1P3AB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3aB00
3C1BB 2AROC 3X1VC 1KX4B 5B40D 1ZLAD 3W99B 3X1TA 5JA4B 5B0ZB 4H9OB 2F8ND 1P3FB 1S32A 3AFAD 3KXBC 3LZ1B 5AV5D 5JRGD 2NQBB 3A6NB 3AZLA 3O62D 3X1SC 1P3BB 3KUYC 1P3LD 5B40C 5B24D 1P3KB 5DNNA 4WU8A 1M1AD 4DRAA 2HIOB 1BH8B 1AOIB 1P3IB 3WKJB 5AV5C 5JRGC 5B2JA 3C1CD 4KUDB 2BYKB 3RELD 5B31D 3MNND 3O62C 1M19B 4AWLB 4JJNB 5CPKB 1WWIA 1P3LC 1HQ3B 1TZYB 5B0YA 5B24C 4R8PB 1EQZA 1M1AC 3B0BA 1P34C 5CP6B 4H9QB 2NQBD 3A6ND 3AZFA 1P3GB 3AV2B 1P3BD 3WAAA 3RELC 3MGQB 5B31C 3MNNC 3WTPB 1P3KD 5GSUA 4J8UA 4LD9B 1P3AA 5CPIB 1P3PC 5B2IB 1TAFA 5G49A 3X1UD 1BH9B 1Q9CA 4ZUXA 3WKJD 3AZHB 1U35D 3MGRB 3UTAA 4XZQB 2PYOC 5B33A 2CV5A 1HQ3D 1TZYD 5B1MB 3X1TC 1JFIA 2IO5B 3X1UC 5AVBD 3AZJB 3AZGA 1P3GD 1U35C 4HGAC 4UUZA 3MGQD 3TU4A 5AV9D 3AZMB 1ID3B 3WTPD 2HUEB 4X23A 5DNNC 4CSRA 5GT3B 5GXQA 3MGPB 4CAYA 3AN2A 3AZHD 4YS3A 5AVBC 5B2JC 4XUJD 3VH6T 1F66B 1N1JB 2YFWB 4H9NB 2NZDB 5AV9C 5B1MD 5B0YC 3MVDA 4J8XB 4J8VB 5CPJA 3LJAA 2FJ7A 3REIA 3AZKB 1P3MA 4ZUXD 5CHLB 3AZJD 3AZIA 5AY8A 3REJA 1M18A 2AROB 3AZFC 3X1VB 4KGCA 4XUJC 3WAAC 2CV5D 4H9RA 3AZEA 3KXBB 2F8NH 4J8UC 2YFVB 4H9PA 5AV8A 5GT3D 3REHA 5B1LA 5C3IC 4J8WA 4ZUXC 3X1SB 4WNNA 3KUYB 3AZGD 3NQUB 3REKA 3UTAC 3W98A 5B40B 5BS7C 2F8NB 4M6BA 5DNMA 4WU9A 3AZND 2CV5C 4J8VD 1KX3D 5AV5B 4NE6A 5JRGB 5E5AA 3LELA 3B6FA 3O62B 2AROD 3AZGC 4ZBJC 1P3LB 5B24B 1M1AB 1P34B 4G91C 3KXBD 3AZNC 3LJAD 1KX3C 2FJ7D 5GXQC 4QLCA 4NE5A 4KHAA 4Z2MH 3AN2C 3KUYD 3REJD 5BNVA 3RELB 5B31B 3MNNB 4NFTA 3UT9A 5AV6D 1P3PB 3LJAC 2FJ7C 3KSYA 3AYWA 1KX4A 5JA4A 2PYOB 3REKD 5AY8C 3REJC 3AZIC 1P3FA 3AV1A 4Z5TD 1P3OA 4KGCC 3X1TB 3LZ1A 5AV6C 4WU9D 1P34D 3AZEC 5FUGB 3X1UB 5E5AD 5F99D 1U35B 5B1LC 4HGAB 5BT1D 4DRBA 3B6FD 2HIOA 1BH8A 3REKC 4Z5TC 5DNNB 1P3IA 5B32A 5DNMC 1P3PD 4WU9C 4G92C 3WA9D 4KUDA 3W97A 5AVBB 1M19A 5E5AC 5F99C 3LELC 5BT1C 2PYOD 3B6FC 4R8PA 3W96A 5AV9B 3X1TD 5B0YB 5CP6A 4EO5C 1S32D 3KWQA 3WA9C 3AV2A 3AZLD 3AZFB 4XUJB 3WAAB 4LD9A 3UT9C 5B2IA 5DNND 4WU8D 4J8UB 3V9RA 3MGSA 1S32C 1TAFB 5C3IB 4ZUXB 4XZQA 5B2JD 3UTAB 3AYWC 3AZLC 2F8NG 2RVQC 4Z66A 1KX5A 5BO0A 4E45A 4YM6A 3AV1C 1P3OC 2CV5B 5B0YD 1EQZD 4WU8C 1JFIB 3W97D 3AZFD 3AZGB 4ZBJB 3AZMA 1ID3A 4UUZB 3WAAD 3W96D 3MGPA 3VH5A 4G91B 3VH5W 5GSUD 3AZNB 4J8UD 5B32C 1KX3B 1EQZC 1P3AD 4CSRB 5GXQB 4CAYB 4E44A 3AN2B 3B6GA 3R45B 1N1JA 5B31G 2YFWA 3W97C 3UTAD 2NZDA 4J8XA 3W96C 5B33D 2JSSA 3AZKA 5GSUC 4Z2MG 3LJAB 2FJ7B 1P3AC 3KWQC 3X1VA 3AZIB 5AY8B 3REJB 3B0DC 5KDMA 4KGCB 3UTBA 1B6WA 5AV6B 3TU4D 4YM6D 3AZEB 5B33C 4X23D 3LZ0A 4H9PB 3MGSC 5GXQD 3NQUA 5B1LB 1ZLAA 3AN2D 4WNNB 4YS3D 1A7WA 3REKB 5BNXB 4Z5TB 3AFAA 4Z66C 5AV5A 1KX5C 5DNMB 3TU4C 4WU9B 5JRGA 4YM6C 4G92B 3MVDD 4X23C 5CPJD 3O62A 1H3OB 5E5AB 5F99B 3REID 1P3MD 3LELB 1P3LA 4H9SA 3B6FB 4WZSB 3AZID 5AY8D 5AVCA 1M18D 4YS3C 1M1AA 4KGCD 5GT0A 2BYMA 4EO5B 3AZED 3WA9B 3C1CA 5AV8D 3MVDC 3NQJA 3REHD 3RELA 5B31A 3MNNA 5CPJC 3C1BA 5B1LD 3W99A 4J8WD 3REIC 1P3MC 3B6GC 5BNVB 5B0ZA 4H9OA 3W98D 3UT9B 1M18C 3UTBD 3WTPE 5DNMD 2NQBA 3A6NA 1S32B 5AV8C 1P3BA 3REHC 3AYWB 3AZLB 3LELD 4J8WC 1P3KA 3AV1B 1P3OB 3W98C 1AOIA 3UTBC 5FUGA 3WKJA 4WU8B 3X1UA 1U35A 3LZ0C 2BYKA 4WV4B 4QLCD 5B2JB 4JJNA 5CPKA 1ZLAC 5AVCD 1HQ3A 1TZYA 3UT9D 5GT0D 3AFAC 5B32B 1EQZB 4H9QA 5AVBA 1P3GA 3W97B 3C1BD 3W99D 4QLCC 1B67A 3MGQA 3AYWD 5AV9A 1KX4D 4H9SC 2F8NK 3WTPA 2RVQD 5B0ZD 5AVCC 1P3FD 3W96B 3VH5T 3AV1D 1P3OD 5CPIA 5GT0C 3LZ1D 5GSUB 1BH9A 1P3AB 3AZHA 3KWQB 3MGRA 5G49B 4XUJA 1KU5A 3C1CC 3B0DB 3C1BC 3W99C 1KX4C 5B1MA 5B0ZC 2HIOD 2LY8A 1P3FC 1AOID 5B33B 4NE3A 1P3ID 5B32D 3LZ1C 3V9RB 3MGSB 2NQBC 3AZJA 3A6NC 4KUDD 5BS7A 1R4VA 1M19D 1P3BC 4JJND 5CPKD 1P3KC 4R8PD 4Z66B 1KX5B 5BO0B 3TU4B 2HIOC 4YM6B 5GT3A 1AOIC 5CP6D 4X23B 1P3IC 3WKJC 3KWQD 3AV2D 4KUDC 1F66A 4YS3B 1M19C 4AWLC 4JJNC 4H9NA 5CPKC 1ULYA 3AZNA 1HQ3C 1TZYC 2L5AA 4J8VA 1KX3A 1F1EA 4R8PC 4LD9D 5CPID 5B2ID 3MVDB 5CP6C 3MGSD 3R45A 5CPJB 3MGRD 2AROA 3REIB 1P3GC 1P3MB 4XZQD 3B6GB 3AV2C 3MGQC 1M18B 3C1CB 3WTPC 3KXBA 4Z66D 1KX5D 2YFVA 4LD9C 5CPIC 4H9RB 5B2IC 5AV8B 3X1SA 3KUYA 3AZHC 3REHB 3MGRC 4J8WB 5B40A 4XZQC 5AV6A 2F8NA 5KDMB 3AZMD 1ID3D 3W98B 3UTBB 5B1MC 3MGPD 3B0CT 3LZ0B 2IO5C 1HTAA 2CWEA 3AZJC 5BNXA 1ZLAB 1F66D 4Z5TA 3B6GD 3VH6A 5B24A 3VH6W 1BFMA 2NZDD 3AZMC 1ID3C 1P34A 3AFAB 4J8XD 2HUEC 5B32G 1H3OA 5GT3C 5F99A 3MGPC 3AZKD 4QLCB 3X1VD 4KHAB 1F66C 5AVCB 1WWSA 1P3PA 5GT0B 2NZDC 2BYMB 3WA9A 4J8XC 4J8VC 3AZKC 3LZ0D 3B0CW 3X1SD 3NQJB 2PYOA
chains in the Genus database with same CATH superfamily
3C1BB 2AROC 3X1VC 1KX4B 5B40D 1ZLAD 3W99B 3X1TA 5JA4B 5B0ZB 4H9OB 2F8ND 3F6TA 1P3FB 1S32A 3AFAD 3KXBC 3LZ1B 5AV5D 5JRGD 2NQBB 3A6NB 3AZLA 3O62D 3X1SC 1P3BB 3KUYC 1P3LD 5B40C 5B24D 1P3KB 5DNNA 4WU8A 1M1AD 4DRAA 2HIOB 1BH8B 1AOIB 1P3IB 3WKJB 3H0MC 5AV5C 3EG5B 5JRGC 5B2JA 2Y2QA 3C1CD 4KUDB 2BYKB 3RELD 5B31D 3MNND 3O62C 1M19B 4AWLB 4JJNB 5CPKB 1WWIA 1P3LC 1HQ3B 1TZYB 5B0YA 5B24C 4R8PB 1EQZA 1M1AC 3B0BA 1P34C 5CP6B 4H9QB 2NQBD 3A6ND 3AZFA 1P3GB 3AV2B 1P3BD 3WAAA 3RELC 3MGQB 5B31C 3MNNC 3WTPB 1P3KD 5GSUA 4J8UA 4LD9B 1P3AA 5CPIB 1P3PC 5B2IB 1TAFA 5G49A 1BH9B 1Q9CA 3IP4C 4ZUXA 3X1UD 3WKJD 3AZHB 1U35D 3MGRB 3UTAA 4XZQB 2PYOC 5B33A 2CV5A 1HQ3D 1TZYD 5B1MB 3X1TC 2Y2PA 1JFIA 2IO5B 2Y2NA 3X1UC 2XD1A 5AVBD 3AZJB 3AZGA 1P3GD 1U35C 4HGAC 4UUZA 3MGQD 3TU4A 5AV9D 3AZMB 1ID3B 3WTPD 2HUEB 4X23A 5DNNC 2XD5A 4CSRA 5GT3B 5GXQA 3H0RC 3MGPB 4CAYA 3AN2A 3AZHD 4YS3A 5AVBC 5B2JC 4XUJD 3AL0C 3VH6T 1F66B 1N1JB 2YFWB 4H9NB 2NZDB 5AV9C 5B1MD 5B0YC 3MVDA 4J8XB 4J8VB 5CPJA 3LJAA 2FJ7A 3REIA 3AZKB 1P3MA 4ZUXD 5CHLB 3AZJD 3AZIA 5AY8A 4DQYB 3REJA 1M18A 2AROB 3AZFC 3X1VB 4KGCA 4XUJC 3WAAC 2CV5D 4H9RA 3AZEA 3KXBB 2G5IC 2F8NH 4J8UC 2YFVB 4H9PA 5AV8A 5GT3D 3REHA 5B1LA 5C3IC 4J8WA 4ZUXC 3X1SB 4WNNA 3KUYB 3AZGD 3NQUB 3REKA 3UTAC 3W98A 5B40B 5BS7C 2F8NB 4M6BA 5DNMA 4WU9A 3AZND 2CV5C 4J8VD 1KX3D 5AV5B 4NE6A 5JRGB 5E5AA 3LELA 3B6FA 3O62B 2VQRA 2AROD 3AZGC 4ZBJC 1P3LB 5B24B 1M1AB 1P34B 4G91C 3KXBD 3AZNC 3KFUG 3LJAD 1KX3C 2FJ7D 5GXQC 4QLCA 4NE5A 4KHAA 4Z2MH 3AN2C 3KUYD 3REJD 5BNVA 3RELB 5B31B 3MNNB 4NFTA 3UT9A 1T3UA 5AV6D 3FDDA 1P3PB 3LJAC 2JCHA 2FJ7C 3KSYA 3AYWA 1KX4A 5JA4A 2PYOB 3REKD 5AY8C 3REJC 3AZIC 1P3FA 3AV1A 4Z5TD 1P3OA 4KGCC 3X1TB 3LZ1A 5AV6C 4WU9D 1P34D 3AZEC 5FUGB 3X1UB 5E5AD 5F99D 1U35B 5B1LC 4HGAB 5BT1D 4DRBA 3B6FD 2HIOA 1BH8A 3REKC 4Z5TC 5DNNB 1P3IA 5B32A 5DNMC 1P3PD 4WU9C 4G92C 3WA9D 4KUDA 3EPJA 3W97A 5AVBB 1M19A 5E5AC 5F99C 3LELC 5BT1C 2PYOD 3B6FC 4R8PA 3W96A 5AV9B 3X1TD 5B0YB 5CP6A 4EO5C 1S32D 3KWQA 3WA9C 3AV2A 3AZLD 3AZFB 4XUJB 3WAAB 4LD9A 3UT9C 5B2IA 5DNND 4WU8D 4J8UB 3V9RA 3MGSA 1S32C 1TAFB 5C3IB 2Y2MA 4ZUXB 4XZQA 5B2JD 3UTAB 3AYWC 3AZLC 2JE5A 2Y2IA 2F8NG 2RVQC 4Z66A 1KX5A 5BO0A 4E45A 4YM6A 3AV1C 1P3OC 2CV5B 5B0YD 1EQZD 4WU8C 1JFIB 3W97D 3AZFD 3AZGB 4ZBJB 3AZMA 1ID3A 4UUZB 3WAAD 3W96D 3MGPA 3VH5A 4G91B 3VH5W 5GSUD 3AZNB 3H0LC 4J8UD 5B32C 1KX3B 1EQZC 1P3AD 4CSRB 5GXQB 2Y2HA 4CAYB 4E44A 3AN2B 3B6GA 3R45B 1N1JA 2ZY2A 2YFWA 5B31G 3W97C 3UTAD 2NZDA 4J8XA 3W96C 5B33D 2JSSA 3AZKA 5GSUC 4Z2MG 3LJAB 2FJ7B 1P3AC 3KWQC 3X1VA 3AZIB 5AY8B 3REJB 3B0DC 5KDMA 4KGCB 3UTBA 1B6WA 5AV6B 3TU4D 4YM6D 3AZEB 5B33C 4X23D 3LZ0A 4H9PB 3MGSC 5GXQD 3NQUA 5B1LB 1ZLAA 3AN2D 4WNNB 4YS3D 1A7WA 3REKB 5BNXB 4Z5TB 3AFAA 4Z66C 5AV5A 1KX5C 5DNMB 3TU4C 4WU9B 5JRGA 4YM6C 4G92B 4WJ3C 3MVDD 4X23C 5CPJD 3O62A 1H3OB 5E5AB 5F99B 3REID 1P3MD 3LELB 1P3LA 4H9SA 3B6FB 4WZSB 3AZID 2Y2OA 5AY8D 5AVCA 1M18D 4YS3C 1M1AA 4KGCD 5GT0A 2BYMA 4EO5B 3AZED 3WA9B 3C1CA 5AV8D 3MVDC 3NQJA 3REHD 3RELA 5B31A 3MNNA 5CPJC 3C1BA 5B1LD 1W2EA 4J8WD 2W8SA 3REIC 1P3MC 3W99A 3B6GC 5BNVB 5B0ZA 4H9OA 3W98D 2ZY3A 3UT9B 1M18C 3UTBD 3WTPE 5DNMD 2NQBA 3A6NA 1S32B 5AV8C 1P3BA 3REHC 3AYWB 3AZLB 3LELD 1PZRA 4J8WC 1P3KA 3AV1B 1P3OB 3W98C 1AOIA 3UTBC 5FUGA 3WKJA 4WU8B 3X1UA 1U35A 3A1IA 3LZ0C 2BYKA 4WV4B 4QLCD 5B2JB 4JJNA 5CPKA 2Y2LA 1ZLAC 5AVCD 1HQ3A 1TZYA 3UT9D 5GT0D 3AFAC 5B32B 1EQZB 3EPHA 4H9QA 5AVBA 1P3GA 3W97B 3C1BD 3W99D 4QLCC 1B67A 3MGQA 3AYWD 5AV9A 1KX4D 4H9SC 2F8NK 3WTPA 2RVQD 5B0ZD 5AVCC 1P3FD 3W96B 3VH5T 3AV1D 1P3OD 5CPIA 5GT0C 3LZ1D 5GSUB 1BH9A 2F2AC 2Y2JA 1P3AB 3AZHA 3KWQB 3MGRA 5G49B 4XUJA 1KU5A 3C1CC 3B0DB 3C1BC 3W99C 1KX4C 5B1MA 5B0ZC 2HIOD 2Y2KA 2DQNC 2LY8A 1P3FC 1AOID 5B33B 4NE3A 1P3ID 1Z2CB 5B32D 3LZ1C 3V9RB 3MGSB 2NQBC 3AZJA 3A6NC 3A1KA 4KUDD 5BS7A 1R4VA 1M19D 1P3BC 4JJND 5CPKD 2ZY4A 1P3KC 4R8PD 4Z66B 1KX5B 5BO0B 2RIQA 2HIOC 4UPKA 4YM6B 3TU4B 5GT3A 1AOIC 5CP6D 4X23B 1P3IC 3WKJC 3KWQD 3AV2D 4KUDC 1F66A 4YS3B 2J8PA 1M19C 4AWLC 4JJNC 4H9NA 5CPKC 1ULYA 3AZNA 1HQ3C 1TZYC 2L5AA 4J8VA 1KX3A 1F1EA 4R8PC 4LD9D 5CPID 5B2ID 2ZY5A 3MVDB 5CP6C 3MGSD 3R45A 5CPJB 3MGRD 2Y2GA 2AROA 3REIB 1P3GC 1P3MB 4XZQD 3B6GB 3AV2C 3MGQC 1M18B 3C1CB 2UWXA 3WTPC 3KXBA 4Z66D 1KX5D 2YFVA 4LD9C 5CPIC 4H9RB 5B2IC 2DF4C 5AV8B 3X1SA 3KUYA 3AZHC 3REHB 3MGRC 4J8WB 5B40A 4XZQC 5AV6A 2F8NA 5KDMB 3AZMD 1ID3D 3W98B 3EPLA 3UTBB 5B1MC 3MGPD 3B0CT 3LZ0B 2IO5C 1HTAA 2CWEA 3AZJC 5BNXA 1ZLAB 1F66D 4Z5TA 3B6GD 2ZM5A 3EPKA 3VH6A 5B24A 3VH6W 1BFMA 2NZDD 3AZMC 1ID3C 1P34A 3AFAB 4J8XD 2HUEC 5B32G 1H3OA 2G5HC 5GT3C 5F99A 3MGPC 3AZKD 2FFFB 4QLCB 3X1VD 2BG1A 4KHAB 1F66C 5AVCB 1WWSA 1P3PA 5GT0B 2NZDC 2BYMB 3WA9A 4J8XC 4J8VC 3P5JB 3AZKC 3LZ0D 3B0CW 3X1SD 3NQJB 2PYOA
chains in the Genus database with same CATH topology
3C1BB 2AROC 3X1VC 1KX4B 5B40D 1ZLAD 3W99B 3X1TA 5JA4B 5B0ZB 4H9OB 2F8ND 3F6TA 1P3FB 1S32A 3AFAD 3KXBC 3LZ1B 5AV5D 5JRGD 2NQBB 3A6NB 3AZLA 3O62D 3X1SC 1P3BB 3KUYC 1P3LD 5B40C 5B24D 1P3KB 5DNNA 4WU8A 1M1AD 4DRAA 2HIOB 1BH8B 1AOIB 1P3IB 3WKJB 3H0MC 5AV5C 3EG5B 5JRGC 5B2JA 2Y2QA 3C1CD 4KUDB 2BYKB 3RELD 5B31D 3MNND 3O62C 1M19B 4AWLB 4JJNB 5CPKB 1WWIA 1P3LC 1HQ3B 1TZYB 5B0YA 5B24C 4R8PB 1EQZA 1M1AC 3B0BA 1P34C 5CP6B 4H9QB 2NQBD 3A6ND 3AZFA 1P3GB 3AV2B 1P3BD 3WAAA 3RELC 3MGQB 5B31C 3MNNC 3WTPB 1P3KD 5GSUA 4J8UA 4LD9B 1P3AA 5CPIB 1P3PC 5B2IB 1TAFA 5G49A 1BH9B 1Q9CA 3IP4C 4ZUXA 3X1UD 3WKJD 3AZHB 1U35D 3MGRB 3UTAA 4XZQB 2PYOC 5B33A 2CV5A 1HQ3D 1TZYD 5B1MB 3X1TC 2Y2PA 1JFIA 2IO5B 2Y2NA 3X1UC 2XD1A 5AVBD 3AZJB 3AZGA 1P3GD 1U35C 4HGAC 4UUZA 3MGQD 3TU4A 5AV9D 3AZMB 1ID3B 3WTPD 2HUEB 4X23A 5DNNC 2XD5A 4CSRA 5GT3B 5GXQA 3H0RC 3MGPB 4CAYA 3AN2A 3AZHD 4YS3A 5AVBC 5B2JC 4XUJD 3AL0C 3VH6T 1F66B 1N1JB 2YFWB 4H9NB 2NZDB 5AV9C 5B1MD 5B0YC 3MVDA 4J8XB 4J8VB 5CPJA 3LJAA 2FJ7A 3REIA 3AZKB 1P3MA 4ZUXD 5CHLB 3AZJD 3AZIA 5AY8A 4DQYB 3REJA 1M18A 2AROB 3AZFC 3X1VB 4KGCA 4XUJC 3WAAC 2CV5D 4H9RA 3AZEA 3KXBB 2G5IC 2F8NH 4J8UC 2YFVB 4H9PA 5AV8A 5GT3D 3REHA 5B1LA 5C3IC 4J8WA 4ZUXC 3X1SB 4WNNA 3KUYB 3AZGD 3NQUB 3REKA 3UTAC 3W98A 5B40B 5BS7C 2F8NB 4M6BA 5DNMA 4WU9A 3AZND 2CV5C 4J8VD 1KX3D 5AV5B 4NE6A 5JRGB 5E5AA 3LELA 3B6FA 3O62B 2VQRA 2AROD 3AZGC 4ZBJC 1P3LB 5B24B 1M1AB 1P34B 4G91C 3KXBD 3AZNC 3KFUG 3LJAD 1KX3C 2FJ7D 5GXQC 4QLCA 4NE5A 4KHAA 4Z2MH 3AN2C 3KUYD 3REJD 5BNVA 3RELB 5B31B 3MNNB 4NFTA 3UT9A 1T3UA 5AV6D 3FDDA 1P3PB 3LJAC 2JCHA 2FJ7C 3KSYA 3AYWA 1KX4A 5JA4A 2PYOB 3REKD 5AY8C 3REJC 3AZIC 1P3FA 3AV1A 4Z5TD 1P3OA 4KGCC 3X1TB 3LZ1A 5AV6C 4WU9D 1P34D 3AZEC 5FUGB 3X1UB 5E5AD 5F99D 1U35B 5B1LC 4HGAB 5BT1D 4DRBA 3B6FD 2HIOA 1BH8A 3REKC 4Z5TC 5DNNB 1P3IA 5B32A 5DNMC 1P3PD 4WU9C 4G92C 3WA9D 4KUDA 3EPJA 3W97A 5AVBB 1M19A 5E5AC 5F99C 3LELC 5BT1C 2PYOD 3B6FC 4R8PA 3W96A 5AV9B 3X1TD 5B0YB 5CP6A 4EO5C 1S32D 3KWQA 3WA9C 3AV2A 3AZLD 3AZFB 4XUJB 3WAAB 4LD9A 3UT9C 5B2IA 5DNND 4WU8D 4J8UB 3V9RA 3MGSA 1S32C 1TAFB 5C3IB 2Y2MA 4ZUXB 4XZQA 5B2JD 3UTAB 3AYWC 3AZLC 2JE5A 2Y2IA 2F8NG 2RVQC 4Z66A 1KX5A 5BO0A 4E45A 4YM6A 3AV1C 1P3OC 2CV5B 5B0YD 1EQZD 4WU8C 1JFIB 3W97D 3AZFD 3AZGB 4ZBJB 3AZMA 1ID3A 4UUZB 3WAAD 3W96D 3MGPA 3VH5A 4G91B 3VH5W 5GSUD 3AZNB 3H0LC 4J8UD 5B32C 1KX3B 1EQZC 1P3AD 4CSRB 5GXQB 2Y2HA 4CAYB 4E44A 3AN2B 3B6GA 3R45B 1N1JA 2ZY2A 2YFWA 5B31G 3W97C 3UTAD 2NZDA 4J8XA 3W96C 5B33D 2JSSA 3AZKA 5GSUC 4Z2MG 3LJAB 2FJ7B 1P3AC 3KWQC 3X1VA 3AZIB 5AY8B 3REJB 3B0DC 5KDMA 4KGCB 3UTBA 1B6WA 5AV6B 3TU4D 4YM6D 3AZEB 5B33C 4X23D 3LZ0A 4H9PB 3MGSC 5GXQD 3NQUA 5B1LB 1ZLAA 3AN2D 4WNNB 4YS3D 1A7WA 3REKB 5BNXB 4Z5TB 3AFAA 4Z66C 5AV5A 1KX5C 5DNMB 3TU4C 4WU9B 5JRGA 4YM6C 4G92B 4WJ3C 3MVDD 4X23C 5CPJD 3O62A 1H3OB 5E5AB 5F99B 3REID 1P3MD 3LELB 1P3LA 4H9SA 3B6FB 4WZSB 3AZID 2Y2OA 5AY8D 5AVCA 1M18D 4YS3C 1M1AA 4KGCD 5GT0A 2BYMA 4EO5B 3AZED 3WA9B 3C1CA 5AV8D 3MVDC 3NQJA 3REHD 3RELA 5B31A 3MNNA 5CPJC 3C1BA 5B1LD 1W2EA 4J8WD 2W8SA 3REIC 1P3MC 3W99A 3B6GC 5BNVB 5B0ZA 4H9OA 3W98D 2ZY3A 3UT9B 1M18C 3UTBD 3WTPE 5DNMD 2NQBA 3A6NA 1S32B 5AV8C 1P3BA 3REHC 3AYWB 3AZLB 3LELD 1PZRA 4J8WC 1P3KA 3AV1B 1P3OB 3W98C 1AOIA 3UTBC 5FUGA 3WKJA 4WU8B 3X1UA 1U35A 3A1IA 3LZ0C 2BYKA 4WV4B 4QLCD 5B2JB 4JJNA 5CPKA 2Y2LA 1ZLAC 5AVCD 1HQ3A 1TZYA 3UT9D 5GT0D 3AFAC 5B32B 1EQZB 3EPHA 4H9QA 5AVBA 1P3GA 3W97B 3C1BD 3W99D 4QLCC 1B67A 3MGQA 3AYWD 5AV9A 1KX4D 4H9SC 2F8NK 3WTPA 2RVQD 5B0ZD 5AVCC 1P3FD 3W96B 3VH5T 3AV1D 1P3OD 5CPIA 5GT0C 3LZ1D 5GSUB 1BH9A 2F2AC 2Y2JA 1P3AB 3AZHA 3KWQB 3MGRA 5G49B 4XUJA 1KU5A 3C1CC 3B0DB 3C1BC 3W99C 1KX4C 5B1MA 5B0ZC 2HIOD 2Y2KA 2DQNC 2LY8A 1P3FC 1AOID 5B33B 4NE3A 1P3ID 1Z2CB 5B32D 3LZ1C 3V9RB 3MGSB 2NQBC 3AZJA 3A6NC 3A1KA 4KUDD 5BS7A 1R4VA 1M19D 1P3BC 4JJND 5CPKD 2ZY4A 1P3KC 4R8PD 4Z66B 1KX5B 5BO0B 2RIQA 2HIOC 4UPKA 4YM6B 3TU4B 5GT3A 1AOIC 5CP6D 4X23B 1P3IC 3WKJC 3KWQD 3AV2D 4KUDC 1F66A 4YS3B 2J8PA 1M19C 4AWLC 4JJNC 4H9NA 5CPKC 1ULYA 3AZNA 1HQ3C 1TZYC 2L5AA 4J8VA 1KX3A 1F1EA 4R8PC 4LD9D 5CPID 5B2ID 2ZY5A 3MVDB 5CP6C 3MGSD 3R45A 5CPJB 3MGRD 2Y2GA 2AROA 3REIB 1P3GC 1P3MB 4XZQD 3B6GB 3AV2C 3MGQC 1M18B 3C1CB 2UWXA 3WTPC 3KXBA 4Z66D 1KX5D 2YFVA 4LD9C 5CPIC 4H9RB 5B2IC 2DF4C 5AV8B 3X1SA 3KUYA 3AZHC 3REHB 3MGRC 4J8WB 5B40A 4XZQC 5AV6A 2F8NA 5KDMB 3AZMD 1ID3D 3W98B 3EPLA 3UTBB 5B1MC 3MGPD 3B0CT 3LZ0B 2IO5C 1HTAA 2CWEA 3AZJC 5BNXA 1ZLAB 1F66D 4Z5TA 3B6GD 2ZM5A 3EPKA 3VH6A 5B24A 3VH6W 1BFMA 2NZDD 3AZMC 1ID3C 1P34A 3AFAB 4J8XD 2HUEC 5B32G 1H3OA 2G5HC 5GT3C 5F99A 3MGPC 3AZKD 2FFFB 4QLCB 3X1VD 2BG1A 4KHAB 1F66C 5AVCB 1WWSA 1P3PA 5GT0B 2NZDC 2BYMB 3WA9A 4J8XC 4J8VC 3P5JB 3AZKC 3LZ0D 3B0CW 3X1SD 3NQJB 2PYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B B;  2ARO C;  3X1V C;  1KX4 B;  5B40 D;  1ZLA D;  3W99 B;  3X1T A;  5JA4 B;  5B0Z B;  4H9O B;  2F8N D;  1P3F B;  1S32 A;  3AFA D;  3KXB C;  3LZ1 B;  5AV5 D;  5JRG D;  2NQB B;  3A6N B;  3AZL A;  3O62 D;  3X1S C;  1P3B B;  3KUY C;  1P3L D;  5B40 C;  5B24 D;  1P3K B;  5DNN A;  4WU8 A;  1M1A D;  4DRA A;  2HIO B;  1BH8 B;  1AOI B;  1P3I B;  3WKJ B;  5AV5 C;  5JRG C;  5B2J A;  3C1C D;  4KUD B;  2BYK B;  3REL D;  5B31 D;  3MNN D;  3O62 C;  1M19 B;  4AWL B;  4JJN B;  5CPK B;  1WWI A;  1P3L C;  1HQ3 B;  1TZY B;  5B0Y A;  5B24 C;  4R8P B;  1EQZ A;  1M1A C;  3B0B A;  1P34 C;  5CP6 B;  4H9Q B;  2NQB D;  3A6N D;  3AZF A;  1P3G B;  3AV2 B;  1P3B D;  3WAA A;  3REL C;  3MGQ B;  5B31 C;  3MNN C;  3WTP B;  1P3K D;  5GSU A;  4J8U A;  4LD9 B;  1P3A A;  5CPI B;  1P3P C;  5B2I B;  1TAF A;  5G49 A;  3X1U D;  1BH9 B;  1Q9C A;  4ZUX A;  3WKJ D;  3AZH B;  1U35 D;  3MGR B;  3UTA A;  4XZQ B;  2PYO C;  5B33 A;  2CV5 A;  1HQ3 D;  1TZY D;  5B1M B;  3X1T C;  1JFI A;  2IO5 B;  3X1U C;  5AVB D;  3AZJ B;  3AZG A;  1P3G D;  1U35 C;  4HGA C;  4UUZ A;  3MGQ D;  3TU4 A;  5AV9 D;  3AZM B;  1ID3 B;  3WTP D;  2HUE B;  4X23 A;  5DNN C;  4CSR A;  5GT3 B;  5GXQ A;  3MGP B;  4CAY A;  3AN2 A;  3AZH D;  4YS3 A;  5AVB C;  5B2J C;  4XUJ D;  3VH6 T;  1F66 B;  1N1J B;  2YFW B;  4H9N B;  2NZD B;  5AV9 C;  5B1M D;  5B0Y C;  3MVD A;  4J8X B;  4J8V B;  5CPJ A;  3LJA A;  2FJ7 A;  3REI A;  3AZK B;  1P3M A;  4ZUX D;  5CHL B;  3AZJ D;  3AZI A;  5AY8 A;  3REJ A;  1M18 A;  2ARO B;  3AZF C;  3X1V B;  4KGC A;  4XUJ C;  3WAA C;  2CV5 D;  4H9R A;  3AZE A;  3KXB B;  2F8N H;  4J8U C;  2YFV B;  4H9P A;  5AV8 A;  5GT3 D;  3REH A;  5B1L A;  5C3I C;  4J8W A;  4ZUX C;  3X1S B;  4WNN A;  3KUY B;  3AZG D;  3NQU B;  3REK A;  3UTA C;  3W98 A;  5B40 B;  5BS7 C;  2F8N B;  4M6B A;  5DNM A;  4WU9 A;  3AZN D;  2CV5 C;  4J8V D;  1KX3 D;  5AV5 B;  4NE6 A;  5JRG B;  5E5A A;  3LEL A;  3B6F A;  3O62 B;  2ARO D;  3AZG C;  4ZBJ C;  1P3L B;  5B24 B;  1M1A B;  1P34 B;  4G91 C;  3KXB D;  3AZN C;  3LJA D;  1KX3 C;  2FJ7 D;  5GXQ C;  4QLC A;  4NE5 A;  4KHA A;  4Z2M H;  3AN2 C;  3KUY D;  3REJ D;  5BNV A;  3REL B;  5B31 B;  3MNN B;  4NFT A;  3UT9 A;  5AV6 D;  1P3P B;  3LJA C;  2FJ7 C;  3KSY A;  3AYW A;  1KX4 A;  5JA4 A;  2PYO B;  3REK D;  5AY8 C;  3REJ C;  3AZI C;  1P3F A;  3AV1 A;  4Z5T D;  1P3O A;  4KGC C;  3X1T B;  3LZ1 A;  5AV6 C;  4WU9 D;  1P34 D;  3AZE C;  5FUG B;  3X1U B;  5E5A D;  5F99 D;  1U35 B;  5B1L C;  4HGA B;  5BT1 D;  4DRB A;  3B6F D;  2HIO A;  1BH8 A;  3REK C;  4Z5T C;  5DNN B;  1P3I A;  5B32 A;  5DNM C;  1P3P D;  4WU9 C;  4G92 C;  3WA9 D;  4KUD A;  3W97 A;  5AVB B;  1M19 A;  5E5A C;  5F99 C;  3LEL C;  5BT1 C;  2PYO D;  3B6F C;  4R8P A;  3W96 A;  5AV9 B;  3X1T D;  5B0Y B;  5CP6 A;  4EO5 C;  1S32 D;  3KWQ A;  3WA9 C;  3AV2 A;  3AZL D;  3AZF B;  4XUJ B;  3WAA B;  4LD9 A;  3UT9 C;  5B2I A;  5DNN D;  4WU8 D;  4J8U B;  3V9R A;  3MGS A;  1S32 C;  1TAF B;  5C3I B;  4ZUX B;  4XZQ A;  5B2J D;  3UTA B;  3AYW C;  3AZL C;  2F8N G;  2RVQ C;  4Z66 A;  1KX5 A;  5BO0 A;  4E45 A;  4YM6 A;  3AV1 C;  1P3O C;  2CV5 B;  5B0Y D;  1EQZ D;  4WU8 C;  1JFI B;  3W97 D;  3AZF D;  3AZG B;  4ZBJ B;  3AZM A;  1ID3 A;  4UUZ B;  3WAA D;  3W96 D;  3MGP A;  3VH5 A;  4G91 B;  3VH5 W;  5GSU D;  3AZN B;  4J8U D;  5B32 C;  1KX3 B;  1EQZ C;  1P3A D;  4CSR B;  5GXQ B;  4CAY B;  4E44 A;  3AN2 B;  3B6G A;  3R45 B;  1N1J A;  5B31 G;  2YFW A;  3W97 C;  3UTA D;  2NZD A;  4J8X A;  3W96 C;  5B33 D;  2JSS A;  3AZK A;  5GSU C;  4Z2M G;  3LJA B;  2FJ7 B;  1P3A C;  3KWQ C;  3X1V A;  3AZI B;  5AY8 B;  3REJ B;  3B0D C;  5KDM A;  4KGC B;  3UTB A;  1B6W A;  5AV6 B;  3TU4 D;  4YM6 D;  3AZE B;  5B33 C;  4X23 D;  3LZ0 A;  4H9P B;  3MGS C;  5GXQ D;  3NQU A;  5B1L B;  1ZLA A;  3AN2 D;  4WNN B;  4YS3 D;  1A7W A;  3REK B;  5BNX B;  4Z5T B;  3AFA A;  4Z66 C;  5AV5 A;  1KX5 C;  5DNM B;  3TU4 C;  4WU9 B;  5JRG A;  4YM6 C;  4G92 B;  3MVD D;  4X23 C;  5CPJ D;  3O62 A;  1H3O B;  5E5A B;  5F99 B;  3REI D;  1P3M D;  3LEL B;  1P3L A;  4H9S A;  3B6F B;  4WZS B;  3AZI D;  5AY8 D;  5AVC A;  1M18 D;  4YS3 C;  1M1A A;  4KGC D;  5GT0 A;  2BYM A;  4EO5 B;  3AZE D;  3WA9 B;  3C1C A;  5AV8 D;  3MVD C;  3NQJ A;  3REH D;  3REL A;  5B31 A;  3MNN A;  5CPJ C;  3C1B A;  5B1L D;  3W99 A;  4J8W D;  3REI C;  1P3M C;  3B6G C;  5BNV B;  5B0Z A;  4H9O A;  3W98 D;  3UT9 B;  1M18 C;  3UTB D;  3WTP E;  5DNM D;  2NQB A;  3A6N A;  1S32 B;  5AV8 C;  1P3B A;  3REH C;  3AYW B;  3AZL B;  3LEL D;  4J8W C;  1P3K A;  3AV1 B;  1P3O B;  3W98 C;  1AOI A;  3UTB C;  5FUG A;  3WKJ A;  4WU8 B;  3X1U A;  1U35 A;  3LZ0 C;  2BYK A;  4WV4 B;  4QLC D;  5B2J B;  4JJN A;  5CPK A;  1ZLA C;  5AVC D;  1HQ3 A;  1TZY A;  3UT9 D;  5GT0 D;  3AFA C;  5B32 B;  1EQZ B;  4H9Q A;  5AVB A;  1P3G A;  3W97 B;  3C1B D;  3W99 D;  4QLC C;  1B67 A;  3MGQ A;  3AYW D;  5AV9 A;  1KX4 D;  4H9S C;  2F8N K;  3WTP A;  2RVQ D;  5B0Z D;  5AVC C;  1P3F D;  3W96 B;  3VH5 T;  3AV1 D;  1P3O D;  5CPI A;  5GT0 C;  3LZ1 D;  5GSU B;  1BH9 A;  1P3A B;  3AZH A;  3KWQ B;  3MGR A;  5G49 B;  4XUJ A;  1KU5 A;  3C1C C;  3B0D B;  3C1B C;  3W99 C;  1KX4 C;  5B1M A;  5B0Z C;  2HIO D;  2LY8 A;  1P3F C;  1AOI D;  5B33 B;  4NE3 A;  1P3I D;  5B32 D;  3LZ1 C;  3V9R B;  3MGS B;  2NQB C;  3AZJ A;  3A6N C;  4KUD D;  5BS7 A;  1R4V A;  1M19 D;  1P3B C;  4JJN D;  5CPK D;  1P3K C;  4R8P D;  4Z66 B;  1KX5 B;  5BO0 B;  3TU4 B;  2HIO C;  4YM6 B;  5GT3 A;  1AOI C;  5CP6 D;  4X23 B;  1P3I C;  3WKJ C;  3KWQ D;  3AV2 D;  4KUD C;  1F66 A;  4YS3 B;  1M19 C;  4AWL C;  4JJN C;  4H9N A;  5CPK C;  1ULY A;  3AZN A;  1HQ3 C;  1TZY C;  2L5A A;  4J8V A;  1KX3 A;  1F1E A;  4R8P C;  4LD9 D;  5CPI D;  5B2I D;  3MVD B;  5CP6 C;  3MGS D;  3R45 A;  5CPJ B;  3MGR D;  2ARO A;  3REI B;  1P3G C;  1P3M B;  4XZQ D;  3B6G B;  3AV2 C;  3MGQ C;  1M18 B;  3C1C B;  3WTP C;  3KXB A;  4Z66 D;  1KX5 D;  2YFV A;  4LD9 C;  5CPI C;  4H9R B;  5B2I C;  5AV8 B;  3X1S A;  3KUY A;  3AZH C;  3REH B;  3MGR C;  4J8W B;  5B40 A;  4XZQ C;  5AV6 A;  2F8N A;  5KDM B;  3AZM D;  1ID3 D;  3W98 B;  3UTB B;  5B1M C;  3MGP D;  3B0C T;  3LZ0 B;  2IO5 C;  1HTA A;  2CWE A;  3AZJ C;  5BNX A;  1ZLA B;  1F66 D;  4Z5T A;  3B6G D;  3VH6 A;  5B24 A;  3VH6 W;  1BFM A;  2NZD D;  3AZM C;  1ID3 C;  1P34 A;  3AFA B;  4J8X D;  2HUE C;  5B32 G;  1H3O A;  5GT3 C;  5F99 A;  3MGP C;  3AZK D;  4QLC B;  3X1V D;  4KHA B;  1F66 C;  5AVC B;  1WWS A;  1P3P A;  5GT0 B;  2NZD C;  2BYM B;  3WA9 A;  4J8X C;  4J8V C;  3AZK C;  3LZ0 D;  3B0C W;  3X1S D;  3NQJ B;  2PYO A; 
#chains in the Genus database with same CATH topology
 3C1B B;  2ARO C;  3X1V C;  1KX4 B;  5B40 D;  1ZLA D;  3W99 B;  3X1T A;  5JA4 B;  5B0Z B;  4H9O B;  2F8N D;  3F6T A;  1P3F B;  1S32 A;  3AFA D;  3KXB C;  3LZ1 B;  5AV5 D;  5JRG D;  2NQB B;  3A6N B;  3AZL A;  3O62 D;  3X1S C;  1P3B B;  3KUY C;  1P3L D;  5B40 C;  5B24 D;  1P3K B;  5DNN A;  4WU8 A;  1M1A D;  4DRA A;  2HIO B;  1BH8 B;  1AOI B;  1P3I B;  3WKJ B;  3H0M C;  5AV5 C;  3EG5 B;  5JRG C;  5B2J A;  2Y2Q A;  3C1C D;  4KUD B;  2BYK B;  3REL D;  5B31 D;  3MNN D;  3O62 C;  1M19 B;  4AWL B;  4JJN B;  5CPK B;  1WWI A;  1P3L C;  1HQ3 B;  1TZY B;  5B0Y A;  5B24 C;  4R8P B;  1EQZ A;  1M1A C;  3B0B A;  1P34 C;  5CP6 B;  4H9Q B;  2NQB D;  3A6N D;  3AZF A;  1P3G B;  3AV2 B;  1P3B D;  3WAA A;  3REL C;  3MGQ B;  5B31 C;  3MNN C;  3WTP B;  1P3K D;  5GSU A;  4J8U A;  4LD9 B;  1P3A A;  5CPI B;  1P3P C;  5B2I B;  1TAF A;  5G49 A;  1BH9 B;  1Q9C A;  3IP4 C;  4ZUX A;  3X1U D;  3WKJ D;  3AZH B;  1U35 D;  3MGR B;  3UTA A;  4XZQ B;  2PYO C;  5B33 A;  2CV5 A;  1HQ3 D;  1TZY D;  5B1M B;  3X1T C;  2Y2P A;  1JFI A;  2IO5 B;  2Y2N A;  3X1U C;  2XD1 A;  5AVB D;  3AZJ B;  3AZG A;  1P3G D;  1U35 C;  4HGA C;  4UUZ A;  3MGQ D;  3TU4 A;  5AV9 D;  3AZM B;  1ID3 B;  3WTP D;  2HUE B;  4X23 A;  5DNN C;  2XD5 A;  4CSR A;  5GT3 B;  5GXQ A;  3H0R C;  3MGP B;  4CAY A;  3AN2 A;  3AZH D;  4YS3 A;  5AVB C;  5B2J C;  4XUJ D;  3AL0 C;  3VH6 T;  1F66 B;  1N1J B;  2YFW B;  4H9N B;  2NZD B;  5AV9 C;  5B1M D;  5B0Y C;  3MVD A;  4J8X B;  4J8V B;  5CPJ A;  3LJA A;  2FJ7 A;  3REI A;  3AZK B;  1P3M A;  4ZUX D;  5CHL B;  3AZJ D;  3AZI A;  5AY8 A;  4DQY B;  3REJ A;  1M18 A;  2ARO B;  3AZF C;  3X1V B;  4KGC A;  4XUJ C;  3WAA C;  2CV5 D;  4H9R A;  3AZE A;  3KXB B;  2G5I C;  2F8N H;  4J8U C;  2YFV B;  4H9P A;  5AV8 A;  5GT3 D;  3REH A;  5B1L A;  5C3I C;  4J8W A;  4ZUX C;  3X1S B;  4WNN A;  3KUY B;  3AZG D;  3NQU B;  3REK A;  3UTA C;  3W98 A;  5B40 B;  5BS7 C;  2F8N B;  4M6B A;  5DNM A;  4WU9 A;  3AZN D;  2CV5 C;  4J8V D;  1KX3 D;  5AV5 B;  4NE6 A;  5JRG B;  5E5A A;  3LEL A;  3B6F A;  3O62 B;  2VQR A;  2ARO D;  3AZG C;  4ZBJ C;  1P3L B;  5B24 B;  1M1A B;  1P34 B;  4G91 C;  3KXB D;  3AZN C;  3KFU G;  3LJA D;  1KX3 C;  2FJ7 D;  5GXQ C;  4QLC A;  4NE5 A;  4KHA A;  4Z2M H;  3AN2 C;  3KUY D;  3REJ D;  5BNV A;  3REL B;  5B31 B;  3MNN B;  4NFT A;  3UT9 A;  1T3U A;  5AV6 D;  3FDD A;  1P3P B;  3LJA C;  2JCH A;  2FJ7 C;  3KSY A;  3AYW A;  1KX4 A;  5JA4 A;  2PYO B;  3REK D;  5AY8 C;  3REJ C;  3AZI C;  1P3F A;  3AV1 A;  4Z5T D;  1P3O A;  4KGC C;  3X1T B;  3LZ1 A;  5AV6 C;  4WU9 D;  1P34 D;  3AZE C;  5FUG B;  3X1U B;  5E5A D;  5F99 D;  1U35 B;  5B1L C;  4HGA B;  5BT1 D;  4DRB A;  3B6F D;  2HIO A;  1BH8 A;  3REK C;  4Z5T C;  5DNN B;  1P3I A;  5B32 A;  5DNM C;  1P3P D;  4WU9 C;  4G92 C;  3WA9 D;  4KUD A;  3EPJ A;  3W97 A;  5AVB B;  1M19 A;  5E5A C;  5F99 C;  3LEL C;  5BT1 C;  2PYO D;  3B6F C;  4R8P A;  3W96 A;  5AV9 B;  3X1T D;  5B0Y B;  5CP6 A;  4EO5 C;  1S32 D;  3KWQ A;  3WA9 C;  3AV2 A;  3AZL D;  3AZF B;  4XUJ B;  3WAA B;  4LD9 A;  3UT9 C;  5B2I A;  5DNN D;  4WU8 D;  4J8U B;  3V9R A;  3MGS A;  1S32 C;  1TAF B;  5C3I B;  2Y2M A;  4ZUX B;  4XZQ A;  5B2J D;  3UTA B;  3AYW C;  3AZL C;  2JE5 A;  2Y2I A;  2F8N G;  2RVQ C;  4Z66 A;  1KX5 A;  5BO0 A;  4E45 A;  4YM6 A;  3AV1 C;  1P3O C;  2CV5 B;  5B0Y D;  1EQZ D;  4WU8 C;  1JFI B;  3W97 D;  3AZF D;  3AZG B;  4ZBJ B;  3AZM A;  1ID3 A;  4UUZ B;  3WAA D;  3W96 D;  3MGP A;  3VH5 A;  4G91 B;  3VH5 W;  5GSU D;  3AZN B;  3H0L C;  4J8U D;  5B32 C;  1KX3 B;  1EQZ C;  1P3A D;  4CSR B;  5GXQ B;  2Y2H A;  4CAY B;  4E44 A;  3AN2 B;  3B6G A;  3R45 B;  1N1J A;  2ZY2 A;  2YFW A;  5B31 G;  3W97 C;  3UTA D;  2NZD A;  4J8X A;  3W96 C;  5B33 D;  2JSS A;  3AZK A;  5GSU C;  4Z2M G;  3LJA B;  2FJ7 B;  1P3A C;  3KWQ C;  3X1V A;  3AZI B;  5AY8 B;  3REJ B;  3B0D C;  5KDM A;  4KGC B;  3UTB A;  1B6W A;  5AV6 B;  3TU4 D;  4YM6 D;  3AZE B;  5B33 C;  4X23 D;  3LZ0 A;  4H9P B;  3MGS C;  5GXQ D;  3NQU A;  5B1L B;  1ZLA A;  3AN2 D;  4WNN B;  4YS3 D;  1A7W A;  3REK B;  5BNX B;  4Z5T B;  3AFA A;  4Z66 C;  5AV5 A;  1KX5 C;  5DNM B;  3TU4 C;  4WU9 B;  5JRG A;  4YM6 C;  4G92 B;  4WJ3 C;  3MVD D;  4X23 C;  5CPJ D;  3O62 A;  1H3O B;  5E5A B;  5F99 B;  3REI D;  1P3M D;  3LEL B;  1P3L A;  4H9S A;  3B6F B;  4WZS B;  3AZI D;  2Y2O A;  5AY8 D;  5AVC A;  1M18 D;  4YS3 C;  1M1A A;  4KGC D;  5GT0 A;  2BYM A;  4EO5 B;  3AZE D;  3WA9 B;  3C1C A;  5AV8 D;  3MVD C;  3NQJ A;  3REH D;  3REL A;  5B31 A;  3MNN A;  5CPJ C;  3C1B A;  5B1L D;  1W2E A;  4J8W D;  2W8S A;  3REI C;  1P3M C;  3W99 A;  3B6G C;  5BNV B;  5B0Z A;  4H9O A;  3W98 D;  2ZY3 A;  3UT9 B;  1M18 C;  3UTB D;  3WTP E;  5DNM D;  2NQB A;  3A6N A;  1S32 B;  5AV8 C;  1P3B A;  3REH C;  3AYW B;  3AZL B;  3LEL D;  1PZR A;  4J8W C;  1P3K A;  3AV1 B;  1P3O B;  3W98 C;  1AOI A;  3UTB C;  5FUG A;  3WKJ A;  4WU8 B;  3X1U A;  1U35 A;  3A1I A;  3LZ0 C;  2BYK A;  4WV4 B;  4QLC D;  5B2J B;  4JJN A;  5CPK A;  2Y2L A;  1ZLA C;  5AVC D;  1HQ3 A;  1TZY A;  3UT9 D;  5GT0 D;  3AFA C;  5B32 B;  1EQZ B;  3EPH A;  4H9Q A;  5AVB A;  1P3G A;  3W97 B;  3C1B D;  3W99 D;  4QLC C;  1B67 A;  3MGQ A;  3AYW D;  5AV9 A;  1KX4 D;  4H9S C;  2F8N K;  3WTP A;  2RVQ D;  5B0Z D;  5AVC C;  1P3F D;  3W96 B;  3VH5 T;  3AV1 D;  1P3O D;  5CPI A;  5GT0 C;  3LZ1 D;  5GSU B;  1BH9 A;  2F2A C;  2Y2J A;  1P3A B;  3AZH A;  3KWQ B;  3MGR A;  5G49 B;  4XUJ A;  1KU5 A;  3C1C C;  3B0D B;  3C1B C;  3W99 C;  1KX4 C;  5B1M A;  5B0Z C;  2HIO D;  2Y2K A;  2DQN C;  2LY8 A;  1P3F C;  1AOI D;  5B33 B;  4NE3 A;  1P3I D;  1Z2C B;  5B32 D;  3LZ1 C;  3V9R B;  3MGS B;  2NQB C;  3AZJ A;  3A6N C;  3A1K A;  4KUD D;  5BS7 A;  1R4V A;  1M19 D;  1P3B C;  4JJN D;  5CPK D;  2ZY4 A;  1P3K C;  4R8P D;  4Z66 B;  1KX5 B;  5BO0 B;  2RIQ A;  2HIO C;  4UPK A;  4YM6 B;  3TU4 B;  5GT3 A;  1AOI C;  5CP6 D;  4X23 B;  1P3I C;  3WKJ C;  3KWQ D;  3AV2 D;  4KUD C;  1F66 A;  4YS3 B;  2J8P A;  1M19 C;  4AWL C;  4JJN C;  4H9N A;  5CPK C;  1ULY A;  3AZN A;  1HQ3 C;  1TZY C;  2L5A A;  4J8V A;  1KX3 A;  1F1E A;  4R8P C;  4LD9 D;  5CPI D;  5B2I D;  2ZY5 A;  3MVD B;  5CP6 C;  3MGS D;  3R45 A;  5CPJ B;  3MGR D;  2Y2G A;  2ARO A;  3REI B;  1P3G C;  1P3M B;  4XZQ D;  3B6G B;  3AV2 C;  3MGQ C;  1M18 B;  3C1C B;  2UWX A;  3WTP C;  3KXB A;  4Z66 D;  1KX5 D;  2YFV A;  4LD9 C;  5CPI C;  4H9R B;  5B2I C;  2DF4 C;  5AV8 B;  3X1S A;  3KUY A;  3AZH C;  3REH B;  3MGR C;  4J8W B;  5B40 A;  4XZQ C;  5AV6 A;  2F8N A;  5KDM B;  3AZM D;  1ID3 D;  3W98 B;  3EPL A;  3UTB B;  5B1M C;  3MGP D;  3B0C T;  3LZ0 B;  2IO5 C;  1HTA A;  2CWE A;  3AZJ C;  5BNX A;  1ZLA B;  1F66 D;  4Z5T A;  3B6G D;  2ZM5 A;  3EPK A;  3VH6 A;  5B24 A;  3VH6 W;  1BFM A;  2NZD D;  3AZM C;  1ID3 C;  1P34 A;  3AFA B;  4J8X D;  2HUE C;  5B32 G;  1H3O A;  2G5H C;  5GT3 C;  5F99 A;  3MGP C;  3AZK D;  2FFF B;  4QLC B;  3X1V D;  2BG1 A;  4KHA B;  1F66 C;  5AVC B;  1WWS A;  1P3P A;  5GT0 B;  2NZD C;  2BYM B;  3WA9 A;  4J8X C;  4J8V C;  3P5J B;  3AZK C;  3LZ0 D;  3B0C W;  3X1S D;  3NQJ B;  2PYO A; 
#chains in the Genus database with same CATH homology
 3C1B B;  2ARO C;  3X1V C;  1KX4 B;  5B40 D;  1ZLA D;  3W99 B;  3X1T A;  5JA4 B;  5B0Z B;  4H9O B;  2F8N D;  3F6T A;  1P3F B;  1S32 A;  3AFA D;  3KXB C;  3LZ1 B;  5AV5 D;  5JRG D;  2NQB B;  3A6N B;  3AZL A;  3O62 D;  3X1S C;  1P3B B;  3KUY C;  1P3L D;  5B40 C;  5B24 D;  1P3K B;  5DNN A;  4WU8 A;  1M1A D;  4DRA A;  2HIO B;  1BH8 B;  1AOI B;  1P3I B;  3WKJ B;  3H0M C;  5AV5 C;  3EG5 B;  5JRG C;  5B2J A;  2Y2Q A;  3C1C D;  4KUD B;  2BYK B;  3REL D;  5B31 D;  3MNN D;  3O62 C;  1M19 B;  4AWL B;  4JJN B;  5CPK B;  1WWI A;  1P3L C;  1HQ3 B;  1TZY B;  5B0Y A;  5B24 C;  4R8P B;  1EQZ A;  1M1A C;  3B0B A;  1P34 C;  5CP6 B;  4H9Q B;  2NQB D;  3A6N D;  3AZF A;  1P3G B;  3AV2 B;  1P3B D;  3WAA A;  3REL C;  3MGQ B;  5B31 C;  3MNN C;  3WTP B;  1P3K D;  5GSU A;  4J8U A;  4LD9 B;  1P3A A;  5CPI B;  1P3P C;  5B2I B;  1TAF A;  5G49 A;  1BH9 B;  1Q9C A;  3IP4 C;  4ZUX A;  3X1U D;  3WKJ D;  3AZH B;  1U35 D;  3MGR B;  3UTA A;  4XZQ B;  2PYO C;  5B33 A;  2CV5 A;  1HQ3 D;  1TZY D;  5B1M B;  3X1T C;  2Y2P A;  1JFI A;  2IO5 B;  2Y2N A;  3X1U C;  2XD1 A;  5AVB D;  3AZJ B;  3AZG A;  1P3G D;  1U35 C;  4HGA C;  4UUZ A;  3MGQ D;  3TU4 A;  5AV9 D;  3AZM B;  1ID3 B;  3WTP D;  2HUE B;  4X23 A;  5DNN C;  2XD5 A;  4CSR A;  5GT3 B;  5GXQ A;  3H0R C;  3MGP B;  4CAY A;  3AN2 A;  3AZH D;  4YS3 A;  5AVB C;  5B2J C;  4XUJ D;  3AL0 C;  3VH6 T;  1F66 B;  1N1J B;  2YFW B;  4H9N B;  2NZD B;  5AV9 C;  5B1M D;  5B0Y C;  3MVD A;  4J8X B;  4J8V B;  5CPJ A;  3LJA A;  2FJ7 A;  3REI A;  3AZK B;  1P3M A;  4ZUX D;  5CHL B;  3AZJ D;  3AZI A;  5AY8 A;  4DQY B;  3REJ A;  1M18 A;  2ARO B;  3AZF C;  3X1V B;  4KGC A;  4XUJ C;  3WAA C;  2CV5 D;  4H9R A;  3AZE A;  3KXB B;  2G5I C;  2F8N H;  4J8U C;  2YFV B;  4H9P A;  5AV8 A;  5GT3 D;  3REH A;  5B1L A;  5C3I C;  4J8W A;  4ZUX C;  3X1S B;  4WNN A;  3KUY B;  3AZG D;  3NQU B;  3REK A;  3UTA C;  3W98 A;  5B40 B;  5BS7 C;  2F8N B;  4M6B A;  5DNM A;  4WU9 A;  3AZN D;  2CV5 C;  4J8V D;  1KX3 D;  5AV5 B;  4NE6 A;  5JRG B;  5E5A A;  3LEL A;  3B6F A;  3O62 B;  2VQR A;  2ARO D;  3AZG C;  4ZBJ C;  1P3L B;  5B24 B;  1M1A B;  1P34 B;  4G91 C;  3KXB D;  3AZN C;  3KFU G;  3LJA D;  1KX3 C;  2FJ7 D;  5GXQ C;  4QLC A;  4NE5 A;  4KHA A;  4Z2M H;  3AN2 C;  3KUY D;  3REJ D;  5BNV A;  3REL B;  5B31 B;  3MNN B;  4NFT A;  3UT9 A;  1T3U A;  5AV6 D;  3FDD A;  1P3P B;  3LJA C;  2JCH A;  2FJ7 C;  3KSY A;  3AYW A;  1KX4 A;  5JA4 A;  2PYO B;  3REK D;  5AY8 C;  3REJ C;  3AZI C;  1P3F A;  3AV1 A;  4Z5T D;  1P3O A;  4KGC C;  3X1T B;  3LZ1 A;  5AV6 C;  4WU9 D;  1P34 D;  3AZE C;  5FUG B;  3X1U B;  5E5A D;  5F99 D;  1U35 B;  5B1L C;  4HGA B;  5BT1 D;  4DRB A;  3B6F D;  2HIO A;  1BH8 A;  3REK C;  4Z5T C;  5DNN B;  1P3I A;  5B32 A;  5DNM C;  1P3P D;  4WU9 C;  4G92 C;  3WA9 D;  4KUD A;  3EPJ A;  3W97 A;  5AVB B;  1M19 A;  5E5A C;  5F99 C;  3LEL C;  5BT1 C;  2PYO D;  3B6F C;  4R8P A;  3W96 A;  5AV9 B;  3X1T D;  5B0Y B;  5CP6 A;  4EO5 C;  1S32 D;  3KWQ A;  3WA9 C;  3AV2 A;  3AZL D;  3AZF B;  4XUJ B;  3WAA B;  4LD9 A;  3UT9 C;  5B2I A;  5DNN D;  4WU8 D;  4J8U B;  3V9R A;  3MGS A;  1S32 C;  1TAF B;  5C3I B;  2Y2M A;  4ZUX B;  4XZQ A;  5B2J D;  3UTA B;  3AYW C;  3AZL C;  2JE5 A;  2Y2I A;  2F8N G;  2RVQ C;  4Z66 A;  1KX5 A;  5BO0 A;  4E45 A;  4YM6 A;  3AV1 C;  1P3O C;  2CV5 B;  5B0Y D;  1EQZ D;  4WU8 C;  1JFI B;  3W97 D;  3AZF D;  3AZG B;  4ZBJ B;  3AZM A;  1ID3 A;  4UUZ B;  3WAA D;  3W96 D;  3MGP A;  3VH5 A;  4G91 B;  3VH5 W;  5GSU D;  3AZN B;  3H0L C;  4J8U D;  5B32 C;  1KX3 B;  1EQZ C;  1P3A D;  4CSR B;  5GXQ B;  2Y2H A;  4CAY B;  4E44 A;  3AN2 B;  3B6G A;  3R45 B;  1N1J A;  2ZY2 A;  2YFW A;  5B31 G;  3W97 C;  3UTA D;  2NZD A;  4J8X A;  3W96 C;  5B33 D;  2JSS A;  3AZK A;  5GSU C;  4Z2M G;  3LJA B;  2FJ7 B;  1P3A C;  3KWQ C;  3X1V A;  3AZI B;  5AY8 B;  3REJ B;  3B0D C;  5KDM A;  4KGC B;  3UTB A;  1B6W A;  5AV6 B;  3TU4 D;  4YM6 D;  3AZE B;  5B33 C;  4X23 D;  3LZ0 A;  4H9P B;  3MGS C;  5GXQ D;  3NQU A;  5B1L B;  1ZLA A;  3AN2 D;  4WNN B;  4YS3 D;  1A7W A;  3REK B;  5BNX B;  4Z5T B;  3AFA A;  4Z66 C;  5AV5 A;  1KX5 C;  5DNM B;  3TU4 C;  4WU9 B;  5JRG A;  4YM6 C;  4G92 B;  4WJ3 C;  3MVD D;  4X23 C;  5CPJ D;  3O62 A;  1H3O B;  5E5A B;  5F99 B;  3REI D;  1P3M D;  3LEL B;  1P3L A;  4H9S A;  3B6F B;  4WZS B;  3AZI D;  2Y2O A;  5AY8 D;  5AVC A;  1M18 D;  4YS3 C;  1M1A A;  4KGC D;  5GT0 A;  2BYM A;  4EO5 B;  3AZE D;  3WA9 B;  3C1C A;  5AV8 D;  3MVD C;  3NQJ A;  3REH D;  3REL A;  5B31 A;  3MNN A;  5CPJ C;  3C1B A;  5B1L D;  1W2E A;  4J8W D;  2W8S A;  3REI C;  1P3M C;  3W99 A;  3B6G C;  5BNV B;  5B0Z A;  4H9O A;  3W98 D;  2ZY3 A;  3UT9 B;  1M18 C;  3UTB D;  3WTP E;  5DNM D;  2NQB A;  3A6N A;  1S32 B;  5AV8 C;  1P3B A;  3REH C;  3AYW B;  3AZL B;  3LEL D;  1PZR A;  4J8W C;  1P3K A;  3AV1 B;  1P3O B;  3W98 C;  1AOI A;  3UTB C;  5FUG A;  3WKJ A;  4WU8 B;  3X1U A;  1U35 A;  3A1I A;  3LZ0 C;  2BYK A;  4WV4 B;  4QLC D;  5B2J B;  4JJN A;  5CPK A;  2Y2L A;  1ZLA C;  5AVC D;  1HQ3 A;  1TZY A;  3UT9 D;  5GT0 D;  3AFA C;  5B32 B;  1EQZ B;  3EPH A;  4H9Q A;  5AVB A;  1P3G A;  3W97 B;  3C1B D;  3W99 D;  4QLC C;  1B67 A;  3MGQ A;  3AYW D;  5AV9 A;  1KX4 D;  4H9S C;  2F8N K;  3WTP A;  2RVQ D;  5B0Z D;  5AVC C;  1P3F D;  3W96 B;  3VH5 T;  3AV1 D;  1P3O D;  5CPI A;  5GT0 C;  3LZ1 D;  5GSU B;  1BH9 A;  2F2A C;  2Y2J A;  1P3A B;  3AZH A;  3KWQ B;  3MGR A;  5G49 B;  4XUJ A;  1KU5 A;  3C1C C;  3B0D B;  3C1B C;  3W99 C;  1KX4 C;  5B1M A;  5B0Z C;  2HIO D;  2Y2K A;  2DQN C;  2LY8 A;  1P3F C;  1AOI D;  5B33 B;  4NE3 A;  1P3I D;  1Z2C B;  5B32 D;  3LZ1 C;  3V9R B;  3MGS B;  2NQB C;  3AZJ A;  3A6N C;  3A1K A;  4KUD D;  5BS7 A;  1R4V A;  1M19 D;  1P3B C;  4JJN D;  5CPK D;  2ZY4 A;  1P3K C;  4R8P D;  4Z66 B;  1KX5 B;  5BO0 B;  2RIQ A;  2HIO C;  4UPK A;  4YM6 B;  3TU4 B;  5GT3 A;  1AOI C;  5CP6 D;  4X23 B;  1P3I C;  3WKJ C;  3KWQ D;  3AV2 D;  4KUD C;  1F66 A;  4YS3 B;  2J8P A;  1M19 C;  4AWL C;  4JJN C;  4H9N A;  5CPK C;  1ULY A;  3AZN A;  1HQ3 C;  1TZY C;  2L5A A;  4J8V A;  1KX3 A;  1F1E A;  4R8P C;  4LD9 D;  5CPI D;  5B2I D;  2ZY5 A;  3MVD B;  5CP6 C;  3MGS D;  3R45 A;  5CPJ B;  3MGR D;  2Y2G A;  2ARO A;  3REI B;  1P3G C;  1P3M B;  4XZQ D;  3B6G B;  3AV2 C;  3MGQ C;  1M18 B;  3C1C B;  2UWX A;  3WTP C;  3KXB A;  4Z66 D;  1KX5 D;  2YFV A;  4LD9 C;  5CPI C;  4H9R B;  5B2I C;  2DF4 C;  5AV8 B;  3X1S A;  3KUY A;  3AZH C;  3REH B;  3MGR C;  4J8W B;  5B40 A;  4XZQ C;  5AV6 A;  2F8N A;  5KDM B;  3AZM D;  1ID3 D;  3W98 B;  3EPL A;  3UTB B;  5B1M C;  3MGP D;  3B0C T;  3LZ0 B;  2IO5 C;  1HTA A;  2CWE A;  3AZJ C;  5BNX A;  1ZLA B;  1F66 D;  4Z5T A;  3B6G D;  2ZM5 A;  3EPK A;  3VH6 A;  5B24 A;  3VH6 W;  1BFM A;  2NZD D;  3AZM C;  1ID3 C;  1P34 A;  3AFA B;  4J8X D;  2HUE C;  5B32 G;  1H3O A;  2G5H C;  5GT3 C;  5F99 A;  3MGP C;  3AZK D;  2FFF B;  4QLC B;  3X1V D;  2BG1 A;  4KHA B;  1F66 C;  5AVC B;  1WWS A;  1P3P A;  5GT0 B;  2NZD C;  2BYM B;  3WA9 A;  4J8X C;  4J8V C;  3P5J B;  3AZK C;  3LZ0 D;  3B0C W;  3X1S D;  3NQJ B;  2PYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...