 3C1CB 5B2ID 5B1MB 3B6FA 2VQRA 3X1UA 4KGCD 3W96A 1P3IB 4WZSB 3IP4C 3KUYD 1P3OB 2L5AA 5F99B 2AROB 3AV1C 4H9OB 1N1JA 2JSSA 1TAFB 3X1VC 3MGSD 3AZLC 3AZFD 1P3AC 3W98B 4H9RB 1P3AB 1KX3C 3AFAA 5CPID 5JA4A 5AY8A 3REHD 4R8PB 3REIB 1S32C 4H9NB 4WNNA 4X23D 3VH6A 4J8UC 1M18D 5AV8D 5G49A 3AZID 3V9RB 2ZY4A 3X1SA 2RIQA 5B32A 2PYOD 3EG5B 3X1UC 1B67A 2Y2MA 3B6FB 3X1UB 1P3LA 4J8VD 4KUDA 3W96B 1ZLAD 5AV9D 5GT0D 4XZQD 1P34A 1N1JB 5B40D 2Y2IA 1U35D 2ZY2A 5C3IC 5GSUD 1HQ3C 5C3IB 5AY8C 1M19D 3AFAB 5AVBC 3C1BD 5JA4B 5AY8B 4Z5TD 1BH8A 1M1AC 2NQBA 4M6BA 1KX4C 4WNNB 5B2JA 3LELC 1P3KC 3REKA 3WTPE 5G49B 3X1SC 2NZDD 3AZND 5AV6C 4WU8A 4J8XA 2Y2NA 3X1SB 4YM6A 5B32B 1KX5C 3VH5W 5B1LD 3RELA 5DNND 4KUDC 1P3LB 4ZUXA 3C1CD 4KUDB 2YFWA
chains in the Genus database with same CATH topology
1P34B 1P3ID 1ULYA 5CPJC 5B31G 2XD5A 3WTPA 4J8WA 5BS7C 3H0RC 1BH8B 4G92C 2NQBB 3AZGA 3X1VD 3EPKA 1P3AD 3REKC 2Y2QA 3AN2A 5B2JB 5B24A 3H0MC 3REKB 3MGSC 3MGQC 4LD9A 4YM6C 4WU8B 4J8XB 4YM6B 1S32D 5CPIC 5GXQA 2Y2KA 3RELB 2Y2OA 3REHC 3B6GA 4ZUXB 3AZHA 4X23C 1P3BA 2YFWB 3KFUG 3X1UD 3AZEC 3LZ1C 3WTPC 3WTPB 5B0ZA 4J8WB 2F8ND 3VH5A 1ZLAC 2BG1A 4YS3A 3AN2C 3AZGB 5B24C 3W97C 5GT0C 5CP6A 5B1MA 5AV5A 3AN2B 5B24B 5JRGA 2FJ7A 4LD9B 5AY8D 5B40C 1P3GA 5DNMA 5GXQC 5GSUC 1M19C 1KX4D 3AYWA 5F99A 2CV5A 5GXQB 3AZKA 1P3KD 4Z5TC 2IO5B 3B6GB 3X1SD 5AV6D 3AZHB 5B32D 3REJA 1P3BB 3WA9B 1KX5D 2NZDC 2HUEC 4H9QA 3AZNC 3REIA 4KUDD 4G91B 3W99A 5B0ZC 4XUJA 2G5IC 5B0ZB 3EPLA 4CAYA 1P34D 1Z2CB 3KSYA 4YS3B 5B1MC 5CPJD 5CP6B 5JRGC 5AV5B 3X1TA 1P3IC 5JRGB 5CPKA 2FJ7B 4Z2MG 1P3GB 2Y2JA 5DNMB 1P3OC 5F99C 2AROC 3REKD 3AYWB 2CV5B 3AZKB 3W98C 5E5AA 3MGQD 4J8XD 3NQUA 3EPJA 3REJC 4WU8D 2HIOA 4YM6D 3REJB 2JCHA 3RELD 4H9QB 1P3MA 4R8PC 4E45A 3REIC 5AVCB 3W99B 4XUJB 3UTBA 4DRBA 3AV2A 1PZRA 4CAYB 3AZED 3WKJA 3LZ1D 1B6WA 3WTPD 3B6FC 1WWSA 3AZJA 2Y2LA 3TU4A 3X1TB 3W96C 5CPKB 4DRAA 2ZY5A 3MVDA 3LZ0A 1TZYB 3AN2D 3W97D 5B24D 2JE5A 5BO0A 5E5AC 5E5AB 2HIOC 3NQUB 2HIOB 3MNNA 3AFAC 5GXQD 4UPKA 3B0DB 1P3MB 4QLCA 4NE3A 4H9SA 4JJNA 4EO5B 3KWQA 3UTBB 3AV2B 3WKJC 3B0CW 5B0YA 5B32C 1R4VA 3WKJB 4NE6A 5B0ZD 3TU4C 3AZJB 1P3LC 3TU4B 3AL0C 4YS3D 3MVDB 3LZ0B 5B1MD 4HGAB 5B2IA 1P34C 5JRGD 2FJ7D 5BO0B 4Z66A 5DNMD 1F66A 3MNNB 4KHAA 1P3OD 1AOIA 3KUYA 5F99D 2AROD 4QLCC 3MGRA 2NQBC 3W98D 4QLCB 3VH5T 3AZFA 5B2JC 3REJD 3KWQC 4JJNB 3KWQB 4J8XC 4WU8C 5B0YB 4R8PD 3REID 3W99D 1JFIA 3RELC 4XUJD 3UT9A 4ZUXC 3AZIA 3WA9A 2PYOA 4UUZA 2Y2PA 3B6FD 5B2IB 4Z66C 3LJAA 4WU9A 3W96D 4WV4B 4Z66B 1F66C 4WJ3C 1AOIC 4J8WC 1F66B 4KHAB 1AOIB 2CWEA 3KUYB 4XZQA 5E5AD 3MGRB 3AZGC 2HIOD 3AZFB 1U35A 4LD9C 3A6NA 1H3OA 3AFAD 1P3MD 3UTAA 3A1KA 1JFIB 1P3FA 5B31A 3UT9C 3AV2D 1P3PA 2F8NK 2IO5C 3B6GC 3UT9B 1EQZA 3AZHC 2DQNC 3AZIB 1P3BC 3WKJD 3WA9C 2PYOB 4UUZB 3AZJD 3F6TA 3TU4D 3LJAC 4WU9C 2F8NG 4ZBJB 4G91C 1P3LD 3LJAB 4WU9B 3KXBA 5AVCA 4J8VB 1BFMA 1W2EA 3MVDD 1WWIA 2Y2GA 3VH6T 4XZQB 4YS3C 2J8PA 5GT3A 5CP6C 4NE5A 5AV5C 3A6NC 1U35B 2FJ7C 3A6NB 1H3OB 2FFFB 1P3GC 3C1BB 4QLCD 5B32G 2YFVA 5DNMC 3AV1A 2NQBD 1P3FC 3AZLA 1TZYA 3UTAB 4CSRA 5B2JD 3AYWC 3X1VA 2CV5C 3AZKC 5B31B 3KWQD 1P3FB 1P3PB 1KX3A 1EQZB 3O62A 3H0LC 1ID3A 3P5JB 4E44A 4J8UA 3WAAA 5AVCC 3W99C 3B0BA 4ZUXD 4XUJC 3KXBB 4NFTA 2G5HC 5GT3C 4Z66D 3R45A 5GT3B 1F66D 5BNVA 3X1TC 1AOID 4J8WD 4DQYB 5CPKC 2F8NH 3MGRD 3FDDA 2F8NA 1TZYC 2YFVB 3AZGD 3AV1B 3AZLB 3X1VB 4CSRB 4LD9D 1HQ3A 1KX3B 5AVBA 3O62C 2DF4C 1M1AA 3O62B 3B0DC 1S32B 1ID3C 1P3MC 1KX4A 3WAAC 3UT9D 3LELA 3MGPA 1P3KA 1ID3B 3B6GD 2BYKA 4J8UB 3WAAB 4Z2MH 3AZHD 4EO5C 5AV6A 3UTBC 3AV2C 1P3BD 3WA9D 1KX5A 3LJAD 4WU9D 2LY8A 3R45B 3AZJC 5B33A 5BNVB 3NQJA 3AZMA 2F2AC 2F8NB 3MVDC 3LZ0C 4HGAC 2ZY3A 5CP6D 2ZM5A 5CPJA 3EPHA 5AV5D 3A1IA 3A6ND 4AWLC 4AWLB 4KGCA 1HQ3B 1P3GD 3MNNC 5AVBB 3UTAD 5BS7A 1M1AB 1P3FD 5B31D 3AYWD 1P3PD 3MGPC 3B0CT 2CV5D 1KU5A 3AZKD 1KX4B 3LELB 3MGPB 1P3KB 1EQZD 2BYKB 3MGSA 3MGQA 4H9SC 2RVQC 5BNXA 4JJNC 5AV6B 2BYMA 1KX5B 5BT1C 5B0YC 5CPIA 3KXBD 5AVCD 3REHA 1BH9A 5B33C 4X23A 5B33B 1M18A 5CHLB 5AV8A 3NQJB 3AZMC 3AZMB 5GT3D 1T3UA 3AZEA 3LZ1A 5B2IC 5CPJB 3X1TD 2UWXA 5CPKD 4KGCC 4J8VA 4KGCB 3AV1D 1ZLAA 3AZLD 1TZYD 5AV9A 3KUYC 4G92B 4H9PA 3W97A 3MGRC 5GT0A 1KX3D 3AZFC 3MGSB 3MGQB 5B40A 5BNXB 3O62D 2BYMB 5GSUA 1M19A 1ID3D 5FUGA 3C1BA 4J8UD 3WAAD 5CPIB 4Z5TA 3REHB 1BH9B 3UTBD 1Q9CA 4X23B 1M18C 5AV8C 3AZIC 1M18B 5AV8B 2NZDA 3AZNA 3AZEB 2PYOC 3LZ1B 2XD1A 5B1LA 4ZBJC 5KDMA 5DNNA 4J8VC 2W8SA 5AV9C 3C1CA 1ZLAB 3LZ0D 5AV9B 4H9PB 4XZQC 3W97B 5GT0B 1HQ3D 1A7WA 1P3IA 1HTAA 3VH6W 5AVBD 1U35C 5B40B 3MNND 1M1AD 1P3OA 3C1BC 3LELD 3MGPD 2AROA 5GSUB 4H9OA 1M19B 5FUGB 1TAFA 3UTAC 1F1EA 2Y2HA 4Z5TB 3W98A 4H9RA 5B31C 1P3PC 2RVQD 1P3AA 4JJND 1EQZC 5BT1D 5B0YD 2NZDB 2HUEB 3AZNB 4R8PA 4H9NA 5B1LC 1S32A 5B33D 5B1LB 5DNNC 5KDMB 5DNNB 3KXBC 3V9RA 3AZMD 3C1CC 3C1CB 5B2ID 5B1MB 3B6FA 2VQRA 3X1UA 4KGCD 3W96A 1P3IB 4WZSB 3IP4C 3KUYD 1P3OB 2L5AA 5F99B 2AROB 3AV1C 4H9OB 1N1JA 2JSSA 1TAFB 3X1VC 3MGSD 3AZLC 3AZFD 1P3AC 3W98B 4H9RB 1P3AB 1KX3C 3AFAA 5CPID 5JA4A 5AY8A 3REHD 4R8PB 3REIB 1S32C 4H9NB 4WNNA 4X23D 3VH6A 4J8UC 1M18D 5AV8D 5G49A 3AZID 3V9RB 2ZY4A 3X1SA 2RIQA 5B32A 2PYOD 3EG5B 3X1UC 1B67A 2Y2MA 3B6FB 3X1UB 1P3LA 4J8VD 4KUDA 3W96B 1ZLAD 5AV9D 5GT0D 4XZQD 1P34A 1N1JB 5B40D 2Y2IA 1U35D 2ZY2A 5C3IC 5GSUD 1HQ3C 5C3IB 5AY8C 1M19D 3AFAB 5AVBC 3C1BD 5JA4B 5AY8B 4Z5TD 1BH8A 1M1AC 2NQBA 4M6BA 1KX4C 4WNNB 5B2JA 3LELC 1P3KC 3REKA 3WTPE 5G49B 3X1SC 2NZDD 3AZND 5AV6C 4WU8A 4J8XA 2Y2NA 3X1SB 4YM6A 5B32B 1KX5C 3VH5W 5B1LD 3RELA 5DNND 4KUDC 1P3LB 4ZUXA 3C1CD 4KUDB 2YFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 B;  1P3I D;  1ULY A;  5CPJ C;  5B31 G;  3WTP A;  4J8W A;  5BS7 C;  1BH8 B;  4G92 C;  2NQB B;  3AZG A;  3X1V D;  1P3A D;  3REK C;  3AN2 A;  5B2J B;  5B24 A;  3REK B;  3MGS C;  3MGQ C;  4LD9 A;  4YM6 C;  4WU8 B;  4J8X B;  4YM6 B;  1S32 D;  5CPI C;  5GXQ A;  3REL B;  3REH C;  3B6G A;  4ZUX B;  3AZH A;  4X23 C;  1P3B A;  2YFW B;  3X1U D;  3AZE C;  3LZ1 C;  3WTP C;  3WTP B;  5B0Z A;  4J8W B;  2F8N D;  3VH5 A;  1ZLA C;  4YS3 A;  3AN2 C;  3AZG B;  5B24 C;  3W97 C;  5GT0 C;  5CP6 A;  5B1M A;  5AV5 A;  3AN2 B;  5B24 B;  5JRG A;  2FJ7 A;  4LD9 B;  5AY8 D;  5B40 C;  1P3G A;  5DNM A;  5GXQ C;  5GSU C;  1M19 C;  1KX4 D;  3AYW A;  5F99 A;  2CV5 A;  5GXQ B;  3AZK A;  1P3K D;  4Z5T C;  2IO5 B;  3B6G B;  3X1S D;  5AV6 D;  3AZH B;  5B32 D;  3REJ A;  1P3B B;  3WA9 B;  1KX5 D;  2NZD C;  2HUE C;  4H9Q A;  3AZN C;  3REI A;  4KUD D;  4G91 B;  3W99 A;  5B0Z C;  4XUJ A;  5B0Z B;  4CAY A;  1P34 D;  3KSY A;  4YS3 B;  5B1M C;  5CPJ D;  5CP6 B;  5JRG C;  5AV5 B;  3X1T A;  1P3I C;  5JRG B;  5CPK A;  2FJ7 B;  4Z2M G;  1P3G B;  1P3O C;  5DNM B;  5F99 C;  2ARO C;  3REK D;  3AYW B;  2CV5 B;  3AZK B;  3W98 C;  5E5A A;  3MGQ D;  4J8X D;  3NQU A;  4WU8 D;  3REJ C;  2HIO A;  4YM6 D;  3REJ B;  3REL D;  4H9Q B;  1P3M A;  4R8P C;  4E45 A;  3REI C;  5AVC B;  3W99 B;  4XUJ B;  3UTB A;  4DRB A;  3AV2 A;  4CAY B;  3AZE D;  3WKJ A;  3LZ1 D;  1B6W A;  3WTP D;  3B6F C;  1WWS A;  3AZJ A;  3TU4 A;  3X1T B;  3W96 C;  5CPK B;  4DRA A;  3MVD A;  3LZ0 A;  1TZY B;  3AN2 D;  3W97 D;  5B24 D;  5BO0 A;  5E5A C;  5E5A B;  2HIO C;  3NQU B;  2HIO B;  3MNN A;  3AFA C;  5GXQ D;  3B0D B;  1P3M B;  4QLC A;  4NE3 A;  4H9S A;  4JJN A;  4EO5 B;  3KWQ A;  3UTB B;  3AV2 B;  3WKJ C;  3B0C W;  5B0Y A;  5B32 C;  1R4V A;  3WKJ B;  4NE6 A;  5B0Z D;  3TU4 C;  3AZJ B;  1P3L C;  3TU4 B;  4YS3 D;  3MVD B;  3LZ0 B;  5B1M D;  4HGA B;  5B2I A;  1P34 C;  5JRG D;  2FJ7 D;  5BO0 B;  4Z66 A;  5DNM D;  1F66 A;  3MNN B;  4KHA A;  1P3O D;  1AOI A;  3KUY A;  5F99 D;  2ARO D;  4QLC C;  3MGR A;  2NQB C;  3W98 D;  4QLC B;  3VH5 T;  3AZF A;  5B2J C;  3REJ D;  3KWQ C;  4JJN B;  3KWQ B;  4J8X C;  4WU8 C;  5B0Y B;  4R8P D;  3REI D;  3W99 D;  1JFI A;  3REL C;  4XUJ D;  3UT9 A;  4ZUX C;  3AZI A;  3WA9 A;  2PYO A;  4UUZ A;  3B6F D;  5B2I B;  4Z66 C;  3LJA A;  4WU9 A;  3W96 D;  4WV4 B;  4Z66 B;  1F66 C;  1AOI C;  4J8W C;  1F66 B;  4KHA B;  1AOI B;  2CWE A;  3KUY B;  4XZQ A;  5E5A D;  3MGR B;  3AZG C;  2HIO D;  3AZF B;  1U35 A;  4LD9 C;  3A6N A;  1H3O A;  3AFA D;  1P3M D;  3UTA A;  1JFI B;  1P3F A;  5B31 A;  3UT9 C;  3AV2 D;  1P3P A;  2F8N K;  2IO5 C;  3B6G C;  3UT9 B;  1EQZ A;  3AZH C;  3AZI B;  1P3B C;  3WKJ D;  3WA9 C;  2PYO B;  4UUZ B;  3AZJ D;  3TU4 D;  3LJA C;  4WU9 C;  2F8N G;  4ZBJ B;  4G91 C;  1P3L D;  3LJA B;  4WU9 B;  3KXB A;  5AVC A;  4J8V B;  1BFM A;  3MVD D;  1WWI A;  3VH6 T;  4XZQ B;  4YS3 C;  5GT3 A;  5CP6 C;  4NE5 A;  5AV5 C;  3A6N C;  1U35 B;  2FJ7 C;  3A6N B;  1H3O B;  1P3G C;  3C1B B;  4QLC D;  5B32 G;  2YFV A;  5DNM C;  3AV1 A;  2NQB D;  1P3F C;  3AZL A;  1TZY A;  3UTA B;  4CSR A;  5B2J D;  3AYW C;  3X1V A;  2CV5 C;  3AZK C;  5B31 B;  3KWQ D;  1P3F B;  1P3P B;  1KX3 A;  1EQZ B;  3O62 A;  1ID3 A;  4E44 A;  4J8U A;  3WAA A;  5AVC C;  3W99 C;  3B0B A;  4ZUX D;  4XUJ C;  3KXB B;  4NFT A;  5GT3 C;  4Z66 D;  3R45 A;  5GT3 B;  1F66 D;  5BNV A;  3X1T C;  1AOI D;  4J8W D;  5CPK C;  2F8N H;  3MGR D;  2F8N A;  1TZY C;  2YFV B;  3AZG D;  3AV1 B;  3AZL B;  3X1V B;  4CSR B;  4LD9 D;  1HQ3 A;  1KX3 B;  5AVB A;  3O62 C;  1M1A A;  3O62 B;  3B0D C;  1S32 B;  1ID3 C;  1P3M C;  1KX4 A;  3WAA C;  3UT9 D;  3LEL A;  3MGP A;  1P3K A;  1ID3 B;  3B6G D;  2BYK A;  4J8U B;  3WAA B;  4Z2M H;  3AZH D;  4EO5 C;  5AV6 A;  3UTB C;  3AV2 C;  1P3B D;  3WA9 D;  1KX5 A;  3LJA D;  4WU9 D;  2LY8 A;  3R45 B;  3AZJ C;  5B33 A;  5BNV B;  3NQJ A;  3AZM A;  2F8N B;  3MVD C;  3LZ0 C;  4HGA C;  5CP6 D;  5CPJ A;  5AV5 D;  3A6N D;  4AWL C;  4AWL B;  4KGC A;  1HQ3 B;  1P3G D;  3MNN C;  5AVB B;  3UTA D;  5BS7 A;  1M1A B;  1P3F D;  5B31 D;  3AYW D;  1P3P D;  3MGP C;  3B0C T;  2CV5 D;  1KU5 A;  3AZK D;  1KX4 B;  3LEL B;  3MGP B;  1P3K B;  1EQZ D;  2BYK B;  3MGS A;  3MGQ A;  4H9S C;  2RVQ C;  5BNX A;  4JJN C;  5AV6 B;  2BYM A;  1KX5 B;  5BT1 C;  5B0Y C;  5CPI A;  3KXB D;  5AVC D;  3REH A;  1BH9 A;  5B33 C;  4X23 A;  5B33 B;  1M18 A;  5CHL B;  5AV8 A;  3NQJ B;  3AZM C;  3AZM B;  5GT3 D;  3AZE A;  3LZ1 A;  5B2I C;  5CPJ B;  3X1T D;  5CPK D;  4KGC C;  4J8V A;  4KGC B;  3AV1 D;  1ZLA A;  3AZL D;  1TZY D;  5AV9 A;  3KUY C;  4G92 B;  4H9P A;  3W97 A;  3MGR C;  5GT0 A;  1KX3 D;  3AZF C;  3MGS B;  3MGQ B;  5B40 A;  5BNX B;  3O62 D;  2BYM B;  5GSU A;  1M19 A;  1ID3 D;  5FUG A;  3C1B A;  4J8U D;  3WAA D;  5CPI B;  4Z5T A;  3REH B;  1BH9 B;  3UTB D;  1Q9C A;  4X23 B;  1M18 C;  5AV8 C;  3AZI C;  1M18 B;  5AV8 B;  2NZD A;  3AZN A;  3AZE B;  2PYO C;  3LZ1 B;  5B1L A;  4ZBJ C;  5KDM A;  5DNN A;  4J8V C;  5AV9 C;  3C1C A;  1ZLA B;  3LZ0 D;  5AV9 B;  4H9P B;  4XZQ C;  3W97 B;  5GT0 B;  1HQ3 D;  1A7W A;  1P3I A;  1HTA A;  3VH6 W;  5AVB D;  1U35 C;  5B40 B;  3MNN D;  1M1A D;  1P3O A;  3C1B C;  3LEL D;  3MGP D;  2ARO A;  5GSU B;  4H9O A;  1M19 B;  5FUG B;  1TAF A;  3UTA C;  1F1E A;  3W98 A;  4Z5T B;  4H9R A;  5B31 C;  1P3P C;  2RVQ D;  1P3A A;  4JJN D;  1EQZ C;  5BT1 D;  5B0Y D;  2NZD B;  2HUE B;  3AZN B;  4R8P A;  4H9N A;  5B1L C;  1S32 A;  5B33 D;  5B1L B;  5DNN C;  5KDM B;  5DNN B;  3KXB C;  3V9R A;  3AZM D;  3C1C C;  3C1C B;  5B2I D;  5B1M B;  3B6F A;  3X1U A;  4KGC D;  3W96 A;  1P3I B;  4WZS B;  3KUY D;  1P3O B;  2L5A A;  5F99 B;  2ARO B;  3AV1 C;  4H9O B;  1N1J A;  2JSS A;  1TAF B;  3X1V C;  3MGS D;  3AZL C;  3AZF D;  1P3A C;  3W98 B;  4H9R B;  1P3A B;  1KX3 C;  3AFA A;  5CPI D;  5JA4 A;  5AY8 A;  3REH D;  4R8P B;  3REI B;  1S32 C;  4H9N B;  4WNN A;  4X23 D;  3VH6 A;  4J8U C;  1M18 D;  5AV8 D;  5G49 A;  3AZI D;  3V9R B;  3X1S A;  5B32 A;  2PYO D;  3X1U C;  1B67 A;  3B6F B;  3X1U B;  1P3L A;  4J8V D;  4KUD A;  3W96 B;  1ZLA D;  5AV9 D;  5GT0 D;  4XZQ D;  1P34 A;  1N1J B;  5B40 D;  1U35 D;  5C3I C;  5GSU D;  1HQ3 C;  5C3I B;  5AY8 C;  1M19 D;  3AFA B;  5AVB C;  3C1B D;  5JA4 B;  5AY8 B;  4Z5T D;  1BH8 A;  1M1A C;  2NQB A;  4M6B A;  1KX4 C;  4WNN B;  5B2J A;  3LEL C;  1P3K C;  3REK A;  3WTP E;  5G49 B;  3X1S C;  2NZD D;  3AZN D;  5AV6 C;  4WU8 A;  4J8X A;  3X1S B;  4YM6 A;  5B32 B;  1KX5 C;  3VH5 W;  5B1L D;  3REL A;  5DNN D;  4KUD C;  1P3L B;  4ZUX A;  3C1C D;  4KUD B;  2YFW A; 
#chains in the Genus database with same CATH topology
 1P34 B;  1P3I D;  1ULY A;  5CPJ C;  5B31 G;  2XD5 A;  3WTP A;  4J8W A;  5BS7 C;  3H0R C;  1BH8 B;  4G92 C;  2NQB B;  3AZG A;  3X1V D;  3EPK A;  1P3A D;  3REK C;  2Y2Q A;  3AN2 A;  5B2J B;  5B24 A;  3H0M C;  3REK B;  3MGS C;  3MGQ C;  4LD9 A;  4YM6 C;  4WU8 B;  4J8X B;  4YM6 B;  1S32 D;  5CPI C;  5GXQ A;  2Y2K A;  3REL B;  2Y2O A;  3REH C;  3B6G A;  4ZUX B;  3AZH A;  4X23 C;  1P3B A;  2YFW B;  3KFU G;  3X1U D;  3AZE C;  3LZ1 C;  3WTP C;  3WTP B;  5B0Z A;  4J8W B;  2F8N D;  3VH5 A;  1ZLA C;  2BG1 A;  4YS3 A;  3AN2 C;  3AZG B;  5B24 C;  3W97 C;  5GT0 C;  5CP6 A;  5B1M A;  5AV5 A;  3AN2 B;  5B24 B;  5JRG A;  2FJ7 A;  4LD9 B;  5AY8 D;  5B40 C;  1P3G A;  5DNM A;  5GXQ C;  5GSU C;  1M19 C;  1KX4 D;  3AYW A;  5F99 A;  2CV5 A;  5GXQ B;  3AZK A;  1P3K D;  4Z5T C;  2IO5 B;  3B6G B;  3X1S D;  5AV6 D;  3AZH B;  5B32 D;  3REJ A;  1P3B B;  3WA9 B;  1KX5 D;  2NZD C;  2HUE C;  4H9Q A;  3AZN C;  3REI A;  4KUD D;  4G91 B;  3W99 A;  5B0Z C;  4XUJ A;  2G5I C;  5B0Z B;  3EPL A;  4CAY A;  1P34 D;  1Z2C B;  3KSY A;  4YS3 B;  5B1M C;  5CPJ D;  5CP6 B;  5JRG C;  5AV5 B;  3X1T A;  1P3I C;  5JRG B;  5CPK A;  2FJ7 B;  4Z2M G;  1P3G B;  2Y2J A;  5DNM B;  1P3O C;  5F99 C;  2ARO C;  3REK D;  3AYW B;  2CV5 B;  3AZK B;  3W98 C;  5E5A A;  3MGQ D;  4J8X D;  3NQU A;  3EPJ A;  3REJ C;  4WU8 D;  2HIO A;  4YM6 D;  3REJ B;  2JCH A;  3REL D;  4H9Q B;  1P3M A;  4R8P C;  4E45 A;  3REI C;  5AVC B;  3W99 B;  4XUJ B;  3UTB A;  4DRB A;  3AV2 A;  1PZR A;  4CAY B;  3AZE D;  3WKJ A;  3LZ1 D;  1B6W A;  3WTP D;  3B6F C;  1WWS A;  3AZJ A;  2Y2L A;  3TU4 A;  3X1T B;  3W96 C;  5CPK B;  4DRA A;  2ZY5 A;  3MVD A;  3LZ0 A;  1TZY B;  3AN2 D;  3W97 D;  5B24 D;  2JE5 A;  5BO0 A;  5E5A C;  5E5A B;  2HIO C;  3NQU B;  2HIO B;  3MNN A;  3AFA C;  5GXQ D;  4UPK A;  3B0D B;  1P3M B;  4QLC A;  4NE3 A;  4H9S A;  4JJN A;  4EO5 B;  3KWQ A;  3UTB B;  3AV2 B;  3WKJ C;  3B0C W;  5B0Y A;  5B32 C;  1R4V A;  3WKJ B;  4NE6 A;  5B0Z D;  3TU4 C;  3AZJ B;  1P3L C;  3TU4 B;  3AL0 C;  4YS3 D;  3MVD B;  3LZ0 B;  5B1M D;  4HGA B;  5B2I A;  1P34 C;  5JRG D;  2FJ7 D;  5BO0 B;  4Z66 A;  5DNM D;  1F66 A;  3MNN B;  4KHA A;  1P3O D;  1AOI A;  3KUY A;  5F99 D;  2ARO D;  4QLC C;  3MGR A;  2NQB C;  3W98 D;  4QLC B;  3VH5 T;  3AZF A;  5B2J C;  3REJ D;  3KWQ C;  4JJN B;  3KWQ B;  4J8X C;  4WU8 C;  5B0Y B;  4R8P D;  3REI D;  3W99 D;  1JFI A;  3REL C;  4XUJ D;  3UT9 A;  4ZUX C;  3AZI A;  3WA9 A;  2PYO A;  4UUZ A;  2Y2P A;  3B6F D;  5B2I B;  4Z66 C;  3LJA A;  4WU9 A;  3W96 D;  4WV4 B;  4Z66 B;  1F66 C;  4WJ3 C;  1AOI C;  4J8W C;  1F66 B;  4KHA B;  1AOI B;  2CWE A;  3KUY B;  4XZQ A;  5E5A D;  3MGR B;  3AZG C;  2HIO D;  3AZF B;  1U35 A;  4LD9 C;  3A6N A;  1H3O A;  3AFA D;  1P3M D;  3UTA A;  3A1K A;  1JFI B;  1P3F A;  5B31 A;  3UT9 C;  3AV2 D;  1P3P A;  2F8N K;  2IO5 C;  3B6G C;  3UT9 B;  1EQZ A;  3AZH C;  2DQN C;  3AZI B;  1P3B C;  3WKJ D;  3WA9 C;  2PYO B;  4UUZ B;  3AZJ D;  3F6T A;  3TU4 D;  3LJA C;  4WU9 C;  2F8N G;  4ZBJ B;  4G91 C;  1P3L D;  3LJA B;  4WU9 B;  3KXB A;  5AVC A;  4J8V B;  1BFM A;  1W2E A;  3MVD D;  1WWI A;  2Y2G A;  3VH6 T;  4XZQ B;  4YS3 C;  2J8P A;  5GT3 A;  5CP6 C;  4NE5 A;  5AV5 C;  3A6N C;  1U35 B;  2FJ7 C;  3A6N B;  1H3O B;  2FFF B;  1P3G C;  3C1B B;  4QLC D;  5B32 G;  2YFV A;  5DNM C;  3AV1 A;  2NQB D;  1P3F C;  3AZL A;  1TZY A;  3UTA B;  4CSR A;  5B2J D;  3AYW C;  3X1V A;  2CV5 C;  3AZK C;  5B31 B;  3KWQ D;  1P3F B;  1P3P B;  1KX3 A;  1EQZ B;  3O62 A;  3H0L C;  1ID3 A;  3P5J B;  4E44 A;  4J8U A;  3WAA A;  5AVC C;  3W99 C;  3B0B A;  4ZUX D;  4XUJ C;  3KXB B;  4NFT A;  2G5H C;  5GT3 C;  4Z66 D;  3R45 A;  5GT3 B;  1F66 D;  5BNV A;  3X1T C;  1AOI D;  4J8W D;  4DQY B;  5CPK C;  2F8N H;  3MGR D;  3FDD A;  2F8N A;  1TZY C;  2YFV B;  3AZG D;  3AV1 B;  3AZL B;  3X1V B;  4CSR B;  4LD9 D;  1HQ3 A;  1KX3 B;  5AVB A;  3O62 C;  2DF4 C;  1M1A A;  3O62 B;  3B0D C;  1S32 B;  1ID3 C;  1P3M C;  1KX4 A;  3WAA C;  3UT9 D;  3LEL A;  3MGP A;  1P3K A;  1ID3 B;  3B6G D;  2BYK A;  4J8U B;  3WAA B;  4Z2M H;  3AZH D;  4EO5 C;  5AV6 A;  3UTB C;  3AV2 C;  1P3B D;  3WA9 D;  1KX5 A;  3LJA D;  4WU9 D;  2LY8 A;  3R45 B;  3AZJ C;  5B33 A;  5BNV B;  3NQJ A;  3AZM A;  2F2A C;  2F8N B;  3MVD C;  3LZ0 C;  4HGA C;  2ZY3 A;  5CP6 D;  2ZM5 A;  5CPJ A;  3EPH A;  5AV5 D;  3A1I A;  3A6N D;  4AWL C;  4AWL B;  4KGC A;  1HQ3 B;  1P3G D;  3MNN C;  5AVB B;  3UTA D;  5BS7 A;  1M1A B;  1P3F D;  5B31 D;  3AYW D;  1P3P D;  3MGP C;  3B0C T;  2CV5 D;  1KU5 A;  3AZK D;  1KX4 B;  3LEL B;  3MGP B;  1P3K B;  1EQZ D;  2BYK B;  3MGS A;  3MGQ A;  4H9S C;  2RVQ C;  5BNX A;  4JJN C;  5AV6 B;  2BYM A;  1KX5 B;  5BT1 C;  5B0Y C;  5CPI A;  3KXB D;  5AVC D;  3REH A;  1BH9 A;  5B33 C;  4X23 A;  5B33 B;  1M18 A;  5CHL B;  5AV8 A;  3NQJ B;  3AZM C;  3AZM B;  5GT3 D;  1T3U A;  3AZE A;  3LZ1 A;  5B2I C;  5CPJ B;  3X1T D;  2UWX A;  5CPK D;  4KGC C;  4J8V A;  4KGC B;  3AV1 D;  1ZLA A;  3AZL D;  1TZY D;  5AV9 A;  3KUY C;  4G92 B;  4H9P A;  3W97 A;  3MGR C;  5GT0 A;  1KX3 D;  3AZF C;  3MGS B;  3MGQ B;  5B40 A;  5BNX B;  3O62 D;  2BYM B;  5GSU A;  1M19 A;  1ID3 D;  5FUG A;  3C1B A;  4J8U D;  3WAA D;  5CPI B;  4Z5T A;  3REH B;  1BH9 B;  3UTB D;  1Q9C A;  4X23 B;  1M18 C;  5AV8 C;  3AZI C;  1M18 B;  5AV8 B;  2NZD A;  3AZN A;  3AZE B;  2PYO C;  3LZ1 B;  2XD1 A;  5B1L A;  4ZBJ C;  5KDM A;  5DNN A;  4J8V C;  2W8S A;  5AV9 C;  3C1C A;  1ZLA B;  3LZ0 D;  5AV9 B;  4H9P B;  4XZQ C;  3W97 B;  5GT0 B;  1HQ3 D;  1A7W A;  1P3I A;  1HTA A;  3VH6 W;  5AVB D;  1U35 C;  5B40 B;  3MNN D;  1M1A D;  1P3O A;  3C1B C;  3LEL D;  3MGP D;  2ARO A;  5GSU B;  4H9O A;  1M19 B;  5FUG B;  1TAF A;  3UTA C;  1F1E A;  2Y2H A;  4Z5T B;  3W98 A;  4H9R A;  5B31 C;  1P3P C;  2RVQ D;  1P3A A;  4JJN D;  1EQZ C;  5BT1 D;  5B0Y D;  2NZD B;  2HUE B;  3AZN B;  4R8P A;  4H9N A;  5B1L C;  1S32 A;  5B33 D;  5B1L B;  5DNN C;  5KDM B;  5DNN B;  3KXB C;  3V9R A;  3AZM D;  3C1C C;  3C1C B;  5B2I D;  5B1M B;  3B6F A;  2VQR A;  3X1U A;  4KGC D;  3W96 A;  1P3I B;  4WZS B;  3IP4 C;  3KUY D;  1P3O B;  2L5A A;  5F99 B;  2ARO B;  3AV1 C;  4H9O B;  1N1J A;  2JSS A;  1TAF B;  3X1V C;  3MGS D;  3AZL C;  3AZF D;  1P3A C;  3W98 B;  4H9R B;  1P3A B;  1KX3 C;  3AFA A;  5CPI D;  5JA4 A;  5AY8 A;  3REH D;  4R8P B;  3REI B;  1S32 C;  4H9N B;  4WNN A;  4X23 D;  3VH6 A;  4J8U C;  1M18 D;  5AV8 D;  5G49 A;  3AZI D;  3V9R B;  2ZY4 A;  3X1S A;  2RIQ A;  5B32 A;  2PYO D;  3EG5 B;  3X1U C;  1B67 A;  2Y2M A;  3B6F B;  3X1U B;  1P3L A;  4J8V D;  4KUD A;  3W96 B;  1ZLA D;  5AV9 D;  5GT0 D;  4XZQ D;  1P34 A;  1N1J B;  5B40 D;  2Y2I A;  1U35 D;  2ZY2 A;  5C3I C;  5GSU D;  1HQ3 C;  5C3I B;  5AY8 C;  1M19 D;  3AFA B;  5AVB C;  3C1B D;  5JA4 B;  5AY8 B;  4Z5T D;  1BH8 A;  1M1A C;  2NQB A;  4M6B A;  1KX4 C;  4WNN B;  5B2J A;  3LEL C;  1P3K C;  3REK A;  3WTP E;  5G49 B;  3X1S C;  2NZD D;  3AZN D;  5AV6 C;  4WU8 A;  4J8X A;  2Y2N A;  3X1S B;  4YM6 A;  5B32 B;  1KX5 C;  3VH5 W;  5B1L D;  3REL A;  5DNN D;  4KUD C;  1P3L B;  4ZUX A;  3C1C D;  4KUD B;  2YFW A; 
#chains in the Genus database with same CATH homology
 1P34 B;  1P3I D;  1ULY A;  5CPJ C;  5B31 G;  2XD5 A;  3WTP A;  4J8W A;  5BS7 C;  3H0R C;  1BH8 B;  4G92 C;  2NQB B;  3AZG A;  3X1V D;  3EPK A;  1P3A D;  3REK C;  2Y2Q A;  3AN2 A;  5B2J B;  5B24 A;  3H0M C;  3REK B;  3MGS C;  3MGQ C;  4LD9 A;  4YM6 C;  4WU8 B;  4J8X B;  4YM6 B;  1S32 D;  5CPI C;  5GXQ A;  2Y2K A;  3REL B;  2Y2O A;  3REH C;  3B6G A;  4ZUX B;  3AZH A;  4X23 C;  1P3B A;  2YFW B;  3KFU G;  3X1U D;  3AZE C;  3LZ1 C;  3WTP C;  3WTP B;  5B0Z A;  4J8W B;  2F8N D;  3VH5 A;  1ZLA C;  2BG1 A;  4YS3 A;  3AN2 C;  3AZG B;  5B24 C;  3W97 C;  5GT0 C;  5CP6 A;  5B1M A;  5AV5 A;  3AN2 B;  5B24 B;  5JRG A;  2FJ7 A;  4LD9 B;  5AY8 D;  5B40 C;  1P3G A;  5DNM A;  5GXQ C;  5GSU C;  1M19 C;  1KX4 D;  3AYW A;  5F99 A;  2CV5 A;  5GXQ B;  3AZK A;  1P3K D;  4Z5T C;  2IO5 B;  3B6G B;  3X1S D;  5AV6 D;  3AZH B;  5B32 D;  3REJ A;  1P3B B;  3WA9 B;  1KX5 D;  2NZD C;  2HUE C;  4H9Q A;  3AZN C;  3REI A;  4KUD D;  4G91 B;  3W99 A;  5B0Z C;  4XUJ A;  2G5I C;  5B0Z B;  3EPL A;  4CAY A;  1P34 D;  1Z2C B;  3KSY A;  4YS3 B;  5B1M C;  5CPJ D;  5CP6 B;  5JRG C;  5AV5 B;  3X1T A;  1P3I C;  5JRG B;  5CPK A;  2FJ7 B;  4Z2M G;  1P3G B;  2Y2J A;  5DNM B;  1P3O C;  5F99 C;  2ARO C;  3REK D;  3AYW B;  2CV5 B;  3AZK B;  3W98 C;  5E5A A;  3MGQ D;  4J8X D;  3NQU A;  3EPJ A;  3REJ C;  4WU8 D;  2HIO A;  4YM6 D;  3REJ B;  2JCH A;  3REL D;  4H9Q B;  1P3M A;  4R8P C;  4E45 A;  3REI C;  5AVC B;  3W99 B;  4XUJ B;  3UTB A;  4DRB A;  3AV2 A;  1PZR A;  4CAY B;  3AZE D;  3WKJ A;  3LZ1 D;  1B6W A;  3WTP D;  3B6F C;  1WWS A;  3AZJ A;  2Y2L A;  3TU4 A;  3X1T B;  3W96 C;  5CPK B;  4DRA A;  2ZY5 A;  3MVD A;  3LZ0 A;  1TZY B;  3AN2 D;  3W97 D;  5B24 D;  2JE5 A;  5BO0 A;  5E5A C;  5E5A B;  2HIO C;  3NQU B;  2HIO B;  3MNN A;  3AFA C;  5GXQ D;  4UPK A;  3B0D B;  1P3M B;  4QLC A;  4NE3 A;  4H9S A;  4JJN A;  4EO5 B;  3KWQ A;  3UTB B;  3AV2 B;  3WKJ C;  3B0C W;  5B0Y A;  5B32 C;  1R4V A;  3WKJ B;  4NE6 A;  5B0Z D;  3TU4 C;  3AZJ B;  1P3L C;  3TU4 B;  3AL0 C;  4YS3 D;  3MVD B;  3LZ0 B;  5B1M D;  4HGA B;  5B2I A;  1P34 C;  5JRG D;  2FJ7 D;  5BO0 B;  4Z66 A;  5DNM D;  1F66 A;  3MNN B;  4KHA A;  1P3O D;  1AOI A;  3KUY A;  5F99 D;  2ARO D;  4QLC C;  3MGR A;  2NQB C;  3W98 D;  4QLC B;  3VH5 T;  3AZF A;  5B2J C;  3REJ D;  3KWQ C;  4JJN B;  3KWQ B;  4J8X C;  4WU8 C;  5B0Y B;  4R8P D;  3REI D;  3W99 D;  1JFI A;  3REL C;  4XUJ D;  3UT9 A;  4ZUX C;  3AZI A;  3WA9 A;  2PYO A;  4UUZ A;  2Y2P A;  3B6F D;  5B2I B;  4Z66 C;  3LJA A;  4WU9 A;  3W96 D;  4WV4 B;  4Z66 B;  1F66 C;  4WJ3 C;  1AOI C;  4J8W C;  1F66 B;  4KHA B;  1AOI B;  2CWE A;  3KUY B;  4XZQ A;  5E5A D;  3MGR B;  3AZG C;  2HIO D;  3AZF B;  1U35 A;  4LD9 C;  3A6N A;  1H3O A;  3AFA D;  1P3M D;  3UTA A;  3A1K A;  1JFI B;  1P3F A;  5B31 A;  3UT9 C;  3AV2 D;  1P3P A;  2F8N K;  2IO5 C;  3B6G C;  3UT9 B;  1EQZ A;  3AZH C;  2DQN C;  3AZI B;  1P3B C;  3WKJ D;  3WA9 C;  2PYO B;  4UUZ B;  3AZJ D;  3F6T A;  3TU4 D;  3LJA C;  4WU9 C;  2F8N G;  4ZBJ B;  4G91 C;  1P3L D;  3LJA B;  4WU9 B;  3KXB A;  5AVC A;  4J8V B;  1BFM A;  1W2E A;  3MVD D;  1WWI A;  2Y2G A;  3VH6 T;  4XZQ B;  4YS3 C;  2J8P A;  5GT3 A;  5CP6 C;  4NE5 A;  5AV5 C;  3A6N C;  1U35 B;  2FJ7 C;  3A6N B;  1H3O B;  2FFF B;  1P3G C;  3C1B B;  4QLC D;  5B32 G;  2YFV A;  5DNM C;  3AV1 A;  2NQB D;  1P3F C;  3AZL A;  1TZY A;  3UTA B;  4CSR A;  5B2J D;  3AYW C;  3X1V A;  2CV5 C;  3AZK C;  5B31 B;  3KWQ D;  1P3F B;  1P3P B;  1KX3 A;  1EQZ B;  3O62 A;  3H0L C;  1ID3 A;  3P5J B;  4E44 A;  4J8U A;  3WAA A;  5AVC C;  3W99 C;  3B0B A;  4ZUX D;  4XUJ C;  3KXB B;  4NFT A;  2G5H C;  5GT3 C;  4Z66 D;  3R45 A;  5GT3 B;  1F66 D;  5BNV A;  3X1T C;  1AOI D;  4J8W D;  4DQY B;  5CPK C;  2F8N H;  3MGR D;  3FDD A;  2F8N A;  1TZY C;  2YFV B;  3AZG D;  3AV1 B;  3AZL B;  3X1V B;  4CSR B;  4LD9 D;  1HQ3 A;  1KX3 B;  5AVB A;  3O62 C;  2DF4 C;  1M1A A;  3O62 B;  3B0D C;  1S32 B;  1ID3 C;  1P3M C;  1KX4 A;  3WAA C;  3UT9 D;  3LEL A;  3MGP A;  1P3K A;  1ID3 B;  3B6G D;  2BYK A;  4J8U B;  3WAA B;  4Z2M H;  3AZH D;  4EO5 C;  5AV6 A;  3UTB C;  3AV2 C;  1P3B D;  3WA9 D;  1KX5 A;  3LJA D;  4WU9 D;  2LY8 A;  3R45 B;  3AZJ C;  5B33 A;  5BNV B;  3NQJ A;  3AZM A;  2F2A C;  2F8N B;  3MVD C;  3LZ0 C;  4HGA C;  2ZY3 A;  5CP6 D;  2ZM5 A;  5CPJ A;  3EPH A;  5AV5 D;  3A1I A;  3A6N D;  4AWL C;  4AWL B;  4KGC A;  1HQ3 B;  1P3G D;  3MNN C;  5AVB B;  3UTA D;  5BS7 A;  1M1A B;  1P3F D;  5B31 D;  3AYW D;  1P3P D;  3MGP C;  3B0C T;  2CV5 D;  1KU5 A;  3AZK D;  1KX4 B;  3LEL B;  3MGP B;  1P3K B;  1EQZ D;  2BYK B;  3MGS A;  3MGQ A;  4H9S C;  2RVQ C;  5BNX A;  4JJN C;  5AV6 B;  2BYM A;  1KX5 B;  5BT1 C;  5B0Y C;  5CPI A;  3KXB D;  5AVC D;  3REH A;  1BH9 A;  5B33 C;  4X23 A;  5B33 B;  1M18 A;  5CHL B;  5AV8 A;  3NQJ B;  3AZM C;  3AZM B;  5GT3 D;  1T3U A;  3AZE A;  3LZ1 A;  5B2I C;  5CPJ B;  3X1T D;  2UWX A;  5CPK D;  4KGC C;  4J8V A;  4KGC B;  3AV1 D;  1ZLA A;  3AZL D;  1TZY D;  5AV9 A;  3KUY C;  4G92 B;  4H9P A;  3W97 A;  3MGR C;  5GT0 A;  1KX3 D;  3AZF C;  3MGS B;  3MGQ B;  5B40 A;  5BNX B;  3O62 D;  2BYM B;  5GSU A;  1M19 A;  1ID3 D;  5FUG A;  3C1B A;  4J8U D;  3WAA D;  5CPI B;  4Z5T A;  3REH B;  1BH9 B;  3UTB D;  1Q9C A;  4X23 B;  1M18 C;  5AV8 C;  3AZI C;  1M18 B;  5AV8 B;  2NZD A;  3AZN A;  3AZE B;  2PYO C;  3LZ1 B;  2XD1 A;  5B1L A;  4ZBJ C;  5KDM A;  5DNN A;  4J8V C;  2W8S A;  5AV9 C;  3C1C A;  1ZLA B;  3LZ0 D;  5AV9 B;  4H9P B;  4XZQ C;  3W97 B;  5GT0 B;  1HQ3 D;  1A7W A;  1P3I A;  1HTA A;  3VH6 W;  5AVB D;  1U35 C;  5B40 B;  3MNN D;  1M1A D;  1P3O A;  3C1B C;  3LEL D;  3MGP D;  2ARO A;  5GSU B;  4H9O A;  1M19 B;  5FUG B;  1TAF A;  3UTA C;  1F1E A;  2Y2H A;  4Z5T B;  3W98 A;  4H9R A;  5B31 C;  1P3P C;  2RVQ D;  1P3A A;  4JJN D;  1EQZ C;  5BT1 D;  5B0Y D;  2NZD B;  2HUE B;  3AZN B;  4R8P A;  4H9N A;  5B1L C;  1S32 A;  5B33 D;  5B1L B;  5DNN C;  5KDM B;  5DNN B;  3KXB C;  3V9R A;  3AZM D;  3C1C C;  3C1C B;  5B2I D;  5B1M B;  3B6F A;  2VQR A;  3X1U A;  4KGC D;  3W96 A;  1P3I B;  4WZS B;  3IP4 C;  3KUY D;  1P3O B;  2L5A A;  5F99 B;  2ARO B;  3AV1 C;  4H9O B;  1N1J A;  2JSS A;  1TAF B;  3X1V C;  3MGS D;  3AZL C;  3AZF D;  1P3A C;  3W98 B;  4H9R B;  1P3A B;  1KX3 C;  3AFA A;  5CPI D;  5JA4 A;  5AY8 A;  3REH D;  4R8P B;  3REI B;  1S32 C;  4H9N B;  4WNN A;  4X23 D;  3VH6 A;  4J8U C;  1M18 D;  5AV8 D;  5G49 A;  3AZI D;  3V9R B;  2ZY4 A;  3X1S A;  2RIQ A;  5B32 A;  2PYO D;  3EG5 B;  3X1U C;  1B67 A;  2Y2M A;  3B6F B;  3X1U B;  1P3L A;  4J8V D;  4KUD A;  3W96 B;  1ZLA D;  5AV9 D;  5GT0 D;  4XZQ D;  1P34 A;  1N1J B;  5B40 D;  2Y2I A;  1U35 D;  2ZY2 A;  5C3I C;  5GSU D;  1HQ3 C;  5C3I B;  5AY8 C;  1M19 D;  3AFA B;  5AVB C;  3C1B D;  5JA4 B;  5AY8 B;  4Z5T D;  1BH8 A;  1M1A C;  2NQB A;  4M6B A;  1KX4 C;  4WNN B;  5B2J A;  3LEL C;  1P3K C;  3REK A;  3WTP E;  5G49 B;  3X1S C;  2NZD D;  3AZN D;  5AV6 C;  4WU8 A;  4J8X A;  2Y2N A;  3X1S B;  4YM6 A;  5B32 B;  1KX5 C;  3VH5 W;  5B1L D;  3REL A;  5DNN D;  4KUD C;  1P3L B;  4ZUX A;  3C1C D;  4KUD B;  2YFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...