5B2ID

Human nucleosome containing cpg unmethylated dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2iD00
3AZIB 1P3BD 3MGSB 3TU4A 5GT0D 4J8UC 1KX4C 5B31G 3TU4D 5GXQA 5BT1D 3AZIA 3AZID 1U35B 3MGSD 2AROB 1P3GC 2F8NA 4KGCB 4H9NB 3MNNB 1U35A 3LJAB 5CPJC 2AROD 3O62B 3AZMC 3B6FC 3W96B 4KGCA 3MNNA 1P3LC 3LJAA 3MNND 3W96A 3O62A 3C1BC 1TAFA 3W96D 5B31C 5C3IB 5AY8C 5AV9B 3WTPC 5AV9A 5B40D 3AZHC 1P3BA 4J8XC 5AVBC 5AV9D 1P3IB 5DNMB 1P3PA 1ID3B 3MGQC 1BH8A 4J8UB 1P3IA 1KX4B 5DNMA 1ID3A 1P3ID 1ID3D 4J8UA 4J8UD 1KX4D 3B6GD 5CP6C 2PYOB 1P3GA 5B1MA 3RELC 5KDMB 3AZMB 3B6FB 5CPKD 5CPJA 3C1BB 3AZMA 2PYOD 3B6FA 3B6FD 1P3LA 4UUZA 5AY8B 5B2JC 4WZSB 4Z5TC 3C1BA 4H9OB 3AZGC 1M19C 3C1BD 5B31A 5AY8A 3MVDC 4H9OA 5AY8D 3WTPA 3AZHB 2IO5C 1P3MC 3AZHA 4J8XA 5AVBA 5AV8C 3AZHD 5G49B 3MGQB 1F1EA 1AOIA 5BNXA 5BO0A 3LZ0D 2F8NK 3UT9D 3MGQD 3AZJC 5B2IC 3RELB 4JJNC 5CP6A 3W98C 3RELA 3X1UC 5B1LB 3LELD 4YM6B 4ZBJC 3AZGB 4WU9C 1M19B 5B1LD 5B2JA 3MVDB 4Z5TA 4WU8D 3AV1C 4YM6D 1M19A 2NQBC 3AZGD 1P3MB 1M19D 2LY8A 3MVDA 1WWSA 3AZLC 3MVDD 5B33C 3C1CC 5AV8B 5DNNC 1P3MA 1ID3C 5B32G 4E45A 5AV8D 1TZYC 1F66C 4H9RB 5JA4B 3KSYA 3AZJA 5B2IA 5AV5C 4J8WC 5B0YA 4H9RA 2YFVB 5B24B 3REHC 3W98B 1HQ3C 3X1UB 3KWQC 4JJNA 5F99D 5B24D 3W98A 3X1UA 4ZBJB 3AFAD 3W98D 4WU9B 2F8NB 2FJ7C 5GXQD 4WU9A 2NQBB 5B1MC 5AV6A 2F8ND 3AZLB 3WAAC 5B33B 3AV1A 2NQBA 4HGAC 3C1CB 1U35D 5GSUC 5DNNB 1TAFB 3AZLA 5B33A 3C1CA 3AZLD 5B33D 5DNNA 4KGCD 3LJAD 5DNND 3O62D 1F66B 3AZEA 2CV5C 3NQJA 1TZYA 1F66A 5AV5B 2HIOC 4J8WB 1P3PB 3AZNC 1ZLAC 1H3OA 3VH6A 1HQ3B 1BH8B 3KWQB 1AOIC 5AV5A 4J8WA 1B6WA 5JRGC 5AV5D 3REHA 1P3PD 1HQ3A 3X1TC 3KWQA 2RVQC 5DNMD 2FJ7B 5E5AA 1B67A 3UTBC 3X1VC 1P3GB 5B1MB 1KX3C 2FJ7A 1Q9CA 4R8PC 3KUYC 3AZKC 2FJ7D 3WAAB 3WA9C 4HGAB 5CPJB 1P3GD 5B1MD 3WAAA 1P3LB 4UUZB 3LZ1C 5GSUA 3UTAC 4KUDC 5CPJD 3X1SA 4WNNB 3AZMD 5B31B 3W97C 1P3LD 3W99C 4QLCC 2BYKB 3WTPB 5CPIC 4WNNA 2CV5B 4NE3A 4NFTA 5B31D 2BYKA 2HIOB 4J8XB 3AZNB 5AVBB 3WTPD 2CV5A 1P3FC 2CV5D 1AOIB 5BNXB 2HIOA 3V9RB 5BO0B 5JRGB 3AZNA 1ZLAA 2HIOD 4J8XD 5AVBD 3X1TB 3V9RA 3REKC 5AVCC 5JRGA 1AOID 3WKJA 4DRBA 5JRGD 3X1TA 3UTBB 3VH6T 3X1TD 2RVQD 3VH6W 1KU5A 4NE6A 1KX3B 4R8PB 3AZKB 1P3KC 5CP6B 5B0YC 3UTBA 3X1VA 1A7WA 3UTBD 1KX3A 4X23C 1BH9A 4R8PA 3KUYA 3AZKA 1KX3D 4DRAA 3WA9A 5CP6D 3LZ1B 4KUDB 3RELD 3LZ1A 5B2JB 1P34C 4Z5TB 3W97B 3UTAA 3W99B 4KUDA 5CPIB 3KXBC 4KUDD 5AV6C 3W97A 3W99A 4QLCA 5B2JD 2IO5B 4Z5TD 5CPIA 5CPID 1P3FB 1EQZC 1N1JB 1P3FA 1N1JA 3AZFC 1P3MD 1P3FD 5GT0C 3REKB 5AVCB 3MGPC 3B0CW 2BYMB 5BT1C 3AZEC 4ZUXC 3REKA 5AVCA 3AZJB 5B2IB 3REKD 1HTAA 2BYMA 3NQUB 5B0YB 3AV2C 4X23B 3AZJD 1P3KA 4JJNB 3NQUA 5B2ID 4NE5A 4Z2MG 5B0YD 4X23A 4X23D 5B32C 4JJND 5E5AC 1P34B 2NZDA 1P3AC 3X1UD 5AV6B 3R45A 1P34A 1P34D 3AV1B 4H9PB 5C3IC 3KXBA 3A6NA 5B40C 4WU9D 1EQZB 4XZQC 5AV6D 4H9PA 5B0ZA 3AV1D 2NQBD 1EQZA 3AZFB 3X1SC 1EQZD 5GT0B 2F8NH 4Z66A 3MGPB 2JSSA 3AZEB 3C1CD 3AZFA 3AYWC 5GT0A 4ZUXB 3NQJB 3REIC 3AZFD 1TZYB 3MGPA 3B6GC 3MGPD 3AZED 4ZUXA 3AV2B 3MGSA 5GT3C 1H3OB 4ZUXD 1TZYD 1F66D 4G91C 3REHB 3VH5A 4H9QB 4M6BA 3AV2A 5CPKC 2YFWB 3AV2D 2PYOC 2AROA 1JFIB 3WKJC 5B32B 1R4VA 4H9QA 4J8WD 5E5AB 2YFWA 3REHD 4H9NA 1P3AB 4LD9C 1HQ3D 3KWQD 1JFIA 5B32A 4Z2MH 5B32D 1M18C 1P3AA 5E5AD 3B0DC 5B40B 1P3AD 3REJC 4AWLC 4XZQB 5B40A 4J8VC 5GSUB 2L5AA 4XZQA 3X1SB 4XZQD 3WAAD 4WV4B 3LZ0C 5GSUD 3AYWB 3UT9C 3REIB 3X1SD 5BS7C 3B6GB 3AYWA 4EO5C 3REIA 3AYWD 5GT3B 1BFMA 3REID 1KX4A 1M1AC 3B6GA 3AN2C 4G91B 1ZLAB 5CPKB 5GT3A 5GT3D 3WKJB 5CPKA 1KX5C 3AZND 1ZLAD 4LD9B 3LELC 2PYOA 5B1LC 5KDMA 4H9SC 3VH5T 3WKJD 1M18B 4LD9A 3VH5W 3X1VB 4WU8C 3B0DB 4LD9D 5FUGB 3REJB 4YM6C 4AWLB 1BH9B 3KUYB 1M18A 3WA9B 4G92C 1M18D 5FUGA 4J8VB 3REJA 3X1VD 1P3OC 3REJD 4R8PD 3KUYD 3AZKD 4J8VA 3WA9D 3UTAB 2NZDC 3LZ0B 4J8VD 3UT9B 3MGRC 3B0BA 4QLCB 3LZ1D 3LZ0A 3UTAD 4EO5B 3A6NC 3UT9A 5G49A 4XUJC 4YS3C 3MGQA 5BS7A 2HUEC 1M1AB 2F8NG 3AN2B 3W97D 3W99D 4QLCD 5B0ZC 5BNVB 1S32C 1M1AA 3AN2A 1M1AD 4Z66C 3AN2D 1KX5B 5F99C 1P3BC 5BNVA 5B24C 3LELB 3AFAC 3B0CT 3TU4C 1KX5A 5GXQC 3LELA 1KX5D 4WU8B 3AZIC 3MGSC 4CAYB 5B1LA 2YFVA 4H9SA 5AVCD 1P3KB 4WU8A 4G92B 4CSRB 4CAYA 4YM6A 3AZGA 1U35C 1P3OB 2AROC 1P3KD 1ULYA 4CSRA 4KHAB 4KGCC 3MNNC 2NZDB 1P3OA 3LJAC 1P3OD 4E44A 3W96C 3O62C 3MGRB 4KHAA 3R45B 3KXBB 3A6NB 5AV8A 2NZDD 4YS3B 4XUJB 3MGRA 2HUEB 3MGRD 2CWEA 5B0ZB 4XUJA 4YS3A 3KXBD 5AV9C 3A6ND 4YS3D 4XUJD 1S32B 1WWIA 4Z66B 3WTPE 5F99B 5B0ZD 1P3BB 1S32A 1P3PC 5JA4A 3AFAB 1S32D 5CHLB 3TU4B 1P3IC 5F99A 5DNMC 4Z66D 5GXQB 5B24A 3AFAA
chains in the Genus database with same CATH superfamily
3AZIB 1P3BD 3MGSB 3TU4A 5GT0D 4J8UC 1KX4C 5B31G 3TU4D 5GXQA 5BT1D 3AZIA 3AL0C 3AZID 1U35B 3MGSD 2AROB 1P3GC 2F8NA 4KGCB 4H9NB 3MNNB 1U35A 3LJAB 5CPJC 2AROD 3O62B 3AZMC 3B6FC 3W96B 4KGCA 3MNNA 1P3LC 3LJAA 3MNND 3W96A 3O62A 3C1BC 2G5IC 1TAFA 3W96D 5B31C 5C3IB 5AY8C 2VQRA 5AV9B 3WTPC 5AV9A 5B40D 3AZHC 1P3BA 4J8XC 5AVBC 5AV9D 1P3IB 5DNMB 1P3PA 1ID3B 3MGQC 1BH8A 4J8UB 1P3IA 1KX4B 5DNMA 4DQYB 1ID3A 1P3ID 1ID3D 4J8UA 4J8UD 1KX4D 3B6GD 5CP6C 2PYOB 1P3GA 5B1MA 3RELC 5KDMB 3AZMB 3B6FB 3IP4C 5CPKD 5CPJA 3C1BB 3AZMA 2PYOD 3B6FA 3B6FD 1P3LA 4UUZA 5AY8B 5B2JC 4WZSB 4Z5TC 3C1BA 4H9OB 3AZGC 2UWXA 1M19C 3C1BD 5B31A 4WJ3C 5AY8A 3MVDC 4H9OA 5AY8D 3WTPA 3AZHB 2IO5C 1P3MC 3F6TA 2Y2IA 3AZHA 4J8XA 5AVBA 5AV8C 2Y2KA 3AZHD 5G49B 3MGQB 1F1EA 1AOIA 3H0MC 5BNXA 5BO0A 3LZ0D 2F8NK 3UT9D 3MGQD 3AZJC 5B2IC 3RELB 3FDDA 4JJNC 5CP6A 3W98C 3RELA 5B1LB 3X1UC 2Y2JA 3LELD 3EPLA 4YM6B 4ZBJC 3AZGB 4WU9C 1M19B 5B1LD 5B2JA 3MVDB 4Z5TA 2Y2OA 4WU8D 3AV1C 4YM6D 1M19A 2NQBC 3AZGD 1P3MB 1M19D 2LY8A 3A1IA 3MVDA 1WWSA 3AZLC 3MVDD 5B33C 3C1CC 5AV8B 5DNNC 2DF4C 1P3MA 1ID3C 1Z2CB 3EPJA 5B32G 1W2EA 4E45A 5AV8D 1TZYC 1F66C 4H9RB 5JA4B 3KSYA 3AZJA 5B2IA 5AV5C 4J8WC 5B0YA 4H9RA 2YFVB 5B24B 3REHC 3W98B 1HQ3C 3X1UB 3KWQC 4JJNA 5F99D 5B24D 3W98A 3X1UA 4ZBJB 3AFAD 3W98D 4WU9B 2F8NB 2FJ7C 5GXQD 4WU9A 2NQBB 5B1MC 5AV6A 2F8ND 3AZLB 3WAAC 5B33B 3AV1A 2NQBA 4HGAC 3C1CB 1U35D 5GSUC 5DNNB 1TAFB 3AZLA 5B33A 3C1CA 3AZLD 5B33D 5DNNA 4KGCD 3LJAD 5DNND 3O62D 1F66B 3AZEA 2CV5C 3NQJA 1TZYA 1F66A 5AV5B 2HIOC 3H0RC 4J8WB 1P3PB 3AZNC 1ZLAC 1H3OA 3VH6A 1HQ3B 1BH8B 3KWQB 1AOIC 5AV5A 4J8WA 1B6WA 5JRGC 5AV5D 3REHA 1P3PD 1HQ3A 3X1TC 2W8SA 2RVQC 3KWQA 5DNMD 2FJ7B 5E5AA 1B67A 3UTBC 3X1VC 1P3GB 5B1MB 2Y2LA 1KX3C 2FJ7A 1Q9CA 4R8PC 3KUYC 3AZKC 2FJ7D 3WAAB 3WA9C 4HGAB 2Y2HA 5CPJB 1P3GD 5B1MD 3WAAA 1P3LB 4UUZB 3LZ1C 5GSUA 3UTAC 4KUDC 5CPJD 3X1SA 4WNNB 3AZMD 5B31B 3W97C 1P3LD 3W99C 4QLCC 2BYKB 3WTPB 5CPIC 4WNNA 2CV5B 4NE3A 4NFTA 5B31D 2BYKA 2HIOB 4J8XB 3AZNB 5AVBB 3WTPD 2CV5A 1P3FC 2CV5D 1AOIB 5BNXB 2HIOA 3V9RB 5BO0B 5JRGB 3AZNA 1ZLAA 2HIOD 4J8XD 5AVBD 3X1TB 3V9RA 3REKC 5AVCC 5JRGA 1AOID 3WKJA 4DRBA 5JRGD 3X1TA 3UTBB 3VH6T 3X1TD 2RVQD 2ZY5A 3VH6W 1KU5A 4NE6A 1KX3B 4R8PB 3AZKB 1P3KC 5CP6B 5B0YC 3UTBA 3X1VA 1A7WA 3UTBD 1KX3A 4X23C 1BH9A 4R8PA 3KUYA 3AZKA 1KX3D 4DRAA 3WA9A 5CP6D 3LZ1B 2Y2PA 4KUDB 3RELD 3LZ1A 5B2JB 1P34C 4Z5TB 3W97B 3UTAA 3W99B 3EPHA 4KUDA 5CPIB 3KXBC 4KUDD 3EG5B 5AV6C 3W97A 3W99A 2F2AC 4QLCA 5B2JD 2IO5B 4Z5TD 5CPIA 5CPID 1P3FB 1EQZC 1N1JB 1P3FA 1N1JA 3AZFC 1P3MD 2FFFB 1P3FD 5GT0C 3REKB 5AVCB 3MGPC 3B0CW 2BYMB 5BT1C 3AZEC 2Y2NA 2J8PA 4ZUXC 3REKA 5AVCA 3AZJB 2JE5A 5B2IB 3REKD 1HTAA 2BYMA 3NQUB 5B0YB 3AV2C 4X23B 3AZJD 1P3KA 4JJNB 3NQUA 5B2ID 4NE5A 4Z2MG 5B0YD 4X23A 4X23D 5B32C 4JJND 5E5AC 1P34B 2NZDA 1P3AC 3X1UD 2Y2GA 5AV6B 3R45A 1P34A 1P34D 3AV1B 4H9PB 5C3IC 3KXBA 3A6NA 5B40C 2ZY3A 4WU9D 1EQZB 4XZQC 5AV6D 4H9PA 5B0ZA 3AV1D 2NQBD 1EQZA 3AZFB 3X1SC 1EQZD 5GT0B 2F8NH 4Z66A 3MGPB 2JSSA 3AZEB 3C1CD 3AZFA 3AYWC 5GT0A 4ZUXB 3NQJB 3REIC 3AZFD 1TZYB 3MGPA 3B6GC 3MGPD 3AZED 4ZUXA 3AV2B 3MGSA 5GT3C 1H3OB 4ZUXD 1TZYD 1F66D 2XD1A 4G91C 3REHB 3VH5A 4H9QB 4M6BA 3AV2A 5CPKC 2YFWB 3AV2D 2PYOC 2AROA 1JFIB 3WKJC 5B32B 2RIQA 1R4VA 4H9QA 4J8WD 5E5AB 2YFWA 3REHD 4H9NA 1P3AB 4LD9C 1HQ3D 3KWQD 1JFIA 5B32A 2G5HC 4Z2MH 5B32D 1M18C 1P3AA 5E5AD 2ZY4A 3B0DC 5B40B 1P3AD 3REJC 2BG1A 4AWLC 4XZQB 3KFUG 1T3UA 5B40A 4J8VC 5GSUB 2L5AA 4XZQA 3X1SB 4XZQD 3WAAD 4WV4B 3LZ0C 5GSUD 3AYWB 3UT9C 3REIB 3X1SD 5BS7C 2XD5A 3B6GB 3AYWA 4EO5C 3REIA 3AYWD 5GT3B 1BFMA 3REID 1KX4A 1M1AC 3B6GA 3AN2C 4G91B 1ZLAB 5CPKB 5GT3A 3A1KA 5GT3D 3WKJB 5CPKA 1KX5C 3AZND 1ZLAD 2ZM5A 4LD9B 3LELC 2PYOA 5B1LC 5KDMA 4H9SC 3VH5T 3WKJD 1M18B 4LD9A 3VH5W 3X1VB 4WU8C 3B0DB 4LD9D 5FUGB 3REJB 4YM6C 4AWLB 1BH9B 3KUYB 1M18A 3WA9B 4G92C 1M18D 5FUGA 4J8VB 3REJA 3X1VD 1P3OC 3REJD 4R8PD 3KUYD 3AZKD 4J8VA 3WA9D 3UTAB 2NZDC 3LZ0B 4J8VD 3UT9B 3MGRC 3B0BA 4QLCB 3LZ1D 3LZ0A 3UTAD 4EO5B 3A6NC 3UT9A 5G49A 4XUJC 4YS3C 3MGQA 5BS7A 2HUEC 1M1AB 2F8NG 3AN2B 3W97D 3W99D 4QLCD 4UPKA 5B0ZC 5BNVB 1S32C 1M1AA 3AN2A 1M1AD 4Z66C 3EPKA 3AN2D 1KX5B 5F99C 1P3BC 5BNVA 5B24C 3LELB 3AFAC 2JCHA 3B0CT 3TU4C 1KX5A 5GXQC 3LELA 1KX5D 4WU8B 3AZIC 3MGSC 4CAYB 5B1LA 2YFVA 4H9SA 5AVCD 1P3KB 4WU8A 4G92B 2ZY2A 4CSRB 4CAYA 4YM6A 3AZGA 1U35C 1P3OB 2AROC 1P3KD 1ULYA 4CSRA 4KHAB 2Y2MA 4KGCC 3MNNC 2NZDB 1P3OA 3LJAC 1P3OD 4E44A 3W96C 3O62C 3MGRB 4KHAA 1PZRA 3R45B 2Y2QA 3KXBB 3A6NB 5AV8A 2NZDD 4YS3B 4XUJB 3MGRA 2HUEB 3MGRD 2CWEA 5B0ZB 4XUJA 4YS3A 3KXBD 5AV9C 3A6ND 4YS3D 4XUJD 1S32B 1WWIA 3P5JB 4Z66B 3WTPE 5F99B 5B0ZD 1P3BB 1S32A 1P3PC 5JA4A 2DQNC 3H0LC 3AFAB 1S32D 5CHLB 3TU4B 1P3IC 5F99A 5DNMC 4Z66D 5GXQB 5B24A 3AFAA
chains in the Genus database with same CATH topology
3AZIB 1P3BD 3MGSB 3TU4A 5GT0D 4J8UC 1KX4C 5B31G 3TU4D 5GXQA 5BT1D 3AZIA 3AL0C 3AZID 1U35B 3MGSD 2AROB 1P3GC 2F8NA 4KGCB 4H9NB 3MNNB 1U35A 3LJAB 5CPJC 2AROD 3O62B 3AZMC 3B6FC 3W96B 4KGCA 3MNNA 1P3LC 3LJAA 3MNND 3W96A 3O62A 3C1BC 2G5IC 1TAFA 3W96D 5B31C 5C3IB 5AY8C 2VQRA 5AV9B 3WTPC 5AV9A 5B40D 3AZHC 1P3BA 4J8XC 5AVBC 5AV9D 1P3IB 5DNMB 1P3PA 1ID3B 3MGQC 1BH8A 4J8UB 1P3IA 1KX4B 5DNMA 4DQYB 1ID3A 1P3ID 1ID3D 4J8UA 4J8UD 1KX4D 3B6GD 5CP6C 2PYOB 1P3GA 5B1MA 3RELC 5KDMB 3AZMB 3B6FB 3IP4C 5CPKD 5CPJA 3C1BB 3AZMA 2PYOD 3B6FA 3B6FD 1P3LA 4UUZA 5AY8B 5B2JC 4WZSB 4Z5TC 3C1BA 4H9OB 3AZGC 2UWXA 1M19C 3C1BD 5B31A 4WJ3C 5AY8A 3MVDC 4H9OA 5AY8D 3WTPA 3AZHB 2IO5C 1P3MC 3F6TA 2Y2IA 3AZHA 4J8XA 5AVBA 5AV8C 2Y2KA 3AZHD 5G49B 3MGQB 1F1EA 1AOIA 3H0MC 5BNXA 5BO0A 3LZ0D 2F8NK 3UT9D 3MGQD 3AZJC 5B2IC 3RELB 3FDDA 4JJNC 5CP6A 3W98C 3RELA 5B1LB 3X1UC 2Y2JA 3LELD 3EPLA 4YM6B 4ZBJC 3AZGB 4WU9C 1M19B 5B1LD 5B2JA 3MVDB 4Z5TA 2Y2OA 4WU8D 3AV1C 4YM6D 1M19A 2NQBC 3AZGD 1P3MB 1M19D 2LY8A 3A1IA 3MVDA 1WWSA 3AZLC 3MVDD 5B33C 3C1CC 5AV8B 5DNNC 2DF4C 1P3MA 1ID3C 1Z2CB 3EPJA 5B32G 1W2EA 4E45A 5AV8D 1TZYC 1F66C 4H9RB 5JA4B 3KSYA 3AZJA 5B2IA 5AV5C 4J8WC 5B0YA 4H9RA 2YFVB 5B24B 3REHC 3W98B 1HQ3C 3X1UB 3KWQC 4JJNA 5F99D 5B24D 3W98A 3X1UA 4ZBJB 3AFAD 3W98D 4WU9B 2F8NB 2FJ7C 5GXQD 4WU9A 2NQBB 5B1MC 5AV6A 2F8ND 3AZLB 3WAAC 5B33B 3AV1A 2NQBA 4HGAC 3C1CB 1U35D 5GSUC 5DNNB 1TAFB 3AZLA 5B33A 3C1CA 3AZLD 5B33D 5DNNA 4KGCD 3LJAD 5DNND 3O62D 1F66B 3AZEA 2CV5C 3NQJA 1TZYA 1F66A 5AV5B 2HIOC 3H0RC 4J8WB 1P3PB 3AZNC 1ZLAC 1H3OA 3VH6A 1HQ3B 1BH8B 3KWQB 1AOIC 5AV5A 4J8WA 1B6WA 5JRGC 5AV5D 3REHA 1P3PD 1HQ3A 3X1TC 2W8SA 2RVQC 3KWQA 5DNMD 2FJ7B 5E5AA 1B67A 3UTBC 3X1VC 1P3GB 5B1MB 2Y2LA 1KX3C 2FJ7A 1Q9CA 4R8PC 3KUYC 3AZKC 2FJ7D 3WAAB 3WA9C 4HGAB 2Y2HA 5CPJB 1P3GD 5B1MD 3WAAA 1P3LB 4UUZB 3LZ1C 5GSUA 3UTAC 4KUDC 5CPJD 3X1SA 4WNNB 3AZMD 5B31B 3W97C 1P3LD 3W99C 4QLCC 2BYKB 3WTPB 5CPIC 4WNNA 2CV5B 4NE3A 4NFTA 5B31D 2BYKA 2HIOB 4J8XB 3AZNB 5AVBB 3WTPD 2CV5A 1P3FC 2CV5D 1AOIB 5BNXB 2HIOA 3V9RB 5BO0B 5JRGB 3AZNA 1ZLAA 2HIOD 4J8XD 5AVBD 3X1TB 3V9RA 3REKC 5AVCC 5JRGA 1AOID 3WKJA 4DRBA 5JRGD 3X1TA 3UTBB 3VH6T 3X1TD 2RVQD 2ZY5A 3VH6W 1KU5A 4NE6A 1KX3B 4R8PB 3AZKB 1P3KC 5CP6B 5B0YC 3UTBA 3X1VA 1A7WA 3UTBD 1KX3A 4X23C 1BH9A 4R8PA 3KUYA 3AZKA 1KX3D 4DRAA 3WA9A 5CP6D 3LZ1B 2Y2PA 4KUDB 3RELD 3LZ1A 5B2JB 1P34C 4Z5TB 3W97B 3UTAA 3W99B 3EPHA 4KUDA 5CPIB 3KXBC 4KUDD 3EG5B 5AV6C 3W97A 3W99A 2F2AC 4QLCA 5B2JD 2IO5B 4Z5TD 5CPIA 5CPID 1P3FB 1EQZC 1N1JB 1P3FA 1N1JA 3AZFC 1P3MD 2FFFB 1P3FD 5GT0C 3REKB 5AVCB 3MGPC 3B0CW 2BYMB 5BT1C 3AZEC 2Y2NA 2J8PA 4ZUXC 3REKA 5AVCA 3AZJB 2JE5A 5B2IB 3REKD 1HTAA 2BYMA 3NQUB 5B0YB 3AV2C 4X23B 3AZJD 1P3KA 4JJNB 3NQUA 5B2ID 4NE5A 4Z2MG 5B0YD 4X23A 4X23D 5B32C 4JJND 5E5AC 1P34B 2NZDA 1P3AC 3X1UD 2Y2GA 5AV6B 3R45A 1P34A 1P34D 3AV1B 4H9PB 5C3IC 3KXBA 3A6NA 5B40C 2ZY3A 4WU9D 1EQZB 4XZQC 5AV6D 4H9PA 5B0ZA 3AV1D 2NQBD 1EQZA 3AZFB 3X1SC 1EQZD 5GT0B 2F8NH 4Z66A 3MGPB 2JSSA 3AZEB 3C1CD 3AZFA 3AYWC 5GT0A 4ZUXB 3NQJB 3REIC 3AZFD 1TZYB 3MGPA 3B6GC 3MGPD 3AZED 4ZUXA 3AV2B 3MGSA 5GT3C 1H3OB 4ZUXD 1TZYD 1F66D 2XD1A 4G91C 3REHB 3VH5A 4H9QB 4M6BA 3AV2A 5CPKC 2YFWB 3AV2D 2PYOC 2AROA 1JFIB 3WKJC 5B32B 2RIQA 1R4VA 4H9QA 4J8WD 5E5AB 2YFWA 3REHD 4H9NA 1P3AB 4LD9C 1HQ3D 3KWQD 1JFIA 5B32A 2G5HC 4Z2MH 5B32D 1M18C 1P3AA 5E5AD 2ZY4A 3B0DC 5B40B 1P3AD 3REJC 2BG1A 4AWLC 4XZQB 3KFUG 1T3UA 5B40A 4J8VC 5GSUB 2L5AA 4XZQA 3X1SB 4XZQD 3WAAD 4WV4B 3LZ0C 5GSUD 3AYWB 3UT9C 3REIB 3X1SD 5BS7C 2XD5A 3B6GB 3AYWA 4EO5C 3REIA 3AYWD 5GT3B 1BFMA 3REID 1KX4A 1M1AC 3B6GA 3AN2C 4G91B 1ZLAB 5CPKB 5GT3A 3A1KA 5GT3D 3WKJB 5CPKA 1KX5C 3AZND 1ZLAD 2ZM5A 4LD9B 3LELC 2PYOA 5B1LC 5KDMA 4H9SC 3VH5T 3WKJD 1M18B 4LD9A 3VH5W 3X1VB 4WU8C 3B0DB 4LD9D 5FUGB 3REJB 4YM6C 4AWLB 1BH9B 3KUYB 1M18A 3WA9B 4G92C 1M18D 5FUGA 4J8VB 3REJA 3X1VD 1P3OC 3REJD 4R8PD 3KUYD 3AZKD 4J8VA 3WA9D 3UTAB 2NZDC 3LZ0B 4J8VD 3UT9B 3MGRC 3B0BA 4QLCB 3LZ1D 3LZ0A 3UTAD 4EO5B 3A6NC 3UT9A 5G49A 4XUJC 4YS3C 3MGQA 5BS7A 2HUEC 1M1AB 2F8NG 3AN2B 3W97D 3W99D 4QLCD 4UPKA 5B0ZC 5BNVB 1S32C 1M1AA 3AN2A 1M1AD 4Z66C 3EPKA 3AN2D 1KX5B 5F99C 1P3BC 5BNVA 5B24C 3LELB 3AFAC 2JCHA 3B0CT 3TU4C 1KX5A 5GXQC 3LELA 1KX5D 4WU8B 3AZIC 3MGSC 4CAYB 5B1LA 2YFVA 4H9SA 5AVCD 1P3KB 4WU8A 4G92B 2ZY2A 4CSRB 4CAYA 4YM6A 3AZGA 1U35C 1P3OB 2AROC 1P3KD 1ULYA 4CSRA 4KHAB 2Y2MA 4KGCC 3MNNC 2NZDB 1P3OA 3LJAC 1P3OD 4E44A 3W96C 3O62C 3MGRB 4KHAA 1PZRA 3R45B 2Y2QA 3KXBB 3A6NB 5AV8A 2NZDD 4YS3B 4XUJB 3MGRA 2HUEB 3MGRD 2CWEA 5B0ZB 4XUJA 4YS3A 3KXBD 5AV9C 3A6ND 4YS3D 4XUJD 1S32B 1WWIA 3P5JB 4Z66B 3WTPE 5F99B 5B0ZD 1P3BB 1S32A 1P3PC 5JA4A 2DQNC 3H0LC 3AFAB 1S32D 5CHLB 3TU4B 1P3IC 5F99A 5DNMC 4Z66D 5GXQB 5B24A 3AFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZI B;  1P3B D;  3MGS B;  3TU4 A;  5GT0 D;  4J8U C;  1KX4 C;  5B31 G;  3TU4 D;  5GXQ A;  5BT1 D;  3AZI A;  3AZI D;  1U35 B;  3MGS D;  2ARO B;  1P3G C;  2F8N A;  4KGC B;  4H9N B;  3MNN B;  1U35 A;  3LJA B;  5CPJ C;  2ARO D;  3O62 B;  3AZM C;  3B6F C;  3W96 B;  4KGC A;  3MNN A;  1P3L C;  3LJA A;  3MNN D;  3W96 A;  3O62 A;  3C1B C;  1TAF A;  3W96 D;  5B31 C;  5C3I B;  5AY8 C;  5AV9 B;  3WTP C;  5AV9 A;  5B40 D;  3AZH C;  1P3B A;  4J8X C;  5AVB C;  5AV9 D;  1P3I B;  5DNM B;  1P3P A;  1ID3 B;  3MGQ C;  1BH8 A;  4J8U B;  1P3I A;  1KX4 B;  5DNM A;  1ID3 A;  1P3I D;  1ID3 D;  4J8U A;  4J8U D;  1KX4 D;  3B6G D;  5CP6 C;  2PYO B;  1P3G A;  5B1M A;  3REL C;  5KDM B;  3AZM B;  3B6F B;  5CPK D;  5CPJ A;  3C1B B;  3AZM A;  2PYO D;  3B6F A;  3B6F D;  1P3L A;  4UUZ A;  5AY8 B;  5B2J C;  4WZS B;  4Z5T C;  3C1B A;  4H9O B;  3AZG C;  1M19 C;  3C1B D;  5B31 A;  5AY8 A;  3MVD C;  4H9O A;  5AY8 D;  3WTP A;  3AZH B;  2IO5 C;  1P3M C;  3AZH A;  4J8X A;  5AVB A;  5AV8 C;  3AZH D;  5G49 B;  3MGQ B;  1F1E A;  1AOI A;  5BNX A;  5BO0 A;  3LZ0 D;  2F8N K;  3UT9 D;  3MGQ D;  3AZJ C;  5B2I C;  3REL B;  4JJN C;  5CP6 A;  3W98 C;  3REL A;  3X1U C;  5B1L B;  3LEL D;  4YM6 B;  4ZBJ C;  3AZG B;  4WU9 C;  1M19 B;  5B1L D;  5B2J A;  3MVD B;  4Z5T A;  4WU8 D;  3AV1 C;  4YM6 D;  1M19 A;  2NQB C;  3AZG D;  1P3M B;  1M19 D;  2LY8 A;  3MVD A;  1WWS A;  3AZL C;  3MVD D;  5B33 C;  3C1C C;  5AV8 B;  5DNN C;  1P3M A;  1ID3 C;  5B32 G;  4E45 A;  5AV8 D;  1TZY C;  1F66 C;  4H9R B;  5JA4 B;  3KSY A;  3AZJ A;  5B2I A;  5AV5 C;  4J8W C;  5B0Y A;  4H9R A;  2YFV B;  5B24 B;  3REH C;  3W98 B;  1HQ3 C;  3X1U B;  3KWQ C;  4JJN A;  5F99 D;  5B24 D;  3W98 A;  3X1U A;  4ZBJ B;  3AFA D;  3W98 D;  4WU9 B;  2F8N B;  2FJ7 C;  5GXQ D;  4WU9 A;  2NQB B;  5B1M C;  5AV6 A;  2F8N D;  3AZL B;  3WAA C;  5B33 B;  3AV1 A;  2NQB A;  4HGA C;  3C1C B;  1U35 D;  5GSU C;  5DNN B;  1TAF B;  3AZL A;  5B33 A;  3C1C A;  3AZL D;  5B33 D;  5DNN A;  4KGC D;  3LJA D;  5DNN D;  3O62 D;  1F66 B;  3AZE A;  2CV5 C;  3NQJ A;  1TZY A;  1F66 A;  5AV5 B;  2HIO C;  4J8W B;  1P3P B;  3AZN C;  1ZLA C;  1H3O A;  3VH6 A;  1HQ3 B;  1BH8 B;  3KWQ B;  1AOI C;  5AV5 A;  4J8W A;  1B6W A;  5JRG C;  5AV5 D;  3REH A;  1P3P D;  1HQ3 A;  3X1T C;  3KWQ A;  2RVQ C;  5DNM D;  2FJ7 B;  5E5A A;  1B67 A;  3UTB C;  3X1V C;  1P3G B;  5B1M B;  1KX3 C;  2FJ7 A;  1Q9C A;  4R8P C;  3KUY C;  3AZK C;  2FJ7 D;  3WAA B;  3WA9 C;  4HGA B;  5CPJ B;  1P3G D;  5B1M D;  3WAA A;  1P3L B;  4UUZ B;  3LZ1 C;  5GSU A;  3UTA C;  4KUD C;  5CPJ D;  3X1S A;  4WNN B;  3AZM D;  5B31 B;  3W97 C;  1P3L D;  3W99 C;  4QLC C;  2BYK B;  3WTP B;  5CPI C;  4WNN A;  2CV5 B;  4NE3 A;  4NFT A;  5B31 D;  2BYK A;  2HIO B;  4J8X B;  3AZN B;  5AVB B;  3WTP D;  2CV5 A;  1P3F C;  2CV5 D;  1AOI B;  5BNX B;  2HIO A;  3V9R B;  5BO0 B;  5JRG B;  3AZN A;  1ZLA A;  2HIO D;  4J8X D;  5AVB D;  3X1T B;  3V9R A;  3REK C;  5AVC C;  5JRG A;  1AOI D;  3WKJ A;  4DRB A;  5JRG D;  3X1T A;  3UTB B;  3VH6 T;  3X1T D;  2RVQ D;  3VH6 W;  1KU5 A;  4NE6 A;  1KX3 B;  4R8P B;  3AZK B;  1P3K C;  5CP6 B;  5B0Y C;  3UTB A;  3X1V A;  1A7W A;  3UTB D;  1KX3 A;  4X23 C;  1BH9 A;  4R8P A;  3KUY A;  3AZK A;  1KX3 D;  4DRA A;  3WA9 A;  5CP6 D;  3LZ1 B;  4KUD B;  3REL D;  3LZ1 A;  5B2J B;  1P34 C;  4Z5T B;  3W97 B;  3UTA A;  3W99 B;  4KUD A;  5CPI B;  3KXB C;  4KUD D;  5AV6 C;  3W97 A;  3W99 A;  4QLC A;  5B2J D;  2IO5 B;  4Z5T D;  5CPI A;  5CPI D;  1P3F B;  1EQZ C;  1N1J B;  1P3F A;  1N1J A;  3AZF C;  1P3M D;  1P3F D;  5GT0 C;  3REK B;  5AVC B;  3MGP C;  3B0C W;  2BYM B;  5BT1 C;  3AZE C;  4ZUX C;  3REK A;  5AVC A;  3AZJ B;  5B2I B;  3REK D;  1HTA A;  2BYM A;  3NQU B;  5B0Y B;  3AV2 C;  4X23 B;  3AZJ D;  1P3K A;  4JJN B;  3NQU A;  5B2I D;  4NE5 A;  4Z2M G;  5B0Y D;  4X23 A;  4X23 D;  5B32 C;  4JJN D;  5E5A C;  1P34 B;  2NZD A;  1P3A C;  3X1U D;  5AV6 B;  3R45 A;  1P34 A;  1P34 D;  3AV1 B;  4H9P B;  5C3I C;  3KXB A;  3A6N A;  5B40 C;  4WU9 D;  1EQZ B;  4XZQ C;  5AV6 D;  4H9P A;  5B0Z A;  3AV1 D;  2NQB D;  1EQZ A;  3AZF B;  3X1S C;  1EQZ D;  5GT0 B;  2F8N H;  4Z66 A;  3MGP B;  2JSS A;  3AZE B;  3C1C D;  3AZF A;  3AYW C;  5GT0 A;  4ZUX B;  3NQJ B;  3REI C;  3AZF D;  1TZY B;  3MGP A;  3B6G C;  3MGP D;  3AZE D;  4ZUX A;  3AV2 B;  3MGS A;  5GT3 C;  1H3O B;  4ZUX D;  1TZY D;  1F66 D;  4G91 C;  3REH B;  3VH5 A;  4H9Q B;  4M6B A;  3AV2 A;  5CPK C;  2YFW B;  3AV2 D;  2PYO C;  2ARO A;  1JFI B;  3WKJ C;  5B32 B;  1R4V A;  4H9Q A;  4J8W D;  5E5A B;  2YFW A;  3REH D;  4H9N A;  1P3A B;  4LD9 C;  1HQ3 D;  3KWQ D;  1JFI A;  5B32 A;  4Z2M H;  5B32 D;  1M18 C;  1P3A A;  5E5A D;  3B0D C;  5B40 B;  1P3A D;  3REJ C;  4AWL C;  4XZQ B;  5B40 A;  4J8V C;  5GSU B;  2L5A A;  4XZQ A;  3X1S B;  4XZQ D;  3WAA D;  4WV4 B;  3LZ0 C;  5GSU D;  3AYW B;  3UT9 C;  3REI B;  3X1S D;  5BS7 C;  3B6G B;  3AYW A;  4EO5 C;  3REI A;  3AYW D;  5GT3 B;  1BFM A;  3REI D;  1KX4 A;  1M1A C;  3B6G A;  3AN2 C;  4G91 B;  1ZLA B;  5CPK B;  5GT3 A;  5GT3 D;  3WKJ B;  5CPK A;  1KX5 C;  3AZN D;  1ZLA D;  4LD9 B;  3LEL C;  2PYO A;  5B1L C;  5KDM A;  4H9S C;  3VH5 T;  3WKJ D;  1M18 B;  4LD9 A;  3VH5 W;  3X1V B;  4WU8 C;  3B0D B;  4LD9 D;  5FUG B;  3REJ B;  4YM6 C;  4AWL B;  1BH9 B;  3KUY B;  1M18 A;  3WA9 B;  4G92 C;  1M18 D;  5FUG A;  4J8V B;  3REJ A;  3X1V D;  1P3O C;  3REJ D;  4R8P D;  3KUY D;  3AZK D;  4J8V A;  3WA9 D;  3UTA B;  2NZD C;  3LZ0 B;  4J8V D;  3UT9 B;  3MGR C;  3B0B A;  4QLC B;  3LZ1 D;  3LZ0 A;  3UTA D;  4EO5 B;  3A6N C;  3UT9 A;  5G49 A;  4XUJ C;  4YS3 C;  3MGQ A;  5BS7 A;  2HUE C;  1M1A B;  2F8N G;  3AN2 B;  3W97 D;  3W99 D;  4QLC D;  5B0Z C;  5BNV B;  1S32 C;  1M1A A;  3AN2 A;  1M1A D;  4Z66 C;  3AN2 D;  1KX5 B;  5F99 C;  1P3B C;  5BNV A;  5B24 C;  3LEL B;  3AFA C;  3B0C T;  3TU4 C;  1KX5 A;  5GXQ C;  3LEL A;  1KX5 D;  4WU8 B;  3AZI C;  3MGS C;  4CAY B;  5B1L A;  2YFV A;  4H9S A;  5AVC D;  1P3K B;  4WU8 A;  4G92 B;  4CSR B;  4CAY A;  4YM6 A;  3AZG A;  1U35 C;  1P3O B;  2ARO C;  1P3K D;  1ULY A;  4CSR A;  4KHA B;  4KGC C;  3MNN C;  2NZD B;  1P3O A;  3LJA C;  1P3O D;  4E44 A;  3W96 C;  3O62 C;  3MGR B;  4KHA A;  3R45 B;  3KXB B;  3A6N B;  5AV8 A;  2NZD D;  4YS3 B;  4XUJ B;  3MGR A;  2HUE B;  3MGR D;  2CWE A;  5B0Z B;  4XUJ A;  4YS3 A;  3KXB D;  5AV9 C;  3A6N D;  4YS3 D;  4XUJ D;  1S32 B;  1WWI A;  4Z66 B;  3WTP E;  5F99 B;  5B0Z D;  1P3B B;  1S32 A;  1P3P C;  5JA4 A;  3AFA B;  1S32 D;  5CHL B;  3TU4 B;  1P3I C;  5F99 A;  5DNM C;  4Z66 D;  5GXQ B;  5B24 A;  3AFA A; 
#chains in the Genus database with same CATH topology
 3AZI B;  1P3B D;  3MGS B;  3TU4 A;  5GT0 D;  4J8U C;  1KX4 C;  5B31 G;  3TU4 D;  5GXQ A;  5BT1 D;  3AZI A;  3AL0 C;  3AZI D;  1U35 B;  3MGS D;  2ARO B;  1P3G C;  2F8N A;  4KGC B;  4H9N B;  3MNN B;  1U35 A;  3LJA B;  5CPJ C;  2ARO D;  3O62 B;  3AZM C;  3B6F C;  3W96 B;  4KGC A;  3MNN A;  1P3L C;  3LJA A;  3MNN D;  3W96 A;  3O62 A;  3C1B C;  2G5I C;  1TAF A;  3W96 D;  5B31 C;  5C3I B;  5AY8 C;  2VQR A;  5AV9 B;  3WTP C;  5AV9 A;  5B40 D;  3AZH C;  1P3B A;  4J8X C;  5AVB C;  5AV9 D;  1P3I B;  5DNM B;  1P3P A;  1ID3 B;  3MGQ C;  1BH8 A;  4J8U B;  1P3I A;  1KX4 B;  5DNM A;  4DQY B;  1ID3 A;  1P3I D;  1ID3 D;  4J8U A;  4J8U D;  1KX4 D;  3B6G D;  5CP6 C;  2PYO B;  1P3G A;  5B1M A;  3REL C;  5KDM B;  3AZM B;  3B6F B;  3IP4 C;  5CPK D;  5CPJ A;  3C1B B;  3AZM A;  2PYO D;  3B6F A;  3B6F D;  1P3L A;  4UUZ A;  5AY8 B;  5B2J C;  4WZS B;  4Z5T C;  3C1B A;  4H9O B;  3AZG C;  2UWX A;  1M19 C;  3C1B D;  5B31 A;  4WJ3 C;  5AY8 A;  3MVD C;  4H9O A;  5AY8 D;  3WTP A;  3AZH B;  2IO5 C;  1P3M C;  3F6T A;  2Y2I A;  3AZH A;  4J8X A;  5AVB A;  5AV8 C;  2Y2K A;  3AZH D;  5G49 B;  3MGQ B;  1F1E A;  1AOI A;  3H0M C;  5BNX A;  5BO0 A;  3LZ0 D;  2F8N K;  3UT9 D;  3MGQ D;  3AZJ C;  5B2I C;  3REL B;  3FDD A;  4JJN C;  5CP6 A;  3W98 C;  3REL A;  5B1L B;  3X1U C;  2Y2J A;  3LEL D;  3EPL A;  4YM6 B;  4ZBJ C;  3AZG B;  4WU9 C;  1M19 B;  5B1L D;  5B2J A;  3MVD B;  4Z5T A;  2Y2O A;  4WU8 D;  3AV1 C;  4YM6 D;  1M19 A;  2NQB C;  3AZG D;  1P3M B;  1M19 D;  2LY8 A;  3A1I A;  3MVD A;  1WWS A;  3AZL C;  3MVD D;  5B33 C;  3C1C C;  5AV8 B;  5DNN C;  2DF4 C;  1P3M A;  1ID3 C;  1Z2C B;  3EPJ A;  5B32 G;  1W2E A;  4E45 A;  5AV8 D;  1TZY C;  1F66 C;  4H9R B;  5JA4 B;  3KSY A;  3AZJ A;  5B2I A;  5AV5 C;  4J8W C;  5B0Y A;  4H9R A;  2YFV B;  5B24 B;  3REH C;  3W98 B;  1HQ3 C;  3X1U B;  3KWQ C;  4JJN A;  5F99 D;  5B24 D;  3W98 A;  3X1U A;  4ZBJ B;  3AFA D;  3W98 D;  4WU9 B;  2F8N B;  2FJ7 C;  5GXQ D;  4WU9 A;  2NQB B;  5B1M C;  5AV6 A;  2F8N D;  3AZL B;  3WAA C;  5B33 B;  3AV1 A;  2NQB A;  4HGA C;  3C1C B;  1U35 D;  5GSU C;  5DNN B;  1TAF B;  3AZL A;  5B33 A;  3C1C A;  3AZL D;  5B33 D;  5DNN A;  4KGC D;  3LJA D;  5DNN D;  3O62 D;  1F66 B;  3AZE A;  2CV5 C;  3NQJ A;  1TZY A;  1F66 A;  5AV5 B;  2HIO C;  3H0R C;  4J8W B;  1P3P B;  3AZN C;  1ZLA C;  1H3O A;  3VH6 A;  1HQ3 B;  1BH8 B;  3KWQ B;  1AOI C;  5AV5 A;  4J8W A;  1B6W A;  5JRG C;  5AV5 D;  3REH A;  1P3P D;  1HQ3 A;  3X1T C;  2W8S A;  2RVQ C;  3KWQ A;  5DNM D;  2FJ7 B;  5E5A A;  1B67 A;  3UTB C;  3X1V C;  1P3G B;  5B1M B;  2Y2L A;  1KX3 C;  2FJ7 A;  1Q9C A;  4R8P C;  3KUY C;  3AZK C;  2FJ7 D;  3WAA B;  3WA9 C;  4HGA B;  2Y2H A;  5CPJ B;  1P3G D;  5B1M D;  3WAA A;  1P3L B;  4UUZ B;  3LZ1 C;  5GSU A;  3UTA C;  4KUD C;  5CPJ D;  3X1S A;  4WNN B;  3AZM D;  5B31 B;  3W97 C;  1P3L D;  3W99 C;  4QLC C;  2BYK B;  3WTP B;  5CPI C;  4WNN A;  2CV5 B;  4NE3 A;  4NFT A;  5B31 D;  2BYK A;  2HIO B;  4J8X B;  3AZN B;  5AVB B;  3WTP D;  2CV5 A;  1P3F C;  2CV5 D;  1AOI B;  5BNX B;  2HIO A;  3V9R B;  5BO0 B;  5JRG B;  3AZN A;  1ZLA A;  2HIO D;  4J8X D;  5AVB D;  3X1T B;  3V9R A;  3REK C;  5AVC C;  5JRG A;  1AOI D;  3WKJ A;  4DRB A;  5JRG D;  3X1T A;  3UTB B;  3VH6 T;  3X1T D;  2RVQ D;  2ZY5 A;  3VH6 W;  1KU5 A;  4NE6 A;  1KX3 B;  4R8P B;  3AZK B;  1P3K C;  5CP6 B;  5B0Y C;  3UTB A;  3X1V A;  1A7W A;  3UTB D;  1KX3 A;  4X23 C;  1BH9 A;  4R8P A;  3KUY A;  3AZK A;  1KX3 D;  4DRA A;  3WA9 A;  5CP6 D;  3LZ1 B;  2Y2P A;  4KUD B;  3REL D;  3LZ1 A;  5B2J B;  1P34 C;  4Z5T B;  3W97 B;  3UTA A;  3W99 B;  3EPH A;  4KUD A;  5CPI B;  3KXB C;  4KUD D;  3EG5 B;  5AV6 C;  3W97 A;  3W99 A;  2F2A C;  4QLC A;  5B2J D;  2IO5 B;  4Z5T D;  5CPI A;  5CPI D;  1P3F B;  1EQZ C;  1N1J B;  1P3F A;  1N1J A;  3AZF C;  1P3M D;  2FFF B;  1P3F D;  5GT0 C;  3REK B;  5AVC B;  3MGP C;  3B0C W;  2BYM B;  5BT1 C;  3AZE C;  2Y2N A;  2J8P A;  4ZUX C;  3REK A;  5AVC A;  3AZJ B;  2JE5 A;  5B2I B;  3REK D;  1HTA A;  2BYM A;  3NQU B;  5B0Y B;  3AV2 C;  4X23 B;  3AZJ D;  1P3K A;  4JJN B;  3NQU A;  5B2I D;  4NE5 A;  4Z2M G;  5B0Y D;  4X23 A;  4X23 D;  5B32 C;  4JJN D;  5E5A C;  1P34 B;  2NZD A;  1P3A C;  3X1U D;  2Y2G A;  5AV6 B;  3R45 A;  1P34 A;  1P34 D;  3AV1 B;  4H9P B;  5C3I C;  3KXB A;  3A6N A;  5B40 C;  2ZY3 A;  4WU9 D;  1EQZ B;  4XZQ C;  5AV6 D;  4H9P A;  5B0Z A;  3AV1 D;  2NQB D;  1EQZ A;  3AZF B;  3X1S C;  1EQZ D;  5GT0 B;  2F8N H;  4Z66 A;  3MGP B;  2JSS A;  3AZE B;  3C1C D;  3AZF A;  3AYW C;  5GT0 A;  4ZUX B;  3NQJ B;  3REI C;  3AZF D;  1TZY B;  3MGP A;  3B6G C;  3MGP D;  3AZE D;  4ZUX A;  3AV2 B;  3MGS A;  5GT3 C;  1H3O B;  4ZUX D;  1TZY D;  1F66 D;  2XD1 A;  4G91 C;  3REH B;  3VH5 A;  4H9Q B;  4M6B A;  3AV2 A;  5CPK C;  2YFW B;  3AV2 D;  2PYO C;  2ARO A;  1JFI B;  3WKJ C;  5B32 B;  2RIQ A;  1R4V A;  4H9Q A;  4J8W D;  5E5A B;  2YFW A;  3REH D;  4H9N A;  1P3A B;  4LD9 C;  1HQ3 D;  3KWQ D;  1JFI A;  5B32 A;  2G5H C;  4Z2M H;  5B32 D;  1M18 C;  1P3A A;  5E5A D;  2ZY4 A;  3B0D C;  5B40 B;  1P3A D;  3REJ C;  2BG1 A;  4AWL C;  4XZQ B;  3KFU G;  1T3U A;  5B40 A;  4J8V C;  5GSU B;  2L5A A;  4XZQ A;  3X1S B;  4XZQ D;  3WAA D;  4WV4 B;  3LZ0 C;  5GSU D;  3AYW B;  3UT9 C;  3REI B;  3X1S D;  5BS7 C;  2XD5 A;  3B6G B;  3AYW A;  4EO5 C;  3REI A;  3AYW D;  5GT3 B;  1BFM A;  3REI D;  1KX4 A;  1M1A C;  3B6G A;  3AN2 C;  4G91 B;  1ZLA B;  5CPK B;  5GT3 A;  3A1K A;  5GT3 D;  3WKJ B;  5CPK A;  1KX5 C;  3AZN D;  1ZLA D;  2ZM5 A;  4LD9 B;  3LEL C;  2PYO A;  5B1L C;  5KDM A;  4H9S C;  3VH5 T;  3WKJ D;  1M18 B;  4LD9 A;  3VH5 W;  3X1V B;  4WU8 C;  3B0D B;  4LD9 D;  5FUG B;  3REJ B;  4YM6 C;  4AWL B;  1BH9 B;  3KUY B;  1M18 A;  3WA9 B;  4G92 C;  1M18 D;  5FUG A;  4J8V B;  3REJ A;  3X1V D;  1P3O C;  3REJ D;  4R8P D;  3KUY D;  3AZK D;  4J8V A;  3WA9 D;  3UTA B;  2NZD C;  3LZ0 B;  4J8V D;  3UT9 B;  3MGR C;  3B0B A;  4QLC B;  3LZ1 D;  3LZ0 A;  3UTA D;  4EO5 B;  3A6N C;  3UT9 A;  5G49 A;  4XUJ C;  4YS3 C;  3MGQ A;  5BS7 A;  2HUE C;  1M1A B;  2F8N G;  3AN2 B;  3W97 D;  3W99 D;  4QLC D;  4UPK A;  5B0Z C;  5BNV B;  1S32 C;  1M1A A;  3AN2 A;  1M1A D;  4Z66 C;  3EPK A;  3AN2 D;  1KX5 B;  5F99 C;  1P3B C;  5BNV A;  5B24 C;  3LEL B;  3AFA C;  2JCH A;  3B0C T;  3TU4 C;  1KX5 A;  5GXQ C;  3LEL A;  1KX5 D;  4WU8 B;  3AZI C;  3MGS C;  4CAY B;  5B1L A;  2YFV A;  4H9S A;  5AVC D;  1P3K B;  4WU8 A;  4G92 B;  2ZY2 A;  4CSR B;  4CAY A;  4YM6 A;  3AZG A;  1U35 C;  1P3O B;  2ARO C;  1P3K D;  1ULY A;  4CSR A;  4KHA B;  2Y2M A;  4KGC C;  3MNN C;  2NZD B;  1P3O A;  3LJA C;  1P3O D;  4E44 A;  3W96 C;  3O62 C;  3MGR B;  4KHA A;  1PZR A;  3R45 B;  2Y2Q A;  3KXB B;  3A6N B;  5AV8 A;  2NZD D;  4YS3 B;  4XUJ B;  3MGR A;  2HUE B;  3MGR D;  2CWE A;  5B0Z B;  4XUJ A;  4YS3 A;  3KXB D;  5AV9 C;  3A6N D;  4YS3 D;  4XUJ D;  1S32 B;  1WWI A;  3P5J B;  4Z66 B;  3WTP E;  5F99 B;  5B0Z D;  1P3B B;  1S32 A;  1P3P C;  5JA4 A;  2DQN C;  3H0L C;  3AFA B;  1S32 D;  5CHL B;  3TU4 B;  1P3I C;  5F99 A;  5DNM C;  4Z66 D;  5GXQ B;  5B24 A;  3AFA A; 
#chains in the Genus database with same CATH homology
 3AZI B;  1P3B D;  3MGS B;  3TU4 A;  5GT0 D;  4J8U C;  1KX4 C;  5B31 G;  3TU4 D;  5GXQ A;  5BT1 D;  3AZI A;  3AL0 C;  3AZI D;  1U35 B;  3MGS D;  2ARO B;  1P3G C;  2F8N A;  4KGC B;  4H9N B;  3MNN B;  1U35 A;  3LJA B;  5CPJ C;  2ARO D;  3O62 B;  3AZM C;  3B6F C;  3W96 B;  4KGC A;  3MNN A;  1P3L C;  3LJA A;  3MNN D;  3W96 A;  3O62 A;  3C1B C;  2G5I C;  1TAF A;  3W96 D;  5B31 C;  5C3I B;  5AY8 C;  2VQR A;  5AV9 B;  3WTP C;  5AV9 A;  5B40 D;  3AZH C;  1P3B A;  4J8X C;  5AVB C;  5AV9 D;  1P3I B;  5DNM B;  1P3P A;  1ID3 B;  3MGQ C;  1BH8 A;  4J8U B;  1P3I A;  1KX4 B;  5DNM A;  4DQY B;  1ID3 A;  1P3I D;  1ID3 D;  4J8U A;  4J8U D;  1KX4 D;  3B6G D;  5CP6 C;  2PYO B;  1P3G A;  5B1M A;  3REL C;  5KDM B;  3AZM B;  3B6F B;  3IP4 C;  5CPK D;  5CPJ A;  3C1B B;  3AZM A;  2PYO D;  3B6F A;  3B6F D;  1P3L A;  4UUZ A;  5AY8 B;  5B2J C;  4WZS B;  4Z5T C;  3C1B A;  4H9O B;  3AZG C;  2UWX A;  1M19 C;  3C1B D;  5B31 A;  4WJ3 C;  5AY8 A;  3MVD C;  4H9O A;  5AY8 D;  3WTP A;  3AZH B;  2IO5 C;  1P3M C;  3F6T A;  2Y2I A;  3AZH A;  4J8X A;  5AVB A;  5AV8 C;  2Y2K A;  3AZH D;  5G49 B;  3MGQ B;  1F1E A;  1AOI A;  3H0M C;  5BNX A;  5BO0 A;  3LZ0 D;  2F8N K;  3UT9 D;  3MGQ D;  3AZJ C;  5B2I C;  3REL B;  3FDD A;  4JJN C;  5CP6 A;  3W98 C;  3REL A;  5B1L B;  3X1U C;  2Y2J A;  3LEL D;  3EPL A;  4YM6 B;  4ZBJ C;  3AZG B;  4WU9 C;  1M19 B;  5B1L D;  5B2J A;  3MVD B;  4Z5T A;  2Y2O A;  4WU8 D;  3AV1 C;  4YM6 D;  1M19 A;  2NQB C;  3AZG D;  1P3M B;  1M19 D;  2LY8 A;  3A1I A;  3MVD A;  1WWS A;  3AZL C;  3MVD D;  5B33 C;  3C1C C;  5AV8 B;  5DNN C;  2DF4 C;  1P3M A;  1ID3 C;  1Z2C B;  3EPJ A;  5B32 G;  1W2E A;  4E45 A;  5AV8 D;  1TZY C;  1F66 C;  4H9R B;  5JA4 B;  3KSY A;  3AZJ A;  5B2I A;  5AV5 C;  4J8W C;  5B0Y A;  4H9R A;  2YFV B;  5B24 B;  3REH C;  3W98 B;  1HQ3 C;  3X1U B;  3KWQ C;  4JJN A;  5F99 D;  5B24 D;  3W98 A;  3X1U A;  4ZBJ B;  3AFA D;  3W98 D;  4WU9 B;  2F8N B;  2FJ7 C;  5GXQ D;  4WU9 A;  2NQB B;  5B1M C;  5AV6 A;  2F8N D;  3AZL B;  3WAA C;  5B33 B;  3AV1 A;  2NQB A;  4HGA C;  3C1C B;  1U35 D;  5GSU C;  5DNN B;  1TAF B;  3AZL A;  5B33 A;  3C1C A;  3AZL D;  5B33 D;  5DNN A;  4KGC D;  3LJA D;  5DNN D;  3O62 D;  1F66 B;  3AZE A;  2CV5 C;  3NQJ A;  1TZY A;  1F66 A;  5AV5 B;  2HIO C;  3H0R C;  4J8W B;  1P3P B;  3AZN C;  1ZLA C;  1H3O A;  3VH6 A;  1HQ3 B;  1BH8 B;  3KWQ B;  1AOI C;  5AV5 A;  4J8W A;  1B6W A;  5JRG C;  5AV5 D;  3REH A;  1P3P D;  1HQ3 A;  3X1T C;  2W8S A;  2RVQ C;  3KWQ A;  5DNM D;  2FJ7 B;  5E5A A;  1B67 A;  3UTB C;  3X1V C;  1P3G B;  5B1M B;  2Y2L A;  1KX3 C;  2FJ7 A;  1Q9C A;  4R8P C;  3KUY C;  3AZK C;  2FJ7 D;  3WAA B;  3WA9 C;  4HGA B;  2Y2H A;  5CPJ B;  1P3G D;  5B1M D;  3WAA A;  1P3L B;  4UUZ B;  3LZ1 C;  5GSU A;  3UTA C;  4KUD C;  5CPJ D;  3X1S A;  4WNN B;  3AZM D;  5B31 B;  3W97 C;  1P3L D;  3W99 C;  4QLC C;  2BYK B;  3WTP B;  5CPI C;  4WNN A;  2CV5 B;  4NE3 A;  4NFT A;  5B31 D;  2BYK A;  2HIO B;  4J8X B;  3AZN B;  5AVB B;  3WTP D;  2CV5 A;  1P3F C;  2CV5 D;  1AOI B;  5BNX B;  2HIO A;  3V9R B;  5BO0 B;  5JRG B;  3AZN A;  1ZLA A;  2HIO D;  4J8X D;  5AVB D;  3X1T B;  3V9R A;  3REK C;  5AVC C;  5JRG A;  1AOI D;  3WKJ A;  4DRB A;  5JRG D;  3X1T A;  3UTB B;  3VH6 T;  3X1T D;  2RVQ D;  2ZY5 A;  3VH6 W;  1KU5 A;  4NE6 A;  1KX3 B;  4R8P B;  3AZK B;  1P3K C;  5CP6 B;  5B0Y C;  3UTB A;  3X1V A;  1A7W A;  3UTB D;  1KX3 A;  4X23 C;  1BH9 A;  4R8P A;  3KUY A;  3AZK A;  1KX3 D;  4DRA A;  3WA9 A;  5CP6 D;  3LZ1 B;  2Y2P A;  4KUD B;  3REL D;  3LZ1 A;  5B2J B;  1P34 C;  4Z5T B;  3W97 B;  3UTA A;  3W99 B;  3EPH A;  4KUD A;  5CPI B;  3KXB C;  4KUD D;  3EG5 B;  5AV6 C;  3W97 A;  3W99 A;  2F2A C;  4QLC A;  5B2J D;  2IO5 B;  4Z5T D;  5CPI A;  5CPI D;  1P3F B;  1EQZ C;  1N1J B;  1P3F A;  1N1J A;  3AZF C;  1P3M D;  2FFF B;  1P3F D;  5GT0 C;  3REK B;  5AVC B;  3MGP C;  3B0C W;  2BYM B;  5BT1 C;  3AZE C;  2Y2N A;  2J8P A;  4ZUX C;  3REK A;  5AVC A;  3AZJ B;  2JE5 A;  5B2I B;  3REK D;  1HTA A;  2BYM A;  3NQU B;  5B0Y B;  3AV2 C;  4X23 B;  3AZJ D;  1P3K A;  4JJN B;  3NQU A;  5B2I D;  4NE5 A;  4Z2M G;  5B0Y D;  4X23 A;  4X23 D;  5B32 C;  4JJN D;  5E5A C;  1P34 B;  2NZD A;  1P3A C;  3X1U D;  2Y2G A;  5AV6 B;  3R45 A;  1P34 A;  1P34 D;  3AV1 B;  4H9P B;  5C3I C;  3KXB A;  3A6N A;  5B40 C;  2ZY3 A;  4WU9 D;  1EQZ B;  4XZQ C;  5AV6 D;  4H9P A;  5B0Z A;  3AV1 D;  2NQB D;  1EQZ A;  3AZF B;  3X1S C;  1EQZ D;  5GT0 B;  2F8N H;  4Z66 A;  3MGP B;  2JSS A;  3AZE B;  3C1C D;  3AZF A;  3AYW C;  5GT0 A;  4ZUX B;  3NQJ B;  3REI C;  3AZF D;  1TZY B;  3MGP A;  3B6G C;  3MGP D;  3AZE D;  4ZUX A;  3AV2 B;  3MGS A;  5GT3 C;  1H3O B;  4ZUX D;  1TZY D;  1F66 D;  2XD1 A;  4G91 C;  3REH B;  3VH5 A;  4H9Q B;  4M6B A;  3AV2 A;  5CPK C;  2YFW B;  3AV2 D;  2PYO C;  2ARO A;  1JFI B;  3WKJ C;  5B32 B;  2RIQ A;  1R4V A;  4H9Q A;  4J8W D;  5E5A B;  2YFW A;  3REH D;  4H9N A;  1P3A B;  4LD9 C;  1HQ3 D;  3KWQ D;  1JFI A;  5B32 A;  2G5H C;  4Z2M H;  5B32 D;  1M18 C;  1P3A A;  5E5A D;  2ZY4 A;  3B0D C;  5B40 B;  1P3A D;  3REJ C;  2BG1 A;  4AWL C;  4XZQ B;  3KFU G;  1T3U A;  5B40 A;  4J8V C;  5GSU B;  2L5A A;  4XZQ A;  3X1S B;  4XZQ D;  3WAA D;  4WV4 B;  3LZ0 C;  5GSU D;  3AYW B;  3UT9 C;  3REI B;  3X1S D;  5BS7 C;  2XD5 A;  3B6G B;  3AYW A;  4EO5 C;  3REI A;  3AYW D;  5GT3 B;  1BFM A;  3REI D;  1KX4 A;  1M1A C;  3B6G A;  3AN2 C;  4G91 B;  1ZLA B;  5CPK B;  5GT3 A;  3A1K A;  5GT3 D;  3WKJ B;  5CPK A;  1KX5 C;  3AZN D;  1ZLA D;  2ZM5 A;  4LD9 B;  3LEL C;  2PYO A;  5B1L C;  5KDM A;  4H9S C;  3VH5 T;  3WKJ D;  1M18 B;  4LD9 A;  3VH5 W;  3X1V B;  4WU8 C;  3B0D B;  4LD9 D;  5FUG B;  3REJ B;  4YM6 C;  4AWL B;  1BH9 B;  3KUY B;  1M18 A;  3WA9 B;  4G92 C;  1M18 D;  5FUG A;  4J8V B;  3REJ A;  3X1V D;  1P3O C;  3REJ D;  4R8P D;  3KUY D;  3AZK D;  4J8V A;  3WA9 D;  3UTA B;  2NZD C;  3LZ0 B;  4J8V D;  3UT9 B;  3MGR C;  3B0B A;  4QLC B;  3LZ1 D;  3LZ0 A;  3UTA D;  4EO5 B;  3A6N C;  3UT9 A;  5G49 A;  4XUJ C;  4YS3 C;  3MGQ A;  5BS7 A;  2HUE C;  1M1A B;  2F8N G;  3AN2 B;  3W97 D;  3W99 D;  4QLC D;  4UPK A;  5B0Z C;  5BNV B;  1S32 C;  1M1A A;  3AN2 A;  1M1A D;  4Z66 C;  3EPK A;  3AN2 D;  1KX5 B;  5F99 C;  1P3B C;  5BNV A;  5B24 C;  3LEL B;  3AFA C;  2JCH A;  3B0C T;  3TU4 C;  1KX5 A;  5GXQ C;  3LEL A;  1KX5 D;  4WU8 B;  3AZI C;  3MGS C;  4CAY B;  5B1L A;  2YFV A;  4H9S A;  5AVC D;  1P3K B;  4WU8 A;  4G92 B;  2ZY2 A;  4CSR B;  4CAY A;  4YM6 A;  3AZG A;  1U35 C;  1P3O B;  2ARO C;  1P3K D;  1ULY A;  4CSR A;  4KHA B;  2Y2M A;  4KGC C;  3MNN C;  2NZD B;  1P3O A;  3LJA C;  1P3O D;  4E44 A;  3W96 C;  3O62 C;  3MGR B;  4KHA A;  1PZR A;  3R45 B;  2Y2Q A;  3KXB B;  3A6N B;  5AV8 A;  2NZD D;  4YS3 B;  4XUJ B;  3MGR A;  2HUE B;  3MGR D;  2CWE A;  5B0Z B;  4XUJ A;  4YS3 A;  3KXB D;  5AV9 C;  3A6N D;  4YS3 D;  4XUJ D;  1S32 B;  1WWI A;  3P5J B;  4Z66 B;  3WTP E;  5F99 B;  5B0Z D;  1P3B B;  1S32 A;  1P3P C;  5JA4 A;  2DQN C;  3H0L C;  3AFA B;  1S32 D;  5CHL B;  3TU4 B;  1P3I C;  5F99 A;  5DNM C;  4Z66 D;  5GXQ B;  5B24 A;  3AFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...