5B2ID

Human nucleosome containing cpg unmethylated dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2iD00
5CPJD 5CPIB 5JRGC 3KXBD 5BT1C 3VH5T 5AV5B 3MVDC 1U35C 3WA9C 4KHAA 3AV2D 3MGSD 1F66D 3R45B 4UUZA 3AZKA 3AZND 5DNNA 5C3IB 1BH9B 5B2JB 3C1BC 5E5AA 3AZFB 4XUJA 5GT3A 1P34A 1P3OD 3KWQD 5GXQC 3A6NB 1Q9CA 3REIC 4WU9A 2YFVA 5AV6C 1P3GD 5AY8D 1P3PD 4JJNA 2CV5C 2PYOD 3B0BA 3TU4D 3AZMD 3B6GD 3AZIC 3MGQC 4J8VD 1P3AA 5GSUB 5B32B 4X23A 3VH6A 1P3PA 3MNNA 5FUGB 3KUYC 3LELD 3W97A 5CPKD 3O62C 4QLCC 3C1CC 3AYWC 5CP6C 4ZUXB 1P3FB 4R8PB 3X1TB 2IO5C 4H9SC 3B6FB 3B0DC 4Z5TD 4J8UD 5B0ZC 1M1AD 3AV1B 3UTBA 5B31A 1H3OB 4YM6B 1TZYB 2HUEC 5GT0B 3AZJD 3W99C 2F8NA 1P3BD 3LJAD 3REJA 1M18D 1AOID 3X1VB 1KX3A 3REHA 1S32B 4H9QA 3MGPC 1ZLAA 4LD9A 4KHAB 5BO0A 4UUZB 3AZEA 5CHLB 3LZ1C 2HIOD 5E5AB 2F8NK 5CPID 3MGSB 5B32G 1P34B 5AV5D 4KUDA 4EO5B 5AVCC 4WU9B 2F8NH 3AZLC 4JJNB 3LZ0A 4J8XC 4Z2MG 4WV4B 5B0YC 3WTPC 1KX4A 3AFAA 3AZFD 1P3AB 3VH5W 1N1JA 5KDMB 4X23B 3A6ND 5AV8A 1P3PB 3MNNB 3W98A 4J8WA 3W97B 1P3KA 1KX5C 1U35A 5JRGA 3WA9A 5GSUD 5B32D 3MVDA 1EQZC 5B33C 3UTBB 5B31B 3C1BA 3UTAC 4ZUXD 1P3FD 2F8NB 3W96C 1M1AB 3B6FD 4E45A 5GXQA 5B1MD 3REJB 4YS3C 3REIA 3KSYA 5AV6A 1KX3B 3REHB 3RELC 2CV5A 4YM6D 4H9QB 4LD9B 1HQ3C 3AZIA 3MGQA 3LJAB 5CP6D 2RVQC 5BO0B 5DNMC 4G91B 3AZEB 3KUYA 1P3MC 3O62A 4QLCA 3C1CA 4KUDB 4WZSB 3AYWA 5CP6A 3WKJC 4J8WC 4H9SA 3AZHC 5BNXA 5B0ZA 3AZKD 2HIOB 5DNND 4KGCC 4NFTA 4CAYA 5E5AD 1KX4B 3AFAB 1N1JB 4XUJD 3NQJA 5GT3D 1P34D 2BYKB 4G92B 3W99A 4WNNA 5AV8B 4WU9D 3W98B 1JFIA 5JA4A 1BH8A 4DRAA 4JJND 5AVBC 1P3KB 4Z66C 1KU5A 3MGRC 3MGPA 5JRGB 1U35B 1P3AD 3MVDB 3AZGC 5C3IC 4X23D 2AROC 5B24C 3MNND 1M19C 3W97D 3LZ1A 3C1BB 3UT9C 3X1SC 3WTPD 2FJ7C 5GXQB 5AVCA 4XZQC 3REIB 5AV6B 3UTBD 3AZLA 4WU8C 5B31D 2CV5B 3X1UC 5BNVA 4J8XA 5B0YA 3WTPA 2NQBC 1ID3C 3AZIB 3MGQB 2F8ND 5AV9C 5B1MB 1B6WA 1TAFA 3REJD 1P3LC 3KUYB 3REHD 3X1TC 1KX3D 2NZDC 5B1LC 3O62B 4QLCB 3C1CB 1KX5A 1ZLAD 3AYWB 4LD9D 5CP6B 3AV1C 2IO5B 1EQZA 5BNXB 3B0DB 3WAAC 3AZED 5B33A 1P3IC 4CAYB 5B2IC 2HUEB 4KUDD 3UTAA 3W99B 4M6BA 3W96A 5B40C 1BFMA 3AZKB 1JFIB 5JA4B 5DNNB 1S32C 1BH8B 3REKC 3LZ0D 4YS3A 3NQUA 3RELA 4XUJB 5GT3B 1KX4D 3AFAD 3MGPB 5F99C 1HQ3A 2YFVB 5CPJC 5AV8D 3W98D 3KXBC 4J8WD 5DNMA 3AV2C 3MGSC 1F66C 3LZ1B 3AN2C 1P3KD 1P3MA 1A7WA 3AZNC 4HGAB 1U35D 5JRGD 3WA9D 5BT1D 3MVDD 3WKJA 5AVCB 3AZHA 1P3OC 3AZLB 3KWQC 4KGCA 5BNVB 3VH5A 3C1BD 4J8XB 5B0YB 3WTPB 1P3GC 5AY8C 3VH6T 2PYOC 3TU4C 3AZMC 1TAFB 5GXQD 3B6GC 4J8VC 3REID 5AV6D 5AVBA 2CV5D 4Z66A 1KX5B 3LELC 3MGRA 3MGQD 3AZID 5CPKC 3AZGA 1EQZB 5B33B 2AROA 4ZBJC 5B24A 4NE3A 1M19A 4XZQD 3KUYD 4Z5TC 4J8UC 1ZLAB 1M1AC 3O62D 4QLCD 3C1CD 3UT9A 3X1SA 3AYWD 3UTAB 2FJ7A 3W96B 3AZJC 4XZQA 5B0ZD 4YS3B 2JSSA 2YFWA 4AWLC 3NQUB 4WU8A 1P3BC 4H9PA 3LJAC 3RELB 1M18C 1AOIC 3X1UA 2NQBA 1HQ3B 1ID3A 3W99D 5AV9A 3WTPE 3LZ0B 5DNMB 1P3LA 4R8PA 3X1TA 2NZDA 5B1LA 3MGPD 5B2ID 2HIOC 3B0CT 3AV1A 1WWSA 3V9RA 4J8WB 3WKJB 5B31G 5CPIC 1H3OA 4E44A 5AV5C 3WAAA 1P3IA 3LZ1D 4KGCB 2BYMA 2F8NG 5BS7C 3WA9B 5B2IA 5B2JC 3X1VA 5AVCD 3AZFC 5B40A 1S32A 3AZLD 3REKA 5AVBB 3A6NC 4Z2MH 4Z66B 4J8XD 5B0YD 3AN2D 3MGRB 5F99A 3AZGB 2AROB 5CPJA 4H9OA 5B24B 3KXBA 5GSUC 4NE5A 5B32C 1M19B 3AV2A 3MGSA 1F66A 3AN2A 3UT9B 1KX5D 3X1SB 1B67A 3VH6W 3AZNA 2FJ7B 1WWIA 1EQZD 5B33D 4XZQB 4ZUXC 4R8PC 1P3FC 1P3OA 2YFWB 4WU8B 3KWQA 4CSRA 3B6FC 4H9PB 5KDMA 5B1MC 3X1UB 1P3GA 2NQBB 5AY8A 3UTAD 1ID3B 2PYOA 3W96D 5AV9B 4YM6C 4H9RA 1TZYC 5B0ZB 3TU4A 3AZMA 5GT0C 4H9NA 3B6GA 4YS3D 4J8VA 1P3LB 2NZDB 3RELD 3NQJB 5B1LB 3X1VC 1HTAA 1HQ3D 4WNNB 3LELA 3V9RB 5CPKA 2RVQD 5DNMD 3WAAB 1P3IB 2BYMB 4NE6A 4Z5TA 5B2IB 4J8UA 3AZKC 1P3MD 1M1AA 5DNNC 5E5AC 3WKJD 5B40B 3AZHD 4XUJC 5GT3C 1P34C 4EO5C 3AZJA 3REKB 4WU9C 4KGCD 1P3BA 3LJAA 5G49A 4JJNC 1M18A 1AOIA 5F99B 3B0CW 5CPJB 4H9OB 1P3AC 3KXBB 4HGAC 4X23C 3AV2B 5AVBD 1F66B 3AN2B 4Z66D 3MNNC 1P3PC 3AZNB 3W97C 3MGRD 1ULYA 2HIOA 3AZGD 5B2JD 2AROD 5CPIA 5B24D 1P3OB 5AV5A 1M19D 3KWQB 4CSRB 2BYKA 3R45A 3UT9D 1P3GB 5BS7A 3X1SD 3UTBC 5AY8B 5B31C 5B2JA 2FJ7D 1BH9A 2PYOB 4H9RB 3TU4B 2L5AA 3AZMB 4H9NB 3AZFA 3B6GB 4J8VB 4DRBA 4WU8D 2LY8A 3A6NA 3REJC 3X1UD 2NQBD 1KX3C 3REHC 3LELB 1ID3D 5CPKB 5AV9D 1ZLAC 4LD9C 2CWEA 4ZBJB 1P3LD 5GSUA 5B32A 3X1TD 4R8PD 2NZDD 4G91C 4Z5TB 4J8UB 3AZEC 5B1LD 5FUGA 3AV1D 4KUDC 3WAAD 3AZJB 1TZYD 4ZUXA 1P3FA 1P3ID 5GT0D 4AWLB 1P3MB 1P3BB 3B6FA 5G49B 5B1MA 3LZ0C 1M18B 1AOIB 1F1EA 3AZHB 3X1VD 1KX4C 3AFAC 4YM6A 5B40D 1TZYA 1S32D 5GT0A 3REKD 4G92C 5AV8C 3W98C 1R4VA 1P3KC 5F99D
chains in the Genus database with same CATH superfamily
2JE5A 5CPJD 5CPIB 5JRGC 3KXBD 5BT1C 3VH5T 5AV5B 3MVDC 1U35C 3WA9C 4KHAA 3AV2D 3MGSD 1F66D 3R45B 4UUZA 3AZKA 3AZND 5DNNA 5C3IB 1BH9B 5B2JB 3C1BC 5E5AA 3AZFB 4XUJA 5GT3A 1P34A 1P3OD 3KWQD 5GXQC 3A6NB 1Q9CA 2VQRA 3REIC 4WU9A 2YFVA 5AV6C 1P3GD 5AY8D 1P3PD 4JJNA 2CV5C 2PYOD 3B0BA 3TU4D 3AZMD 3B6GD 3AZIC 3MGQC 4J8VD 1P3AA 3H0MC 5GSUB 5B32B 4X23A 3VH6A 1P3PA 3MNNA 3EPHA 5FUGB 3KUYC 3LELD 3W97A 5CPKD 3O62C 4QLCC 3C1CC 3AYWC 5CP6C 4ZUXB 1P3FB 4R8PB 3X1TB 2IO5C 4H9SC 3B6FB 3B0DC 4Z5TD 4J8UD 5B0ZC 1M1AD 3AV1B 3UTBA 5B31A 1H3OB 4YM6B 1TZYB 2HUEC 5GT0B 3AZJD 3W99C 2F8NA 1P3BD 3LJAD 3REJA 1M18D 1AOID 3X1VB 1KX3A 3REHA 1S32B 4H9QA 3MGPC 1ZLAA 4LD9A 4KHAB 5BO0A 4UUZB 3AZEA 5CHLB 3LZ1C 2HIOD 2UWXA 5E5AB 2F8NK 5CPID 3MGSB 5B32G 1P34B 5AV5D 4KUDA 4EO5B 5AVCC 4WU9B 2F8NH 2ZM5A 3AZLC 4JJNB 3LZ0A 4J8XC 4Z2MG 4WV4B 5B0YC 3WTPC 1KX4A 3AFAA 3AZFD 1P3AB 3VH5W 1N1JA 5KDMB 2ZY4A 4X23B 2G5HC 3A6ND 5AV8A 1P3PB 3MNNB 3W98A 4J8WA 3W97B 1P3KA 1KX5C 1U35A 5JRGA 3WA9A 5GSUD 5B32D 3MVDA 1EQZC 5B33C 3FDDA 3UTBB 5B31B 3C1BA 3UTAC 4ZUXD 1P3FD 2F8NB 3W96C 2J8PA 1M1AB 3B6FD 4E45A 5GXQA 5B1MD 3REJB 4YS3C 3REIA 3KSYA 5AV6A 1KX3B 3REHB 3RELC 2CV5A 4YM6D 4H9QB 4LD9B 1HQ3C 2Y2OA 3AZIA 3MGQA 3LJAB 5CP6D 2RVQC 5BO0B 5DNMC 4G91B 3AZEB 3KUYA 4WJ3C 1P3MC 3O62A 4QLCA 3C1CA 4KUDB 4WZSB 3AYWA 5CP6A 3WKJC 4J8WC 4H9SA 3AZHC 5BNXA 5B0ZA 3AZKD 2HIOB 5DNND 4KGCC 4NFTA 4CAYA 5E5AD 2Y2GA 3AFAB 1KX4B 1N1JB 4XUJD 3NQJA 5GT3D 1P34D 2BYKB 4G92B 3W99A 4WNNA 5AV8B 4WU9D 3W98B 1JFIA 5JA4A 1BH8A 4DRAA 4JJND 2Y2PA 5AVBC 3EPLA 1P3KB 4Z66C 1KU5A 3MGRC 3MGPA 5JRGB 1U35B 1P3AD 3MVDB 3AZGC 5C3IC 4X23D 2AROC 5B24C 3MNND 1M19C 3W97D 3LZ1A 3C1BB 3UT9C 3X1SC 3EPJA 3WTPD 2FJ7C 2BG1A 5GXQB 5AVCA 4XZQC 3REIB 5AV6B 3UTBD 3AZLA 4WU8C 5B31D 3EG5B 2CV5B 3X1UC 5BNVA 4J8XA 5B0YA 3WTPA 2NQBC 1ID3C 3AZIB 3MGQB 2F8ND 5AV9C 5B1MB 1B6WA 1TAFA 3REJD 1P3LC 3KUYB 3REHD 3X1TC 1KX3D 2NZDC 5B1LC 3O62B 4QLCB 3C1CB 1KX5A 1ZLAD 3AYWB 4LD9D 5CP6B 3AV1C 2IO5B 1EQZA 5BNXB 3B0DB 3WAAC 3AZED 5B33A 1P3IC 4CAYB 5B2IC 2Y2MA 2HUEB 4KUDD 3UTAA 3W99B 4M6BA 3W96A 5B40C 1BFMA 3AZKB 1JFIB 5JA4B 5DNNB 2Y2JA 1BH8B 1S32C 2G5IC 3REKC 3LZ0D 4YS3A 3NQUA 2F2AC 4XUJB 3RELA 5GT3B 1KX4D 3AFAD 3MGPB 5F99C 1HQ3A 2YFVB 5CPJC 5AV8D 3W98D 3KXBC 4J8WD 5DNMA 3AV2C 3MGSC 1F66C 2JCHA 2Y2IA 3LZ1B 3AN2C 1P3KD 1P3MA 1A7WA 3AZNC 4HGAB 1U35D 5JRGD 3WA9D 5BT1D 3MVDD 3WKJA 5AVCB 3AZHA 1P3OC 3AZLB 2ZY2A 3KWQC 4KGCA 5BNVB 3VH5A 3C1BD 4J8XB 5B0YB 3WTPB 1P3GC 5AY8C 3VH6T 2PYOC 3TU4C 2Y2QA 3AZMC 1TAFB 5GXQD 3B6GC 4J8VC 3REID 5AV6D 5AVBA 4UPKA 2CV5D 4Z66A 1KX5B 3EPKA 3LELC 3MGRA 3MGQD 3AZID 5CPKC 1T3UA 3AZGA 1EQZB 2Y2KA 5B33B 2AROA 4ZBJC 3H0RC 4NE3A 5B24A 1M19A 4XZQD 3KUYD 4Z5TC 4J8UC 1ZLAB 1M1AC 3O62D 4QLCD 3C1CD 3UT9A 3X1SA 3AYWD 3UTAB 2FJ7A 3W96B 1Z2CB 3AZJC 4XZQA 5B0ZD 4YS3B 2JSSA 2YFWA 4AWLC 3NQUB 4WU8A 1P3BC 4H9PA 3LJAC 3RELB 1M18C 1AOIC 3X1UA 2NQBA 1HQ3B 1ID3A 3W99D 5AV9A 3WTPE 3LZ0B 5DNMB 2DQNC 1P3LA 4R8PA 3X1TA 2NZDA 5B1LA 3MGPD 5B2ID 2HIOC 3B0CT 3AV1A 1WWSA 3V9RA 4J8WB 3WKJB 5B31G 5CPIC 1H3OA 4E44A 5AV5C 3WAAA 3KFUG 1P3IA 3LZ1D 4KGCB 2BYMA 2F8NG 5BS7C 3WA9B 5B2IA 5B2JC 3X1VA 5AVCD 3AZFC 5B40A 1S32A 3AZLD 3REKA 5AVBB 3A6NC 4DQYB 4Z2MH 4Z66B 4J8XD 5B0YD 3AN2D 3MGRB 5F99A 3AZGB 2AROB 5CPJA 4H9OA 5B24B 2ZY3A 3IP4C 3KXBA 5GSUC 4NE5A 5B32C 1M19B 3AV2A 3MGSA 1F66A 3A1IA 3AN2A 3UT9B 1KX5D 3X1SB 1B67A 3VH6W 3AZNA 2Y2HA 2FJ7B 1WWIA 1EQZD 2FFFB 4XZQB 5B33D 4R8PC 4ZUXC 1P3FC 1P3OA 2YFWB 4WU8B 3KWQA 4CSRA 3B6FC 4H9PB 5KDMA 5B1MC 3X1UB 1P3GA 2NQBB 5AY8A 3UTAD 1ID3B 2PYOA 3W96D 5AV9B 4YM6C 4H9RA 1TZYC 5B0ZB 3TU4A 3AZMA 5GT0C 4H9NA 3B6GA 4YS3D 4J8VA 1P3LB 2NZDB 3RELD 3NQJB 5B1LB 3X1VC 1HTAA 1HQ3D 4WNNB 3LELA 3F6TA 3V9RB 5CPKA 2RVQD 5DNMD 3WAAB 1P3IB 2BYMB 4NE6A 4Z5TA 5B2IB 4J8UA 3AZKC 1P3MD 1M1AA 5DNNC 2ZY5A 5E5AC 3WKJD 5B40B 3AZHD 4XUJC 5GT3C 1P34C 2DF4C 4EO5C 3AZJA 3REKB 2Y2NA 4WU9C 4KGCD 1P3BA 3LJAA 5G49A 4JJNC 1M18A 1AOIA 5F99B 3B0CW 5CPJB 4H9OB 1P3AC 3KXBB 4HGAC 4X23C 3AV2B 5AVBD 1F66B 3AN2B 4Z66D 3MNNC 1P3PC 3AZNB 3W97C 3MGRD 1ULYA 2HIOA 3AZGD 5B2JD 2AROD 5CPIA 5B24D 1P3OB 5AV5A 1M19D 3KWQB 4CSRB 2BYKA 3R45A 3UT9D 1P3GB 5BS7A 3X1SD 3UTBC 5AY8B 5B31C 3A1KA 5B2JA 1BH9A 2FJ7D 2PYOB 4H9RB 3TU4B 2L5AA 3AZMB 4H9NB 3AZFA 3B6GB 4J8VB 4DRBA 4WU8D 2LY8A 3A6NA 3REJC 3X1UD 2NQBD 1KX3C 3REHC 3LELB 1ID3D 5CPKB 5AV9D 1ZLAC 4LD9C 2CWEA 4ZBJB 1P3LD 3AL0C 5GSUA 5B32A 3P5JB 3X1TD 4R8PD 2NZDD 4G91C 4Z5TB 4J8UB 3AZEC 5B1LD 2W8SA 5FUGA 3AV1D 4KUDC 3WAAD 3AZJB 1TZYD 4ZUXA 1P3FA 1W2EA 1P3ID 5GT0D 4AWLB 1P3MB 1P3BB 3B6FA 2RIQA 5G49B 5B1MA 2XD5A 3LZ0C 1M18B 1AOIB 1F1EA 3AZHB 3X1VD 1KX4C 3AFAC 4YM6A 5B40D 1TZYA 1S32D 5GT0A 2XD1A 3REKD 4G92C 5AV8C 3W98C 2Y2LA 1PZRA 1R4VA 3H0LC 1P3KC 5F99D
chains in the Genus database with same CATH topology
2JE5A 5CPJD 5CPIB 5JRGC 3KXBD 5BT1C 3VH5T 5AV5B 3MVDC 1U35C 3WA9C 4KHAA 3AV2D 3MGSD 1F66D 3R45B 4UUZA 3AZKA 3AZND 5DNNA 5C3IB 1BH9B 5B2JB 3C1BC 5E5AA 3AZFB 4XUJA 5GT3A 1P34A 1P3OD 3KWQD 5GXQC 3A6NB 1Q9CA 2VQRA 3REIC 4WU9A 2YFVA 5AV6C 1P3GD 5AY8D 1P3PD 4JJNA 2CV5C 2PYOD 3B0BA 3TU4D 3AZMD 3B6GD 3AZIC 3MGQC 4J8VD 1P3AA 3H0MC 5GSUB 5B32B 4X23A 3VH6A 1P3PA 3MNNA 3EPHA 5FUGB 3KUYC 3LELD 3W97A 5CPKD 3O62C 4QLCC 3C1CC 3AYWC 5CP6C 4ZUXB 1P3FB 4R8PB 3X1TB 2IO5C 4H9SC 3B6FB 3B0DC 4Z5TD 4J8UD 5B0ZC 1M1AD 3AV1B 3UTBA 5B31A 1H3OB 4YM6B 1TZYB 2HUEC 5GT0B 3AZJD 3W99C 2F8NA 1P3BD 3LJAD 3REJA 1M18D 1AOID 3X1VB 1KX3A 3REHA 1S32B 4H9QA 3MGPC 1ZLAA 4LD9A 4KHAB 5BO0A 4UUZB 3AZEA 5CHLB 3LZ1C 2HIOD 2UWXA 5E5AB 2F8NK 5CPID 3MGSB 5B32G 1P34B 5AV5D 4KUDA 4EO5B 5AVCC 4WU9B 2F8NH 2ZM5A 3AZLC 4JJNB 3LZ0A 4J8XC 4Z2MG 4WV4B 5B0YC 3WTPC 1KX4A 3AFAA 3AZFD 1P3AB 3VH5W 1N1JA 5KDMB 2ZY4A 4X23B 2G5HC 3A6ND 5AV8A 1P3PB 3MNNB 3W98A 4J8WA 3W97B 1P3KA 1KX5C 1U35A 5JRGA 3WA9A 5GSUD 5B32D 3MVDA 1EQZC 5B33C 3FDDA 3UTBB 5B31B 3C1BA 3UTAC 4ZUXD 1P3FD 2F8NB 3W96C 2J8PA 1M1AB 3B6FD 4E45A 5GXQA 5B1MD 3REJB 4YS3C 3REIA 3KSYA 5AV6A 1KX3B 3REHB 3RELC 2CV5A 4YM6D 4H9QB 4LD9B 1HQ3C 2Y2OA 3AZIA 3MGQA 3LJAB 5CP6D 2RVQC 5BO0B 5DNMC 4G91B 3AZEB 3KUYA 4WJ3C 1P3MC 3O62A 4QLCA 3C1CA 4KUDB 4WZSB 3AYWA 5CP6A 3WKJC 4J8WC 4H9SA 3AZHC 5BNXA 5B0ZA 3AZKD 2HIOB 5DNND 4KGCC 4NFTA 4CAYA 5E5AD 2Y2GA 3AFAB 1KX4B 1N1JB 4XUJD 3NQJA 5GT3D 1P34D 2BYKB 4G92B 3W99A 4WNNA 5AV8B 4WU9D 3W98B 1JFIA 5JA4A 1BH8A 4DRAA 4JJND 2Y2PA 5AVBC 3EPLA 1P3KB 4Z66C 1KU5A 3MGRC 3MGPA 5JRGB 1U35B 1P3AD 3MVDB 3AZGC 5C3IC 4X23D 2AROC 5B24C 3MNND 1M19C 3W97D 3LZ1A 3C1BB 3UT9C 3X1SC 3EPJA 3WTPD 2FJ7C 2BG1A 5GXQB 5AVCA 4XZQC 3REIB 5AV6B 3UTBD 3AZLA 4WU8C 5B31D 3EG5B 2CV5B 3X1UC 5BNVA 4J8XA 5B0YA 3WTPA 2NQBC 1ID3C 3AZIB 3MGQB 2F8ND 5AV9C 5B1MB 1B6WA 1TAFA 3REJD 1P3LC 3KUYB 3REHD 3X1TC 1KX3D 2NZDC 5B1LC 3O62B 4QLCB 3C1CB 1KX5A 1ZLAD 3AYWB 4LD9D 5CP6B 3AV1C 2IO5B 1EQZA 5BNXB 3B0DB 3WAAC 3AZED 5B33A 1P3IC 4CAYB 5B2IC 2Y2MA 2HUEB 4KUDD 3UTAA 3W99B 4M6BA 3W96A 5B40C 1BFMA 3AZKB 1JFIB 5JA4B 5DNNB 2Y2JA 1BH8B 1S32C 2G5IC 3REKC 3LZ0D 4YS3A 3NQUA 2F2AC 4XUJB 3RELA 5GT3B 1KX4D 3AFAD 3MGPB 5F99C 1HQ3A 2YFVB 5CPJC 5AV8D 3W98D 3KXBC 4J8WD 5DNMA 3AV2C 3MGSC 1F66C 2JCHA 2Y2IA 3LZ1B 3AN2C 1P3KD 1P3MA 1A7WA 3AZNC 4HGAB 1U35D 5JRGD 3WA9D 5BT1D 3MVDD 3WKJA 5AVCB 3AZHA 1P3OC 3AZLB 2ZY2A 3KWQC 4KGCA 5BNVB 3VH5A 3C1BD 4J8XB 5B0YB 3WTPB 1P3GC 5AY8C 3VH6T 2PYOC 3TU4C 2Y2QA 3AZMC 1TAFB 5GXQD 3B6GC 4J8VC 3REID 5AV6D 5AVBA 4UPKA 2CV5D 4Z66A 1KX5B 3EPKA 3LELC 3MGRA 3MGQD 3AZID 5CPKC 1T3UA 3AZGA 1EQZB 2Y2KA 5B33B 2AROA 4ZBJC 3H0RC 4NE3A 5B24A 1M19A 4XZQD 3KUYD 4Z5TC 4J8UC 1ZLAB 1M1AC 3O62D 4QLCD 3C1CD 3UT9A 3X1SA 3AYWD 3UTAB 2FJ7A 3W96B 1Z2CB 3AZJC 4XZQA 5B0ZD 4YS3B 2JSSA 2YFWA 4AWLC 3NQUB 4WU8A 1P3BC 4H9PA 3LJAC 3RELB 1M18C 1AOIC 3X1UA 2NQBA 1HQ3B 1ID3A 3W99D 5AV9A 3WTPE 3LZ0B 5DNMB 2DQNC 1P3LA 4R8PA 3X1TA 2NZDA 5B1LA 3MGPD 5B2ID 2HIOC 3B0CT 3AV1A 1WWSA 3V9RA 4J8WB 3WKJB 5B31G 5CPIC 1H3OA 4E44A 5AV5C 3WAAA 3KFUG 1P3IA 3LZ1D 4KGCB 2BYMA 2F8NG 5BS7C 3WA9B 5B2IA 5B2JC 3X1VA 5AVCD 3AZFC 5B40A 1S32A 3AZLD 3REKA 5AVBB 3A6NC 4DQYB 4Z2MH 4Z66B 4J8XD 5B0YD 3AN2D 3MGRB 5F99A 3AZGB 2AROB 5CPJA 4H9OA 5B24B 2ZY3A 3IP4C 3KXBA 5GSUC 4NE5A 5B32C 1M19B 3AV2A 3MGSA 1F66A 3A1IA 3AN2A 3UT9B 1KX5D 3X1SB 1B67A 3VH6W 3AZNA 2Y2HA 2FJ7B 1WWIA 1EQZD 2FFFB 4XZQB 5B33D 4R8PC 4ZUXC 1P3FC 1P3OA 2YFWB 4WU8B 3KWQA 4CSRA 3B6FC 4H9PB 5KDMA 5B1MC 3X1UB 1P3GA 2NQBB 5AY8A 3UTAD 1ID3B 2PYOA 3W96D 5AV9B 4YM6C 4H9RA 1TZYC 5B0ZB 3TU4A 3AZMA 5GT0C 4H9NA 3B6GA 4YS3D 4J8VA 1P3LB 2NZDB 3RELD 3NQJB 5B1LB 3X1VC 1HTAA 1HQ3D 4WNNB 3LELA 3F6TA 3V9RB 5CPKA 2RVQD 5DNMD 3WAAB 1P3IB 2BYMB 4NE6A 4Z5TA 5B2IB 4J8UA 3AZKC 1P3MD 1M1AA 5DNNC 2ZY5A 5E5AC 3WKJD 5B40B 3AZHD 4XUJC 5GT3C 1P34C 2DF4C 4EO5C 3AZJA 3REKB 2Y2NA 4WU9C 4KGCD 1P3BA 3LJAA 5G49A 4JJNC 1M18A 1AOIA 5F99B 3B0CW 5CPJB 4H9OB 1P3AC 3KXBB 4HGAC 4X23C 3AV2B 5AVBD 1F66B 3AN2B 4Z66D 3MNNC 1P3PC 3AZNB 3W97C 3MGRD 1ULYA 2HIOA 3AZGD 5B2JD 2AROD 5CPIA 5B24D 1P3OB 5AV5A 1M19D 3KWQB 4CSRB 2BYKA 3R45A 3UT9D 1P3GB 5BS7A 3X1SD 3UTBC 5AY8B 5B31C 3A1KA 5B2JA 1BH9A 2FJ7D 2PYOB 4H9RB 3TU4B 2L5AA 3AZMB 4H9NB 3AZFA 3B6GB 4J8VB 4DRBA 4WU8D 2LY8A 3A6NA 3REJC 3X1UD 2NQBD 1KX3C 3REHC 3LELB 1ID3D 5CPKB 5AV9D 1ZLAC 4LD9C 2CWEA 4ZBJB 1P3LD 3AL0C 5GSUA 5B32A 3P5JB 3X1TD 4R8PD 2NZDD 4G91C 4Z5TB 4J8UB 3AZEC 5B1LD 2W8SA 5FUGA 3AV1D 4KUDC 3WAAD 3AZJB 1TZYD 4ZUXA 1P3FA 1W2EA 1P3ID 5GT0D 4AWLB 1P3MB 1P3BB 3B6FA 2RIQA 5G49B 5B1MA 2XD5A 3LZ0C 1M18B 1AOIB 1F1EA 3AZHB 3X1VD 1KX4C 3AFAC 4YM6A 5B40D 1TZYA 1S32D 5GT0A 2XD1A 3REKD 4G92C 5AV8C 3W98C 2Y2LA 1PZRA 1R4VA 3H0LC 1P3KC 5F99D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ D;  5CPI B;  5JRG C;  3KXB D;  5BT1 C;  3VH5 T;  5AV5 B;  3MVD C;  1U35 C;  3WA9 C;  4KHA A;  3AV2 D;  3MGS D;  1F66 D;  3R45 B;  4UUZ A;  3AZK A;  3AZN D;  5DNN A;  5C3I B;  1BH9 B;  5B2J B;  3C1B C;  5E5A A;  3AZF B;  4XUJ A;  5GT3 A;  1P34 A;  1P3O D;  3KWQ D;  5GXQ C;  3A6N B;  1Q9C A;  3REI C;  4WU9 A;  2YFV A;  5AV6 C;  1P3G D;  5AY8 D;  1P3P D;  4JJN A;  2CV5 C;  2PYO D;  3B0B A;  3TU4 D;  3AZM D;  3B6G D;  3AZI C;  3MGQ C;  4J8V D;  1P3A A;  5GSU B;  5B32 B;  4X23 A;  3VH6 A;  1P3P A;  3MNN A;  5FUG B;  3KUY C;  3LEL D;  3W97 A;  5CPK D;  3O62 C;  4QLC C;  3C1C C;  3AYW C;  5CP6 C;  4ZUX B;  1P3F B;  4R8P B;  3X1T B;  2IO5 C;  4H9S C;  3B6F B;  3B0D C;  4Z5T D;  4J8U D;  5B0Z C;  1M1A D;  3AV1 B;  3UTB A;  5B31 A;  1H3O B;  4YM6 B;  1TZY B;  2HUE C;  5GT0 B;  3AZJ D;  3W99 C;  2F8N A;  1P3B D;  3LJA D;  3REJ A;  1M18 D;  1AOI D;  3X1V B;  1KX3 A;  3REH A;  1S32 B;  4H9Q A;  3MGP C;  1ZLA A;  4LD9 A;  4KHA B;  5BO0 A;  4UUZ B;  3AZE A;  5CHL B;  3LZ1 C;  2HIO D;  5E5A B;  2F8N K;  5CPI D;  3MGS B;  5B32 G;  1P34 B;  5AV5 D;  4KUD A;  4EO5 B;  5AVC C;  4WU9 B;  2F8N H;  3AZL C;  4JJN B;  3LZ0 A;  4J8X C;  4Z2M G;  4WV4 B;  5B0Y C;  3WTP C;  1KX4 A;  3AFA A;  3AZF D;  1P3A B;  3VH5 W;  1N1J A;  5KDM B;  4X23 B;  3A6N D;  5AV8 A;  1P3P B;  3MNN B;  3W98 A;  4J8W A;  3W97 B;  1P3K A;  1KX5 C;  1U35 A;  5JRG A;  3WA9 A;  5GSU D;  5B32 D;  3MVD A;  1EQZ C;  5B33 C;  3UTB B;  5B31 B;  3C1B A;  3UTA C;  4ZUX D;  1P3F D;  2F8N B;  3W96 C;  1M1A B;  3B6F D;  4E45 A;  5GXQ A;  5B1M D;  3REJ B;  4YS3 C;  3REI A;  3KSY A;  5AV6 A;  1KX3 B;  3REH B;  3REL C;  2CV5 A;  4YM6 D;  4H9Q B;  4LD9 B;  1HQ3 C;  3AZI A;  3MGQ A;  3LJA B;  5CP6 D;  2RVQ C;  5BO0 B;  5DNM C;  4G91 B;  3AZE B;  3KUY A;  1P3M C;  3O62 A;  4QLC A;  3C1C A;  4KUD B;  4WZS B;  3AYW A;  5CP6 A;  3WKJ C;  4J8W C;  4H9S A;  3AZH C;  5BNX A;  5B0Z A;  3AZK D;  2HIO B;  5DNN D;  4KGC C;  4NFT A;  4CAY A;  5E5A D;  1KX4 B;  3AFA B;  1N1J B;  4XUJ D;  3NQJ A;  5GT3 D;  1P34 D;  2BYK B;  4G92 B;  3W99 A;  4WNN A;  5AV8 B;  4WU9 D;  3W98 B;  1JFI A;  5JA4 A;  1BH8 A;  4DRA A;  4JJN D;  5AVB C;  1P3K B;  4Z66 C;  1KU5 A;  3MGR C;  3MGP A;  5JRG B;  1U35 B;  1P3A D;  3MVD B;  3AZG C;  5C3I C;  4X23 D;  2ARO C;  5B24 C;  3MNN D;  1M19 C;  3W97 D;  3LZ1 A;  3C1B B;  3UT9 C;  3X1S C;  3WTP D;  2FJ7 C;  5GXQ B;  5AVC A;  4XZQ C;  3REI B;  5AV6 B;  3UTB D;  3AZL A;  4WU8 C;  5B31 D;  2CV5 B;  3X1U C;  5BNV A;  4J8X A;  5B0Y A;  3WTP A;  2NQB C;  1ID3 C;  3AZI B;  3MGQ B;  2F8N D;  5AV9 C;  5B1M B;  1B6W A;  1TAF A;  3REJ D;  1P3L C;  3KUY B;  3REH D;  3X1T C;  1KX3 D;  2NZD C;  5B1L C;  3O62 B;  4QLC B;  3C1C B;  1KX5 A;  1ZLA D;  3AYW B;  4LD9 D;  5CP6 B;  3AV1 C;  2IO5 B;  1EQZ A;  5BNX B;  3B0D B;  3WAA C;  3AZE D;  5B33 A;  1P3I C;  4CAY B;  5B2I C;  2HUE B;  4KUD D;  3UTA A;  3W99 B;  4M6B A;  3W96 A;  5B40 C;  1BFM A;  3AZK B;  1JFI B;  5JA4 B;  5DNN B;  1S32 C;  1BH8 B;  3REK C;  3LZ0 D;  4YS3 A;  3NQU A;  3REL A;  4XUJ B;  5GT3 B;  1KX4 D;  3AFA D;  3MGP B;  5F99 C;  1HQ3 A;  2YFV B;  5CPJ C;  5AV8 D;  3W98 D;  3KXB C;  4J8W D;  5DNM A;  3AV2 C;  3MGS C;  1F66 C;  3LZ1 B;  3AN2 C;  1P3K D;  1P3M A;  1A7W A;  3AZN C;  4HGA B;  1U35 D;  5JRG D;  3WA9 D;  5BT1 D;  3MVD D;  3WKJ A;  5AVC B;  3AZH A;  1P3O C;  3AZL B;  3KWQ C;  4KGC A;  5BNV B;  3VH5 A;  3C1B D;  4J8X B;  5B0Y B;  3WTP B;  1P3G C;  5AY8 C;  3VH6 T;  2PYO C;  3TU4 C;  3AZM C;  1TAF B;  5GXQ D;  3B6G C;  4J8V C;  3REI D;  5AV6 D;  5AVB A;  2CV5 D;  4Z66 A;  1KX5 B;  3LEL C;  3MGR A;  3MGQ D;  3AZI D;  5CPK C;  3AZG A;  1EQZ B;  5B33 B;  2ARO A;  4ZBJ C;  5B24 A;  4NE3 A;  1M19 A;  4XZQ D;  3KUY D;  4Z5T C;  4J8U C;  1ZLA B;  1M1A C;  3O62 D;  4QLC D;  3C1C D;  3UT9 A;  3X1S A;  3AYW D;  3UTA B;  2FJ7 A;  3W96 B;  3AZJ C;  4XZQ A;  5B0Z D;  4YS3 B;  2JSS A;  2YFW A;  4AWL C;  3NQU B;  4WU8 A;  1P3B C;  4H9P A;  3LJA C;  3REL B;  1M18 C;  1AOI C;  3X1U A;  2NQB A;  1HQ3 B;  1ID3 A;  3W99 D;  5AV9 A;  3WTP E;  3LZ0 B;  5DNM B;  1P3L A;  4R8P A;  3X1T A;  2NZD A;  5B1L A;  3MGP D;  5B2I D;  2HIO C;  3B0C T;  3AV1 A;  1WWS A;  3V9R A;  4J8W B;  3WKJ B;  5B31 G;  5CPI C;  1H3O A;  4E44 A;  5AV5 C;  3WAA A;  1P3I A;  3LZ1 D;  4KGC B;  2BYM A;  2F8N G;  5BS7 C;  3WA9 B;  5B2I A;  5B2J C;  3X1V A;  5AVC D;  3AZF C;  5B40 A;  1S32 A;  3AZL D;  3REK A;  5AVB B;  3A6N C;  4Z2M H;  4Z66 B;  4J8X D;  5B0Y D;  3AN2 D;  3MGR B;  5F99 A;  3AZG B;  2ARO B;  5CPJ A;  4H9O A;  5B24 B;  3KXB A;  5GSU C;  4NE5 A;  5B32 C;  1M19 B;  3AV2 A;  3MGS A;  1F66 A;  3AN2 A;  3UT9 B;  1KX5 D;  3X1S B;  1B67 A;  3VH6 W;  3AZN A;  2FJ7 B;  1WWI A;  1EQZ D;  5B33 D;  4XZQ B;  4ZUX C;  4R8P C;  1P3F C;  1P3O A;  2YFW B;  4WU8 B;  3KWQ A;  4CSR A;  3B6F C;  4H9P B;  5KDM A;  5B1M C;  3X1U B;  1P3G A;  2NQB B;  5AY8 A;  3UTA D;  1ID3 B;  2PYO A;  3W96 D;  5AV9 B;  4YM6 C;  4H9R A;  1TZY C;  5B0Z B;  3TU4 A;  3AZM A;  5GT0 C;  4H9N A;  3B6G A;  4YS3 D;  4J8V A;  1P3L B;  2NZD B;  3REL D;  3NQJ B;  5B1L B;  3X1V C;  1HTA A;  1HQ3 D;  4WNN B;  3LEL A;  3V9R B;  5CPK A;  2RVQ D;  5DNM D;  3WAA B;  1P3I B;  2BYM B;  4NE6 A;  4Z5T A;  5B2I B;  4J8U A;  3AZK C;  1P3M D;  1M1A A;  5DNN C;  5E5A C;  3WKJ D;  5B40 B;  3AZH D;  4XUJ C;  5GT3 C;  1P34 C;  4EO5 C;  3AZJ A;  3REK B;  4WU9 C;  4KGC D;  1P3B A;  3LJA A;  5G49 A;  4JJN C;  1M18 A;  1AOI A;  5F99 B;  3B0C W;  5CPJ B;  4H9O B;  1P3A C;  3KXB B;  4HGA C;  4X23 C;  3AV2 B;  5AVB D;  1F66 B;  3AN2 B;  4Z66 D;  3MNN C;  1P3P C;  3AZN B;  3W97 C;  3MGR D;  1ULY A;  2HIO A;  3AZG D;  5B2J D;  2ARO D;  5CPI A;  5B24 D;  1P3O B;  5AV5 A;  1M19 D;  3KWQ B;  4CSR B;  2BYK A;  3R45 A;  3UT9 D;  1P3G B;  5BS7 A;  3X1S D;  3UTB C;  5AY8 B;  5B31 C;  5B2J A;  2FJ7 D;  1BH9 A;  2PYO B;  4H9R B;  3TU4 B;  2L5A A;  3AZM B;  4H9N B;  3AZF A;  3B6G B;  4J8V B;  4DRB A;  4WU8 D;  2LY8 A;  3A6N A;  3REJ C;  3X1U D;  2NQB D;  1KX3 C;  3REH C;  3LEL B;  1ID3 D;  5CPK B;  5AV9 D;  1ZLA C;  4LD9 C;  2CWE A;  4ZBJ B;  1P3L D;  5GSU A;  5B32 A;  3X1T D;  4R8P D;  2NZD D;  4G91 C;  4Z5T B;  4J8U B;  3AZE C;  5B1L D;  5FUG A;  3AV1 D;  4KUD C;  3WAA D;  3AZJ B;  1TZY D;  4ZUX A;  1P3F A;  1P3I D;  5GT0 D;  4AWL B;  1P3M B;  1P3B B;  3B6F A;  5G49 B;  5B1M A;  3LZ0 C;  1M18 B;  1AOI B;  1F1E A;  3AZH B;  3X1V D;  1KX4 C;  3AFA C;  4YM6 A;  5B40 D;  1TZY A;  1S32 D;  5GT0 A;  3REK D;  4G92 C;  5AV8 C;  3W98 C;  1R4V A;  1P3K C;  5F99 D; 
#chains in the Genus database with same CATH topology
 2JE5 A;  5CPJ D;  5CPI B;  5JRG C;  3KXB D;  5BT1 C;  3VH5 T;  5AV5 B;  3MVD C;  1U35 C;  3WA9 C;  4KHA A;  3AV2 D;  3MGS D;  1F66 D;  3R45 B;  4UUZ A;  3AZK A;  3AZN D;  5DNN A;  5C3I B;  1BH9 B;  5B2J B;  3C1B C;  5E5A A;  3AZF B;  4XUJ A;  5GT3 A;  1P34 A;  1P3O D;  3KWQ D;  5GXQ C;  3A6N B;  1Q9C A;  2VQR A;  3REI C;  4WU9 A;  2YFV A;  5AV6 C;  1P3G D;  5AY8 D;  1P3P D;  4JJN A;  2CV5 C;  2PYO D;  3B0B A;  3TU4 D;  3AZM D;  3B6G D;  3AZI C;  3MGQ C;  4J8V D;  1P3A A;  3H0M C;  5GSU B;  5B32 B;  4X23 A;  3VH6 A;  1P3P A;  3MNN A;  3EPH A;  5FUG B;  3KUY C;  3LEL D;  3W97 A;  5CPK D;  3O62 C;  4QLC C;  3C1C C;  3AYW C;  5CP6 C;  4ZUX B;  1P3F B;  4R8P B;  3X1T B;  2IO5 C;  4H9S C;  3B6F B;  3B0D C;  4Z5T D;  4J8U D;  5B0Z C;  1M1A D;  3AV1 B;  3UTB A;  5B31 A;  1H3O B;  4YM6 B;  1TZY B;  2HUE C;  5GT0 B;  3AZJ D;  3W99 C;  2F8N A;  1P3B D;  3LJA D;  3REJ A;  1M18 D;  1AOI D;  3X1V B;  1KX3 A;  3REH A;  1S32 B;  4H9Q A;  3MGP C;  1ZLA A;  4LD9 A;  4KHA B;  5BO0 A;  4UUZ B;  3AZE A;  5CHL B;  3LZ1 C;  2HIO D;  2UWX A;  5E5A B;  2F8N K;  5CPI D;  3MGS B;  5B32 G;  1P34 B;  5AV5 D;  4KUD A;  4EO5 B;  5AVC C;  4WU9 B;  2F8N H;  2ZM5 A;  3AZL C;  4JJN B;  3LZ0 A;  4J8X C;  4Z2M G;  4WV4 B;  5B0Y C;  3WTP C;  1KX4 A;  3AFA A;  3AZF D;  1P3A B;  3VH5 W;  1N1J A;  5KDM B;  2ZY4 A;  4X23 B;  2G5H C;  3A6N D;  5AV8 A;  1P3P B;  3MNN B;  3W98 A;  4J8W A;  3W97 B;  1P3K A;  1KX5 C;  1U35 A;  5JRG A;  3WA9 A;  5GSU D;  5B32 D;  3MVD A;  1EQZ C;  5B33 C;  3FDD A;  3UTB B;  5B31 B;  3C1B A;  3UTA C;  4ZUX D;  1P3F D;  2F8N B;  3W96 C;  2J8P A;  1M1A B;  3B6F D;  4E45 A;  5GXQ A;  5B1M D;  3REJ B;  4YS3 C;  3REI A;  3KSY A;  5AV6 A;  1KX3 B;  3REH B;  3REL C;  2CV5 A;  4YM6 D;  4H9Q B;  4LD9 B;  1HQ3 C;  2Y2O A;  3AZI A;  3MGQ A;  3LJA B;  5CP6 D;  2RVQ C;  5BO0 B;  5DNM C;  4G91 B;  3AZE B;  3KUY A;  4WJ3 C;  1P3M C;  3O62 A;  4QLC A;  3C1C A;  4KUD B;  4WZS B;  3AYW A;  5CP6 A;  3WKJ C;  4J8W C;  4H9S A;  3AZH C;  5BNX A;  5B0Z A;  3AZK D;  2HIO B;  5DNN D;  4KGC C;  4NFT A;  4CAY A;  5E5A D;  2Y2G A;  3AFA B;  1KX4 B;  1N1J B;  4XUJ D;  3NQJ A;  5GT3 D;  1P34 D;  2BYK B;  4G92 B;  3W99 A;  4WNN A;  5AV8 B;  4WU9 D;  3W98 B;  1JFI A;  5JA4 A;  1BH8 A;  4DRA A;  4JJN D;  2Y2P A;  5AVB C;  3EPL A;  1P3K B;  4Z66 C;  1KU5 A;  3MGR C;  3MGP A;  5JRG B;  1U35 B;  1P3A D;  3MVD B;  3AZG C;  5C3I C;  4X23 D;  2ARO C;  5B24 C;  3MNN D;  1M19 C;  3W97 D;  3LZ1 A;  3C1B B;  3UT9 C;  3X1S C;  3EPJ A;  3WTP D;  2FJ7 C;  2BG1 A;  5GXQ B;  5AVC A;  4XZQ C;  3REI B;  5AV6 B;  3UTB D;  3AZL A;  4WU8 C;  5B31 D;  3EG5 B;  2CV5 B;  3X1U C;  5BNV A;  4J8X A;  5B0Y A;  3WTP A;  2NQB C;  1ID3 C;  3AZI B;  3MGQ B;  2F8N D;  5AV9 C;  5B1M B;  1B6W A;  1TAF A;  3REJ D;  1P3L C;  3KUY B;  3REH D;  3X1T C;  1KX3 D;  2NZD C;  5B1L C;  3O62 B;  4QLC B;  3C1C B;  1KX5 A;  1ZLA D;  3AYW B;  4LD9 D;  5CP6 B;  3AV1 C;  2IO5 B;  1EQZ A;  5BNX B;  3B0D B;  3WAA C;  3AZE D;  5B33 A;  1P3I C;  4CAY B;  5B2I C;  2Y2M A;  2HUE B;  4KUD D;  3UTA A;  3W99 B;  4M6B A;  3W96 A;  5B40 C;  1BFM A;  3AZK B;  1JFI B;  5JA4 B;  5DNN B;  2Y2J A;  1BH8 B;  1S32 C;  2G5I C;  3REK C;  3LZ0 D;  4YS3 A;  3NQU A;  2F2A C;  4XUJ B;  3REL A;  5GT3 B;  1KX4 D;  3AFA D;  3MGP B;  5F99 C;  1HQ3 A;  2YFV B;  5CPJ C;  5AV8 D;  3W98 D;  3KXB C;  4J8W D;  5DNM A;  3AV2 C;  3MGS C;  1F66 C;  2JCH A;  2Y2I A;  3LZ1 B;  3AN2 C;  1P3K D;  1P3M A;  1A7W A;  3AZN C;  4HGA B;  1U35 D;  5JRG D;  3WA9 D;  5BT1 D;  3MVD D;  3WKJ A;  5AVC B;  3AZH A;  1P3O C;  3AZL B;  2ZY2 A;  3KWQ C;  4KGC A;  5BNV B;  3VH5 A;  3C1B D;  4J8X B;  5B0Y B;  3WTP B;  1P3G C;  5AY8 C;  3VH6 T;  2PYO C;  3TU4 C;  2Y2Q A;  3AZM C;  1TAF B;  5GXQ D;  3B6G C;  4J8V C;  3REI D;  5AV6 D;  5AVB A;  4UPK A;  2CV5 D;  4Z66 A;  1KX5 B;  3EPK A;  3LEL C;  3MGR A;  3MGQ D;  3AZI D;  5CPK C;  1T3U A;  3AZG A;  1EQZ B;  2Y2K A;  5B33 B;  2ARO A;  4ZBJ C;  3H0R C;  4NE3 A;  5B24 A;  1M19 A;  4XZQ D;  3KUY D;  4Z5T C;  4J8U C;  1ZLA B;  1M1A C;  3O62 D;  4QLC D;  3C1C D;  3UT9 A;  3X1S A;  3AYW D;  3UTA B;  2FJ7 A;  3W96 B;  1Z2C B;  3AZJ C;  4XZQ A;  5B0Z D;  4YS3 B;  2JSS A;  2YFW A;  4AWL C;  3NQU B;  4WU8 A;  1P3B C;  4H9P A;  3LJA C;  3REL B;  1M18 C;  1AOI C;  3X1U A;  2NQB A;  1HQ3 B;  1ID3 A;  3W99 D;  5AV9 A;  3WTP E;  3LZ0 B;  5DNM B;  2DQN C;  1P3L A;  4R8P A;  3X1T A;  2NZD A;  5B1L A;  3MGP D;  5B2I D;  2HIO C;  3B0C T;  3AV1 A;  1WWS A;  3V9R A;  4J8W B;  3WKJ B;  5B31 G;  5CPI C;  1H3O A;  4E44 A;  5AV5 C;  3WAA A;  3KFU G;  1P3I A;  3LZ1 D;  4KGC B;  2BYM A;  2F8N G;  5BS7 C;  3WA9 B;  5B2I A;  5B2J C;  3X1V A;  5AVC D;  3AZF C;  5B40 A;  1S32 A;  3AZL D;  3REK A;  5AVB B;  3A6N C;  4DQY B;  4Z2M H;  4Z66 B;  4J8X D;  5B0Y D;  3AN2 D;  3MGR B;  5F99 A;  3AZG B;  2ARO B;  5CPJ A;  4H9O A;  5B24 B;  2ZY3 A;  3IP4 C;  3KXB A;  5GSU C;  4NE5 A;  5B32 C;  1M19 B;  3AV2 A;  3MGS A;  1F66 A;  3A1I A;  3AN2 A;  3UT9 B;  1KX5 D;  3X1S B;  1B67 A;  3VH6 W;  3AZN A;  2Y2H A;  2FJ7 B;  1WWI A;  1EQZ D;  2FFF B;  4XZQ B;  5B33 D;  4R8P C;  4ZUX C;  1P3F C;  1P3O A;  2YFW B;  4WU8 B;  3KWQ A;  4CSR A;  3B6F C;  4H9P B;  5KDM A;  5B1M C;  3X1U B;  1P3G A;  2NQB B;  5AY8 A;  3UTA D;  1ID3 B;  2PYO A;  3W96 D;  5AV9 B;  4YM6 C;  4H9R A;  1TZY C;  5B0Z B;  3TU4 A;  3AZM A;  5GT0 C;  4H9N A;  3B6G A;  4YS3 D;  4J8V A;  1P3L B;  2NZD B;  3REL D;  3NQJ B;  5B1L B;  3X1V C;  1HTA A;  1HQ3 D;  4WNN B;  3LEL A;  3F6T A;  3V9R B;  5CPK A;  2RVQ D;  5DNM D;  3WAA B;  1P3I B;  2BYM B;  4NE6 A;  4Z5T A;  5B2I B;  4J8U A;  3AZK C;  1P3M D;  1M1A A;  5DNN C;  2ZY5 A;  5E5A C;  3WKJ D;  5B40 B;  3AZH D;  4XUJ C;  5GT3 C;  1P34 C;  2DF4 C;  4EO5 C;  3AZJ A;  3REK B;  2Y2N A;  4WU9 C;  4KGC D;  1P3B A;  3LJA A;  5G49 A;  4JJN C;  1M18 A;  1AOI A;  5F99 B;  3B0C W;  5CPJ B;  4H9O B;  1P3A C;  3KXB B;  4HGA C;  4X23 C;  3AV2 B;  5AVB D;  1F66 B;  3AN2 B;  4Z66 D;  3MNN C;  1P3P C;  3AZN B;  3W97 C;  3MGR D;  1ULY A;  2HIO A;  3AZG D;  5B2J D;  2ARO D;  5CPI A;  5B24 D;  1P3O B;  5AV5 A;  1M19 D;  3KWQ B;  4CSR B;  2BYK A;  3R45 A;  3UT9 D;  1P3G B;  5BS7 A;  3X1S D;  3UTB C;  5AY8 B;  5B31 C;  3A1K A;  5B2J A;  1BH9 A;  2FJ7 D;  2PYO B;  4H9R B;  3TU4 B;  2L5A A;  3AZM B;  4H9N B;  3AZF A;  3B6G B;  4J8V B;  4DRB A;  4WU8 D;  2LY8 A;  3A6N A;  3REJ C;  3X1U D;  2NQB D;  1KX3 C;  3REH C;  3LEL B;  1ID3 D;  5CPK B;  5AV9 D;  1ZLA C;  4LD9 C;  2CWE A;  4ZBJ B;  1P3L D;  3AL0 C;  5GSU A;  5B32 A;  3P5J B;  3X1T D;  4R8P D;  2NZD D;  4G91 C;  4Z5T B;  4J8U B;  3AZE C;  5B1L D;  2W8S A;  5FUG A;  3AV1 D;  4KUD C;  3WAA D;  3AZJ B;  1TZY D;  4ZUX A;  1P3F A;  1W2E A;  1P3I D;  5GT0 D;  4AWL B;  1P3M B;  1P3B B;  3B6F A;  2RIQ A;  5G49 B;  5B1M A;  2XD5 A;  3LZ0 C;  1M18 B;  1AOI B;  1F1E A;  3AZH B;  3X1V D;  1KX4 C;  3AFA C;  4YM6 A;  5B40 D;  1TZY A;  1S32 D;  5GT0 A;  2XD1 A;  3REK D;  4G92 C;  5AV8 C;  3W98 C;  2Y2L A;  1PZR A;  1R4V A;  3H0L C;  1P3K C;  5F99 D; 
#chains in the Genus database with same CATH homology
 2JE5 A;  5CPJ D;  5CPI B;  5JRG C;  3KXB D;  5BT1 C;  3VH5 T;  5AV5 B;  3MVD C;  1U35 C;  3WA9 C;  4KHA A;  3AV2 D;  3MGS D;  1F66 D;  3R45 B;  4UUZ A;  3AZK A;  3AZN D;  5DNN A;  5C3I B;  1BH9 B;  5B2J B;  3C1B C;  5E5A A;  3AZF B;  4XUJ A;  5GT3 A;  1P34 A;  1P3O D;  3KWQ D;  5GXQ C;  3A6N B;  1Q9C A;  2VQR A;  3REI C;  4WU9 A;  2YFV A;  5AV6 C;  1P3G D;  5AY8 D;  1P3P D;  4JJN A;  2CV5 C;  2PYO D;  3B0B A;  3TU4 D;  3AZM D;  3B6G D;  3AZI C;  3MGQ C;  4J8V D;  1P3A A;  3H0M C;  5GSU B;  5B32 B;  4X23 A;  3VH6 A;  1P3P A;  3MNN A;  3EPH A;  5FUG B;  3KUY C;  3LEL D;  3W97 A;  5CPK D;  3O62 C;  4QLC C;  3C1C C;  3AYW C;  5CP6 C;  4ZUX B;  1P3F B;  4R8P B;  3X1T B;  2IO5 C;  4H9S C;  3B6F B;  3B0D C;  4Z5T D;  4J8U D;  5B0Z C;  1M1A D;  3AV1 B;  3UTB A;  5B31 A;  1H3O B;  4YM6 B;  1TZY B;  2HUE C;  5GT0 B;  3AZJ D;  3W99 C;  2F8N A;  1P3B D;  3LJA D;  3REJ A;  1M18 D;  1AOI D;  3X1V B;  1KX3 A;  3REH A;  1S32 B;  4H9Q A;  3MGP C;  1ZLA A;  4LD9 A;  4KHA B;  5BO0 A;  4UUZ B;  3AZE A;  5CHL B;  3LZ1 C;  2HIO D;  2UWX A;  5E5A B;  2F8N K;  5CPI D;  3MGS B;  5B32 G;  1P34 B;  5AV5 D;  4KUD A;  4EO5 B;  5AVC C;  4WU9 B;  2F8N H;  2ZM5 A;  3AZL C;  4JJN B;  3LZ0 A;  4J8X C;  4Z2M G;  4WV4 B;  5B0Y C;  3WTP C;  1KX4 A;  3AFA A;  3AZF D;  1P3A B;  3VH5 W;  1N1J A;  5KDM B;  2ZY4 A;  4X23 B;  2G5H C;  3A6N D;  5AV8 A;  1P3P B;  3MNN B;  3W98 A;  4J8W A;  3W97 B;  1P3K A;  1KX5 C;  1U35 A;  5JRG A;  3WA9 A;  5GSU D;  5B32 D;  3MVD A;  1EQZ C;  5B33 C;  3FDD A;  3UTB B;  5B31 B;  3C1B A;  3UTA C;  4ZUX D;  1P3F D;  2F8N B;  3W96 C;  2J8P A;  1M1A B;  3B6F D;  4E45 A;  5GXQ A;  5B1M D;  3REJ B;  4YS3 C;  3REI A;  3KSY A;  5AV6 A;  1KX3 B;  3REH B;  3REL C;  2CV5 A;  4YM6 D;  4H9Q B;  4LD9 B;  1HQ3 C;  2Y2O A;  3AZI A;  3MGQ A;  3LJA B;  5CP6 D;  2RVQ C;  5BO0 B;  5DNM C;  4G91 B;  3AZE B;  3KUY A;  4WJ3 C;  1P3M C;  3O62 A;  4QLC A;  3C1C A;  4KUD B;  4WZS B;  3AYW A;  5CP6 A;  3WKJ C;  4J8W C;  4H9S A;  3AZH C;  5BNX A;  5B0Z A;  3AZK D;  2HIO B;  5DNN D;  4KGC C;  4NFT A;  4CAY A;  5E5A D;  2Y2G A;  3AFA B;  1KX4 B;  1N1J B;  4XUJ D;  3NQJ A;  5GT3 D;  1P34 D;  2BYK B;  4G92 B;  3W99 A;  4WNN A;  5AV8 B;  4WU9 D;  3W98 B;  1JFI A;  5JA4 A;  1BH8 A;  4DRA A;  4JJN D;  2Y2P A;  5AVB C;  3EPL A;  1P3K B;  4Z66 C;  1KU5 A;  3MGR C;  3MGP A;  5JRG B;  1U35 B;  1P3A D;  3MVD B;  3AZG C;  5C3I C;  4X23 D;  2ARO C;  5B24 C;  3MNN D;  1M19 C;  3W97 D;  3LZ1 A;  3C1B B;  3UT9 C;  3X1S C;  3EPJ A;  3WTP D;  2FJ7 C;  2BG1 A;  5GXQ B;  5AVC A;  4XZQ C;  3REI B;  5AV6 B;  3UTB D;  3AZL A;  4WU8 C;  5B31 D;  3EG5 B;  2CV5 B;  3X1U C;  5BNV A;  4J8X A;  5B0Y A;  3WTP A;  2NQB C;  1ID3 C;  3AZI B;  3MGQ B;  2F8N D;  5AV9 C;  5B1M B;  1B6W A;  1TAF A;  3REJ D;  1P3L C;  3KUY B;  3REH D;  3X1T C;  1KX3 D;  2NZD C;  5B1L C;  3O62 B;  4QLC B;  3C1C B;  1KX5 A;  1ZLA D;  3AYW B;  4LD9 D;  5CP6 B;  3AV1 C;  2IO5 B;  1EQZ A;  5BNX B;  3B0D B;  3WAA C;  3AZE D;  5B33 A;  1P3I C;  4CAY B;  5B2I C;  2Y2M A;  2HUE B;  4KUD D;  3UTA A;  3W99 B;  4M6B A;  3W96 A;  5B40 C;  1BFM A;  3AZK B;  1JFI B;  5JA4 B;  5DNN B;  2Y2J A;  1BH8 B;  1S32 C;  2G5I C;  3REK C;  3LZ0 D;  4YS3 A;  3NQU A;  2F2A C;  4XUJ B;  3REL A;  5GT3 B;  1KX4 D;  3AFA D;  3MGP B;  5F99 C;  1HQ3 A;  2YFV B;  5CPJ C;  5AV8 D;  3W98 D;  3KXB C;  4J8W D;  5DNM A;  3AV2 C;  3MGS C;  1F66 C;  2JCH A;  2Y2I A;  3LZ1 B;  3AN2 C;  1P3K D;  1P3M A;  1A7W A;  3AZN C;  4HGA B;  1U35 D;  5JRG D;  3WA9 D;  5BT1 D;  3MVD D;  3WKJ A;  5AVC B;  3AZH A;  1P3O C;  3AZL B;  2ZY2 A;  3KWQ C;  4KGC A;  5BNV B;  3VH5 A;  3C1B D;  4J8X B;  5B0Y B;  3WTP B;  1P3G C;  5AY8 C;  3VH6 T;  2PYO C;  3TU4 C;  2Y2Q A;  3AZM C;  1TAF B;  5GXQ D;  3B6G C;  4J8V C;  3REI D;  5AV6 D;  5AVB A;  4UPK A;  2CV5 D;  4Z66 A;  1KX5 B;  3EPK A;  3LEL C;  3MGR A;  3MGQ D;  3AZI D;  5CPK C;  1T3U A;  3AZG A;  1EQZ B;  2Y2K A;  5B33 B;  2ARO A;  4ZBJ C;  3H0R C;  4NE3 A;  5B24 A;  1M19 A;  4XZQ D;  3KUY D;  4Z5T C;  4J8U C;  1ZLA B;  1M1A C;  3O62 D;  4QLC D;  3C1C D;  3UT9 A;  3X1S A;  3AYW D;  3UTA B;  2FJ7 A;  3W96 B;  1Z2C B;  3AZJ C;  4XZQ A;  5B0Z D;  4YS3 B;  2JSS A;  2YFW A;  4AWL C;  3NQU B;  4WU8 A;  1P3B C;  4H9P A;  3LJA C;  3REL B;  1M18 C;  1AOI C;  3X1U A;  2NQB A;  1HQ3 B;  1ID3 A;  3W99 D;  5AV9 A;  3WTP E;  3LZ0 B;  5DNM B;  2DQN C;  1P3L A;  4R8P A;  3X1T A;  2NZD A;  5B1L A;  3MGP D;  5B2I D;  2HIO C;  3B0C T;  3AV1 A;  1WWS A;  3V9R A;  4J8W B;  3WKJ B;  5B31 G;  5CPI C;  1H3O A;  4E44 A;  5AV5 C;  3WAA A;  3KFU G;  1P3I A;  3LZ1 D;  4KGC B;  2BYM A;  2F8N G;  5BS7 C;  3WA9 B;  5B2I A;  5B2J C;  3X1V A;  5AVC D;  3AZF C;  5B40 A;  1S32 A;  3AZL D;  3REK A;  5AVB B;  3A6N C;  4DQY B;  4Z2M H;  4Z66 B;  4J8X D;  5B0Y D;  3AN2 D;  3MGR B;  5F99 A;  3AZG B;  2ARO B;  5CPJ A;  4H9O A;  5B24 B;  2ZY3 A;  3IP4 C;  3KXB A;  5GSU C;  4NE5 A;  5B32 C;  1M19 B;  3AV2 A;  3MGS A;  1F66 A;  3A1I A;  3AN2 A;  3UT9 B;  1KX5 D;  3X1S B;  1B67 A;  3VH6 W;  3AZN A;  2Y2H A;  2FJ7 B;  1WWI A;  1EQZ D;  2FFF B;  4XZQ B;  5B33 D;  4R8P C;  4ZUX C;  1P3F C;  1P3O A;  2YFW B;  4WU8 B;  3KWQ A;  4CSR A;  3B6F C;  4H9P B;  5KDM A;  5B1M C;  3X1U B;  1P3G A;  2NQB B;  5AY8 A;  3UTA D;  1ID3 B;  2PYO A;  3W96 D;  5AV9 B;  4YM6 C;  4H9R A;  1TZY C;  5B0Z B;  3TU4 A;  3AZM A;  5GT0 C;  4H9N A;  3B6G A;  4YS3 D;  4J8V A;  1P3L B;  2NZD B;  3REL D;  3NQJ B;  5B1L B;  3X1V C;  1HTA A;  1HQ3 D;  4WNN B;  3LEL A;  3F6T A;  3V9R B;  5CPK A;  2RVQ D;  5DNM D;  3WAA B;  1P3I B;  2BYM B;  4NE6 A;  4Z5T A;  5B2I B;  4J8U A;  3AZK C;  1P3M D;  1M1A A;  5DNN C;  2ZY5 A;  5E5A C;  3WKJ D;  5B40 B;  3AZH D;  4XUJ C;  5GT3 C;  1P34 C;  2DF4 C;  4EO5 C;  3AZJ A;  3REK B;  2Y2N A;  4WU9 C;  4KGC D;  1P3B A;  3LJA A;  5G49 A;  4JJN C;  1M18 A;  1AOI A;  5F99 B;  3B0C W;  5CPJ B;  4H9O B;  1P3A C;  3KXB B;  4HGA C;  4X23 C;  3AV2 B;  5AVB D;  1F66 B;  3AN2 B;  4Z66 D;  3MNN C;  1P3P C;  3AZN B;  3W97 C;  3MGR D;  1ULY A;  2HIO A;  3AZG D;  5B2J D;  2ARO D;  5CPI A;  5B24 D;  1P3O B;  5AV5 A;  1M19 D;  3KWQ B;  4CSR B;  2BYK A;  3R45 A;  3UT9 D;  1P3G B;  5BS7 A;  3X1S D;  3UTB C;  5AY8 B;  5B31 C;  3A1K A;  5B2J A;  1BH9 A;  2FJ7 D;  2PYO B;  4H9R B;  3TU4 B;  2L5A A;  3AZM B;  4H9N B;  3AZF A;  3B6G B;  4J8V B;  4DRB A;  4WU8 D;  2LY8 A;  3A6N A;  3REJ C;  3X1U D;  2NQB D;  1KX3 C;  3REH C;  3LEL B;  1ID3 D;  5CPK B;  5AV9 D;  1ZLA C;  4LD9 C;  2CWE A;  4ZBJ B;  1P3L D;  3AL0 C;  5GSU A;  5B32 A;  3P5J B;  3X1T D;  4R8P D;  2NZD D;  4G91 C;  4Z5T B;  4J8U B;  3AZE C;  5B1L D;  2W8S A;  5FUG A;  3AV1 D;  4KUD C;  3WAA D;  3AZJ B;  1TZY D;  4ZUX A;  1P3F A;  1W2E A;  1P3I D;  5GT0 D;  4AWL B;  1P3M B;  1P3B B;  3B6F A;  2RIQ A;  5G49 B;  5B1M A;  2XD5 A;  3LZ0 C;  1M18 B;  1AOI B;  1F1E A;  3AZH B;  3X1V D;  1KX4 C;  3AFA C;  4YM6 A;  5B40 D;  1TZY A;  1S32 D;  5GT0 A;  2XD1 A;  3REK D;  4G92 C;  5AV8 C;  3W98 C;  2Y2L A;  1PZR A;  1R4V A;  3H0L C;  1P3K C;  5F99 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...