5B2ID

Human nucleosome containing cpg unmethylated dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2iD00
1M18C 3W98D 5AV5B 3B6FB 4CAYB 4KUDC 3VH6T 5GT3C 4WU8A 3WAAA 3MNNB 5AV6B 3R45A 5JA4A 4QLCB 3B0DC 5B40C 1P3KB 4YM6A 1P3LA 3KUYB 3X1TC 1M1AC 3TU4B 5AY8B 5CP6C 3MVDC 3AZIB 3X1VA 5AVBB 5AV5A 5B0YD 4CAYA 3AZKB 1EQZB 3UTAC 3UTBA 3AV1D 1P3GD 1M19C 5CPIC 3C1BD 4QLCA 2PYOB 3KUYA 3REKA 3O62C 2BYMA 3MGPB 4G92B 3AZIA 4H9RB 5B0ZB 1F66B 4H9NB 5AVBA 3C1CC 3AZNA 3W99C 3MGRD 3KSYA 2IO5C 1KX5B 5CPJD 3LZ1B 1P3OB 1U35D 3MGPA 1S32C 3LZ0C 3WAAC 2YFVB 3KWQC 4J8XB 1P3AB 1ULYA 4WU9D 5AVCA 2CV5A 1P3LC 3WTPA 4J8WB 5B32C 3AV2D 4JJND 1KX5A 3RELD 4AWLB 1BH8A 3REJD 2CWEA 3WA9A 4J8VD 4WV4B 3MGQB 1P3OA 1ID3B 1TZYD 3VH5T 5DNNB 3UTBC 3AZGD 1P3MC 2YFVA 3MGSD 5CPKC 3AZED 1P3AA 4WNNA 3REKC 1HQ3A 4E44A 4J8WA 1ZLAC 1P3FB 3W97D 5E5AD 5GXQD 3WKJD 3AFAB 3UT9A 3AZMA 3MGQA 1P3PD 2NQBB 5DNNA 2AROB 3AZNC 4X23A 3AZHA 1M18B 5B24C 4KUDB 5GT3B 5GSUD 5B31D 4J8UD 4XUJA 4YS3A 1P3FA 5CHLB 3REHD 4ZUXA 4R8PD 3B0DB 5B40B 1M1AB 4Z66D 3X1TB 1AOID 5CP6B 5JRGD 3MVDB 2NQBA 5AVCC 2CV5C 3WTPC 3AZLC 1M18A 3W96C 2F8NB 4NE5A 3AN2D 2F8NH 2FJ7D 4KUDA 3UTAB 3REID 1M19B 3WA9C 5CPIB 5BT1D 5B40A 4EO5C 1M1AA 3AZFA 3O62B 3AZJD 3X1UC 5CP6A 5BS7C 5F99D 4NE6A 2NZDC 1HQ3C 5AV9A 3VH6W 4H9OB 4KGCD 5BO0B 3UTAA 5B2JD 3C1CB 3LJAC 3UT9C 3AZMC 3KXBD 1M19A 3W99B 2IO5B 5C3IC 5CPIA 3W98A 1P3ID 4XZQC 4X23C 3AZHC 3O62A 1S32B 3LZ0B 4LD9D 3WAAB 3KWQB 4H9OA 4XUJC 4YS3C 3A6ND 3B6GC 3R45B 5JA4B 4ZUXC 5BO0A 1P3BC 1P3LB 5B32B 3C1CA 4NFTA 1P34D 1S32A 3LZ0A 1P3MB 4H9QB 3UTBB 1P3GA 1A7WA 2HIOD 5B1LD 3KWQA 5CPKB 3LELC 4M6BA 3REKB 3AZFC 5B32A 5KDMB 5B33D 1ZLAB 2BYMB 5AV9C 3AYWC 5B2IC 3VH6A 1P3MA 4H9QA 1B6WA 3AZNB 5CPKA 5B1MC 4DRAA 5DNMC 5B24B 3W98C 4Z5TD 1WWSA 1U35A 5AV8D 4Z2MH 5KDMA 1ZLAA 3VH5W 5AVCB 2CV5B 1KX4D 3WTPB 3AZLB 3AV2A 3B0BA 3W96B 5B24A 1BH8B 5B0YC 5GT0D 3WTPE 1JFIB 3WA9B 1TZYA 1B67A 3AZGA 3AV1C 4WU8D 1P3GC 3X1SD 4EO5B 3X1UB 3C1BC 2BYKB 4YM6D 4WNNB 3AZLA 2NZDB 1HQ3B 1Q9CA 3X1VD 3W96A 4CSRB 5GXQA 5AV5D 3B6FD 1P3PA 3LJAB 3UT9B 3AZMB 1JFIA 5C3IB 3MNND 3MGRC 4XZQB 5AV6D 4X23B 3AZHB 3X1UA 4QLCD 5CPJC 1P3KD 5GSUA 5BS7A 3KUYD 3TU4D 5AY8D 1U35C 2NZDA 4KHAB 4XUJB 4YS3B 1BH9B 3AZID 3B6GB 4ZUXB 1AOIA 4CSRA 5AVBD 1P3BB 5JRGA 4WU9C 5G49B 3AZKD 3LJAA 1EQZD 1BFMA 3AV2C 3V9RB 4UUZA 2YFWA 4JJNC 4XZQA 2FJ7A 3RELC 2HUEC 2PYOD 3REJC 2F8NK 4J8VC 3B0CT 3MGPD 4KHAA 1TZYC 1BH9A 3AZGC 3LELB 1F66D 5B0ZD 3B6GA 3MGSC 3AZJA 3AZEC 1P3BA 3AZFB 5G49A 3V9RA 5AV9B 3W97C 4KGCA 1KX5D 5E5AC 3AYWB 5GXQC 5B2IB 3WKJC 3LZ1D 1P3PC 1P3OD 4H9SC 5B1MB 1P3IA 5DNMB 3LELA 3W98B 4J8XD 1P3AD 2RVQD 5GSUC 4LD9A 5B31C 4J8WD 4J8UC 3A6NA 3REHC 1KX3D 4R8PC 4Z66C 3AYWA 1AOIC 5B2IA 4G91C 5JRGC 3MGQD 1ID3D 5B1MA 5DNMA 1P34A 4HGAC 2FJ7C 5B0YB 3AN2C 3NQJB 5B31G 3REIC 3AV1B 1P3GB 5B1LA 2HIOA 1P3FD 5BT1C 3C1BB 3AZJC 3AFAD 2NQBD 5F99C 1WWIA 2AROD 1KX3C 1M18D 5B0YA 2LY8A 4KGCC 3NQJA 4H9PB 4KUDD 5B2JC 5GT3D 3AV1A 3KXBC 3MGRB 5BNXB 3C1BA 5CPJB 1P3IC 5B40D 1M1AD 3X1TD 1N1JB 1U35B 3MVDD 4LD9C 3A6NC 2F8ND 4WU9B 4H9PA 1KX4A 3UTAD 4WZSB 3AV2B 1M19D 4JJNB 3MGRA 5BNXA 3RELB 2HUEB 5CPID 5CPJA 1P34C 5GT0A 3REJB 3O62D 1N1JA 4J8VB 4NE3A 1TZYB 3X1SA 3AZGB 3MGSB 5B1LC 2HIOC 3AZEB 4WU9A 5B33C 3C1CD 3W99D 4JJNA 3W97B 2BYKA 5E5AB 3RELA 5GXQB 3B6FA 3WKJB 3REJA 4J8VA 1P3PB 5FUGB 1S32D 3LZ0D 3MNNA 3WAAD 5AV6A 3MGSA 3KWQD 3AZEA 2AROC 1P3KA 3TU4A 4Z5TC 1P3LD 5GSUB 5AY8A 5AV8C 5B31B 5B32D 4J8UB 3REHB 3W97A 4R8PB 5E5AA 3B0CW 4Z66B 1AOIB 2F8NG 3WKJA 4ZBJC 3AZKA 1EQZA 4G91B 5JRGB 5FUGA 1KX4C 4H9SA 1P3MD 3UTBD 4UUZB 1KU5A 2YFWB 5CPKD 4HGAB 2FJ7B 3AN2B 2PYOA 3REIB 5GT0C 3REKD 5B31A 1ZLAD 4J8UA 4WU8C 3REHA 4H9RA 5B0ZA 4R8PA 4H9NA 3X1SC 1F66A 4Z66A 3AZJB 4YM6C 5F99B 3VH5A 3AZND 1KX3B 3X1VC 4KGCB 3AN2A 5B24D 3LZ1A 5AV5C 5B2JB 3B6FC 3REIA 1H3OB 3KXBB 1P3IB 1HTAA 3MNNC 4J8XA 5AV6C 4QLCC 1P3KC 5B32G 3KUYC 5F99A 4DRBA 5AVCD 3TU4C 2CV5D 5AY8C 3WTPD 3AZLD 4LD9B 1KX3A 3A6NB 3AZIC 3W96D 3NQUB 5AVBC 5B2JA 1ID3A 3AZKC 1EQZC 3WA9D 1H3OA 3KXBA 1P34B 3X1UD 2PYOC 4E45A 2NZDD 1HQ3D 3MGPC 4G92C 5B1LB 2HIOB 1F66C 5B0ZC 2JSSA 3NQUA 3AFAA 5B33B 3LJAD 3UT9D 3AZMD 1R4VA 2AROA 5DNND 4XZQD 2L5AA 4X23D 1F1EA 3AZHD 1KX5C 4Z2MG 5GT3A 3LZ1C 1P3OC 4XUJD 4YS3D 3B6GD 4ZUXD 3X1TA 1P3BD 4Z5TB 4J8XC 1P3AC 5AV8B 5B33A 3MVDA 2RVQC 5BNVB 4J8WC 2F8NA 4ZBJB 4AWLC 1TAFB 1KX4B 3MGQC 1ID3C 5DNNC 3LELD 4Z5TA 5GT0B 3AZFD 5AV8A 5CP6D 4WU8B 5BNVA 3X1SB 1P3FC 5AV9D 4YM6B 3AYWD 1TAFA 5B2ID 3AFAC 3W99A 2NQBC 3X1VB 5B1MD 5DNMD
chains in the Genus database with same CATH superfamily
1M18C 3W98D 5AV5B 3B6FB 4CAYB 4KUDC 3VH6T 5GT3C 4WU8A 3WAAA 3MNNB 5AV6B 3R45A 5JA4A 4QLCB 3B0DC 5B40C 1P3KB 4YM6A 1P3LA 3KUYB 3X1TC 1M1AC 3TU4B 5AY8B 5CP6C 3MVDC 3AZIB 3X1VA 5AVBB 5AV5A 5B0YD 4CAYA 3AZKB 1EQZB 3UTAC 3UTBA 3AV1D 1P3GD 1M19C 5CPIC 3C1BD 4QLCA 2PYOB 3KUYA 3REKA 3O62C 2BYMA 3MGPB 4G92B 3AZIA 4H9RB 5B0ZB 1F66B 4H9NB 5AVBA 2Y2GA 3A1IA 3C1CC 3AZNA 3W99C 3MGRD 3KSYA 2IO5C 1KX5B 5CPJD 3LZ1B 4UPKA 1P3OB 1U35D 3MGPA 1S32C 3LZ0C 3WAAC 2YFVB 3KWQC 4J8XB 1P3AB 1ULYA 2ZY3A 4WU9D 5AVCA 2CV5A 1P3LC 3WTPA 4J8WB 5B32C 3AV2D 4JJND 1KX5A 3RELD 4AWLB 1BH8A 3REJD 2CWEA 3WA9A 4J8VD 4WV4B 3MGQB 1P3OA 1ID3B 2JE5A 1TZYD 3VH5T 5DNNB 3UTBC 3AZGD 1P3MC 2YFVA 3MGSD 5CPKC 3AZED 1P3AA 4WNNA 3REKC 1HQ3A 4E44A 4J8WA 1ZLAC 1P3FB 3W97D 5E5AD 5GXQD 3WKJD 3AFAB 3UT9A 3AZMA 3MGQA 1P3PD 2NQBB 5DNNA 2AROB 3AZNC 4X23A 3AZHA 1M18B 5B24C 4KUDB 5GT3B 5GSUD 5B31D 4J8UD 4XUJA 4YS3A 1P3FA 5CHLB 3REHD 4ZUXA 4R8PD 2Y2NA 3B0DB 5B40B 1M1AB 4Z66D 3X1TB 1AOID 5CP6B 5JRGD 3MVDB 2NQBA 5AVCC 2Y2LA 2CV5C 3WTPC 3AZLC 1M18A 2VQRA 3W96C 2F8NB 4NE5A 3IP4C 3AN2D 2F8NH 2FJ7D 4KUDA 3UTAB 3REID 1M19B 3WA9C 5CPIB 5BT1D 5B40A 4EO5C 1M1AA 3AZFA 3O62B 3AZJD 3X1UC 2Y2KA 5CP6A 5BS7C 5F99D 4NE6A 2NZDC 1HQ3C 1T3UA 5AV9A 3VH6W 4H9OB 2Y2HA 4KGCD 5BO0B 3UTAA 5B2JD 3C1CB 3LJAC 3UT9C 3AZMC 3KXBD 1M19A 3W99B 2IO5B 5C3IC 5CPIA 3W98A 1P3ID 4XZQC 4X23C 3AZHC 3O62A 1S32B 3KFUG 3LZ0B 4LD9D 3WAAB 3KWQB 4H9OA 4XUJC 4YS3C 3A6ND 3B6GC 3R45B 2F2AC 5JA4B 4ZUXC 5BO0A 1P3BC 1P3LB 5B32B 3C1CA 2J8PA 3EPJA 4NFTA 1P34D 1S32A 3LZ0A 1P3MB 4H9QB 3UTBB 1P3GA 1A7WA 2HIOD 5B1LD 3KWQA 5CPKB 3LELC 4M6BA 3REKB 3AZFC 2ZM5A 5B32A 5KDMB 5B33D 1ZLAB 2BYMB 3H0LC 3EG5B 5AV9C 3AYWC 5B2IC 3VH6A 1P3MA 4H9QA 1B6WA 3AZNB 5CPKA 5B1MC 4DRAA 5DNMC 5B24B 3W98C 4Z5TD 1WWSA 1U35A 5AV8D 4Z2MH 5KDMA 1ZLAA 3VH5W 2G5IC 5AVCB 2CV5B 1KX4D 3WTPB 3AZLB 3AV2A 3B0BA 3W96B 2Y2IA 5B24A 1BH8B 2JCHA 5B0YC 5GT0D 3WTPE 1JFIB 3WA9B 1TZYA 1B67A 3AZGA 3AV1C 4WU8D 1P3GC 3X1SD 4EO5B 3X1UB 3C1BC 2BYKB 4YM6D 4WNNB 3AZLA 2NZDB 1HQ3B 1Q9CA 3X1VD 3W96A 4CSRB 5GXQA 1W2EA 5AV5D 3B6FD 1P3PA 3LJAB 3UT9B 3AZMB 1JFIA 5C3IB 2ZY2A 3MNND 3MGRC 4XZQB 5AV6D 4X23B 3AZHB 3X1UA 4QLCD 5CPJC 1P3KD 5GSUA 5BS7A 3KUYD 3TU4D 5AY8D 1U35C 2NZDA 4KHAB 2Y2QA 4XUJB 4YS3B 1BH9B 3AZID 3B6GB 4ZUXB 1AOIA 4CSRA 5AVBD 1P3BB 5JRGA 4WU9C 5G49B 3AZKD 3LJAA 1EQZD 1BFMA 3AL0C 3AV2C 3V9RB 4UUZA 2YFWA 4JJNC 4XZQA 2FJ7A 3RELC 2HUEC 2PYOD 3REJC 2F8NK 3H0RC 4J8VC 3B0CT 3MGPD 4KHAA 1TZYC 1BH9A 3AZGC 3LELB 1F66D 5B0ZD 3B6GA 3P5JB 3MGSC 3AZJA 3AZEC 1P3BA 3AZFB 5G49A 2Y2PA 3V9RA 5AV9B 3W97C 4KGCA 1KX5D 5E5AC 3AYWB 5GXQC 5B2IB 3WKJC 2W8SA 3LZ1D 1P3PC 1P3OD 4H9SC 5B1MB 1P3IA 5DNMB 3LELA 3W98B 4J8XD 1P3AD 2RVQD 5GSUC 4LD9A 5B31C 4J8WD 4J8UC 3A6NA 3REHC 1KX3D 4R8PC 4Z66C 3AYWA 1AOIC 5B2IA 4G91C 5JRGC 3MGQD 1ID3D 5B1MA 5DNMA 1P34A 4HGAC 2FJ7C 5B0YB 3AN2C 3NQJB 2BG1A 5B31G 3REIC 3AV1B 1P3GB 5B1LA 2HIOA 3EPHA 1P3FD 5BT1C 3C1BB 1PZRA 3AZJC 3AFAD 2NQBD 5F99C 1WWIA 2AROD 1KX3C 1M18D 5B0YA 2LY8A 4KGCC 3NQJA 4H9PB 4KUDD 5B2JC 5GT3D 3AV1A 2UWXA 3KXBC 3MGRB 5BNXB 3C1BA 5CPJB 1P3IC 5B40D 2XD1A 1M1AD 3X1TD 1N1JB 1U35B 3MVDD 4LD9C 3A6NC 2F8ND 4WU9B 4H9PA 1KX4A 3UTAD 4WZSB 3AV2B 1M19D 4JJNB 3MGRA 5BNXA 3RELB 2HUEB 5CPID 5CPJA 1P34C 5GT0A 3REJB 3O62D 1N1JA 4J8VB 4NE3A 1TZYB 3X1SA 3AZGB 3MGSB 5B1LC 2HIOC 3AZEB 4WU9A 2FFFB 2Y2OA 2G5HC 5B33C 3C1CD 3W99D 4JJNA 3W97B 2BYKA 5E5AB 2ZY4A 3RELA 5GXQB 3B6FA 3WKJB 3REJA 4J8VA 1P3PB 5FUGB 1S32D 3LZ0D 3MNNA 3WAAD 5AV6A 3MGSA 3KWQD 3AZEA 2AROC 1P3KA 3TU4A 4Z5TC 1P3LD 5GSUB 5AY8A 5AV8C 5B31B 5B32D 4J8UB 3REHB 3W97A 4R8PB 5E5AA 3B0CW 4Z66B 1AOIB 2F8NG 3WKJA 2Y2MA 4ZBJC 3AZKA 1EQZA 4G91B 5JRGB 5FUGA 2DF4C 1KX4C 4H9SA 1P3MD 3UTBD 4UUZB 1KU5A 2YFWB 5CPKD 4HGAB 2FJ7B 3AN2B 2PYOA 3REIB 2RIQA 5GT0C 3REKD 5B31A 1ZLAD 4J8UA 4WU8C 3REHA 4H9RA 5B0ZA 4R8PA 4H9NA 3X1SC 1F66A 4Z66A 3EPKA 3AZJB 4YM6C 5F99B 3VH5A 3AZND 1KX3B 2XD5A 3X1VC 4KGCB 3AN2A 5B24D 4DQYB 3LZ1A 5AV5C 5B2JB 3B6FC 3REIA 1H3OB 3KXBB 2DQNC 1P3IB 1HTAA 3MNNC 4J8XA 5AV6C 4QLCC 1P3KC 5B32G 3KUYC 5F99A 4DRBA 5AVCD 3TU4C 2CV5D 5AY8C 3WTPD 3AZLD 4LD9B 1KX3A 3A6NB 3AZIC 3W96D 2Y2JA 3NQUB 5AVBC 5B2JA 1ID3A 3AZKC 1EQZC 3WA9D 1H3OA 3KXBA 1P34B 3X1UD 2PYOC 4E45A 2NZDD 1HQ3D 3MGPC 4G92C 5B1LB 2HIOB 1Z2CB 3H0MC 5B0ZC 1F66C 2JSSA 3NQUA 3AFAA 5B33B 3LJAD 3UT9D 3AZMD 1R4VA 2AROA 5DNND 4XZQD 2L5AA 4X23D 1F1EA 3AZHD 1KX5C 4Z2MG 5GT3A 3LZ1C 3A1KA 1P3OC 4XUJD 4YS3D 3B6GD 4ZUXD 3X1TA 1P3BD 4Z5TB 4J8XC 1P3AC 5AV8B 5B33A 3MVDA 2RVQC 5BNVB 4J8WC 2ZY5A 2F8NA 4ZBJB 4AWLC 1TAFB 3FDDA 1KX4B 3MGQC 1ID3C 5DNNC 3LELD 3EPLA 4Z5TA 5GT0B 3AZFD 5AV8A 5CP6D 4WU8B 5BNVA 3X1SB 3F6TA 1P3FC 5AV9D 4YM6B 3AYWD 1TAFA 5B2ID 3AFAC 3W99A 2NQBC 4WJ3C 3X1VB 5B1MD 5DNMD
chains in the Genus database with same CATH topology
1M18C 3W98D 5AV5B 3B6FB 4CAYB 4KUDC 3VH6T 5GT3C 4WU8A 3WAAA 3MNNB 5AV6B 3R45A 5JA4A 4QLCB 3B0DC 5B40C 1P3KB 4YM6A 1P3LA 3KUYB 3X1TC 1M1AC 3TU4B 5AY8B 5CP6C 3MVDC 3AZIB 3X1VA 5AVBB 5AV5A 5B0YD 4CAYA 3AZKB 1EQZB 3UTAC 3UTBA 3AV1D 1P3GD 1M19C 5CPIC 3C1BD 4QLCA 2PYOB 3KUYA 3REKA 3O62C 2BYMA 3MGPB 4G92B 3AZIA 4H9RB 5B0ZB 1F66B 4H9NB 5AVBA 2Y2GA 3A1IA 3C1CC 3AZNA 3W99C 3MGRD 3KSYA 2IO5C 1KX5B 5CPJD 3LZ1B 4UPKA 1P3OB 1U35D 3MGPA 1S32C 3LZ0C 3WAAC 2YFVB 3KWQC 4J8XB 1P3AB 1ULYA 2ZY3A 4WU9D 5AVCA 2CV5A 1P3LC 3WTPA 4J8WB 5B32C 3AV2D 4JJND 1KX5A 3RELD 4AWLB 1BH8A 3REJD 2CWEA 3WA9A 4J8VD 4WV4B 3MGQB 1P3OA 1ID3B 2JE5A 1TZYD 3VH5T 5DNNB 3UTBC 3AZGD 1P3MC 2YFVA 3MGSD 5CPKC 3AZED 1P3AA 4WNNA 3REKC 1HQ3A 4E44A 4J8WA 1ZLAC 1P3FB 3W97D 5E5AD 5GXQD 3WKJD 3AFAB 3UT9A 3AZMA 3MGQA 1P3PD 2NQBB 5DNNA 2AROB 3AZNC 4X23A 3AZHA 1M18B 5B24C 4KUDB 5GT3B 5GSUD 5B31D 4J8UD 4XUJA 4YS3A 1P3FA 5CHLB 3REHD 4ZUXA 4R8PD 2Y2NA 3B0DB 5B40B 1M1AB 4Z66D 3X1TB 1AOID 5CP6B 5JRGD 3MVDB 2NQBA 5AVCC 2Y2LA 2CV5C 3WTPC 3AZLC 1M18A 2VQRA 3W96C 2F8NB 4NE5A 3IP4C 3AN2D 2F8NH 2FJ7D 4KUDA 3UTAB 3REID 1M19B 3WA9C 5CPIB 5BT1D 5B40A 4EO5C 1M1AA 3AZFA 3O62B 3AZJD 3X1UC 2Y2KA 5CP6A 5BS7C 5F99D 4NE6A 2NZDC 1HQ3C 1T3UA 5AV9A 3VH6W 4H9OB 2Y2HA 4KGCD 5BO0B 3UTAA 5B2JD 3C1CB 3LJAC 3UT9C 3AZMC 3KXBD 1M19A 3W99B 2IO5B 5C3IC 5CPIA 3W98A 1P3ID 4XZQC 4X23C 3AZHC 3O62A 1S32B 3KFUG 3LZ0B 4LD9D 3WAAB 3KWQB 4H9OA 4XUJC 4YS3C 3A6ND 3B6GC 3R45B 2F2AC 5JA4B 4ZUXC 5BO0A 1P3BC 1P3LB 5B32B 3C1CA 2J8PA 3EPJA 4NFTA 1P34D 1S32A 3LZ0A 1P3MB 4H9QB 3UTBB 1P3GA 1A7WA 2HIOD 5B1LD 3KWQA 5CPKB 3LELC 4M6BA 3REKB 3AZFC 2ZM5A 5B32A 5KDMB 5B33D 1ZLAB 2BYMB 3H0LC 3EG5B 5AV9C 3AYWC 5B2IC 3VH6A 1P3MA 4H9QA 1B6WA 3AZNB 5CPKA 5B1MC 4DRAA 5DNMC 5B24B 3W98C 4Z5TD 1WWSA 1U35A 5AV8D 4Z2MH 5KDMA 1ZLAA 3VH5W 2G5IC 5AVCB 2CV5B 1KX4D 3WTPB 3AZLB 3AV2A 3B0BA 3W96B 2Y2IA 5B24A 1BH8B 2JCHA 5B0YC 5GT0D 3WTPE 1JFIB 3WA9B 1TZYA 1B67A 3AZGA 3AV1C 4WU8D 1P3GC 3X1SD 4EO5B 3X1UB 3C1BC 2BYKB 4YM6D 4WNNB 3AZLA 2NZDB 1HQ3B 1Q9CA 3X1VD 3W96A 4CSRB 5GXQA 1W2EA 5AV5D 3B6FD 1P3PA 3LJAB 3UT9B 3AZMB 1JFIA 5C3IB 2ZY2A 3MNND 3MGRC 4XZQB 5AV6D 4X23B 3AZHB 3X1UA 4QLCD 5CPJC 1P3KD 5GSUA 5BS7A 3KUYD 3TU4D 5AY8D 1U35C 2NZDA 4KHAB 2Y2QA 4XUJB 4YS3B 1BH9B 3AZID 3B6GB 4ZUXB 1AOIA 4CSRA 5AVBD 1P3BB 5JRGA 4WU9C 5G49B 3AZKD 3LJAA 1EQZD 1BFMA 3AL0C 3AV2C 3V9RB 4UUZA 2YFWA 4JJNC 4XZQA 2FJ7A 3RELC 2HUEC 2PYOD 3REJC 2F8NK 3H0RC 4J8VC 3B0CT 3MGPD 4KHAA 1TZYC 1BH9A 3AZGC 3LELB 1F66D 5B0ZD 3B6GA 3P5JB 3MGSC 3AZJA 3AZEC 1P3BA 3AZFB 5G49A 2Y2PA 3V9RA 5AV9B 3W97C 4KGCA 1KX5D 5E5AC 3AYWB 5GXQC 5B2IB 3WKJC 2W8SA 3LZ1D 1P3PC 1P3OD 4H9SC 5B1MB 1P3IA 5DNMB 3LELA 3W98B 4J8XD 1P3AD 2RVQD 5GSUC 4LD9A 5B31C 4J8WD 4J8UC 3A6NA 3REHC 1KX3D 4R8PC 4Z66C 3AYWA 1AOIC 5B2IA 4G91C 5JRGC 3MGQD 1ID3D 5B1MA 5DNMA 1P34A 4HGAC 2FJ7C 5B0YB 3AN2C 3NQJB 2BG1A 5B31G 3REIC 3AV1B 1P3GB 5B1LA 2HIOA 3EPHA 1P3FD 5BT1C 3C1BB 1PZRA 3AZJC 3AFAD 2NQBD 5F99C 1WWIA 2AROD 1KX3C 1M18D 5B0YA 2LY8A 4KGCC 3NQJA 4H9PB 4KUDD 5B2JC 5GT3D 3AV1A 2UWXA 3KXBC 3MGRB 5BNXB 3C1BA 5CPJB 1P3IC 5B40D 2XD1A 1M1AD 3X1TD 1N1JB 1U35B 3MVDD 4LD9C 3A6NC 2F8ND 4WU9B 4H9PA 1KX4A 3UTAD 4WZSB 3AV2B 1M19D 4JJNB 3MGRA 5BNXA 3RELB 2HUEB 5CPID 5CPJA 1P34C 5GT0A 3REJB 3O62D 1N1JA 4J8VB 4NE3A 1TZYB 3X1SA 3AZGB 3MGSB 5B1LC 2HIOC 3AZEB 4WU9A 2FFFB 2Y2OA 2G5HC 5B33C 3C1CD 3W99D 4JJNA 3W97B 2BYKA 5E5AB 2ZY4A 3RELA 5GXQB 3B6FA 3WKJB 3REJA 4J8VA 1P3PB 5FUGB 1S32D 3LZ0D 3MNNA 3WAAD 5AV6A 3MGSA 3KWQD 3AZEA 2AROC 1P3KA 3TU4A 4Z5TC 1P3LD 5GSUB 5AY8A 5AV8C 5B31B 5B32D 4J8UB 3REHB 3W97A 4R8PB 5E5AA 3B0CW 4Z66B 1AOIB 2F8NG 3WKJA 2Y2MA 4ZBJC 3AZKA 1EQZA 4G91B 5JRGB 5FUGA 2DF4C 1KX4C 4H9SA 1P3MD 3UTBD 4UUZB 1KU5A 2YFWB 5CPKD 4HGAB 2FJ7B 3AN2B 2PYOA 3REIB 2RIQA 5GT0C 3REKD 5B31A 1ZLAD 4J8UA 4WU8C 3REHA 4H9RA 5B0ZA 4R8PA 4H9NA 3X1SC 1F66A 4Z66A 3EPKA 3AZJB 4YM6C 5F99B 3VH5A 3AZND 1KX3B 2XD5A 3X1VC 4KGCB 3AN2A 5B24D 4DQYB 3LZ1A 5AV5C 5B2JB 3B6FC 3REIA 1H3OB 3KXBB 2DQNC 1P3IB 1HTAA 3MNNC 4J8XA 5AV6C 4QLCC 1P3KC 5B32G 3KUYC 5F99A 4DRBA 5AVCD 3TU4C 2CV5D 5AY8C 3WTPD 3AZLD 4LD9B 1KX3A 3A6NB 3AZIC 3W96D 2Y2JA 3NQUB 5AVBC 5B2JA 1ID3A 3AZKC 1EQZC 3WA9D 1H3OA 3KXBA 1P34B 3X1UD 2PYOC 4E45A 2NZDD 1HQ3D 3MGPC 4G92C 5B1LB 2HIOB 1Z2CB 3H0MC 5B0ZC 1F66C 2JSSA 3NQUA 3AFAA 5B33B 3LJAD 3UT9D 3AZMD 1R4VA 2AROA 5DNND 4XZQD 2L5AA 4X23D 1F1EA 3AZHD 1KX5C 4Z2MG 5GT3A 3LZ1C 3A1KA 1P3OC 4XUJD 4YS3D 3B6GD 4ZUXD 3X1TA 1P3BD 4Z5TB 4J8XC 1P3AC 5AV8B 5B33A 3MVDA 2RVQC 5BNVB 4J8WC 2ZY5A 2F8NA 4ZBJB 4AWLC 1TAFB 3FDDA 1KX4B 3MGQC 1ID3C 5DNNC 3LELD 3EPLA 4Z5TA 5GT0B 3AZFD 5AV8A 5CP6D 4WU8B 5BNVA 3X1SB 3F6TA 1P3FC 5AV9D 4YM6B 3AYWD 1TAFA 5B2ID 3AFAC 3W99A 2NQBC 4WJ3C 3X1VB 5B1MD 5DNMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M18 C;  3W98 D;  5AV5 B;  3B6F B;  4CAY B;  4KUD C;  3VH6 T;  5GT3 C;  4WU8 A;  3WAA A;  3MNN B;  5AV6 B;  3R45 A;  5JA4 A;  4QLC B;  3B0D C;  5B40 C;  1P3K B;  4YM6 A;  1P3L A;  3KUY B;  3X1T C;  1M1A C;  3TU4 B;  5AY8 B;  5CP6 C;  3MVD C;  3AZI B;  3X1V A;  5AVB B;  5AV5 A;  5B0Y D;  4CAY A;  3AZK B;  1EQZ B;  3UTA C;  3UTB A;  3AV1 D;  1P3G D;  1M19 C;  5CPI C;  3C1B D;  4QLC A;  2PYO B;  3KUY A;  3REK A;  3O62 C;  2BYM A;  3MGP B;  4G92 B;  3AZI A;  4H9R B;  5B0Z B;  1F66 B;  4H9N B;  5AVB A;  3C1C C;  3AZN A;  3W99 C;  3MGR D;  3KSY A;  2IO5 C;  1KX5 B;  5CPJ D;  3LZ1 B;  1P3O B;  1U35 D;  3MGP A;  1S32 C;  3LZ0 C;  3WAA C;  2YFV B;  3KWQ C;  4J8X B;  1P3A B;  1ULY A;  4WU9 D;  5AVC A;  2CV5 A;  1P3L C;  3WTP A;  4J8W B;  5B32 C;  3AV2 D;  4JJN D;  1KX5 A;  3REL D;  4AWL B;  1BH8 A;  3REJ D;  2CWE A;  3WA9 A;  4J8V D;  4WV4 B;  3MGQ B;  1P3O A;  1ID3 B;  1TZY D;  3VH5 T;  5DNN B;  3UTB C;  3AZG D;  1P3M C;  2YFV A;  3MGS D;  5CPK C;  3AZE D;  1P3A A;  4WNN A;  3REK C;  1HQ3 A;  4E44 A;  4J8W A;  1ZLA C;  1P3F B;  3W97 D;  5E5A D;  5GXQ D;  3WKJ D;  3AFA B;  3UT9 A;  3AZM A;  3MGQ A;  1P3P D;  2NQB B;  5DNN A;  2ARO B;  3AZN C;  4X23 A;  3AZH A;  1M18 B;  5B24 C;  4KUD B;  5GT3 B;  5GSU D;  5B31 D;  4J8U D;  4XUJ A;  4YS3 A;  1P3F A;  5CHL B;  3REH D;  4ZUX A;  4R8P D;  3B0D B;  5B40 B;  1M1A B;  4Z66 D;  3X1T B;  1AOI D;  5CP6 B;  5JRG D;  3MVD B;  2NQB A;  5AVC C;  2CV5 C;  3WTP C;  3AZL C;  1M18 A;  3W96 C;  2F8N B;  4NE5 A;  3AN2 D;  2F8N H;  2FJ7 D;  4KUD A;  3UTA B;  3REI D;  1M19 B;  3WA9 C;  5CPI B;  5BT1 D;  5B40 A;  4EO5 C;  1M1A A;  3AZF A;  3O62 B;  3AZJ D;  3X1U C;  5CP6 A;  5BS7 C;  5F99 D;  4NE6 A;  2NZD C;  1HQ3 C;  5AV9 A;  3VH6 W;  4H9O B;  4KGC D;  5BO0 B;  3UTA A;  5B2J D;  3C1C B;  3LJA C;  3UT9 C;  3AZM C;  3KXB D;  1M19 A;  3W99 B;  2IO5 B;  5C3I C;  5CPI A;  3W98 A;  1P3I D;  4XZQ C;  4X23 C;  3AZH C;  3O62 A;  1S32 B;  3LZ0 B;  4LD9 D;  3WAA B;  3KWQ B;  4H9O A;  4XUJ C;  4YS3 C;  3A6N D;  3B6G C;  3R45 B;  5JA4 B;  4ZUX C;  5BO0 A;  1P3B C;  1P3L B;  5B32 B;  3C1C A;  4NFT A;  1P34 D;  1S32 A;  3LZ0 A;  1P3M B;  4H9Q B;  3UTB B;  1P3G A;  1A7W A;  2HIO D;  5B1L D;  3KWQ A;  5CPK B;  3LEL C;  4M6B A;  3REK B;  3AZF C;  5B32 A;  5KDM B;  5B33 D;  1ZLA B;  2BYM B;  5AV9 C;  3AYW C;  5B2I C;  3VH6 A;  1P3M A;  4H9Q A;  1B6W A;  3AZN B;  5CPK A;  5B1M C;  4DRA A;  5DNM C;  5B24 B;  3W98 C;  4Z5T D;  1WWS A;  1U35 A;  5AV8 D;  4Z2M H;  5KDM A;  1ZLA A;  3VH5 W;  5AVC B;  2CV5 B;  1KX4 D;  3WTP B;  3AZL B;  3AV2 A;  3B0B A;  3W96 B;  5B24 A;  1BH8 B;  5B0Y C;  5GT0 D;  3WTP E;  1JFI B;  3WA9 B;  1TZY A;  1B67 A;  3AZG A;  3AV1 C;  4WU8 D;  1P3G C;  3X1S D;  4EO5 B;  3X1U B;  3C1B C;  2BYK B;  4YM6 D;  4WNN B;  3AZL A;  2NZD B;  1HQ3 B;  1Q9C A;  3X1V D;  3W96 A;  4CSR B;  5GXQ A;  5AV5 D;  3B6F D;  1P3P A;  3LJA B;  3UT9 B;  3AZM B;  1JFI A;  5C3I B;  3MNN D;  3MGR C;  4XZQ B;  5AV6 D;  4X23 B;  3AZH B;  3X1U A;  4QLC D;  5CPJ C;  1P3K D;  5GSU A;  5BS7 A;  3KUY D;  3TU4 D;  5AY8 D;  1U35 C;  2NZD A;  4KHA B;  4XUJ B;  4YS3 B;  1BH9 B;  3AZI D;  3B6G B;  4ZUX B;  1AOI A;  4CSR A;  5AVB D;  1P3B B;  5JRG A;  4WU9 C;  5G49 B;  3AZK D;  3LJA A;  1EQZ D;  1BFM A;  3AV2 C;  3V9R B;  4UUZ A;  2YFW A;  4JJN C;  4XZQ A;  2FJ7 A;  3REL C;  2HUE C;  2PYO D;  3REJ C;  2F8N K;  4J8V C;  3B0C T;  3MGP D;  4KHA A;  1TZY C;  1BH9 A;  3AZG C;  3LEL B;  1F66 D;  5B0Z D;  3B6G A;  3MGS C;  3AZJ A;  3AZE C;  1P3B A;  3AZF B;  5G49 A;  3V9R A;  5AV9 B;  3W97 C;  4KGC A;  1KX5 D;  5E5A C;  3AYW B;  5GXQ C;  5B2I B;  3WKJ C;  3LZ1 D;  1P3P C;  1P3O D;  4H9S C;  5B1M B;  1P3I A;  5DNM B;  3LEL A;  3W98 B;  4J8X D;  1P3A D;  2RVQ D;  5GSU C;  4LD9 A;  5B31 C;  4J8W D;  4J8U C;  3A6N A;  3REH C;  1KX3 D;  4R8P C;  4Z66 C;  3AYW A;  1AOI C;  5B2I A;  4G91 C;  5JRG C;  3MGQ D;  1ID3 D;  5B1M A;  5DNM A;  1P34 A;  4HGA C;  2FJ7 C;  5B0Y B;  3AN2 C;  3NQJ B;  5B31 G;  3REI C;  3AV1 B;  1P3G B;  5B1L A;  2HIO A;  1P3F D;  5BT1 C;  3C1B B;  3AZJ C;  3AFA D;  2NQB D;  5F99 C;  1WWI A;  2ARO D;  1KX3 C;  1M18 D;  5B0Y A;  2LY8 A;  4KGC C;  3NQJ A;  4H9P B;  4KUD D;  5B2J C;  5GT3 D;  3AV1 A;  3KXB C;  3MGR B;  5BNX B;  3C1B A;  5CPJ B;  1P3I C;  5B40 D;  1M1A D;  3X1T D;  1N1J B;  1U35 B;  3MVD D;  4LD9 C;  3A6N C;  2F8N D;  4WU9 B;  4H9P A;  1KX4 A;  3UTA D;  4WZS B;  3AV2 B;  1M19 D;  4JJN B;  3MGR A;  5BNX A;  3REL B;  2HUE B;  5CPI D;  5CPJ A;  1P34 C;  5GT0 A;  3REJ B;  3O62 D;  1N1J A;  4J8V B;  4NE3 A;  1TZY B;  3X1S A;  3AZG B;  3MGS B;  5B1L C;  2HIO C;  3AZE B;  4WU9 A;  5B33 C;  3C1C D;  3W99 D;  4JJN A;  3W97 B;  2BYK A;  5E5A B;  3REL A;  5GXQ B;  3B6F A;  3WKJ B;  3REJ A;  4J8V A;  1P3P B;  5FUG B;  1S32 D;  3LZ0 D;  3MNN A;  3WAA D;  5AV6 A;  3MGS A;  3KWQ D;  3AZE A;  2ARO C;  1P3K A;  3TU4 A;  4Z5T C;  1P3L D;  5GSU B;  5AY8 A;  5AV8 C;  5B31 B;  5B32 D;  4J8U B;  3REH B;  3W97 A;  4R8P B;  5E5A A;  3B0C W;  4Z66 B;  1AOI B;  2F8N G;  3WKJ A;  4ZBJ C;  3AZK A;  1EQZ A;  4G91 B;  5JRG B;  5FUG A;  1KX4 C;  4H9S A;  1P3M D;  3UTB D;  4UUZ B;  1KU5 A;  2YFW B;  5CPK D;  4HGA B;  2FJ7 B;  3AN2 B;  2PYO A;  3REI B;  5GT0 C;  3REK D;  5B31 A;  1ZLA D;  4J8U A;  4WU8 C;  3REH A;  4H9R A;  5B0Z A;  4R8P A;  4H9N A;  3X1S C;  1F66 A;  4Z66 A;  3AZJ B;  4YM6 C;  5F99 B;  3VH5 A;  3AZN D;  1KX3 B;  3X1V C;  4KGC B;  3AN2 A;  5B24 D;  3LZ1 A;  5AV5 C;  5B2J B;  3B6F C;  3REI A;  1H3O B;  3KXB B;  1P3I B;  1HTA A;  3MNN C;  4J8X A;  5AV6 C;  4QLC C;  1P3K C;  5B32 G;  3KUY C;  5F99 A;  4DRB A;  5AVC D;  3TU4 C;  2CV5 D;  5AY8 C;  3WTP D;  3AZL D;  4LD9 B;  1KX3 A;  3A6N B;  3AZI C;  3W96 D;  3NQU B;  5AVB C;  5B2J A;  1ID3 A;  3AZK C;  1EQZ C;  3WA9 D;  1H3O A;  3KXB A;  1P34 B;  3X1U D;  2PYO C;  4E45 A;  2NZD D;  1HQ3 D;  3MGP C;  4G92 C;  5B1L B;  2HIO B;  1F66 C;  5B0Z C;  2JSS A;  3NQU A;  3AFA A;  5B33 B;  3LJA D;  3UT9 D;  3AZM D;  1R4V A;  2ARO A;  5DNN D;  4XZQ D;  2L5A A;  4X23 D;  1F1E A;  3AZH D;  1KX5 C;  4Z2M G;  5GT3 A;  3LZ1 C;  1P3O C;  4XUJ D;  4YS3 D;  3B6G D;  4ZUX D;  3X1T A;  1P3B D;  4Z5T B;  4J8X C;  1P3A C;  5AV8 B;  5B33 A;  3MVD A;  2RVQ C;  5BNV B;  4J8W C;  2F8N A;  4ZBJ B;  4AWL C;  1TAF B;  1KX4 B;  3MGQ C;  1ID3 C;  5DNN C;  3LEL D;  4Z5T A;  5GT0 B;  3AZF D;  5AV8 A;  5CP6 D;  4WU8 B;  5BNV A;  3X1S B;  1P3F C;  5AV9 D;  4YM6 B;  3AYW D;  1TAF A;  5B2I D;  3AFA C;  3W99 A;  2NQB C;  3X1V B;  5B1M D;  5DNM D; 
#chains in the Genus database with same CATH topology
 1M18 C;  3W98 D;  5AV5 B;  3B6F B;  4CAY B;  4KUD C;  3VH6 T;  5GT3 C;  4WU8 A;  3WAA A;  3MNN B;  5AV6 B;  3R45 A;  5JA4 A;  4QLC B;  3B0D C;  5B40 C;  1P3K B;  4YM6 A;  1P3L A;  3KUY B;  3X1T C;  1M1A C;  3TU4 B;  5AY8 B;  5CP6 C;  3MVD C;  3AZI B;  3X1V A;  5AVB B;  5AV5 A;  5B0Y D;  4CAY A;  3AZK B;  1EQZ B;  3UTA C;  3UTB A;  3AV1 D;  1P3G D;  1M19 C;  5CPI C;  3C1B D;  4QLC A;  2PYO B;  3KUY A;  3REK A;  3O62 C;  2BYM A;  3MGP B;  4G92 B;  3AZI A;  4H9R B;  5B0Z B;  1F66 B;  4H9N B;  5AVB A;  2Y2G A;  3A1I A;  3C1C C;  3AZN A;  3W99 C;  3MGR D;  3KSY A;  2IO5 C;  1KX5 B;  5CPJ D;  3LZ1 B;  4UPK A;  1P3O B;  1U35 D;  3MGP A;  1S32 C;  3LZ0 C;  3WAA C;  2YFV B;  3KWQ C;  4J8X B;  1P3A B;  1ULY A;  2ZY3 A;  4WU9 D;  5AVC A;  2CV5 A;  1P3L C;  3WTP A;  4J8W B;  5B32 C;  3AV2 D;  4JJN D;  1KX5 A;  3REL D;  4AWL B;  1BH8 A;  3REJ D;  2CWE A;  3WA9 A;  4J8V D;  4WV4 B;  3MGQ B;  1P3O A;  1ID3 B;  2JE5 A;  1TZY D;  3VH5 T;  5DNN B;  3UTB C;  3AZG D;  1P3M C;  2YFV A;  3MGS D;  5CPK C;  3AZE D;  1P3A A;  4WNN A;  3REK C;  1HQ3 A;  4E44 A;  4J8W A;  1ZLA C;  1P3F B;  3W97 D;  5E5A D;  5GXQ D;  3WKJ D;  3AFA B;  3UT9 A;  3AZM A;  3MGQ A;  1P3P D;  2NQB B;  5DNN A;  2ARO B;  3AZN C;  4X23 A;  3AZH A;  1M18 B;  5B24 C;  4KUD B;  5GT3 B;  5GSU D;  5B31 D;  4J8U D;  4XUJ A;  4YS3 A;  1P3F A;  5CHL B;  3REH D;  4ZUX A;  4R8P D;  2Y2N A;  3B0D B;  5B40 B;  1M1A B;  4Z66 D;  3X1T B;  1AOI D;  5CP6 B;  5JRG D;  3MVD B;  2NQB A;  5AVC C;  2Y2L A;  2CV5 C;  3WTP C;  3AZL C;  1M18 A;  2VQR A;  3W96 C;  2F8N B;  4NE5 A;  3IP4 C;  3AN2 D;  2F8N H;  2FJ7 D;  4KUD A;  3UTA B;  3REI D;  1M19 B;  3WA9 C;  5CPI B;  5BT1 D;  5B40 A;  4EO5 C;  1M1A A;  3AZF A;  3O62 B;  3AZJ D;  3X1U C;  2Y2K A;  5CP6 A;  5BS7 C;  5F99 D;  4NE6 A;  2NZD C;  1HQ3 C;  1T3U A;  5AV9 A;  3VH6 W;  4H9O B;  2Y2H A;  4KGC D;  5BO0 B;  3UTA A;  5B2J D;  3C1C B;  3LJA C;  3UT9 C;  3AZM C;  3KXB D;  1M19 A;  3W99 B;  2IO5 B;  5C3I C;  5CPI A;  3W98 A;  1P3I D;  4XZQ C;  4X23 C;  3AZH C;  3O62 A;  1S32 B;  3KFU G;  3LZ0 B;  4LD9 D;  3WAA B;  3KWQ B;  4H9O A;  4XUJ C;  4YS3 C;  3A6N D;  3B6G C;  3R45 B;  2F2A C;  5JA4 B;  4ZUX C;  5BO0 A;  1P3B C;  1P3L B;  5B32 B;  3C1C A;  2J8P A;  3EPJ A;  4NFT A;  1P34 D;  1S32 A;  3LZ0 A;  1P3M B;  4H9Q B;  3UTB B;  1P3G A;  1A7W A;  2HIO D;  5B1L D;  3KWQ A;  5CPK B;  3LEL C;  4M6B A;  3REK B;  3AZF C;  2ZM5 A;  5B32 A;  5KDM B;  5B33 D;  1ZLA B;  2BYM B;  3H0L C;  3EG5 B;  5AV9 C;  3AYW C;  5B2I C;  3VH6 A;  1P3M A;  4H9Q A;  1B6W A;  3AZN B;  5CPK A;  5B1M C;  4DRA A;  5DNM C;  5B24 B;  3W98 C;  4Z5T D;  1WWS A;  1U35 A;  5AV8 D;  4Z2M H;  5KDM A;  1ZLA A;  3VH5 W;  2G5I C;  5AVC B;  2CV5 B;  1KX4 D;  3WTP B;  3AZL B;  3AV2 A;  3B0B A;  3W96 B;  2Y2I A;  5B24 A;  1BH8 B;  2JCH A;  5B0Y C;  5GT0 D;  3WTP E;  1JFI B;  3WA9 B;  1TZY A;  1B67 A;  3AZG A;  3AV1 C;  4WU8 D;  1P3G C;  3X1S D;  4EO5 B;  3X1U B;  3C1B C;  2BYK B;  4YM6 D;  4WNN B;  3AZL A;  2NZD B;  1HQ3 B;  1Q9C A;  3X1V D;  3W96 A;  4CSR B;  5GXQ A;  1W2E A;  5AV5 D;  3B6F D;  1P3P A;  3LJA B;  3UT9 B;  3AZM B;  1JFI A;  5C3I B;  2ZY2 A;  3MNN D;  3MGR C;  4XZQ B;  5AV6 D;  4X23 B;  3AZH B;  3X1U A;  4QLC D;  5CPJ C;  1P3K D;  5GSU A;  5BS7 A;  3KUY D;  3TU4 D;  5AY8 D;  1U35 C;  2NZD A;  4KHA B;  2Y2Q A;  4XUJ B;  4YS3 B;  1BH9 B;  3AZI D;  3B6G B;  4ZUX B;  1AOI A;  4CSR A;  5AVB D;  1P3B B;  5JRG A;  4WU9 C;  5G49 B;  3AZK D;  3LJA A;  1EQZ D;  1BFM A;  3AL0 C;  3AV2 C;  3V9R B;  4UUZ A;  2YFW A;  4JJN C;  4XZQ A;  2FJ7 A;  3REL C;  2HUE C;  2PYO D;  3REJ C;  2F8N K;  3H0R C;  4J8V C;  3B0C T;  3MGP D;  4KHA A;  1TZY C;  1BH9 A;  3AZG C;  3LEL B;  1F66 D;  5B0Z D;  3B6G A;  3P5J B;  3MGS C;  3AZJ A;  3AZE C;  1P3B A;  3AZF B;  5G49 A;  2Y2P A;  3V9R A;  5AV9 B;  3W97 C;  4KGC A;  1KX5 D;  5E5A C;  3AYW B;  5GXQ C;  5B2I B;  3WKJ C;  2W8S A;  3LZ1 D;  1P3P C;  1P3O D;  4H9S C;  5B1M B;  1P3I A;  5DNM B;  3LEL A;  3W98 B;  4J8X D;  1P3A D;  2RVQ D;  5GSU C;  4LD9 A;  5B31 C;  4J8W D;  4J8U C;  3A6N A;  3REH C;  1KX3 D;  4R8P C;  4Z66 C;  3AYW A;  1AOI C;  5B2I A;  4G91 C;  5JRG C;  3MGQ D;  1ID3 D;  5B1M A;  5DNM A;  1P34 A;  4HGA C;  2FJ7 C;  5B0Y B;  3AN2 C;  3NQJ B;  2BG1 A;  5B31 G;  3REI C;  3AV1 B;  1P3G B;  5B1L A;  2HIO A;  3EPH A;  1P3F D;  5BT1 C;  3C1B B;  1PZR A;  3AZJ C;  3AFA D;  2NQB D;  5F99 C;  1WWI A;  2ARO D;  1KX3 C;  1M18 D;  5B0Y A;  2LY8 A;  4KGC C;  3NQJ A;  4H9P B;  4KUD D;  5B2J C;  5GT3 D;  3AV1 A;  2UWX A;  3KXB C;  3MGR B;  5BNX B;  3C1B A;  5CPJ B;  1P3I C;  5B40 D;  2XD1 A;  1M1A D;  3X1T D;  1N1J B;  1U35 B;  3MVD D;  4LD9 C;  3A6N C;  2F8N D;  4WU9 B;  4H9P A;  1KX4 A;  3UTA D;  4WZS B;  3AV2 B;  1M19 D;  4JJN B;  3MGR A;  5BNX A;  3REL B;  2HUE B;  5CPI D;  5CPJ A;  1P34 C;  5GT0 A;  3REJ B;  3O62 D;  1N1J A;  4J8V B;  4NE3 A;  1TZY B;  3X1S A;  3AZG B;  3MGS B;  5B1L C;  2HIO C;  3AZE B;  4WU9 A;  2FFF B;  2Y2O A;  2G5H C;  5B33 C;  3C1C D;  3W99 D;  4JJN A;  3W97 B;  2BYK A;  5E5A B;  2ZY4 A;  3REL A;  5GXQ B;  3B6F A;  3WKJ B;  3REJ A;  4J8V A;  1P3P B;  5FUG B;  1S32 D;  3LZ0 D;  3MNN A;  3WAA D;  5AV6 A;  3MGS A;  3KWQ D;  3AZE A;  2ARO C;  1P3K A;  3TU4 A;  4Z5T C;  1P3L D;  5GSU B;  5AY8 A;  5AV8 C;  5B31 B;  5B32 D;  4J8U B;  3REH B;  3W97 A;  4R8P B;  5E5A A;  3B0C W;  4Z66 B;  1AOI B;  2F8N G;  3WKJ A;  2Y2M A;  4ZBJ C;  3AZK A;  1EQZ A;  4G91 B;  5JRG B;  5FUG A;  2DF4 C;  1KX4 C;  4H9S A;  1P3M D;  3UTB D;  4UUZ B;  1KU5 A;  2YFW B;  5CPK D;  4HGA B;  2FJ7 B;  3AN2 B;  2PYO A;  3REI B;  2RIQ A;  5GT0 C;  3REK D;  5B31 A;  1ZLA D;  4J8U A;  4WU8 C;  3REH A;  4H9R A;  5B0Z A;  4R8P A;  4H9N A;  3X1S C;  1F66 A;  4Z66 A;  3EPK A;  3AZJ B;  4YM6 C;  5F99 B;  3VH5 A;  3AZN D;  1KX3 B;  2XD5 A;  3X1V C;  4KGC B;  3AN2 A;  5B24 D;  4DQY B;  3LZ1 A;  5AV5 C;  5B2J B;  3B6F C;  3REI A;  1H3O B;  3KXB B;  2DQN C;  1P3I B;  1HTA A;  3MNN C;  4J8X A;  5AV6 C;  4QLC C;  1P3K C;  5B32 G;  3KUY C;  5F99 A;  4DRB A;  5AVC D;  3TU4 C;  2CV5 D;  5AY8 C;  3WTP D;  3AZL D;  4LD9 B;  1KX3 A;  3A6N B;  3AZI C;  3W96 D;  2Y2J A;  3NQU B;  5AVB C;  5B2J A;  1ID3 A;  3AZK C;  1EQZ C;  3WA9 D;  1H3O A;  3KXB A;  1P34 B;  3X1U D;  2PYO C;  4E45 A;  2NZD D;  1HQ3 D;  3MGP C;  4G92 C;  5B1L B;  2HIO B;  1Z2C B;  3H0M C;  5B0Z C;  1F66 C;  2JSS A;  3NQU A;  3AFA A;  5B33 B;  3LJA D;  3UT9 D;  3AZM D;  1R4V A;  2ARO A;  5DNN D;  4XZQ D;  2L5A A;  4X23 D;  1F1E A;  3AZH D;  1KX5 C;  4Z2M G;  5GT3 A;  3LZ1 C;  3A1K A;  1P3O C;  4XUJ D;  4YS3 D;  3B6G D;  4ZUX D;  3X1T A;  1P3B D;  4Z5T B;  4J8X C;  1P3A C;  5AV8 B;  5B33 A;  3MVD A;  2RVQ C;  5BNV B;  4J8W C;  2ZY5 A;  2F8N A;  4ZBJ B;  4AWL C;  1TAF B;  3FDD A;  1KX4 B;  3MGQ C;  1ID3 C;  5DNN C;  3LEL D;  3EPL A;  4Z5T A;  5GT0 B;  3AZF D;  5AV8 A;  5CP6 D;  4WU8 B;  5BNV A;  3X1S B;  3F6T A;  1P3F C;  5AV9 D;  4YM6 B;  3AYW D;  1TAF A;  5B2I D;  3AFA C;  3W99 A;  2NQB C;  4WJ3 C;  3X1V B;  5B1M D;  5DNM D; 
#chains in the Genus database with same CATH homology
 1M18 C;  3W98 D;  5AV5 B;  3B6F B;  4CAY B;  4KUD C;  3VH6 T;  5GT3 C;  4WU8 A;  3WAA A;  3MNN B;  5AV6 B;  3R45 A;  5JA4 A;  4QLC B;  3B0D C;  5B40 C;  1P3K B;  4YM6 A;  1P3L A;  3KUY B;  3X1T C;  1M1A C;  3TU4 B;  5AY8 B;  5CP6 C;  3MVD C;  3AZI B;  3X1V A;  5AVB B;  5AV5 A;  5B0Y D;  4CAY A;  3AZK B;  1EQZ B;  3UTA C;  3UTB A;  3AV1 D;  1P3G D;  1M19 C;  5CPI C;  3C1B D;  4QLC A;  2PYO B;  3KUY A;  3REK A;  3O62 C;  2BYM A;  3MGP B;  4G92 B;  3AZI A;  4H9R B;  5B0Z B;  1F66 B;  4H9N B;  5AVB A;  2Y2G A;  3A1I A;  3C1C C;  3AZN A;  3W99 C;  3MGR D;  3KSY A;  2IO5 C;  1KX5 B;  5CPJ D;  3LZ1 B;  4UPK A;  1P3O B;  1U35 D;  3MGP A;  1S32 C;  3LZ0 C;  3WAA C;  2YFV B;  3KWQ C;  4J8X B;  1P3A B;  1ULY A;  2ZY3 A;  4WU9 D;  5AVC A;  2CV5 A;  1P3L C;  3WTP A;  4J8W B;  5B32 C;  3AV2 D;  4JJN D;  1KX5 A;  3REL D;  4AWL B;  1BH8 A;  3REJ D;  2CWE A;  3WA9 A;  4J8V D;  4WV4 B;  3MGQ B;  1P3O A;  1ID3 B;  2JE5 A;  1TZY D;  3VH5 T;  5DNN B;  3UTB C;  3AZG D;  1P3M C;  2YFV A;  3MGS D;  5CPK C;  3AZE D;  1P3A A;  4WNN A;  3REK C;  1HQ3 A;  4E44 A;  4J8W A;  1ZLA C;  1P3F B;  3W97 D;  5E5A D;  5GXQ D;  3WKJ D;  3AFA B;  3UT9 A;  3AZM A;  3MGQ A;  1P3P D;  2NQB B;  5DNN A;  2ARO B;  3AZN C;  4X23 A;  3AZH A;  1M18 B;  5B24 C;  4KUD B;  5GT3 B;  5GSU D;  5B31 D;  4J8U D;  4XUJ A;  4YS3 A;  1P3F A;  5CHL B;  3REH D;  4ZUX A;  4R8P D;  2Y2N A;  3B0D B;  5B40 B;  1M1A B;  4Z66 D;  3X1T B;  1AOI D;  5CP6 B;  5JRG D;  3MVD B;  2NQB A;  5AVC C;  2Y2L A;  2CV5 C;  3WTP C;  3AZL C;  1M18 A;  2VQR A;  3W96 C;  2F8N B;  4NE5 A;  3IP4 C;  3AN2 D;  2F8N H;  2FJ7 D;  4KUD A;  3UTA B;  3REI D;  1M19 B;  3WA9 C;  5CPI B;  5BT1 D;  5B40 A;  4EO5 C;  1M1A A;  3AZF A;  3O62 B;  3AZJ D;  3X1U C;  2Y2K A;  5CP6 A;  5BS7 C;  5F99 D;  4NE6 A;  2NZD C;  1HQ3 C;  1T3U A;  5AV9 A;  3VH6 W;  4H9O B;  2Y2H A;  4KGC D;  5BO0 B;  3UTA A;  5B2J D;  3C1C B;  3LJA C;  3UT9 C;  3AZM C;  3KXB D;  1M19 A;  3W99 B;  2IO5 B;  5C3I C;  5CPI A;  3W98 A;  1P3I D;  4XZQ C;  4X23 C;  3AZH C;  3O62 A;  1S32 B;  3KFU G;  3LZ0 B;  4LD9 D;  3WAA B;  3KWQ B;  4H9O A;  4XUJ C;  4YS3 C;  3A6N D;  3B6G C;  3R45 B;  2F2A C;  5JA4 B;  4ZUX C;  5BO0 A;  1P3B C;  1P3L B;  5B32 B;  3C1C A;  2J8P A;  3EPJ A;  4NFT A;  1P34 D;  1S32 A;  3LZ0 A;  1P3M B;  4H9Q B;  3UTB B;  1P3G A;  1A7W A;  2HIO D;  5B1L D;  3KWQ A;  5CPK B;  3LEL C;  4M6B A;  3REK B;  3AZF C;  2ZM5 A;  5B32 A;  5KDM B;  5B33 D;  1ZLA B;  2BYM B;  3H0L C;  3EG5 B;  5AV9 C;  3AYW C;  5B2I C;  3VH6 A;  1P3M A;  4H9Q A;  1B6W A;  3AZN B;  5CPK A;  5B1M C;  4DRA A;  5DNM C;  5B24 B;  3W98 C;  4Z5T D;  1WWS A;  1U35 A;  5AV8 D;  4Z2M H;  5KDM A;  1ZLA A;  3VH5 W;  2G5I C;  5AVC B;  2CV5 B;  1KX4 D;  3WTP B;  3AZL B;  3AV2 A;  3B0B A;  3W96 B;  2Y2I A;  5B24 A;  1BH8 B;  2JCH A;  5B0Y C;  5GT0 D;  3WTP E;  1JFI B;  3WA9 B;  1TZY A;  1B67 A;  3AZG A;  3AV1 C;  4WU8 D;  1P3G C;  3X1S D;  4EO5 B;  3X1U B;  3C1B C;  2BYK B;  4YM6 D;  4WNN B;  3AZL A;  2NZD B;  1HQ3 B;  1Q9C A;  3X1V D;  3W96 A;  4CSR B;  5GXQ A;  1W2E A;  5AV5 D;  3B6F D;  1P3P A;  3LJA B;  3UT9 B;  3AZM B;  1JFI A;  5C3I B;  2ZY2 A;  3MNN D;  3MGR C;  4XZQ B;  5AV6 D;  4X23 B;  3AZH B;  3X1U A;  4QLC D;  5CPJ C;  1P3K D;  5GSU A;  5BS7 A;  3KUY D;  3TU4 D;  5AY8 D;  1U35 C;  2NZD A;  4KHA B;  2Y2Q A;  4XUJ B;  4YS3 B;  1BH9 B;  3AZI D;  3B6G B;  4ZUX B;  1AOI A;  4CSR A;  5AVB D;  1P3B B;  5JRG A;  4WU9 C;  5G49 B;  3AZK D;  3LJA A;  1EQZ D;  1BFM A;  3AL0 C;  3AV2 C;  3V9R B;  4UUZ A;  2YFW A;  4JJN C;  4XZQ A;  2FJ7 A;  3REL C;  2HUE C;  2PYO D;  3REJ C;  2F8N K;  3H0R C;  4J8V C;  3B0C T;  3MGP D;  4KHA A;  1TZY C;  1BH9 A;  3AZG C;  3LEL B;  1F66 D;  5B0Z D;  3B6G A;  3P5J B;  3MGS C;  3AZJ A;  3AZE C;  1P3B A;  3AZF B;  5G49 A;  2Y2P A;  3V9R A;  5AV9 B;  3W97 C;  4KGC A;  1KX5 D;  5E5A C;  3AYW B;  5GXQ C;  5B2I B;  3WKJ C;  2W8S A;  3LZ1 D;  1P3P C;  1P3O D;  4H9S C;  5B1M B;  1P3I A;  5DNM B;  3LEL A;  3W98 B;  4J8X D;  1P3A D;  2RVQ D;  5GSU C;  4LD9 A;  5B31 C;  4J8W D;  4J8U C;  3A6N A;  3REH C;  1KX3 D;  4R8P C;  4Z66 C;  3AYW A;  1AOI C;  5B2I A;  4G91 C;  5JRG C;  3MGQ D;  1ID3 D;  5B1M A;  5DNM A;  1P34 A;  4HGA C;  2FJ7 C;  5B0Y B;  3AN2 C;  3NQJ B;  2BG1 A;  5B31 G;  3REI C;  3AV1 B;  1P3G B;  5B1L A;  2HIO A;  3EPH A;  1P3F D;  5BT1 C;  3C1B B;  1PZR A;  3AZJ C;  3AFA D;  2NQB D;  5F99 C;  1WWI A;  2ARO D;  1KX3 C;  1M18 D;  5B0Y A;  2LY8 A;  4KGC C;  3NQJ A;  4H9P B;  4KUD D;  5B2J C;  5GT3 D;  3AV1 A;  2UWX A;  3KXB C;  3MGR B;  5BNX B;  3C1B A;  5CPJ B;  1P3I C;  5B40 D;  2XD1 A;  1M1A D;  3X1T D;  1N1J B;  1U35 B;  3MVD D;  4LD9 C;  3A6N C;  2F8N D;  4WU9 B;  4H9P A;  1KX4 A;  3UTA D;  4WZS B;  3AV2 B;  1M19 D;  4JJN B;  3MGR A;  5BNX A;  3REL B;  2HUE B;  5CPI D;  5CPJ A;  1P34 C;  5GT0 A;  3REJ B;  3O62 D;  1N1J A;  4J8V B;  4NE3 A;  1TZY B;  3X1S A;  3AZG B;  3MGS B;  5B1L C;  2HIO C;  3AZE B;  4WU9 A;  2FFF B;  2Y2O A;  2G5H C;  5B33 C;  3C1C D;  3W99 D;  4JJN A;  3W97 B;  2BYK A;  5E5A B;  2ZY4 A;  3REL A;  5GXQ B;  3B6F A;  3WKJ B;  3REJ A;  4J8V A;  1P3P B;  5FUG B;  1S32 D;  3LZ0 D;  3MNN A;  3WAA D;  5AV6 A;  3MGS A;  3KWQ D;  3AZE A;  2ARO C;  1P3K A;  3TU4 A;  4Z5T C;  1P3L D;  5GSU B;  5AY8 A;  5AV8 C;  5B31 B;  5B32 D;  4J8U B;  3REH B;  3W97 A;  4R8P B;  5E5A A;  3B0C W;  4Z66 B;  1AOI B;  2F8N G;  3WKJ A;  2Y2M A;  4ZBJ C;  3AZK A;  1EQZ A;  4G91 B;  5JRG B;  5FUG A;  2DF4 C;  1KX4 C;  4H9S A;  1P3M D;  3UTB D;  4UUZ B;  1KU5 A;  2YFW B;  5CPK D;  4HGA B;  2FJ7 B;  3AN2 B;  2PYO A;  3REI B;  2RIQ A;  5GT0 C;  3REK D;  5B31 A;  1ZLA D;  4J8U A;  4WU8 C;  3REH A;  4H9R A;  5B0Z A;  4R8P A;  4H9N A;  3X1S C;  1F66 A;  4Z66 A;  3EPK A;  3AZJ B;  4YM6 C;  5F99 B;  3VH5 A;  3AZN D;  1KX3 B;  2XD5 A;  3X1V C;  4KGC B;  3AN2 A;  5B24 D;  4DQY B;  3LZ1 A;  5AV5 C;  5B2J B;  3B6F C;  3REI A;  1H3O B;  3KXB B;  2DQN C;  1P3I B;  1HTA A;  3MNN C;  4J8X A;  5AV6 C;  4QLC C;  1P3K C;  5B32 G;  3KUY C;  5F99 A;  4DRB A;  5AVC D;  3TU4 C;  2CV5 D;  5AY8 C;  3WTP D;  3AZL D;  4LD9 B;  1KX3 A;  3A6N B;  3AZI C;  3W96 D;  2Y2J A;  3NQU B;  5AVB C;  5B2J A;  1ID3 A;  3AZK C;  1EQZ C;  3WA9 D;  1H3O A;  3KXB A;  1P34 B;  3X1U D;  2PYO C;  4E45 A;  2NZD D;  1HQ3 D;  3MGP C;  4G92 C;  5B1L B;  2HIO B;  1Z2C B;  3H0M C;  5B0Z C;  1F66 C;  2JSS A;  3NQU A;  3AFA A;  5B33 B;  3LJA D;  3UT9 D;  3AZM D;  1R4V A;  2ARO A;  5DNN D;  4XZQ D;  2L5A A;  4X23 D;  1F1E A;  3AZH D;  1KX5 C;  4Z2M G;  5GT3 A;  3LZ1 C;  3A1K A;  1P3O C;  4XUJ D;  4YS3 D;  3B6G D;  4ZUX D;  3X1T A;  1P3B D;  4Z5T B;  4J8X C;  1P3A C;  5AV8 B;  5B33 A;  3MVD A;  2RVQ C;  5BNV B;  4J8W C;  2ZY5 A;  2F8N A;  4ZBJ B;  4AWL C;  1TAF B;  3FDD A;  1KX4 B;  3MGQ C;  1ID3 C;  5DNN C;  3LEL D;  3EPL A;  4Z5T A;  5GT0 B;  3AZF D;  5AV8 A;  5CP6 D;  4WU8 B;  5BNV A;  3X1S B;  3F6T A;  1P3F C;  5AV9 D;  4YM6 B;  3AYW D;  1TAF A;  5B2I D;  3AFA C;  3W99 A;  2NQB C;  4WJ3 C;  3X1V B;  5B1M D;  5DNM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...