3X1SB

Crystal structure of the nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1sB00
2YFVB 3V9RA 5B1LC 5F99A 3WTPB 3WAAC 3TU4B 4X23A 5JRGA 3W96B 3KUYC 5BT1C 4LD9C 5B24B 3AZKD 3A6NA 4R8PD 1JFIA 2HIOB 5B2ID 3X1SC 5G49A 3MGSA 5AY8D 1P3PD 3X1TB 1AOIA 3W99B 4YM6B 1P3OA 4EO5C 1BH8A 3C1BB 4YS3A 3VH5W 5F99C 3NQJA 4X23C 5JRGC 3REIA 5B31G 5B0ZB 2F8ND 5B0YB 3O62B 3A6NC 4J8XB 3AZID 3X1VA 1P3GA 3AFAA 3MGSC 5B1LB 3B0DC 5DNMA 1EQZD 3WAAB 1AOIC 5GT3A 5DNND 3KUYB 1P3OC 3LZ0A 4LD9B 4YS3C 1P3AA 5CHLB 3LJAA 1ID3A 5AV6A 3X1SB 3AZEA 1S32D 5CPIC 1F1EA 3X1VC 3AYWD 4EO5B 1P3GC 1KX5A 1TZYD 3AFAC 3V9RB 4Z5TD 3AZMA 4XZQC 5F99B 5DNMC 4X23B 5JRGB 1P3BD 3LZ0C 3MGQD 1ZLAD 2CWEA 3LZ1A 1P3AC 5FUGA 3A6NB 1JFIB 3B6FA 3LJAC 1ID3C 5AV6C 3MGRA 5G49B 3MGSB 3AZEC 3KSYA 3B0DB 3W98D 5AV9D 1AOIB 1P3OB 2NQBA 1BH8B 2AROA 1KX5C 1HQ3D 4YS3B 2HUEC 3KXBC 3NQJB 3MGPA 3REIB 3VH6T 3LZ1C 5CPIB 3C1CA 1P3KA 3AN2A 3X1VB 5B1MA 4J8WD 1P3GB 3MGRC 1M19A 2F8NK 3AFAB 2NZDA 2F8NH 5DNMB 3UTAA 2NQBC 5AV5A 2AROC 3LZ0B 4AWLC 4QLCA 3REKA 1P3AB 3MGPC 3LJAB 1ID3B 5AV6B 3AV2A 3B0CT 3AZEB 3WA9D 3C1CC 4WV4B 3VH6W 1P3KC 4KGCA 5B32D 5B1MC 1M19C 1KX5B 2NZDC 2CV5D 2RVQD 2HUEB 3AZMB 3UTAC 5BO0A 5B31C 3MVDA 5AV5C 3TU4D 4QLCC 3REKC 3LZ1B 5GT0A 3REJA 4XUJA 2HIOD 3MGRB 2F8NG 3AV2C 1U35D 3B6GA 4KUDD 4J8XA 4H9SC 4Z66D 4KGCC 2NQBB 4AWLB 2AROB 2PYOD 4YM6D 4G91C 3C1BD 3MGPB 3REHC 1P3MA 5KDMA 4WU8A 4NE5A 4J8VC 3MVDC 5CPKA 4JJND 5B0YD 3C1CB 1P3KB 5GT0C 3REJC 5B1MB 4XUJC 1P3ID 1M19B 2NZDB 3B6GC 1F66A 3UTAB 3W97D 5B31B 3UT9A 3VH5T 4J8UD 5AV5B 3WAAD 4QLCB 3REKB 5BT1D 3AV1A 1P3MC 4WU8C 5CPKC 1KX4C 3AZGD 3AZND 3AV2B 4H9PA 3MNNA 4DRAA 4NFTA 1P3FC 4KGCB 3AZFD 1F66C 4G91B 3REHB 5BO0B 2YFWA 3UT9C 4J8VB 3MVDB 5JRGD 1B6WA 1P3LD 5B2IA 3AV1C 1ULYA 1N1JA 4NE6A 5GXQD 5GT0B 3REJB 3UTBD 4XUJB 1P3PA 5AV8D 3B6GB 3LELD 3MNNC 1M18D 3MGSD 4G92B 5CPIA 1M1AA 1P3OD 4XZQA 1P3MB 5KDMB 4WU8B 5CPKB 1H3OA 2F8NA 1KX4B 3REID 4R8PC 5B2IC 1P3FB 1WWIA 1P3PC 1P34D 1KX3D 5B33A 1F66B 3AFAD 5B32G 3RELA 3UT9B 1M1AC 5CPJA 5GT3D 4ZUXD 3LZ0D 3X1UA 3AZHA 3AV1B 3KXBA 2FJ7A 4H9QA 3VH6A 4H9PB 1ID3D 5C3IC 5GSUD 5AVBD 5AV6D 3MNNB 3AZED 3AYWA 5B40D 4UUZA 4H9RA 4Z5TA 5B33C 1EQZC 3RELC 5DNNC 5E5AD 3AZMD 2YFWB 1P3BA 1ZLAA 1KU5A 5CPJC 4R8PB 3X1UC 5B2IB 5B2JD 3AZHC 2FJ7C 3LZ1D 4DRBA 1N1JB 3KWQD 5AVCA 4M6BA 4KHAA 3B6FD 1S32C 1P3PB 3MGRD 5AV9A 3AYWC 1TZYC 1HQ3A 1B67A 1M1AB 4Z5TC 3AZLD 4XZQB 3MGQC 1P3BC 1H3OB 3MGPD 5B31A 1ZLAC 2F8NB 4WU9A 5C3IB 5JA4A 3WKJD 4J8WA 3AZJD 5AVCC 3C1CD 3AN2D 5B1MD 5B33B 1M19D 5AV9C 3RELB 5DNNB 1HQ3C 4H9SA 5CPJB 3X1UB 3AZHB 2FJ7B 3KXBB 4H9QB 3REHA 3WTPD 4J8VA 4WU9C 3WA9A 3W96D 5B32A 4E45A 4J8WC 3AYWB 1TZYB 5B24D 2CV5A 4KGCD 4UUZB 4H9RB 4Z5TB 3B0BA 3MGQB 1P3BB 3VH5A 1ZLAB 3X1TD 3MVDD 3W99D 5AVCB 1U35A 4KHAB 5GT0D 1KX4A 3WA9C 4KUDA 5AV9B 4Z66A 5B32C 5B0ZD 2PYOA 3O62D 2CV5C 1HQ3B 2RVQC 5CP6A 4WZSB 4J8XD 1P3FA 5BS7A 4ZBJC 5B1LD 4WU9B 4WU8D 4JJNA 5JA4B 3KUYD 1BFMA 4J8WB 1P3IA 4LD9D 1U35C 4KUDC 4Z66C 4Z2MG 3W97A 3X1SD 2LY8A 4J8UA 2PYOC 4HGAC 5CP6C 5BS7C 4CSRB 3AZGA 5F99D 4H9OA 4X23D 4JJNC 3AZKA 3WA9B 4R8PA 4CAYA 5B32B 3AZFA 3MNND 1P3IC 1BH9A 2CV5B 3A6ND 5AY8A 3W97C 4J8UC 2JSSA 1TAFA 1P3LA 4ZBJB 4WNNA 1AOID 5GXQA 3UTBA 4YS3D 3AZGC 3AZNC 5AV8A 1U35B 3LELA 1HTAA 1M18A 3AZKC 4KUDB 4Z66B 3AZFC 3AZIA 2PYOB 4HGAB 5CPID 4H9NA 5CP6B 5AY8C 4NE3A 3X1VD 1M1AD 1P3GD 3WTPE 1EQZA 5DNNA 1P3LC 4XZQD 5DNMD 4JJNB 5GXQC 5BNVA 3UTBC 1P3IB 1P3AD 5AV8C 1P34A 3LELC 1KX3A 1WWSA 1M18C 3LJAD 1S32A 3W97B 5B33D 3AZIC 4J8UB 2IO5C 3RELD 1TZYA 4ZUXA 5CPJD 1KX5D 3X1UD 3REIC 3AZNB 3KXBD 3MGQA 3AZHD 3AZGB 2FJ7D 4H9OB 5GSUA 5BNXA 5AVBA 3AZKB 4CAYB 3AZFB 5B40A 1BH9B 2L5AA 1P34C 1KX3C 5AY8B 5E5AA 3W98A 1TAFB 5GT3C 4ZUXC 1P3LB 4WNNB 5B2JA 5GXQB 3KWQA 1Q9CA 2NQBD 3UTBB 2AROD 5AV8B 3LELB 5GSUC 1M18B 5AVBC 5AVCD 3R45A 3AZIB 5B40C 2IO5B 4H9NB 3AZLA 1P3KD 2BYKA 5E5AC 3AZMC 3W98C 1EQZB 2NZDD 3UTAD 5B2JC 5B31D 3WKJA 5BNVB 3KWQC 4WU9D 3AZJA 5AV5D 2BYMA 4QLCD 3REKD 3B6FC 1P34B 1KX3B 4CSRA 1S32B 3AV2D 5GT3B 3NQUA 4ZUXB 3AZLC 4E44A 2YFVA 3WTPA 3TU4A 4Z2MH 5GSUB 3W96A 5BNXB 5AVBB 3REHD 3WKJC 4J8VD 3AZJC 5B24A 5B40B 3AN2C 2HIOA 3REJD 5E5AB 4XUJD 3W98B 1R4VA 3B6GD 3X1TA 3W99A 4YM6A 5B2JB 3C1BA 5FUGB 3KWQB 3B6FB 3WTPC 3TU4C 3W96C 3R45B 1P3MD 5CPKD 5B0ZA 5B0YA 5B24C 3O62A 1KX4D 3B0CW 2HIOC 3AZLB 2BYKB 1P3FD 5CP6D 3X1TC 5B1LA 1F66D 3WAAA 3W99C 4YM6C 3KUYA 3WKJB 3C1BC 3UT9D 4LD9A 3AZJB 2BYMB 3AN2B 3AZNA 3AV1D 1A7WA 3X1SA 5B0ZC 5B0YC 3O62C 4G92C 4J8XC 3NQUB
chains in the Genus database with same CATH superfamily
2JE5A 2YFVB 3V9RA 5B1LC 5F99A 3WTPB 3WAAC 3TU4B 4X23A 5JRGA 3W96B 3KUYC 5BT1C 4LD9C 5B24B 2ZM5A 3AZKD 3A6NA 4R8PD 1JFIA 2HIOB 5B2ID 3X1SC 5G49A 3MGSA 5AY8D 1P3PD 3X1TB 2VQRA 1AOIA 4YM6B 1P3OA 3W99B 4EO5C 1BH8A 3A1IA 3C1BB 4YS3A 3VH5W 5F99C 3NQJA 4X23C 5JRGC 3REIA 5B31G 5B0ZB 2F8ND 5B0YB 3O62B 3A6NC 4J8XB 3AZID 3X1VA 1P3GA 2Y2NA 3AFAA 3MGSC 5B1LB 3B0DC 5DNMA 1EQZD 3WAAB 1AOIC 5GT3A 5DNND 3KUYB 1P3OC 3LZ0A 4LD9B 4YS3C 1P3AA 5CHLB 3LJAA 1ID3A 5AV6A 3X1SB 3AZEA 1S32D 5CPIC 1F1EA 3X1VC 3AYWD 4EO5B 1P3GC 1KX5A 1TZYD 3AFAC 3V9RB 4Z5TD 3AZMA 4XZQC 5F99B 5DNMC 4X23B 5JRGB 1P3BD 3LZ0C 3MGQD 1ZLAD 2CWEA 3LZ1A 1P3AC 5FUGA 3A6NB 1JFIB 3B6FA 3LJAC 1ID3C 5AV6C 3MGRA 5G49B 3MGSB 3AZEC 3KSYA 3B0DB 3W98D 5AV9D 1AOIB 1P3OB 2NQBA 1BH8B 2AROA 1KX5C 1HQ3D 3EG5B 3H0LC 4YS3B 2F2AC 2HUEC 3KXBC 2Y2QA 3NQJB 3MGPA 3REIB 3VH6T 3LZ1C 5CPIB 3C1CA 1P3KA 3AN2A 3X1VB 5B1MA 4J8WD 1P3GB 3MGRC 1M19A 2F8NK 3AFAB 2NZDA 2F8NH 2ZY2A 5DNMB 3UTAA 3FDDA 2NQBC 5AV5A 2AROC 3LZ0B 4AWLC 4QLCA 3REKA 1P3AB 4WJ3C 3MGPC 3LJAB 1ID3B 5AV6B 3AV2A 3B0CT 3AZEB 3WA9D 3C1CC 4WV4B 3VH6W 1P3KC 4KGCA 5B32D 5B1MC 1M19C 1KX5B 2NZDC 2CV5D 2RVQD 2HUEB 3AZMB 3UTAC 5BO0A 5B31C 3MVDA 5AV5C 3TU4D 4QLCC 1Z2CB 3REKC 3LZ1B 5GT0A 3REJA 4XUJA 2HIOD 3MGRB 2F8NG 3AV2C 1U35D 3B6GA 4KUDD 4J8XA 4H9SC 4Z66D 4KGCC 2NQBB 4AWLB 2AROB 2PYOD 4YM6D 4G91C 3C1BD 3MGPB 3REHC 1P3MA 2UWXA 5KDMA 4WU8A 4NE5A 4J8VC 3MVDC 5CPKA 4JJND 2W8SA 5B0YD 3C1CB 5GT0C 1P3KB 3REJC 5B1MB 4XUJC 1P3ID 1M19B 2NZDB 2XD1A 3B6GC 1F66A 3UTAB 3W97D 5B31B 3UT9A 3VH5T 4J8UD 5AV5B 3WAAD 4QLCB 3REKB 5BT1D 3AV1A 1P3MC 4WU8C 5CPKC 1KX4C 3AZGD 3AZND 3AV2B 4H9PA 3MNNA 4DRAA 4NFTA 1P3FC 4KGCB 3AZFD 1F66C 4G91B 3REHB 5BO0B 2YFWA 3UT9C 4J8VB 3MVDB 5JRGD 1B6WA 1P3LD 5B2IA 3AV1C 1ULYA 1N1JA 4NE6A 5GXQD 5GT0B 3REJB 3UTBD 4XUJB 4DQYB 1P3PA 5AV8D 3B6GB 3LELD 3MNNC 1M18D 3MGSD 4G92B 5CPIA 3AL0C 1M1AA 1P3OD 4XZQA 1P3MB 5KDMB 4WU8B 5CPKB 1H3OA 2F8NA 1KX4B 3REID 4R8PC 2FFFB 5B2IC 1P3FB 2DQNC 1WWIA 1P3PC 1P34D 1KX3D 5B33A 1F66B 3AFAD 5B32G 3RELA 3UT9B 1M1AC 5CPJA 5GT3D 4ZUXD 3LZ0D 3X1UA 3AZHA 3AV1B 3KXBA 2FJ7A 4H9QA 3VH6A 4H9PB 1ID3D 5C3IC 5GSUD 5AVBD 5AV6D 3MNNB 3AZED 3AYWA 3EPLA 5B40D 2ZY5A 1W2EA 4H9RA 4UUZA 4Z5TA 5B33C 1EQZC 3RELC 5DNNC 5E5AD 3AZMD 2YFWB 1P3BA 1ZLAA 1KU5A 5CPJC 4R8PB 3X1UC 5B2IB 5B2JD 3AZHC 2FJ7C 3LZ1D 4DRBA 1N1JB 2BG1A 3KWQD 5AVCA 4M6BA 4KHAA 3B6FD 1S32C 1P3PB 3MGRD 5AV9A 3AYWC 1TZYC 1HQ3A 1B67A 1M1AB 4Z5TC 3AZLD 4XZQB 3MGQC 1P3BC 2JCHA 1H3OB 3MGPD 5B31A 1ZLAC 2F8NB 4WU9A 5C3IB 5JA4A 3WKJD 4J8WA 3AZJD 5AVCC 3C1CD 3AN2D 2XD5A 5B1MD 5B33B 1M19D 5AV9C 3RELB 5DNNB 1HQ3C 4H9SA 2J8PA 5CPJB 3X1UB 3AZHB 2FJ7B 3KXBB 1PZRA 4H9QB 3REHA 3WTPD 4J8VA 4WU9C 2ZY4A 3WA9A 3W96D 5B32A 3KFUG 4E45A 4J8WC 3AYWB 1TZYB 5B24D 2CV5A 4KGCD 4UUZB 4H9RB 4Z5TB 3B0BA 3MGQB 1P3BB 2DF4C 3VH5A 1ZLAB 3X1TD 3MVDD 3W99D 5AVCB 1U35A 3EPKA 2Y2IA 4KHAB 5GT0D 1KX4A 3WA9C 4KUDA 5AV9B 4Z66A 5B32C 5B0ZD 2PYOA 3O62D 2CV5C 1HQ3B 2RVQC 5CP6A 4WZSB 4J8XD 1P3FA 3A1KA 5BS7A 4ZBJC 5B1LD 4WU9B 4WU8D 2Y2PA 4JJNA 5JA4B 3KUYD 1BFMA 4J8WB 1P3IA 4LD9D 2G5HC 1U35C 4KUDC 4Z66C 4Z2MG 3W97A 3X1SD 2LY8A 4J8UA 2PYOC 4HGAC 5CP6C 2Y2HA 5BS7C 3P5JB 4CSRB 3AZGA 5F99D 4H9OA 4X23D 4JJNC 3AZKA 3WA9B 4R8PA 4CAYA 5B32B 3AZFA 3MNND 1P3IC 1BH9A 2CV5B 3A6ND 5AY8A 3W97C 4J8UC 2JSSA 1TAFA 1P3LA 4ZBJB 4WNNA 1AOID 5GXQA 3UTBA 4YS3D 3AZGC 3AZNC 5AV8A 1U35B 3LELA 1HTAA 1M18A 3AZKC 4KUDB 4Z66B 3AZFC 3AZIA 2PYOB 4HGAB 5CPID 4H9NA 5CP6B 5AY8C 4NE3A 3X1VD 1M1AD 1P3GD 3WTPE 1EQZA 3F6TA 5DNNA 1P3LC 4XZQD 5DNMD 4JJNB 5GXQC 5BNVA 3UTBC 1P3IB 1P3AD 5AV8C 1P34A 3LELC 1KX3A 1WWSA 1M18C 3LJAD 2Y2KA 2Y2LA 1S32A 3W97B 5B33D 3AZIC 4J8UB 2IO5C 2Y2JA 3RELD 1TZYA 4ZUXA 3IP4C 5CPJD 1KX5D 3X1UD 3REIC 3AZNB 3KXBD 3MGQA 3AZHD 3AZGB 2FJ7D 4H9OB 5GSUA 5BNXA 5AVBA 3AZKB 4CAYB 3AZFB 5B40A 1BH9B 2L5AA 1P34C 1KX3C 5AY8B 5E5AA 3W98A 3EPJA 1TAFB 5GT3C 4ZUXC 1P3LB 4WNNB 5B2JA 5GXQB 3KWQA 1Q9CA 2NQBD 3UTBB 2AROD 5AV8B 3LELB 5GSUC 1M18B 5AVBC 5AVCD 3R45A 3AZIB 5B40C 2IO5B 4H9NB 3AZLA 1P3KD 2BYKA 3H0MC 5E5AC 3AZMC 3W98C 2ZY3A 1EQZB 2NZDD 3UTAD 5B2JC 5B31D 3WKJA 5BNVB 3KWQC 4WU9D 3AZJA 5AV5D 2BYMA 4QLCD 3REKD 3B6FC 1P34B 1KX3B 4CSRA 1S32B 2Y2MA 3AV2D 5GT3B 3NQUA 4ZUXB 3AZLC 4E44A 2YFVA 3WTPA 3TU4A 4Z2MH 5GSUB 3W96A 5BNXB 5AVBB 3REHD 3WKJC 4J8VD 3AZJC 3H0RC 5B24A 5B40B 3AN2C 2HIOA 3REJD 5E5AB 4XUJD 3W98B 1R4VA 3B6GD 3X1TA 3W99A 4YM6A 2RIQA 5B2JB 3C1BA 5FUGB 3KWQB 3B6FB 3WTPC 2G5IC 3TU4C 3W96C 1T3UA 3R45B 1P3MD 5CPKD 5B0ZA 5B0YA 5B24C 3O62A 1KX4D 3B0CW 2HIOC 3AZLB 2BYKB 1P3FD 5CP6D 4UPKA 3X1TC 5B1LA 1F66D 3WAAA 3W99C 4YM6C 3EPHA 3KUYA 3WKJB 3C1BC 3UT9D 4LD9A 3AZJB 2BYMB 3AN2B 2Y2GA 3AZNA 3AV1D 1A7WA 3X1SA 5B0ZC 5B0YC 3O62C 4G92C 2Y2OA 4J8XC 3NQUB
chains in the Genus database with same CATH topology
2JE5A 2YFVB 3V9RA 5B1LC 5F99A 3WTPB 3WAAC 3TU4B 4X23A 5JRGA 3W96B 3KUYC 5BT1C 4LD9C 5B24B 2ZM5A 3AZKD 3A6NA 4R8PD 1JFIA 2HIOB 5B2ID 3X1SC 5G49A 3MGSA 5AY8D 1P3PD 3X1TB 2VQRA 1AOIA 4YM6B 1P3OA 3W99B 4EO5C 1BH8A 3A1IA 3C1BB 4YS3A 3VH5W 5F99C 3NQJA 4X23C 5JRGC 3REIA 5B31G 5B0ZB 2F8ND 5B0YB 3O62B 3A6NC 4J8XB 3AZID 3X1VA 1P3GA 2Y2NA 3AFAA 3MGSC 5B1LB 3B0DC 5DNMA 1EQZD 3WAAB 1AOIC 5GT3A 5DNND 3KUYB 1P3OC 3LZ0A 4LD9B 4YS3C 1P3AA 5CHLB 3LJAA 1ID3A 5AV6A 3X1SB 3AZEA 1S32D 5CPIC 1F1EA 3X1VC 3AYWD 4EO5B 1P3GC 1KX5A 1TZYD 3AFAC 3V9RB 4Z5TD 3AZMA 4XZQC 5F99B 5DNMC 4X23B 5JRGB 1P3BD 3LZ0C 3MGQD 1ZLAD 2CWEA 3LZ1A 1P3AC 5FUGA 3A6NB 1JFIB 3B6FA 3LJAC 1ID3C 5AV6C 3MGRA 5G49B 3MGSB 3AZEC 3KSYA 3B0DB 3W98D 5AV9D 1AOIB 1P3OB 2NQBA 1BH8B 2AROA 1KX5C 1HQ3D 3EG5B 3H0LC 4YS3B 2F2AC 2HUEC 3KXBC 2Y2QA 3NQJB 3MGPA 3REIB 3VH6T 3LZ1C 5CPIB 3C1CA 1P3KA 3AN2A 3X1VB 5B1MA 4J8WD 1P3GB 3MGRC 1M19A 2F8NK 3AFAB 2NZDA 2F8NH 2ZY2A 5DNMB 3UTAA 3FDDA 2NQBC 5AV5A 2AROC 3LZ0B 4AWLC 4QLCA 3REKA 1P3AB 4WJ3C 3MGPC 3LJAB 1ID3B 5AV6B 3AV2A 3B0CT 3AZEB 3WA9D 3C1CC 4WV4B 3VH6W 1P3KC 4KGCA 5B32D 5B1MC 1M19C 1KX5B 2NZDC 2CV5D 2RVQD 2HUEB 3AZMB 3UTAC 5BO0A 5B31C 3MVDA 5AV5C 3TU4D 4QLCC 1Z2CB 3REKC 3LZ1B 5GT0A 3REJA 4XUJA 2HIOD 3MGRB 2F8NG 3AV2C 1U35D 3B6GA 4KUDD 4J8XA 4H9SC 4Z66D 4KGCC 2NQBB 4AWLB 2AROB 2PYOD 4YM6D 4G91C 3C1BD 3MGPB 3REHC 1P3MA 2UWXA 5KDMA 4WU8A 4NE5A 4J8VC 3MVDC 5CPKA 4JJND 2W8SA 5B0YD 3C1CB 5GT0C 1P3KB 3REJC 5B1MB 4XUJC 1P3ID 1M19B 2NZDB 2XD1A 3B6GC 1F66A 3UTAB 3W97D 5B31B 3UT9A 3VH5T 4J8UD 5AV5B 3WAAD 4QLCB 3REKB 5BT1D 3AV1A 1P3MC 4WU8C 5CPKC 1KX4C 3AZGD 3AZND 3AV2B 4H9PA 3MNNA 4DRAA 4NFTA 1P3FC 4KGCB 3AZFD 1F66C 4G91B 3REHB 5BO0B 2YFWA 3UT9C 4J8VB 3MVDB 5JRGD 1B6WA 1P3LD 5B2IA 3AV1C 1ULYA 1N1JA 4NE6A 5GXQD 5GT0B 3REJB 3UTBD 4XUJB 4DQYB 1P3PA 5AV8D 3B6GB 3LELD 3MNNC 1M18D 3MGSD 4G92B 5CPIA 3AL0C 1M1AA 1P3OD 4XZQA 1P3MB 5KDMB 4WU8B 5CPKB 1H3OA 2F8NA 1KX4B 3REID 4R8PC 2FFFB 5B2IC 1P3FB 2DQNC 1WWIA 1P3PC 1P34D 1KX3D 5B33A 1F66B 3AFAD 5B32G 3RELA 3UT9B 1M1AC 5CPJA 5GT3D 4ZUXD 3LZ0D 3X1UA 3AZHA 3AV1B 3KXBA 2FJ7A 4H9QA 3VH6A 4H9PB 1ID3D 5C3IC 5GSUD 5AVBD 5AV6D 3MNNB 3AZED 3AYWA 3EPLA 5B40D 2ZY5A 1W2EA 4H9RA 4UUZA 4Z5TA 5B33C 1EQZC 3RELC 5DNNC 5E5AD 3AZMD 2YFWB 1P3BA 1ZLAA 1KU5A 5CPJC 4R8PB 3X1UC 5B2IB 5B2JD 3AZHC 2FJ7C 3LZ1D 4DRBA 1N1JB 2BG1A 3KWQD 5AVCA 4M6BA 4KHAA 3B6FD 1S32C 1P3PB 3MGRD 5AV9A 3AYWC 1TZYC 1HQ3A 1B67A 1M1AB 4Z5TC 3AZLD 4XZQB 3MGQC 1P3BC 2JCHA 1H3OB 3MGPD 5B31A 1ZLAC 2F8NB 4WU9A 5C3IB 5JA4A 3WKJD 4J8WA 3AZJD 5AVCC 3C1CD 3AN2D 2XD5A 5B1MD 5B33B 1M19D 5AV9C 3RELB 5DNNB 1HQ3C 4H9SA 2J8PA 5CPJB 3X1UB 3AZHB 2FJ7B 3KXBB 1PZRA 4H9QB 3REHA 3WTPD 4J8VA 4WU9C 2ZY4A 3WA9A 3W96D 5B32A 3KFUG 4E45A 4J8WC 3AYWB 1TZYB 5B24D 2CV5A 4KGCD 4UUZB 4H9RB 4Z5TB 3B0BA 3MGQB 1P3BB 2DF4C 3VH5A 1ZLAB 3X1TD 3MVDD 3W99D 5AVCB 1U35A 3EPKA 2Y2IA 4KHAB 5GT0D 1KX4A 3WA9C 4KUDA 5AV9B 4Z66A 5B32C 5B0ZD 2PYOA 3O62D 2CV5C 1HQ3B 2RVQC 5CP6A 4WZSB 4J8XD 1P3FA 3A1KA 5BS7A 4ZBJC 5B1LD 4WU9B 4WU8D 2Y2PA 4JJNA 5JA4B 3KUYD 1BFMA 4J8WB 1P3IA 4LD9D 2G5HC 1U35C 4KUDC 4Z66C 4Z2MG 3W97A 3X1SD 2LY8A 4J8UA 2PYOC 4HGAC 5CP6C 2Y2HA 5BS7C 3P5JB 4CSRB 3AZGA 5F99D 4H9OA 4X23D 4JJNC 3AZKA 3WA9B 4R8PA 4CAYA 5B32B 3AZFA 3MNND 1P3IC 1BH9A 2CV5B 3A6ND 5AY8A 3W97C 4J8UC 2JSSA 1TAFA 1P3LA 4ZBJB 4WNNA 1AOID 5GXQA 3UTBA 4YS3D 3AZGC 3AZNC 5AV8A 1U35B 3LELA 1HTAA 1M18A 3AZKC 4KUDB 4Z66B 3AZFC 3AZIA 2PYOB 4HGAB 5CPID 4H9NA 5CP6B 5AY8C 4NE3A 3X1VD 1M1AD 1P3GD 3WTPE 1EQZA 3F6TA 5DNNA 1P3LC 4XZQD 5DNMD 4JJNB 5GXQC 5BNVA 3UTBC 1P3IB 1P3AD 5AV8C 1P34A 3LELC 1KX3A 1WWSA 1M18C 3LJAD 2Y2KA 2Y2LA 1S32A 3W97B 5B33D 3AZIC 4J8UB 2IO5C 2Y2JA 3RELD 1TZYA 4ZUXA 3IP4C 5CPJD 1KX5D 3X1UD 3REIC 3AZNB 3KXBD 3MGQA 3AZHD 3AZGB 2FJ7D 4H9OB 5GSUA 5BNXA 5AVBA 3AZKB 4CAYB 3AZFB 5B40A 1BH9B 2L5AA 1P34C 1KX3C 5AY8B 5E5AA 3W98A 3EPJA 1TAFB 5GT3C 4ZUXC 1P3LB 4WNNB 5B2JA 5GXQB 3KWQA 1Q9CA 2NQBD 3UTBB 2AROD 5AV8B 3LELB 5GSUC 1M18B 5AVBC 5AVCD 3R45A 3AZIB 5B40C 2IO5B 4H9NB 3AZLA 1P3KD 2BYKA 3H0MC 5E5AC 3AZMC 3W98C 2ZY3A 1EQZB 2NZDD 3UTAD 5B2JC 5B31D 3WKJA 5BNVB 3KWQC 4WU9D 3AZJA 5AV5D 2BYMA 4QLCD 3REKD 3B6FC 1P34B 1KX3B 4CSRA 1S32B 2Y2MA 3AV2D 5GT3B 3NQUA 4ZUXB 3AZLC 4E44A 2YFVA 3WTPA 3TU4A 4Z2MH 5GSUB 3W96A 5BNXB 5AVBB 3REHD 3WKJC 4J8VD 3AZJC 3H0RC 5B24A 5B40B 3AN2C 2HIOA 3REJD 5E5AB 4XUJD 3W98B 1R4VA 3B6GD 3X1TA 3W99A 4YM6A 2RIQA 5B2JB 3C1BA 5FUGB 3KWQB 3B6FB 3WTPC 2G5IC 3TU4C 3W96C 1T3UA 3R45B 1P3MD 5CPKD 5B0ZA 5B0YA 5B24C 3O62A 1KX4D 3B0CW 2HIOC 3AZLB 2BYKB 1P3FD 5CP6D 4UPKA 3X1TC 5B1LA 1F66D 3WAAA 3W99C 4YM6C 3EPHA 3KUYA 3WKJB 3C1BC 3UT9D 4LD9A 3AZJB 2BYMB 3AN2B 2Y2GA 3AZNA 3AV1D 1A7WA 3X1SA 5B0ZC 5B0YC 3O62C 4G92C 2Y2OA 4J8XC 3NQUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFV B;  3V9R A;  5B1L C;  5F99 A;  3WTP B;  3WAA C;  3TU4 B;  4X23 A;  5JRG A;  3W96 B;  3KUY C;  5BT1 C;  4LD9 C;  5B24 B;  3AZK D;  3A6N A;  4R8P D;  1JFI A;  2HIO B;  5B2I D;  3X1S C;  5G49 A;  3MGS A;  5AY8 D;  1P3P D;  3X1T B;  1AOI A;  3W99 B;  4YM6 B;  1P3O A;  4EO5 C;  1BH8 A;  3C1B B;  4YS3 A;  3VH5 W;  5F99 C;  3NQJ A;  4X23 C;  5JRG C;  3REI A;  5B31 G;  5B0Z B;  2F8N D;  5B0Y B;  3O62 B;  3A6N C;  4J8X B;  3AZI D;  3X1V A;  1P3G A;  3AFA A;  3MGS C;  5B1L B;  3B0D C;  5DNM A;  1EQZ D;  3WAA B;  1AOI C;  5GT3 A;  5DNN D;  3KUY B;  1P3O C;  3LZ0 A;  4LD9 B;  4YS3 C;  1P3A A;  5CHL B;  3LJA A;  1ID3 A;  5AV6 A;  3X1S B;  3AZE A;  1S32 D;  5CPI C;  1F1E A;  3X1V C;  3AYW D;  4EO5 B;  1P3G C;  1KX5 A;  1TZY D;  3AFA C;  3V9R B;  4Z5T D;  3AZM A;  4XZQ C;  5F99 B;  5DNM C;  4X23 B;  5JRG B;  1P3B D;  3LZ0 C;  3MGQ D;  1ZLA D;  2CWE A;  3LZ1 A;  1P3A C;  5FUG A;  3A6N B;  1JFI B;  3B6F A;  3LJA C;  1ID3 C;  5AV6 C;  3MGR A;  5G49 B;  3MGS B;  3AZE C;  3KSY A;  3B0D B;  3W98 D;  5AV9 D;  1AOI B;  1P3O B;  2NQB A;  1BH8 B;  2ARO A;  1KX5 C;  1HQ3 D;  4YS3 B;  2HUE C;  3KXB C;  3NQJ B;  3MGP A;  3REI B;  3VH6 T;  3LZ1 C;  5CPI B;  3C1C A;  1P3K A;  3AN2 A;  3X1V B;  5B1M A;  4J8W D;  1P3G B;  3MGR C;  1M19 A;  2F8N K;  3AFA B;  2NZD A;  2F8N H;  5DNM B;  3UTA A;  2NQB C;  5AV5 A;  2ARO C;  3LZ0 B;  4AWL C;  4QLC A;  3REK A;  1P3A B;  3MGP C;  3LJA B;  1ID3 B;  5AV6 B;  3AV2 A;  3B0C T;  3AZE B;  3WA9 D;  3C1C C;  4WV4 B;  3VH6 W;  1P3K C;  4KGC A;  5B32 D;  5B1M C;  1M19 C;  1KX5 B;  2NZD C;  2CV5 D;  2RVQ D;  2HUE B;  3AZM B;  3UTA C;  5BO0 A;  5B31 C;  3MVD A;  5AV5 C;  3TU4 D;  4QLC C;  3REK C;  3LZ1 B;  5GT0 A;  3REJ A;  4XUJ A;  2HIO D;  3MGR B;  2F8N G;  3AV2 C;  1U35 D;  3B6G A;  4KUD D;  4J8X A;  4H9S C;  4Z66 D;  4KGC C;  2NQB B;  4AWL B;  2ARO B;  2PYO D;  4YM6 D;  4G91 C;  3C1B D;  3MGP B;  3REH C;  1P3M A;  5KDM A;  4WU8 A;  4NE5 A;  4J8V C;  3MVD C;  5CPK A;  4JJN D;  5B0Y D;  3C1C B;  1P3K B;  5GT0 C;  3REJ C;  5B1M B;  4XUJ C;  1P3I D;  1M19 B;  2NZD B;  3B6G C;  1F66 A;  3UTA B;  3W97 D;  5B31 B;  3UT9 A;  3VH5 T;  4J8U D;  5AV5 B;  3WAA D;  4QLC B;  3REK B;  5BT1 D;  3AV1 A;  1P3M C;  4WU8 C;  5CPK C;  1KX4 C;  3AZG D;  3AZN D;  3AV2 B;  4H9P A;  3MNN A;  4DRA A;  4NFT A;  1P3F C;  4KGC B;  3AZF D;  1F66 C;  4G91 B;  3REH B;  5BO0 B;  2YFW A;  3UT9 C;  4J8V B;  3MVD B;  5JRG D;  1B6W A;  1P3L D;  5B2I A;  3AV1 C;  1ULY A;  1N1J A;  4NE6 A;  5GXQ D;  5GT0 B;  3REJ B;  3UTB D;  4XUJ B;  1P3P A;  5AV8 D;  3B6G B;  3LEL D;  3MNN C;  1M18 D;  3MGS D;  4G92 B;  5CPI A;  1M1A A;  1P3O D;  4XZQ A;  1P3M B;  5KDM B;  4WU8 B;  5CPK B;  1H3O A;  2F8N A;  1KX4 B;  3REI D;  4R8P C;  5B2I C;  1P3F B;  1WWI A;  1P3P C;  1P34 D;  1KX3 D;  5B33 A;  1F66 B;  3AFA D;  5B32 G;  3REL A;  3UT9 B;  1M1A C;  5CPJ A;  5GT3 D;  4ZUX D;  3LZ0 D;  3X1U A;  3AZH A;  3AV1 B;  3KXB A;  2FJ7 A;  4H9Q A;  3VH6 A;  4H9P B;  1ID3 D;  5C3I C;  5GSU D;  5AVB D;  5AV6 D;  3MNN B;  3AZE D;  3AYW A;  5B40 D;  4UUZ A;  4H9R A;  4Z5T A;  5B33 C;  1EQZ C;  3REL C;  5DNN C;  5E5A D;  3AZM D;  2YFW B;  1P3B A;  1ZLA A;  1KU5 A;  5CPJ C;  4R8P B;  3X1U C;  5B2I B;  5B2J D;  3AZH C;  2FJ7 C;  3LZ1 D;  4DRB A;  1N1J B;  3KWQ D;  5AVC A;  4M6B A;  4KHA A;  3B6F D;  1S32 C;  1P3P B;  3MGR D;  5AV9 A;  3AYW C;  1TZY C;  1HQ3 A;  1B67 A;  1M1A B;  4Z5T C;  3AZL D;  4XZQ B;  3MGQ C;  1P3B C;  1H3O B;  3MGP D;  5B31 A;  1ZLA C;  2F8N B;  4WU9 A;  5C3I B;  5JA4 A;  3WKJ D;  4J8W A;  3AZJ D;  5AVC C;  3C1C D;  3AN2 D;  5B1M D;  5B33 B;  1M19 D;  5AV9 C;  3REL B;  5DNN B;  1HQ3 C;  4H9S A;  5CPJ B;  3X1U B;  3AZH B;  2FJ7 B;  3KXB B;  4H9Q B;  3REH A;  3WTP D;  4J8V A;  4WU9 C;  3WA9 A;  3W96 D;  5B32 A;  4E45 A;  4J8W C;  3AYW B;  1TZY B;  5B24 D;  2CV5 A;  4KGC D;  4UUZ B;  4H9R B;  4Z5T B;  3B0B A;  3MGQ B;  1P3B B;  3VH5 A;  1ZLA B;  3X1T D;  3MVD D;  3W99 D;  5AVC B;  1U35 A;  4KHA B;  5GT0 D;  1KX4 A;  3WA9 C;  4KUD A;  5AV9 B;  4Z66 A;  5B32 C;  5B0Z D;  2PYO A;  3O62 D;  2CV5 C;  1HQ3 B;  2RVQ C;  5CP6 A;  4WZS B;  4J8X D;  1P3F A;  5BS7 A;  4ZBJ C;  5B1L D;  4WU9 B;  4WU8 D;  4JJN A;  5JA4 B;  3KUY D;  1BFM A;  4J8W B;  1P3I A;  4LD9 D;  1U35 C;  4KUD C;  4Z66 C;  4Z2M G;  3W97 A;  3X1S D;  2LY8 A;  4J8U A;  2PYO C;  4HGA C;  5CP6 C;  5BS7 C;  4CSR B;  3AZG A;  5F99 D;  4H9O A;  4X23 D;  4JJN C;  3AZK A;  3WA9 B;  4R8P A;  4CAY A;  5B32 B;  3AZF A;  3MNN D;  1P3I C;  1BH9 A;  2CV5 B;  3A6N D;  5AY8 A;  3W97 C;  4J8U C;  2JSS A;  1TAF A;  1P3L A;  4ZBJ B;  4WNN A;  1AOI D;  5GXQ A;  3UTB A;  4YS3 D;  3AZG C;  3AZN C;  5AV8 A;  1U35 B;  3LEL A;  1HTA A;  1M18 A;  3AZK C;  4KUD B;  4Z66 B;  3AZF C;  3AZI A;  2PYO B;  4HGA B;  5CPI D;  4H9N A;  5CP6 B;  5AY8 C;  4NE3 A;  3X1V D;  1M1A D;  1P3G D;  3WTP E;  1EQZ A;  5DNN A;  1P3L C;  4XZQ D;  5DNM D;  4JJN B;  5GXQ C;  5BNV A;  3UTB C;  1P3I B;  1P3A D;  5AV8 C;  1P34 A;  3LEL C;  1KX3 A;  1WWS A;  1M18 C;  3LJA D;  1S32 A;  3W97 B;  5B33 D;  3AZI C;  4J8U B;  2IO5 C;  3REL D;  1TZY A;  4ZUX A;  5CPJ D;  1KX5 D;  3X1U D;  3REI C;  3AZN B;  3KXB D;  3MGQ A;  3AZH D;  3AZG B;  2FJ7 D;  4H9O B;  5GSU A;  5BNX A;  5AVB A;  3AZK B;  4CAY B;  3AZF B;  5B40 A;  1BH9 B;  2L5A A;  1P34 C;  1KX3 C;  5AY8 B;  5E5A A;  3W98 A;  1TAF B;  5GT3 C;  4ZUX C;  1P3L B;  4WNN B;  5B2J A;  5GXQ B;  3KWQ A;  1Q9C A;  2NQB D;  3UTB B;  2ARO D;  5AV8 B;  3LEL B;  5GSU C;  1M18 B;  5AVB C;  5AVC D;  3R45 A;  3AZI B;  5B40 C;  2IO5 B;  4H9N B;  3AZL A;  1P3K D;  2BYK A;  5E5A C;  3AZM C;  3W98 C;  1EQZ B;  2NZD D;  3UTA D;  5B2J C;  5B31 D;  3WKJ A;  5BNV B;  3KWQ C;  4WU9 D;  3AZJ A;  5AV5 D;  2BYM A;  4QLC D;  3REK D;  3B6F C;  1P34 B;  1KX3 B;  4CSR A;  1S32 B;  3AV2 D;  5GT3 B;  3NQU A;  4ZUX B;  3AZL C;  4E44 A;  2YFV A;  3WTP A;  3TU4 A;  4Z2M H;  5GSU B;  3W96 A;  5BNX B;  5AVB B;  3REH D;  3WKJ C;  4J8V D;  3AZJ C;  5B24 A;  5B40 B;  3AN2 C;  2HIO A;  3REJ D;  5E5A B;  4XUJ D;  3W98 B;  1R4V A;  3B6G D;  3X1T A;  3W99 A;  4YM6 A;  5B2J B;  3C1B A;  5FUG B;  3KWQ B;  3B6F B;  3WTP C;  3TU4 C;  3W96 C;  3R45 B;  1P3M D;  5CPK D;  5B0Z A;  5B0Y A;  5B24 C;  3O62 A;  1KX4 D;  3B0C W;  2HIO C;  3AZL B;  2BYK B;  1P3F D;  5CP6 D;  3X1T C;  5B1L A;  1F66 D;  3WAA A;  3W99 C;  4YM6 C;  3KUY A;  3WKJ B;  3C1B C;  3UT9 D;  4LD9 A;  3AZJ B;  2BYM B;  3AN2 B;  3AZN A;  3AV1 D;  1A7W A;  3X1S A;  5B0Z C;  5B0Y C;  3O62 C;  4G92 C;  4J8X C;  3NQU B; 
#chains in the Genus database with same CATH topology
 2JE5 A;  2YFV B;  3V9R A;  5B1L C;  5F99 A;  3WTP B;  3WAA C;  3TU4 B;  4X23 A;  5JRG A;  3W96 B;  3KUY C;  5BT1 C;  4LD9 C;  5B24 B;  2ZM5 A;  3AZK D;  3A6N A;  4R8P D;  1JFI A;  2HIO B;  5B2I D;  3X1S C;  5G49 A;  3MGS A;  5AY8 D;  1P3P D;  3X1T B;  2VQR A;  1AOI A;  4YM6 B;  1P3O A;  3W99 B;  4EO5 C;  1BH8 A;  3A1I A;  3C1B B;  4YS3 A;  3VH5 W;  5F99 C;  3NQJ A;  4X23 C;  5JRG C;  3REI A;  5B31 G;  5B0Z B;  2F8N D;  5B0Y B;  3O62 B;  3A6N C;  4J8X B;  3AZI D;  3X1V A;  1P3G A;  2Y2N A;  3AFA A;  3MGS C;  5B1L B;  3B0D C;  5DNM A;  1EQZ D;  3WAA B;  1AOI C;  5GT3 A;  5DNN D;  3KUY B;  1P3O C;  3LZ0 A;  4LD9 B;  4YS3 C;  1P3A A;  5CHL B;  3LJA A;  1ID3 A;  5AV6 A;  3X1S B;  3AZE A;  1S32 D;  5CPI C;  1F1E A;  3X1V C;  3AYW D;  4EO5 B;  1P3G C;  1KX5 A;  1TZY D;  3AFA C;  3V9R B;  4Z5T D;  3AZM A;  4XZQ C;  5F99 B;  5DNM C;  4X23 B;  5JRG B;  1P3B D;  3LZ0 C;  3MGQ D;  1ZLA D;  2CWE A;  3LZ1 A;  1P3A C;  5FUG A;  3A6N B;  1JFI B;  3B6F A;  3LJA C;  1ID3 C;  5AV6 C;  3MGR A;  5G49 B;  3MGS B;  3AZE C;  3KSY A;  3B0D B;  3W98 D;  5AV9 D;  1AOI B;  1P3O B;  2NQB A;  1BH8 B;  2ARO A;  1KX5 C;  1HQ3 D;  3EG5 B;  3H0L C;  4YS3 B;  2F2A C;  2HUE C;  3KXB C;  2Y2Q A;  3NQJ B;  3MGP A;  3REI B;  3VH6 T;  3LZ1 C;  5CPI B;  3C1C A;  1P3K A;  3AN2 A;  3X1V B;  5B1M A;  4J8W D;  1P3G B;  3MGR C;  1M19 A;  2F8N K;  3AFA B;  2NZD A;  2F8N H;  2ZY2 A;  5DNM B;  3UTA A;  3FDD A;  2NQB C;  5AV5 A;  2ARO C;  3LZ0 B;  4AWL C;  4QLC A;  3REK A;  1P3A B;  4WJ3 C;  3MGP C;  3LJA B;  1ID3 B;  5AV6 B;  3AV2 A;  3B0C T;  3AZE B;  3WA9 D;  3C1C C;  4WV4 B;  3VH6 W;  1P3K C;  4KGC A;  5B32 D;  5B1M C;  1M19 C;  1KX5 B;  2NZD C;  2CV5 D;  2RVQ D;  2HUE B;  3AZM B;  3UTA C;  5BO0 A;  5B31 C;  3MVD A;  5AV5 C;  3TU4 D;  4QLC C;  1Z2C B;  3REK C;  3LZ1 B;  5GT0 A;  3REJ A;  4XUJ A;  2HIO D;  3MGR B;  2F8N G;  3AV2 C;  1U35 D;  3B6G A;  4KUD D;  4J8X A;  4H9S C;  4Z66 D;  4KGC C;  2NQB B;  4AWL B;  2ARO B;  2PYO D;  4YM6 D;  4G91 C;  3C1B D;  3MGP B;  3REH C;  1P3M A;  2UWX A;  5KDM A;  4WU8 A;  4NE5 A;  4J8V C;  3MVD C;  5CPK A;  4JJN D;  2W8S A;  5B0Y D;  3C1C B;  5GT0 C;  1P3K B;  3REJ C;  5B1M B;  4XUJ C;  1P3I D;  1M19 B;  2NZD B;  2XD1 A;  3B6G C;  1F66 A;  3UTA B;  3W97 D;  5B31 B;  3UT9 A;  3VH5 T;  4J8U D;  5AV5 B;  3WAA D;  4QLC B;  3REK B;  5BT1 D;  3AV1 A;  1P3M C;  4WU8 C;  5CPK C;  1KX4 C;  3AZG D;  3AZN D;  3AV2 B;  4H9P A;  3MNN A;  4DRA A;  4NFT A;  1P3F C;  4KGC B;  3AZF D;  1F66 C;  4G91 B;  3REH B;  5BO0 B;  2YFW A;  3UT9 C;  4J8V B;  3MVD B;  5JRG D;  1B6W A;  1P3L D;  5B2I A;  3AV1 C;  1ULY A;  1N1J A;  4NE6 A;  5GXQ D;  5GT0 B;  3REJ B;  3UTB D;  4XUJ B;  4DQY B;  1P3P A;  5AV8 D;  3B6G B;  3LEL D;  3MNN C;  1M18 D;  3MGS D;  4G92 B;  5CPI A;  3AL0 C;  1M1A A;  1P3O D;  4XZQ A;  1P3M B;  5KDM B;  4WU8 B;  5CPK B;  1H3O A;  2F8N A;  1KX4 B;  3REI D;  4R8P C;  2FFF B;  5B2I C;  1P3F B;  2DQN C;  1WWI A;  1P3P C;  1P34 D;  1KX3 D;  5B33 A;  1F66 B;  3AFA D;  5B32 G;  3REL A;  3UT9 B;  1M1A C;  5CPJ A;  5GT3 D;  4ZUX D;  3LZ0 D;  3X1U A;  3AZH A;  3AV1 B;  3KXB A;  2FJ7 A;  4H9Q A;  3VH6 A;  4H9P B;  1ID3 D;  5C3I C;  5GSU D;  5AVB D;  5AV6 D;  3MNN B;  3AZE D;  3AYW A;  3EPL A;  5B40 D;  2ZY5 A;  1W2E A;  4H9R A;  4UUZ A;  4Z5T A;  5B33 C;  1EQZ C;  3REL C;  5DNN C;  5E5A D;  3AZM D;  2YFW B;  1P3B A;  1ZLA A;  1KU5 A;  5CPJ C;  4R8P B;  3X1U C;  5B2I B;  5B2J D;  3AZH C;  2FJ7 C;  3LZ1 D;  4DRB A;  1N1J B;  2BG1 A;  3KWQ D;  5AVC A;  4M6B A;  4KHA A;  3B6F D;  1S32 C;  1P3P B;  3MGR D;  5AV9 A;  3AYW C;  1TZY C;  1HQ3 A;  1B67 A;  1M1A B;  4Z5T C;  3AZL D;  4XZQ B;  3MGQ C;  1P3B C;  2JCH A;  1H3O B;  3MGP D;  5B31 A;  1ZLA C;  2F8N B;  4WU9 A;  5C3I B;  5JA4 A;  3WKJ D;  4J8W A;  3AZJ D;  5AVC C;  3C1C D;  3AN2 D;  2XD5 A;  5B1M D;  5B33 B;  1M19 D;  5AV9 C;  3REL B;  5DNN B;  1HQ3 C;  4H9S A;  2J8P A;  5CPJ B;  3X1U B;  3AZH B;  2FJ7 B;  3KXB B;  1PZR A;  4H9Q B;  3REH A;  3WTP D;  4J8V A;  4WU9 C;  2ZY4 A;  3WA9 A;  3W96 D;  5B32 A;  3KFU G;  4E45 A;  4J8W C;  3AYW B;  1TZY B;  5B24 D;  2CV5 A;  4KGC D;  4UUZ B;  4H9R B;  4Z5T B;  3B0B A;  3MGQ B;  1P3B B;  2DF4 C;  3VH5 A;  1ZLA B;  3X1T D;  3MVD D;  3W99 D;  5AVC B;  1U35 A;  3EPK A;  2Y2I A;  4KHA B;  5GT0 D;  1KX4 A;  3WA9 C;  4KUD A;  5AV9 B;  4Z66 A;  5B32 C;  5B0Z D;  2PYO A;  3O62 D;  2CV5 C;  1HQ3 B;  2RVQ C;  5CP6 A;  4WZS B;  4J8X D;  1P3F A;  3A1K A;  5BS7 A;  4ZBJ C;  5B1L D;  4WU9 B;  4WU8 D;  2Y2P A;  4JJN A;  5JA4 B;  3KUY D;  1BFM A;  4J8W B;  1P3I A;  4LD9 D;  2G5H C;  1U35 C;  4KUD C;  4Z66 C;  4Z2M G;  3W97 A;  3X1S D;  2LY8 A;  4J8U A;  2PYO C;  4HGA C;  5CP6 C;  2Y2H A;  5BS7 C;  3P5J B;  4CSR B;  3AZG A;  5F99 D;  4H9O A;  4X23 D;  4JJN C;  3AZK A;  3WA9 B;  4R8P A;  4CAY A;  5B32 B;  3AZF A;  3MNN D;  1P3I C;  1BH9 A;  2CV5 B;  3A6N D;  5AY8 A;  3W97 C;  4J8U C;  2JSS A;  1TAF A;  1P3L A;  4ZBJ B;  4WNN A;  1AOI D;  5GXQ A;  3UTB A;  4YS3 D;  3AZG C;  3AZN C;  5AV8 A;  1U35 B;  3LEL A;  1HTA A;  1M18 A;  3AZK C;  4KUD B;  4Z66 B;  3AZF C;  3AZI A;  2PYO B;  4HGA B;  5CPI D;  4H9N A;  5CP6 B;  5AY8 C;  4NE3 A;  3X1V D;  1M1A D;  1P3G D;  3WTP E;  1EQZ A;  3F6T A;  5DNN A;  1P3L C;  4XZQ D;  5DNM D;  4JJN B;  5GXQ C;  5BNV A;  3UTB C;  1P3I B;  1P3A D;  5AV8 C;  1P34 A;  3LEL C;  1KX3 A;  1WWS A;  1M18 C;  3LJA D;  2Y2K A;  2Y2L A;  1S32 A;  3W97 B;  5B33 D;  3AZI C;  4J8U B;  2IO5 C;  2Y2J A;  3REL D;  1TZY A;  4ZUX A;  3IP4 C;  5CPJ D;  1KX5 D;  3X1U D;  3REI C;  3AZN B;  3KXB D;  3MGQ A;  3AZH D;  3AZG B;  2FJ7 D;  4H9O B;  5GSU A;  5BNX A;  5AVB A;  3AZK B;  4CAY B;  3AZF B;  5B40 A;  1BH9 B;  2L5A A;  1P34 C;  1KX3 C;  5AY8 B;  5E5A A;  3W98 A;  3EPJ A;  1TAF B;  5GT3 C;  4ZUX C;  1P3L B;  4WNN B;  5B2J A;  5GXQ B;  3KWQ A;  1Q9C A;  2NQB D;  3UTB B;  2ARO D;  5AV8 B;  3LEL B;  5GSU C;  1M18 B;  5AVB C;  5AVC D;  3R45 A;  3AZI B;  5B40 C;  2IO5 B;  4H9N B;  3AZL A;  1P3K D;  2BYK A;  3H0M C;  5E5A C;  3AZM C;  3W98 C;  2ZY3 A;  1EQZ B;  2NZD D;  3UTA D;  5B2J C;  5B31 D;  3WKJ A;  5BNV B;  3KWQ C;  4WU9 D;  3AZJ A;  5AV5 D;  2BYM A;  4QLC D;  3REK D;  3B6F C;  1P34 B;  1KX3 B;  4CSR A;  1S32 B;  2Y2M A;  3AV2 D;  5GT3 B;  3NQU A;  4ZUX B;  3AZL C;  4E44 A;  2YFV A;  3WTP A;  3TU4 A;  4Z2M H;  5GSU B;  3W96 A;  5BNX B;  5AVB B;  3REH D;  3WKJ C;  4J8V D;  3AZJ C;  3H0R C;  5B24 A;  5B40 B;  3AN2 C;  2HIO A;  3REJ D;  5E5A B;  4XUJ D;  3W98 B;  1R4V A;  3B6G D;  3X1T A;  3W99 A;  4YM6 A;  2RIQ A;  5B2J B;  3C1B A;  5FUG B;  3KWQ B;  3B6F B;  3WTP C;  2G5I C;  3TU4 C;  3W96 C;  1T3U A;  3R45 B;  1P3M D;  5CPK D;  5B0Z A;  5B0Y A;  5B24 C;  3O62 A;  1KX4 D;  3B0C W;  2HIO C;  3AZL B;  2BYK B;  1P3F D;  5CP6 D;  4UPK A;  3X1T C;  5B1L A;  1F66 D;  3WAA A;  3W99 C;  4YM6 C;  3EPH A;  3KUY A;  3WKJ B;  3C1B C;  3UT9 D;  4LD9 A;  3AZJ B;  2BYM B;  3AN2 B;  2Y2G A;  3AZN A;  3AV1 D;  1A7W A;  3X1S A;  5B0Z C;  5B0Y C;  3O62 C;  4G92 C;  2Y2O A;  4J8X C;  3NQU B; 
#chains in the Genus database with same CATH homology
 2JE5 A;  2YFV B;  3V9R A;  5B1L C;  5F99 A;  3WTP B;  3WAA C;  3TU4 B;  4X23 A;  5JRG A;  3W96 B;  3KUY C;  5BT1 C;  4LD9 C;  5B24 B;  2ZM5 A;  3AZK D;  3A6N A;  4R8P D;  1JFI A;  2HIO B;  5B2I D;  3X1S C;  5G49 A;  3MGS A;  5AY8 D;  1P3P D;  3X1T B;  2VQR A;  1AOI A;  4YM6 B;  1P3O A;  3W99 B;  4EO5 C;  1BH8 A;  3A1I A;  3C1B B;  4YS3 A;  3VH5 W;  5F99 C;  3NQJ A;  4X23 C;  5JRG C;  3REI A;  5B31 G;  5B0Z B;  2F8N D;  5B0Y B;  3O62 B;  3A6N C;  4J8X B;  3AZI D;  3X1V A;  1P3G A;  2Y2N A;  3AFA A;  3MGS C;  5B1L B;  3B0D C;  5DNM A;  1EQZ D;  3WAA B;  1AOI C;  5GT3 A;  5DNN D;  3KUY B;  1P3O C;  3LZ0 A;  4LD9 B;  4YS3 C;  1P3A A;  5CHL B;  3LJA A;  1ID3 A;  5AV6 A;  3X1S B;  3AZE A;  1S32 D;  5CPI C;  1F1E A;  3X1V C;  3AYW D;  4EO5 B;  1P3G C;  1KX5 A;  1TZY D;  3AFA C;  3V9R B;  4Z5T D;  3AZM A;  4XZQ C;  5F99 B;  5DNM C;  4X23 B;  5JRG B;  1P3B D;  3LZ0 C;  3MGQ D;  1ZLA D;  2CWE A;  3LZ1 A;  1P3A C;  5FUG A;  3A6N B;  1JFI B;  3B6F A;  3LJA C;  1ID3 C;  5AV6 C;  3MGR A;  5G49 B;  3MGS B;  3AZE C;  3KSY A;  3B0D B;  3W98 D;  5AV9 D;  1AOI B;  1P3O B;  2NQB A;  1BH8 B;  2ARO A;  1KX5 C;  1HQ3 D;  3EG5 B;  3H0L C;  4YS3 B;  2F2A C;  2HUE C;  3KXB C;  2Y2Q A;  3NQJ B;  3MGP A;  3REI B;  3VH6 T;  3LZ1 C;  5CPI B;  3C1C A;  1P3K A;  3AN2 A;  3X1V B;  5B1M A;  4J8W D;  1P3G B;  3MGR C;  1M19 A;  2F8N K;  3AFA B;  2NZD A;  2F8N H;  2ZY2 A;  5DNM B;  3UTA A;  3FDD A;  2NQB C;  5AV5 A;  2ARO C;  3LZ0 B;  4AWL C;  4QLC A;  3REK A;  1P3A B;  4WJ3 C;  3MGP C;  3LJA B;  1ID3 B;  5AV6 B;  3AV2 A;  3B0C T;  3AZE B;  3WA9 D;  3C1C C;  4WV4 B;  3VH6 W;  1P3K C;  4KGC A;  5B32 D;  5B1M C;  1M19 C;  1KX5 B;  2NZD C;  2CV5 D;  2RVQ D;  2HUE B;  3AZM B;  3UTA C;  5BO0 A;  5B31 C;  3MVD A;  5AV5 C;  3TU4 D;  4QLC C;  1Z2C B;  3REK C;  3LZ1 B;  5GT0 A;  3REJ A;  4XUJ A;  2HIO D;  3MGR B;  2F8N G;  3AV2 C;  1U35 D;  3B6G A;  4KUD D;  4J8X A;  4H9S C;  4Z66 D;  4KGC C;  2NQB B;  4AWL B;  2ARO B;  2PYO D;  4YM6 D;  4G91 C;  3C1B D;  3MGP B;  3REH C;  1P3M A;  2UWX A;  5KDM A;  4WU8 A;  4NE5 A;  4J8V C;  3MVD C;  5CPK A;  4JJN D;  2W8S A;  5B0Y D;  3C1C B;  5GT0 C;  1P3K B;  3REJ C;  5B1M B;  4XUJ C;  1P3I D;  1M19 B;  2NZD B;  2XD1 A;  3B6G C;  1F66 A;  3UTA B;  3W97 D;  5B31 B;  3UT9 A;  3VH5 T;  4J8U D;  5AV5 B;  3WAA D;  4QLC B;  3REK B;  5BT1 D;  3AV1 A;  1P3M C;  4WU8 C;  5CPK C;  1KX4 C;  3AZG D;  3AZN D;  3AV2 B;  4H9P A;  3MNN A;  4DRA A;  4NFT A;  1P3F C;  4KGC B;  3AZF D;  1F66 C;  4G91 B;  3REH B;  5BO0 B;  2YFW A;  3UT9 C;  4J8V B;  3MVD B;  5JRG D;  1B6W A;  1P3L D;  5B2I A;  3AV1 C;  1ULY A;  1N1J A;  4NE6 A;  5GXQ D;  5GT0 B;  3REJ B;  3UTB D;  4XUJ B;  4DQY B;  1P3P A;  5AV8 D;  3B6G B;  3LEL D;  3MNN C;  1M18 D;  3MGS D;  4G92 B;  5CPI A;  3AL0 C;  1M1A A;  1P3O D;  4XZQ A;  1P3M B;  5KDM B;  4WU8 B;  5CPK B;  1H3O A;  2F8N A;  1KX4 B;  3REI D;  4R8P C;  2FFF B;  5B2I C;  1P3F B;  2DQN C;  1WWI A;  1P3P C;  1P34 D;  1KX3 D;  5B33 A;  1F66 B;  3AFA D;  5B32 G;  3REL A;  3UT9 B;  1M1A C;  5CPJ A;  5GT3 D;  4ZUX D;  3LZ0 D;  3X1U A;  3AZH A;  3AV1 B;  3KXB A;  2FJ7 A;  4H9Q A;  3VH6 A;  4H9P B;  1ID3 D;  5C3I C;  5GSU D;  5AVB D;  5AV6 D;  3MNN B;  3AZE D;  3AYW A;  3EPL A;  5B40 D;  2ZY5 A;  1W2E A;  4H9R A;  4UUZ A;  4Z5T A;  5B33 C;  1EQZ C;  3REL C;  5DNN C;  5E5A D;  3AZM D;  2YFW B;  1P3B A;  1ZLA A;  1KU5 A;  5CPJ C;  4R8P B;  3X1U C;  5B2I B;  5B2J D;  3AZH C;  2FJ7 C;  3LZ1 D;  4DRB A;  1N1J B;  2BG1 A;  3KWQ D;  5AVC A;  4M6B A;  4KHA A;  3B6F D;  1S32 C;  1P3P B;  3MGR D;  5AV9 A;  3AYW C;  1TZY C;  1HQ3 A;  1B67 A;  1M1A B;  4Z5T C;  3AZL D;  4XZQ B;  3MGQ C;  1P3B C;  2JCH A;  1H3O B;  3MGP D;  5B31 A;  1ZLA C;  2F8N B;  4WU9 A;  5C3I B;  5JA4 A;  3WKJ D;  4J8W A;  3AZJ D;  5AVC C;  3C1C D;  3AN2 D;  2XD5 A;  5B1M D;  5B33 B;  1M19 D;  5AV9 C;  3REL B;  5DNN B;  1HQ3 C;  4H9S A;  2J8P A;  5CPJ B;  3X1U B;  3AZH B;  2FJ7 B;  3KXB B;  1PZR A;  4H9Q B;  3REH A;  3WTP D;  4J8V A;  4WU9 C;  2ZY4 A;  3WA9 A;  3W96 D;  5B32 A;  3KFU G;  4E45 A;  4J8W C;  3AYW B;  1TZY B;  5B24 D;  2CV5 A;  4KGC D;  4UUZ B;  4H9R B;  4Z5T B;  3B0B A;  3MGQ B;  1P3B B;  2DF4 C;  3VH5 A;  1ZLA B;  3X1T D;  3MVD D;  3W99 D;  5AVC B;  1U35 A;  3EPK A;  2Y2I A;  4KHA B;  5GT0 D;  1KX4 A;  3WA9 C;  4KUD A;  5AV9 B;  4Z66 A;  5B32 C;  5B0Z D;  2PYO A;  3O62 D;  2CV5 C;  1HQ3 B;  2RVQ C;  5CP6 A;  4WZS B;  4J8X D;  1P3F A;  3A1K A;  5BS7 A;  4ZBJ C;  5B1L D;  4WU9 B;  4WU8 D;  2Y2P A;  4JJN A;  5JA4 B;  3KUY D;  1BFM A;  4J8W B;  1P3I A;  4LD9 D;  2G5H C;  1U35 C;  4KUD C;  4Z66 C;  4Z2M G;  3W97 A;  3X1S D;  2LY8 A;  4J8U A;  2PYO C;  4HGA C;  5CP6 C;  2Y2H A;  5BS7 C;  3P5J B;  4CSR B;  3AZG A;  5F99 D;  4H9O A;  4X23 D;  4JJN C;  3AZK A;  3WA9 B;  4R8P A;  4CAY A;  5B32 B;  3AZF A;  3MNN D;  1P3I C;  1BH9 A;  2CV5 B;  3A6N D;  5AY8 A;  3W97 C;  4J8U C;  2JSS A;  1TAF A;  1P3L A;  4ZBJ B;  4WNN A;  1AOI D;  5GXQ A;  3UTB A;  4YS3 D;  3AZG C;  3AZN C;  5AV8 A;  1U35 B;  3LEL A;  1HTA A;  1M18 A;  3AZK C;  4KUD B;  4Z66 B;  3AZF C;  3AZI A;  2PYO B;  4HGA B;  5CPI D;  4H9N A;  5CP6 B;  5AY8 C;  4NE3 A;  3X1V D;  1M1A D;  1P3G D;  3WTP E;  1EQZ A;  3F6T A;  5DNN A;  1P3L C;  4XZQ D;  5DNM D;  4JJN B;  5GXQ C;  5BNV A;  3UTB C;  1P3I B;  1P3A D;  5AV8 C;  1P34 A;  3LEL C;  1KX3 A;  1WWS A;  1M18 C;  3LJA D;  2Y2K A;  2Y2L A;  1S32 A;  3W97 B;  5B33 D;  3AZI C;  4J8U B;  2IO5 C;  2Y2J A;  3REL D;  1TZY A;  4ZUX A;  3IP4 C;  5CPJ D;  1KX5 D;  3X1U D;  3REI C;  3AZN B;  3KXB D;  3MGQ A;  3AZH D;  3AZG B;  2FJ7 D;  4H9O B;  5GSU A;  5BNX A;  5AVB A;  3AZK B;  4CAY B;  3AZF B;  5B40 A;  1BH9 B;  2L5A A;  1P34 C;  1KX3 C;  5AY8 B;  5E5A A;  3W98 A;  3EPJ A;  1TAF B;  5GT3 C;  4ZUX C;  1P3L B;  4WNN B;  5B2J A;  5GXQ B;  3KWQ A;  1Q9C A;  2NQB D;  3UTB B;  2ARO D;  5AV8 B;  3LEL B;  5GSU C;  1M18 B;  5AVB C;  5AVC D;  3R45 A;  3AZI B;  5B40 C;  2IO5 B;  4H9N B;  3AZL A;  1P3K D;  2BYK A;  3H0M C;  5E5A C;  3AZM C;  3W98 C;  2ZY3 A;  1EQZ B;  2NZD D;  3UTA D;  5B2J C;  5B31 D;  3WKJ A;  5BNV B;  3KWQ C;  4WU9 D;  3AZJ A;  5AV5 D;  2BYM A;  4QLC D;  3REK D;  3B6F C;  1P34 B;  1KX3 B;  4CSR A;  1S32 B;  2Y2M A;  3AV2 D;  5GT3 B;  3NQU A;  4ZUX B;  3AZL C;  4E44 A;  2YFV A;  3WTP A;  3TU4 A;  4Z2M H;  5GSU B;  3W96 A;  5BNX B;  5AVB B;  3REH D;  3WKJ C;  4J8V D;  3AZJ C;  3H0R C;  5B24 A;  5B40 B;  3AN2 C;  2HIO A;  3REJ D;  5E5A B;  4XUJ D;  3W98 B;  1R4V A;  3B6G D;  3X1T A;  3W99 A;  4YM6 A;  2RIQ A;  5B2J B;  3C1B A;  5FUG B;  3KWQ B;  3B6F B;  3WTP C;  2G5I C;  3TU4 C;  3W96 C;  1T3U A;  3R45 B;  1P3M D;  5CPK D;  5B0Z A;  5B0Y A;  5B24 C;  3O62 A;  1KX4 D;  3B0C W;  2HIO C;  3AZL B;  2BYK B;  1P3F D;  5CP6 D;  4UPK A;  3X1T C;  5B1L A;  1F66 D;  3WAA A;  3W99 C;  4YM6 C;  3EPH A;  3KUY A;  3WKJ B;  3C1B C;  3UT9 D;  4LD9 A;  3AZJ B;  2BYM B;  3AN2 B;  2Y2G A;  3AZN A;  3AV1 D;  1A7W A;  3X1S A;  5B0Z C;  5B0Y C;  3O62 C;  4G92 C;  2Y2O A;  4J8X C;  3NQU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...