3X1SB

Crystal structure of the nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1sB00
4X23C 1P3PA 4KUDB 3LJAC 4XZQA 1JFIB 3REJA 5AV5B 3MGSB 3MGPB 3B0DC 3NQUB 1P3LD 1WWIA 3AV1D 4YS3C 3LZ0B 1M19D 3REKA 3AZKD 3VH5A 2F8NK 5AVCD 5AV9A 2FJ7A 2IO5B 1BH9A 2YFWA 1P34D 1P3BA 5BS7C 3R45A 3REHB 3W97D 1P3LC 5DNNA 5B40B 3AV1C 3NQJB 4X23A 5CPIA 1M19C 5AVCC 3B6FA 3AZGD 3X1TA 5B2ID 1P34C 5B0ZD 3AZEB 1P3KA 4E45A 4H9PA 1P3AC 3W97C 3UTBD 1KX4D 5B32G 5B32B 3TU4B 4J8WA 3AZGC 5B2IC 4H9QA 2NQBC 5B0ZC 1AOID 5CPKD 2CV5D 3W99B 1N1JB 5AV8A 4H9NB 3UTBC 1ZLAB 1KX4C 3AFAC 1ID3D 3AV1B 5JRGD 3UT9D 5B31D 3AZKB 3W97A 1P3AA 5AVCB 4ZUXD 5CP6D 3AZLD 2CV5C 2BYKA 3LELD 1M18D 4NE5A 3C1CD 3REIC 3A6NA 1B6WA 2NQBA 5B0ZA 5DNMB 1ID3C 4YM6D 1F66D 1P3MA 5JRGC 1U35A 5B31C 3X1SB 2HUEC 3LZ1A 3X1UA 2F8ND 4ZUXC 5CP6C 4J8XD 5AY8B 4G92B 3AFAA 1M18C 1TAFA 3C1CC 3WA9D 5BO0B 1P3OB 1F66C 5B24D 2LY8A 1KX4B 4KUDD 4QLCC 4KHAA 3RELA 5AV5D 3MGSD 4J8XC 2YFVA 4WU9A 3REIA 5BNXA 3LZ0D 1AOIB 5CPKB 3WA9C 3AYWC 2AROB 2RVQD 1P3FB 5B24C 4KUDC 4Z5TD 1ID3B 5AV5C 4H9OB 3MGSC 3MGPC 2F8NH 5CHLB 3MGRB 3UT9B 5B31G 5BT1D 5B31B 3LZ0C 1F66A 4CSRA 4WNNB 3AZLB 3AZNB 4DRAA 3LELB 2RVQC 4QLCA 1M18B 5GXQD 3MNNB 4J8XA 3O62D 3KUYB 5GT3A 4WU8A 3AZED 4Z5TC 3REHC 3VH6T 4YM6B 3WA9A 5KDMA 3AZHA 5BT1C 5B40C 3X1VD 1H3OB 3AYWA 4Z66B 2F8NB 2F8NG 5B32D 4KUDA 3TU4D 5E5AB 3MGSA 3MGPA 3NQUA 5AVBA 3WKJD 3AZEC 3AZID 3W99D 2HIOB 5B24B 3MGQB 1ZLAD 5B32C 3TU4C 3REHA 3WKJC 5B40A 3AZIC 3AV2A 1TZYD 3NQJA 3W99C 1ZLAC 4Z5TB 3MVDB 5F99D 3C1BD 5DNMD 3KWQD 3X1SD 3AZKC 1TZYC 3LJAA 4J8UD 1KX3D 5AY8D 5GXQB 1EQZD 3O62B 3TU4A 1KX5D 5B33B 4YS3A 3KXBB 5B2JB 4JJND 5DNMC 1P3OD 3REJB 3X1VB 1S32B 3X1SC 1N1JA 3W99A 4NE6A 3AN2D 5AY8C 5BS7A 5AV9B 4G92C 5B1LD 2FJ7B 3WKJB 1P3LA 1KX5C 4ZBJB 3AZIB 3AV1A 1M19A 3AZKA 1P3OC 3W96D 5AVCA 2AROD 1P3FD 4G91C 4H9SC 1P34A 5CPIB 3AN2C 4M6BA 3MGRD 5B1LC 3X1TB 5DNMA 1R4VA 5CPKC 1AOIC 1TZYB 1HQ3D 2JSSA 3X1SA 3AZND 1HTAA 5AV6B 3B0CW 2AROC 3W96C 1P3FC 1M1AD 3AZGA 5B2IA 3MNND 1P3IB 5AY8A 4J8VB 3KUYD 5F99B 3C1BB 3AZMB 4R8PD 3MGRC 3UT9C 3KWQB 4J8WB 5BO0A 3WTPD 3UTAD 4Z66D 3UTBA 1KX3B 3AZLC 4J8UB 1KX4A 1HQ3C 4H9SA 3AZNC 3VH6W 5E5AD 1EQZB 3LELC 5FUGB 4WZSB 1M1AC 1KX5B 3MNNC 5GSUB 3KUYC 4JJNB 4R8PC 1AOIA 4YM6C 5CPKA 2HIOD 4G91B 2CV5A 1P3GD 3B6GD 3WTPC 3MGQD 3UTAC 3AZFD 4Z66C 2AROA 4DRBA 5CPJD 3AN2B 2PYOB 4AWLB 4HGAC 4Z2MH 5E5AC 5B1LB 1ID3A 4H9OA 5JRGA 3UT9A 5B31A 3W96B 3W98B 4LD9D 2HIOC 4ZUXA 4WNNA 5CP6A 3AZLA 3B6GC 3MGQC 3AZFC 1P3MB 3LELA 1M18A 5CPJC 5B1MD 3MVDD 3VH5W 3C1CA 3B0CT 3LZ1B 3KUYA 4XUJD 2NZDD 4YM6A 4E44A 5BNVA 1HQ3B 5G49A 1A7WA 3WAAB 1H3OA 2F8NA 1BH8B 1M1AB 3AZJD 5E5AA 1P3PD 5B33D 4R8PB 5B1MC 3KXBD 5B2JD 3MVDC 3V9RA 3RELB 3WTPB 4XUJC 3REJD 3UTAB 2YFVB 1S32D 2HIOA 5B24A 4HGAB 5BNXB 4KGCB 3REKD 1JFIA 5GXQC 5AV5A 5GT0B 5AV9D 3O62C 2FJ7D 5B33C 3KXBC 3LZ0A 5B2JC 4UUZB 1P3GB 1P3BD 3B6GB 3REJC 3X1VC 1BFMA 3AZFB 1S32C 5CPJB 3VH6A 4WV4B 5CPID 4CSRB 3REKC 4Z5TA 3B6FD 5AV9C 2FJ7C 3X1TD 5JA4B 3VH5T 4ZBJC 2L5AA 5B0YB 4LD9B 5GT3B 5AV6D 4WU8B 1P3KD 2BYMB 1P3ID 3AZHB 5B1MB 5C3IB 5GXQA 4J8VD 3O62A 3AZMD 5CPIC 4XUJB 4H9RB 1WWSA 4CAYB 5B33A 3AZEA 3WTPE 3KXBA 5B2JA 3B6FC 2NZDB 4J8WD 3X1TC 4EO5B 3X1VA 1S32A 5B32A 1ULYA 5AVBB 5AV6C 3AZJB 1P3KC 1P3PB 1P3IC 4J8VC 5GSUD 5F99C 3C1BC 5AV8D 3AZMC 4XZQB 3WKJA 3AZIA 3KWQC 4J8WC 1ZLAA 4H9NA 3REKB 1KX3C 4NFTA 4J8UC 1P3AD 2PYOD 1EQZC 3AV2B 1BH9B 2YFWB 5GSUC 4JJNC 5AV8C 1P3BB 3R45B 3W98D 3A6ND 1Q9CA 1TZYA 2NQBD 5DNNB 5AV6A 1P3MD 4X23B 1U35D 2PYOC 4AWLC 1P3IA 4J8VA 3LZ1D 3X1UD 5F99A 3B6FB 3C1BA 3AZMA 3LJAB 1B67A 3AFAD 3KWQA 3B0DB 3WAAD 4YS3B 1P3KB 4H9PB 3W98C 3A6NC 1KX3A 1KU5A 4J8UA 1EQZA 1P3MC 1U35C 5FUGA 1KX5A 5GSUA 3LZ1C 3X1UC 4JJNA 3RELD 4WU9D 1P3OA 3REID 4H9QB 1P3LB 3WAAC 4KGCD 1M19B 5GT0D 3AN2A 2PYOA 5B1LA 5AV8B 1P34B 3RELC 4WU9C 3W96A 1P3FA 3W98A 1P3AB 3W97B 4KGCC 5GT0C 3MGRA 2BYKB 4QLCD 3AZGB 5B0YD 5B2IB 3A6NB 5GT3D 1P3GC 4WU8D 1HQ3A 3AZNA 5B0ZB 2NQBB 3WAAA 1U35B 3AZHD 1BH8A 1M1AA 3MNNA 3AYWD 3X1UB 3UTBB 4R8PA 4Z2MG 3AFAB 1TAFB 3WTPA 5B0YC 3UTAA 3MGPD 4Z66A 4LD9C 5AVBD 5GT3C 4WU8C 4KGCA 3AZHC 2CV5B 5C3IC 5GT0A 4XZQD 4KHAB 4WU9B 2NZDC 3REIB 4UUZA 1P3GA 4EO5C 3REHD 3B6GA 3MGQA 3AZFA 3KSYA 5JRGB 5CPJA 5AVBC 2HUEB 5B40D 3AV2D 3AZJC 1P3PC 4ZUXB 5CP6B 2CWEA 2IO5C 5JA4A 4XZQC 3C1CB 5B0YA 4LD9A 1F1EA 5DNND 4X23D 1F66B 2BYMA 5BNVB 5B1MA 3MVDA 5G49B 3AV2C 3LJAD 4QLCB 4XUJA 4H9RA 4CAYA 4J8XB 2NZDA 1P3BC 4YS3D 3WA9B 5KDMB 3B0BA 3V9RB 5DNNC 4NE3A 3AYWB 3AZJA
chains in the Genus database with same CATH superfamily
2Y2GA 4X23C 1P3PA 4KUDB 3P5JB 3LJAC 4XZQA 1JFIB 3REJA 5AV5B 3MGSB 3MGPB 3KFUG 3B0DC 3NQUB 1P3LD 1WWIA 3AV1D 2Y2NA 4YS3C 3LZ0B 4UPKA 1M19D 3REKA 3AZKD 3VH5A 2F8NK 5AVCD 5AV9A 2FJ7A 2IO5B 1BH9A 2YFWA 1P34D 1P3BA 5BS7C 3R45A 3REHB 2ZY2A 3W97D 1P3LC 5DNNA 5B40B 3AV1C 3NQJB 4X23A 5CPIA 1M19C 2Y2MA 5AVCC 3B6FA 3AZGD 3X1TA 5B2ID 1P34C 5B0ZD 3AZEB 1P3KA 4E45A 4H9PA 1P3AC 3W97C 3UTBD 2W8SA 1KX4D 5B32G 5B32B 3TU4B 4J8WA 3AZGC 5B2IC 4H9QA 2Y2OA 2NQBC 5B0ZC 1AOID 5CPKD 3H0LC 2CV5D 3W99B 1N1JB 5AV8A 4H9NB 3UTBC 3IP4C 4DQYB 1KX4C 1ZLAB 3AFAC 1ID3D 3AV1B 5JRGD 3UT9D 5B31D 3AZKB 3W97A 2RIQA 1P3AA 5AVCB 4ZUXD 5CP6D 3AZLD 2CV5C 2BYKA 3LELD 1M18D 4NE5A 3C1CD 3REIC 3A6NA 1B6WA 2NQBA 5B0ZA 2JE5A 5DNMB 4YM6D 1ID3C 1P3MA 1F66D 5JRGC 1U35A 5B31C 3X1SB 2HUEC 2VQRA 3LZ1A 3X1UA 2F8ND 4ZUXC 5CP6C 4J8XD 5AY8B 4G92B 3AFAA 1M18C 1TAFA 3C1CC 3WA9D 5BO0B 1P3OB 1F66C 5B24D 2LY8A 1KX4B 4KUDD 4QLCC 4KHAA 3RELA 5AV5D 3MGSD 4J8XC 2YFVA 4WU9A 3REIA 5BNXA 3LZ0D 1AOIB 5CPKB 3WA9C 3AYWC 2AROB 2RVQD 1P3FB 5B24C 4KUDC 4Z5TD 1ID3B 5AV5C 4H9OB 3MGSC 3MGPC 2F8NH 5CHLB 3MGRB 3UT9B 5B31G 5BT1D 5B31B 3LZ0C 1F66A 4CSRA 4WNNB 3AZLB 3AZNB 4DRAA 3LELB 2RVQC 4QLCA 1M18B 5GXQD 3A1KA 3MNNB 4J8XA 3O62D 2Y2PA 3KUYB 5GT3A 3F6TA 4WU8A 3AZED 4Z5TC 3REHC 3VH6T 4YM6B 3WA9A 5KDMA 3AZHA 5BT1C 5B40C 3X1VD 1H3OB 3AYWA 4Z66B 2F8NB 2F8NG 5B32D 4KUDA 3TU4D 5E5AB 3MGSA 3MGPA 3NQUA 5AVBA 3WKJD 3AZEC 3AZID 3W99D 2HIOB 5B24B 3MGQB 1ZLAD 3EPJA 5B32C 2Y2IA 3TU4C 3REHA 2DF4C 3WKJC 5B40A 3AZIC 3AV2A 1TZYD 3NQJA 3W99C 2Y2KA 1ZLAC 4Z5TB 3MVDB 5F99D 3C1BD 5DNMD 3KWQD 3X1SD 3AZKC 1TZYC 3LJAA 4J8UD 1KX3D 5AY8D 5GXQB 1EQZD 3O62B 3TU4A 1KX5D 5B33B 4YS3A 3KXBB 5B2JB 4JJND 5DNMC 1P3OD 3REJB 3X1VB 1S32B 3X1SC 1N1JA 3W99A 4NE6A 3AN2D 5AY8C 5BS7A 5AV9B 4G92C 5B1LD 2FJ7B 3WKJB 1P3LA 1KX5C 4ZBJB 3AZIB 3AV1A 2Y2HA 2ZM5A 1M19A 3AZKA 1P3OC 3W96D 5AVCA 2AROD 1P3FD 4G91C 4H9SC 3A1IA 1P34A 5CPIB 3AN2C 4M6BA 3MGRD 5B1LC 3X1TB 2F2AC 5DNMA 1R4VA 5CPKC 1AOIC 1TZYB 1HQ3D 2JSSA 3X1SA 3AZND 1HTAA 5AV6B 3B0CW 2AROC 3H0RC 3W96C 1P3FC 3AZGA 1M1AD 5B2IA 3MNND 1P3IB 5AY8A 4J8VB 3KUYD 5F99B 2ZY4A 3C1BB 2DQNC 3AZMB 4R8PD 3MGRC 3UT9C 3KWQB 2ZY3A 4J8WB 5BO0A 3WTPD 3UTAD 4Z66D 3UTBA 1KX3B 3AZLC 4J8UB 1KX4A 1HQ3C 4H9SA 3AZNC 3VH6W 5E5AD 1EQZB 3LELC 5FUGB 4WZSB 1M1AC 1KX5B 3MNNC 5GSUB 3KUYC 4JJNB 4R8PC 1AOIA 4YM6C 5CPKA 2HIOD 4G91B 2CV5A 1P3GD 3B6GD 3WTPC 3MGQD 3UTAC 2G5HC 4Z66C 3AZFD 2AROA 4DRBA 2BG1A 5CPJD 3AN2B 2PYOB 4AWLB 4HGAC 4Z2MH 5E5AC 5B1LB 2Y2JA 2Y2QA 1ID3A 4H9OA 5JRGA 3UT9A 5B31A 3EPLA 3W96B 3W98B 4LD9D 2HIOC 4ZUXA 4WNNA 5CP6A 3AZLA 3B6GC 3MGQC 3AZFC 1P3MB 3LELA 1M18A 5CPJC 5B1MD 3MVDD 3VH5W 3C1CA 3B0CT 3LZ1B 3KUYA 4XUJD 2NZDD 4YM6A 4E44A 5BNVA 1HQ3B 5G49A 1A7WA 3WAAB 1H3OA 2F8NA 1BH8B 1M1AB 3AZJD 5E5AA 1P3PD 5B33D 4R8PB 5B1MC 3KXBD 5B2JD 3MVDC 3V9RA 3RELB 3WTPB 4XUJC 3REJD 3UTAB 2YFVB 1S32D 2HIOA 5B24A 3EPHA 4HGAB 5BNXB 4KGCB 3REKD 1JFIA 5GXQC 5AV5A 5GT0B 5AV9D 3O62C 2FJ7D 5B33C 3KXBC 3LZ0A 5B2JC 4UUZB 1P3GB 1P3BD 3B6GB 3REJC 3X1VC 1BFMA 3AZFB 1S32C 5CPJB 3VH6A 4WV4B 5CPID 4CSRB 3REKC 4Z5TA 3B6FD 5AV9C 2FJ7C 3X1TD 5JA4B 3VH5T 4ZBJC 2L5AA 5B0YB 4LD9B 5GT3B 5AV6D 4WU8B 1P3KD 2BYMB 1P3ID 3AZHB 5B1MB 5C3IB 5GXQA 4J8VD 3O62A 3AZMD 5CPIC 4XUJB 4H9RB 1WWSA 4CAYB 5B33A 3AZEA 3WTPE 3KXBA 5B2JA 3B6FC 2NZDB 4J8WD 3X1TC 4EO5B 1PZRA 4WJ3C 3X1VA 1S32A 5B32A 1ULYA 5AVBB 5AV6C 3AZJB 1P3KC 1P3PB 2XD1A 1P3IC 4J8VC 5GSUD 5F99C 3C1BC 5AV8D 3AZMC 4XZQB 3WKJA 3AZIA 3KWQC 4J8WC 2UWXA 3EPKA 1ZLAA 4H9NA 3REKB 1KX3C 4NFTA 4J8UC 1P3AD 2PYOD 1EQZC 3AV2B 1BH9B 2YFWB 5GSUC 4JJNC 5AV8C 1P3BB 3R45B 3W98D 3A6ND 1Q9CA 1TZYA 2NQBD 5DNNB 5AV6A 1P3MD 4X23B 1U35D 2PYOC 1T3UA 4AWLC 1P3IA 4J8VA 3LZ1D 3X1UD 5F99A 3B6FB 3C1BA 3AZMA 3LJAB 1B67A 3AFAD 3KWQA 3B0DB 3WAAD 4YS3B 1P3KB 4H9PB 3W98C 3A6NC 1KX3A 1KU5A 4J8UA 1EQZA 1P3MC 1U35C 5FUGA 1KX5A 5GSUA 3LZ1C 3X1UC 4JJNA 2XD5A 3RELD 4WU9D 1P3OA 3REID 4H9QB 1P3LB 3WAAC 4KGCD 1M19B 5GT0D 3AN2A 2PYOA 5B1LA 5AV8B 1P34B 3RELC 4WU9C 3W96A 1P3FA 3W98A 1P3AB 3W97B 4KGCC 5GT0C 3MGRA 2BYKB 4QLCD 3AZGB 5B0YD 5B2IB 3A6NB 5GT3D 3H0MC 1P3GC 4WU8D 1HQ3A 3AZNA 5B0ZB 2NQBB 3WAAA 1W2EA 1U35B 3AZHD 1BH8A 1M1AA 3MNNA 3AYWD 2JCHA 3X1UB 3UTBB 4R8PA 4Z2MG 3AFAB 1TAFB 3WTPA 5B0YC 3UTAA 3MGPD 4Z66A 4LD9C 3AL0C 5AVBD 5GT3C 4WU8C 4KGCA 3AZHC 2CV5B 5C3IC 5GT0A 4XZQD 4KHAB 2G5IC 3EG5B 4WU9B 2NZDC 3REIB 4UUZA 1P3GA 4EO5C 3REHD 3B6GA 3MGQA 3AZFA 3KSYA 5JRGB 5CPJA 5AVBC 2HUEB 5B40D 3AV2D 3AZJC 1P3PC 2Y2LA 4ZUXB 2J8PA 2CWEA 5CP6B 1Z2CB 2IO5C 5JA4A 4XZQC 3C1CB 5B0YA 2FFFB 4LD9A 1F1EA 5DNND 4X23D 1F66B 2BYMA 5BNVB 3FDDA 5B1MA 3MVDA 5G49B 3AV2C 3LJAD 4QLCB 4XUJA 4H9RA 4CAYA 4J8XB 2NZDA 1P3BC 4YS3D 2ZY5A 3WA9B 5KDMB 3B0BA 3V9RB 5DNNC 4NE3A 3AYWB 3AZJA
chains in the Genus database with same CATH topology
2Y2GA 4X23C 1P3PA 4KUDB 3P5JB 3LJAC 4XZQA 1JFIB 3REJA 5AV5B 3MGSB 3MGPB 3KFUG 3B0DC 3NQUB 1P3LD 1WWIA 3AV1D 2Y2NA 4YS3C 3LZ0B 4UPKA 1M19D 3REKA 3AZKD 3VH5A 2F8NK 5AVCD 5AV9A 2FJ7A 2IO5B 1BH9A 2YFWA 1P34D 1P3BA 5BS7C 3R45A 3REHB 2ZY2A 3W97D 1P3LC 5DNNA 5B40B 3AV1C 3NQJB 4X23A 5CPIA 1M19C 2Y2MA 5AVCC 3B6FA 3AZGD 3X1TA 5B2ID 1P34C 5B0ZD 3AZEB 1P3KA 4E45A 4H9PA 1P3AC 3W97C 3UTBD 2W8SA 1KX4D 5B32G 5B32B 3TU4B 4J8WA 3AZGC 5B2IC 4H9QA 2Y2OA 2NQBC 5B0ZC 1AOID 5CPKD 3H0LC 2CV5D 3W99B 1N1JB 5AV8A 4H9NB 3UTBC 3IP4C 4DQYB 1KX4C 1ZLAB 3AFAC 1ID3D 3AV1B 5JRGD 3UT9D 5B31D 3AZKB 3W97A 2RIQA 1P3AA 5AVCB 4ZUXD 5CP6D 3AZLD 2CV5C 2BYKA 3LELD 1M18D 4NE5A 3C1CD 3REIC 3A6NA 1B6WA 2NQBA 5B0ZA 2JE5A 5DNMB 4YM6D 1ID3C 1P3MA 1F66D 5JRGC 1U35A 5B31C 3X1SB 2HUEC 2VQRA 3LZ1A 3X1UA 2F8ND 4ZUXC 5CP6C 4J8XD 5AY8B 4G92B 3AFAA 1M18C 1TAFA 3C1CC 3WA9D 5BO0B 1P3OB 1F66C 5B24D 2LY8A 1KX4B 4KUDD 4QLCC 4KHAA 3RELA 5AV5D 3MGSD 4J8XC 2YFVA 4WU9A 3REIA 5BNXA 3LZ0D 1AOIB 5CPKB 3WA9C 3AYWC 2AROB 2RVQD 1P3FB 5B24C 4KUDC 4Z5TD 1ID3B 5AV5C 4H9OB 3MGSC 3MGPC 2F8NH 5CHLB 3MGRB 3UT9B 5B31G 5BT1D 5B31B 3LZ0C 1F66A 4CSRA 4WNNB 3AZLB 3AZNB 4DRAA 3LELB 2RVQC 4QLCA 1M18B 5GXQD 3A1KA 3MNNB 4J8XA 3O62D 2Y2PA 3KUYB 5GT3A 3F6TA 4WU8A 3AZED 4Z5TC 3REHC 3VH6T 4YM6B 3WA9A 5KDMA 3AZHA 5BT1C 5B40C 3X1VD 1H3OB 3AYWA 4Z66B 2F8NB 2F8NG 5B32D 4KUDA 3TU4D 5E5AB 3MGSA 3MGPA 3NQUA 5AVBA 3WKJD 3AZEC 3AZID 3W99D 2HIOB 5B24B 3MGQB 1ZLAD 3EPJA 5B32C 2Y2IA 3TU4C 3REHA 2DF4C 3WKJC 5B40A 3AZIC 3AV2A 1TZYD 3NQJA 3W99C 2Y2KA 1ZLAC 4Z5TB 3MVDB 5F99D 3C1BD 5DNMD 3KWQD 3X1SD 3AZKC 1TZYC 3LJAA 4J8UD 1KX3D 5AY8D 5GXQB 1EQZD 3O62B 3TU4A 1KX5D 5B33B 4YS3A 3KXBB 5B2JB 4JJND 5DNMC 1P3OD 3REJB 3X1VB 1S32B 3X1SC 1N1JA 3W99A 4NE6A 3AN2D 5AY8C 5BS7A 5AV9B 4G92C 5B1LD 2FJ7B 3WKJB 1P3LA 1KX5C 4ZBJB 3AZIB 3AV1A 2Y2HA 2ZM5A 1M19A 3AZKA 1P3OC 3W96D 5AVCA 2AROD 1P3FD 4G91C 4H9SC 3A1IA 1P34A 5CPIB 3AN2C 4M6BA 3MGRD 5B1LC 3X1TB 2F2AC 5DNMA 1R4VA 5CPKC 1AOIC 1TZYB 1HQ3D 2JSSA 3X1SA 3AZND 1HTAA 5AV6B 3B0CW 2AROC 3H0RC 3W96C 1P3FC 3AZGA 1M1AD 5B2IA 3MNND 1P3IB 5AY8A 4J8VB 3KUYD 5F99B 2ZY4A 3C1BB 2DQNC 3AZMB 4R8PD 3MGRC 3UT9C 3KWQB 2ZY3A 4J8WB 5BO0A 3WTPD 3UTAD 4Z66D 3UTBA 1KX3B 3AZLC 4J8UB 1KX4A 1HQ3C 4H9SA 3AZNC 3VH6W 5E5AD 1EQZB 3LELC 5FUGB 4WZSB 1M1AC 1KX5B 3MNNC 5GSUB 3KUYC 4JJNB 4R8PC 1AOIA 4YM6C 5CPKA 2HIOD 4G91B 2CV5A 1P3GD 3B6GD 3WTPC 3MGQD 3UTAC 2G5HC 4Z66C 3AZFD 2AROA 4DRBA 2BG1A 5CPJD 3AN2B 2PYOB 4AWLB 4HGAC 4Z2MH 5E5AC 5B1LB 2Y2JA 2Y2QA 1ID3A 4H9OA 5JRGA 3UT9A 5B31A 3EPLA 3W96B 3W98B 4LD9D 2HIOC 4ZUXA 4WNNA 5CP6A 3AZLA 3B6GC 3MGQC 3AZFC 1P3MB 3LELA 1M18A 5CPJC 5B1MD 3MVDD 3VH5W 3C1CA 3B0CT 3LZ1B 3KUYA 4XUJD 2NZDD 4YM6A 4E44A 5BNVA 1HQ3B 5G49A 1A7WA 3WAAB 1H3OA 2F8NA 1BH8B 1M1AB 3AZJD 5E5AA 1P3PD 5B33D 4R8PB 5B1MC 3KXBD 5B2JD 3MVDC 3V9RA 3RELB 3WTPB 4XUJC 3REJD 3UTAB 2YFVB 1S32D 2HIOA 5B24A 3EPHA 4HGAB 5BNXB 4KGCB 3REKD 1JFIA 5GXQC 5AV5A 5GT0B 5AV9D 3O62C 2FJ7D 5B33C 3KXBC 3LZ0A 5B2JC 4UUZB 1P3GB 1P3BD 3B6GB 3REJC 3X1VC 1BFMA 3AZFB 1S32C 5CPJB 3VH6A 4WV4B 5CPID 4CSRB 3REKC 4Z5TA 3B6FD 5AV9C 2FJ7C 3X1TD 5JA4B 3VH5T 4ZBJC 2L5AA 5B0YB 4LD9B 5GT3B 5AV6D 4WU8B 1P3KD 2BYMB 1P3ID 3AZHB 5B1MB 5C3IB 5GXQA 4J8VD 3O62A 3AZMD 5CPIC 4XUJB 4H9RB 1WWSA 4CAYB 5B33A 3AZEA 3WTPE 3KXBA 5B2JA 3B6FC 2NZDB 4J8WD 3X1TC 4EO5B 1PZRA 4WJ3C 3X1VA 1S32A 5B32A 1ULYA 5AVBB 5AV6C 3AZJB 1P3KC 1P3PB 2XD1A 1P3IC 4J8VC 5GSUD 5F99C 3C1BC 5AV8D 3AZMC 4XZQB 3WKJA 3AZIA 3KWQC 4J8WC 2UWXA 3EPKA 1ZLAA 4H9NA 3REKB 1KX3C 4NFTA 4J8UC 1P3AD 2PYOD 1EQZC 3AV2B 1BH9B 2YFWB 5GSUC 4JJNC 5AV8C 1P3BB 3R45B 3W98D 3A6ND 1Q9CA 1TZYA 2NQBD 5DNNB 5AV6A 1P3MD 4X23B 1U35D 2PYOC 1T3UA 4AWLC 1P3IA 4J8VA 3LZ1D 3X1UD 5F99A 3B6FB 3C1BA 3AZMA 3LJAB 1B67A 3AFAD 3KWQA 3B0DB 3WAAD 4YS3B 1P3KB 4H9PB 3W98C 3A6NC 1KX3A 1KU5A 4J8UA 1EQZA 1P3MC 1U35C 5FUGA 1KX5A 5GSUA 3LZ1C 3X1UC 4JJNA 2XD5A 3RELD 4WU9D 1P3OA 3REID 4H9QB 1P3LB 3WAAC 4KGCD 1M19B 5GT0D 3AN2A 2PYOA 5B1LA 5AV8B 1P34B 3RELC 4WU9C 3W96A 1P3FA 3W98A 1P3AB 3W97B 4KGCC 5GT0C 3MGRA 2BYKB 4QLCD 3AZGB 5B0YD 5B2IB 3A6NB 5GT3D 3H0MC 1P3GC 4WU8D 1HQ3A 3AZNA 5B0ZB 2NQBB 3WAAA 1W2EA 1U35B 3AZHD 1BH8A 1M1AA 3MNNA 3AYWD 2JCHA 3X1UB 3UTBB 4R8PA 4Z2MG 3AFAB 1TAFB 3WTPA 5B0YC 3UTAA 3MGPD 4Z66A 4LD9C 3AL0C 5AVBD 5GT3C 4WU8C 4KGCA 3AZHC 2CV5B 5C3IC 5GT0A 4XZQD 4KHAB 2G5IC 3EG5B 4WU9B 2NZDC 3REIB 4UUZA 1P3GA 4EO5C 3REHD 3B6GA 3MGQA 3AZFA 3KSYA 5JRGB 5CPJA 5AVBC 2HUEB 5B40D 3AV2D 3AZJC 1P3PC 2Y2LA 4ZUXB 2J8PA 2CWEA 5CP6B 1Z2CB 2IO5C 5JA4A 4XZQC 3C1CB 5B0YA 2FFFB 4LD9A 1F1EA 5DNND 4X23D 1F66B 2BYMA 5BNVB 3FDDA 5B1MA 3MVDA 5G49B 3AV2C 3LJAD 4QLCB 4XUJA 4H9RA 4CAYA 4J8XB 2NZDA 1P3BC 4YS3D 2ZY5A 3WA9B 5KDMB 3B0BA 3V9RB 5DNNC 4NE3A 3AYWB 3AZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 C;  1P3P A;  4KUD B;  3LJA C;  4XZQ A;  1JFI B;  3REJ A;  5AV5 B;  3MGS B;  3MGP B;  3B0D C;  3NQU B;  1P3L D;  1WWI A;  3AV1 D;  4YS3 C;  3LZ0 B;  1M19 D;  3REK A;  3AZK D;  3VH5 A;  2F8N K;  5AVC D;  5AV9 A;  2FJ7 A;  2IO5 B;  1BH9 A;  2YFW A;  1P34 D;  1P3B A;  5BS7 C;  3R45 A;  3REH B;  3W97 D;  1P3L C;  5DNN A;  5B40 B;  3AV1 C;  3NQJ B;  4X23 A;  5CPI A;  1M19 C;  5AVC C;  3B6F A;  3AZG D;  3X1T A;  5B2I D;  1P34 C;  5B0Z D;  3AZE B;  1P3K A;  4E45 A;  4H9P A;  1P3A C;  3W97 C;  3UTB D;  1KX4 D;  5B32 G;  5B32 B;  3TU4 B;  4J8W A;  3AZG C;  5B2I C;  4H9Q A;  2NQB C;  5B0Z C;  1AOI D;  5CPK D;  2CV5 D;  3W99 B;  1N1J B;  5AV8 A;  4H9N B;  3UTB C;  1ZLA B;  1KX4 C;  3AFA C;  1ID3 D;  3AV1 B;  5JRG D;  3UT9 D;  5B31 D;  3AZK B;  3W97 A;  1P3A A;  5AVC B;  4ZUX D;  5CP6 D;  3AZL D;  2CV5 C;  2BYK A;  3LEL D;  1M18 D;  4NE5 A;  3C1C D;  3REI C;  3A6N A;  1B6W A;  2NQB A;  5B0Z A;  5DNM B;  1ID3 C;  4YM6 D;  1F66 D;  1P3M A;  5JRG C;  1U35 A;  5B31 C;  3X1S B;  2HUE C;  3LZ1 A;  3X1U A;  2F8N D;  4ZUX C;  5CP6 C;  4J8X D;  5AY8 B;  4G92 B;  3AFA A;  1M18 C;  1TAF A;  3C1C C;  3WA9 D;  5BO0 B;  1P3O B;  1F66 C;  5B24 D;  2LY8 A;  1KX4 B;  4KUD D;  4QLC C;  4KHA A;  3REL A;  5AV5 D;  3MGS D;  4J8X C;  2YFV A;  4WU9 A;  3REI A;  5BNX A;  3LZ0 D;  1AOI B;  5CPK B;  3WA9 C;  3AYW C;  2ARO B;  2RVQ D;  1P3F B;  5B24 C;  4KUD C;  4Z5T D;  1ID3 B;  5AV5 C;  4H9O B;  3MGS C;  3MGP C;  2F8N H;  5CHL B;  3MGR B;  3UT9 B;  5B31 G;  5BT1 D;  5B31 B;  3LZ0 C;  1F66 A;  4CSR A;  4WNN B;  3AZL B;  3AZN B;  4DRA A;  3LEL B;  2RVQ C;  4QLC A;  1M18 B;  5GXQ D;  3MNN B;  4J8X A;  3O62 D;  3KUY B;  5GT3 A;  4WU8 A;  3AZE D;  4Z5T C;  3REH C;  3VH6 T;  4YM6 B;  3WA9 A;  5KDM A;  3AZH A;  5BT1 C;  5B40 C;  3X1V D;  1H3O B;  3AYW A;  4Z66 B;  2F8N B;  2F8N G;  5B32 D;  4KUD A;  3TU4 D;  5E5A B;  3MGS A;  3MGP A;  3NQU A;  5AVB A;  3WKJ D;  3AZE C;  3AZI D;  3W99 D;  2HIO B;  5B24 B;  3MGQ B;  1ZLA D;  5B32 C;  3TU4 C;  3REH A;  3WKJ C;  5B40 A;  3AZI C;  3AV2 A;  1TZY D;  3NQJ A;  3W99 C;  1ZLA C;  4Z5T B;  3MVD B;  5F99 D;  3C1B D;  5DNM D;  3KWQ D;  3X1S D;  3AZK C;  1TZY C;  3LJA A;  4J8U D;  1KX3 D;  5AY8 D;  5GXQ B;  1EQZ D;  3O62 B;  3TU4 A;  1KX5 D;  5B33 B;  4YS3 A;  3KXB B;  5B2J B;  4JJN D;  5DNM C;  1P3O D;  3REJ B;  3X1V B;  1S32 B;  3X1S C;  1N1J A;  3W99 A;  4NE6 A;  3AN2 D;  5AY8 C;  5BS7 A;  5AV9 B;  4G92 C;  5B1L D;  2FJ7 B;  3WKJ B;  1P3L A;  1KX5 C;  4ZBJ B;  3AZI B;  3AV1 A;  1M19 A;  3AZK A;  1P3O C;  3W96 D;  5AVC A;  2ARO D;  1P3F D;  4G91 C;  4H9S C;  1P34 A;  5CPI B;  3AN2 C;  4M6B A;  3MGR D;  5B1L C;  3X1T B;  5DNM A;  1R4V A;  5CPK C;  1AOI C;  1TZY B;  1HQ3 D;  2JSS A;  3X1S A;  3AZN D;  1HTA A;  5AV6 B;  3B0C W;  2ARO C;  3W96 C;  1P3F C;  1M1A D;  3AZG A;  5B2I A;  3MNN D;  1P3I B;  5AY8 A;  4J8V B;  3KUY D;  5F99 B;  3C1B B;  3AZM B;  4R8P D;  3MGR C;  3UT9 C;  3KWQ B;  4J8W B;  5BO0 A;  3WTP D;  3UTA D;  4Z66 D;  3UTB A;  1KX3 B;  3AZL C;  4J8U B;  1KX4 A;  1HQ3 C;  4H9S A;  3AZN C;  3VH6 W;  5E5A D;  1EQZ B;  3LEL C;  5FUG B;  4WZS B;  1M1A C;  1KX5 B;  3MNN C;  5GSU B;  3KUY C;  4JJN B;  4R8P C;  1AOI A;  4YM6 C;  5CPK A;  2HIO D;  4G91 B;  2CV5 A;  1P3G D;  3B6G D;  3WTP C;  3MGQ D;  3UTA C;  3AZF D;  4Z66 C;  2ARO A;  4DRB A;  5CPJ D;  3AN2 B;  2PYO B;  4AWL B;  4HGA C;  4Z2M H;  5E5A C;  5B1L B;  1ID3 A;  4H9O A;  5JRG A;  3UT9 A;  5B31 A;  3W96 B;  3W98 B;  4LD9 D;  2HIO C;  4ZUX A;  4WNN A;  5CP6 A;  3AZL A;  3B6G C;  3MGQ C;  3AZF C;  1P3M B;  3LEL A;  1M18 A;  5CPJ C;  5B1M D;  3MVD D;  3VH5 W;  3C1C A;  3B0C T;  3LZ1 B;  3KUY A;  4XUJ D;  2NZD D;  4YM6 A;  4E44 A;  5BNV A;  1HQ3 B;  5G49 A;  1A7W A;  3WAA B;  1H3O A;  2F8N A;  1BH8 B;  1M1A B;  3AZJ D;  5E5A A;  1P3P D;  5B33 D;  4R8P B;  5B1M C;  3KXB D;  5B2J D;  3MVD C;  3V9R A;  3REL B;  3WTP B;  4XUJ C;  3REJ D;  3UTA B;  2YFV B;  1S32 D;  2HIO A;  5B24 A;  4HGA B;  5BNX B;  4KGC B;  3REK D;  1JFI A;  5GXQ C;  5AV5 A;  5GT0 B;  5AV9 D;  3O62 C;  2FJ7 D;  5B33 C;  3KXB C;  3LZ0 A;  5B2J C;  4UUZ B;  1P3G B;  1P3B D;  3B6G B;  3REJ C;  3X1V C;  1BFM A;  3AZF B;  1S32 C;  5CPJ B;  3VH6 A;  4WV4 B;  5CPI D;  4CSR B;  3REK C;  4Z5T A;  3B6F D;  5AV9 C;  2FJ7 C;  3X1T D;  5JA4 B;  3VH5 T;  4ZBJ C;  2L5A A;  5B0Y B;  4LD9 B;  5GT3 B;  5AV6 D;  4WU8 B;  1P3K D;  2BYM B;  1P3I D;  3AZH B;  5B1M B;  5C3I B;  5GXQ A;  4J8V D;  3O62 A;  3AZM D;  5CPI C;  4XUJ B;  4H9R B;  1WWS A;  4CAY B;  5B33 A;  3AZE A;  3WTP E;  3KXB A;  5B2J A;  3B6F C;  2NZD B;  4J8W D;  3X1T C;  4EO5 B;  3X1V A;  1S32 A;  5B32 A;  1ULY A;  5AVB B;  5AV6 C;  3AZJ B;  1P3K C;  1P3P B;  1P3I C;  4J8V C;  5GSU D;  5F99 C;  3C1B C;  5AV8 D;  3AZM C;  4XZQ B;  3WKJ A;  3AZI A;  3KWQ C;  4J8W C;  1ZLA A;  4H9N A;  3REK B;  1KX3 C;  4NFT A;  4J8U C;  1P3A D;  2PYO D;  1EQZ C;  3AV2 B;  1BH9 B;  2YFW B;  5GSU C;  4JJN C;  5AV8 C;  1P3B B;  3R45 B;  3W98 D;  3A6N D;  1Q9C A;  1TZY A;  2NQB D;  5DNN B;  5AV6 A;  1P3M D;  4X23 B;  1U35 D;  2PYO C;  4AWL C;  1P3I A;  4J8V A;  3LZ1 D;  3X1U D;  5F99 A;  3B6F B;  3C1B A;  3AZM A;  3LJA B;  1B67 A;  3AFA D;  3KWQ A;  3B0D B;  3WAA D;  4YS3 B;  1P3K B;  4H9P B;  3W98 C;  3A6N C;  1KX3 A;  1KU5 A;  4J8U A;  1EQZ A;  1P3M C;  1U35 C;  5FUG A;  1KX5 A;  5GSU A;  3LZ1 C;  3X1U C;  4JJN A;  3REL D;  4WU9 D;  1P3O A;  3REI D;  4H9Q B;  1P3L B;  3WAA C;  4KGC D;  1M19 B;  5GT0 D;  3AN2 A;  2PYO A;  5B1L A;  5AV8 B;  1P34 B;  3REL C;  4WU9 C;  3W96 A;  1P3F A;  3W98 A;  1P3A B;  3W97 B;  4KGC C;  5GT0 C;  3MGR A;  2BYK B;  4QLC D;  3AZG B;  5B0Y D;  5B2I B;  3A6N B;  5GT3 D;  1P3G C;  4WU8 D;  1HQ3 A;  3AZN A;  5B0Z B;  2NQB B;  3WAA A;  1U35 B;  3AZH D;  1BH8 A;  1M1A A;  3MNN A;  3AYW D;  3X1U B;  3UTB B;  4R8P A;  4Z2M G;  3AFA B;  1TAF B;  3WTP A;  5B0Y C;  3UTA A;  3MGP D;  4Z66 A;  4LD9 C;  5AVB D;  5GT3 C;  4WU8 C;  4KGC A;  3AZH C;  2CV5 B;  5C3I C;  5GT0 A;  4XZQ D;  4KHA B;  4WU9 B;  2NZD C;  3REI B;  4UUZ A;  1P3G A;  4EO5 C;  3REH D;  3B6G A;  3MGQ A;  3AZF A;  3KSY A;  5JRG B;  5CPJ A;  5AVB C;  2HUE B;  5B40 D;  3AV2 D;  3AZJ C;  1P3P C;  4ZUX B;  5CP6 B;  2CWE A;  2IO5 C;  5JA4 A;  4XZQ C;  3C1C B;  5B0Y A;  4LD9 A;  1F1E A;  5DNN D;  4X23 D;  1F66 B;  2BYM A;  5BNV B;  5B1M A;  3MVD A;  5G49 B;  3AV2 C;  3LJA D;  4QLC B;  4XUJ A;  4H9R A;  4CAY A;  4J8X B;  2NZD A;  1P3B C;  4YS3 D;  3WA9 B;  5KDM B;  3B0B A;  3V9R B;  5DNN C;  4NE3 A;  3AYW B;  3AZJ A; 
#chains in the Genus database with same CATH topology
 2Y2G A;  4X23 C;  1P3P A;  4KUD B;  3P5J B;  3LJA C;  4XZQ A;  1JFI B;  3REJ A;  5AV5 B;  3MGS B;  3MGP B;  3KFU G;  3B0D C;  3NQU B;  1P3L D;  1WWI A;  3AV1 D;  2Y2N A;  4YS3 C;  3LZ0 B;  4UPK A;  1M19 D;  3REK A;  3AZK D;  3VH5 A;  2F8N K;  5AVC D;  5AV9 A;  2FJ7 A;  2IO5 B;  1BH9 A;  2YFW A;  1P34 D;  1P3B A;  5BS7 C;  3R45 A;  3REH B;  2ZY2 A;  3W97 D;  1P3L C;  5DNN A;  5B40 B;  3AV1 C;  3NQJ B;  4X23 A;  5CPI A;  1M19 C;  2Y2M A;  5AVC C;  3B6F A;  3AZG D;  3X1T A;  5B2I D;  1P34 C;  5B0Z D;  3AZE B;  1P3K A;  4E45 A;  4H9P A;  1P3A C;  3W97 C;  3UTB D;  2W8S A;  1KX4 D;  5B32 G;  5B32 B;  3TU4 B;  4J8W A;  3AZG C;  5B2I C;  4H9Q A;  2Y2O A;  2NQB C;  5B0Z C;  1AOI D;  5CPK D;  3H0L C;  2CV5 D;  3W99 B;  1N1J B;  5AV8 A;  4H9N B;  3UTB C;  3IP4 C;  4DQY B;  1KX4 C;  1ZLA B;  3AFA C;  1ID3 D;  3AV1 B;  5JRG D;  3UT9 D;  5B31 D;  3AZK B;  3W97 A;  2RIQ A;  1P3A A;  5AVC B;  4ZUX D;  5CP6 D;  3AZL D;  2CV5 C;  2BYK A;  3LEL D;  1M18 D;  4NE5 A;  3C1C D;  3REI C;  3A6N A;  1B6W A;  2NQB A;  5B0Z A;  2JE5 A;  5DNM B;  4YM6 D;  1ID3 C;  1P3M A;  1F66 D;  5JRG C;  1U35 A;  5B31 C;  3X1S B;  2HUE C;  2VQR A;  3LZ1 A;  3X1U A;  2F8N D;  4ZUX C;  5CP6 C;  4J8X D;  5AY8 B;  4G92 B;  3AFA A;  1M18 C;  1TAF A;  3C1C C;  3WA9 D;  5BO0 B;  1P3O B;  1F66 C;  5B24 D;  2LY8 A;  1KX4 B;  4KUD D;  4QLC C;  4KHA A;  3REL A;  5AV5 D;  3MGS D;  4J8X C;  2YFV A;  4WU9 A;  3REI A;  5BNX A;  3LZ0 D;  1AOI B;  5CPK B;  3WA9 C;  3AYW C;  2ARO B;  2RVQ D;  1P3F B;  5B24 C;  4KUD C;  4Z5T D;  1ID3 B;  5AV5 C;  4H9O B;  3MGS C;  3MGP C;  2F8N H;  5CHL B;  3MGR B;  3UT9 B;  5B31 G;  5BT1 D;  5B31 B;  3LZ0 C;  1F66 A;  4CSR A;  4WNN B;  3AZL B;  3AZN B;  4DRA A;  3LEL B;  2RVQ C;  4QLC A;  1M18 B;  5GXQ D;  3A1K A;  3MNN B;  4J8X A;  3O62 D;  2Y2P A;  3KUY B;  5GT3 A;  3F6T A;  4WU8 A;  3AZE D;  4Z5T C;  3REH C;  3VH6 T;  4YM6 B;  3WA9 A;  5KDM A;  3AZH A;  5BT1 C;  5B40 C;  3X1V D;  1H3O B;  3AYW A;  4Z66 B;  2F8N B;  2F8N G;  5B32 D;  4KUD A;  3TU4 D;  5E5A B;  3MGS A;  3MGP A;  3NQU A;  5AVB A;  3WKJ D;  3AZE C;  3AZI D;  3W99 D;  2HIO B;  5B24 B;  3MGQ B;  1ZLA D;  3EPJ A;  5B32 C;  2Y2I A;  3TU4 C;  3REH A;  2DF4 C;  3WKJ C;  5B40 A;  3AZI C;  3AV2 A;  1TZY D;  3NQJ A;  3W99 C;  2Y2K A;  1ZLA C;  4Z5T B;  3MVD B;  5F99 D;  3C1B D;  5DNM D;  3KWQ D;  3X1S D;  3AZK C;  1TZY C;  3LJA A;  4J8U D;  1KX3 D;  5AY8 D;  5GXQ B;  1EQZ D;  3O62 B;  3TU4 A;  1KX5 D;  5B33 B;  4YS3 A;  3KXB B;  5B2J B;  4JJN D;  5DNM C;  1P3O D;  3REJ B;  3X1V B;  1S32 B;  3X1S C;  1N1J A;  3W99 A;  4NE6 A;  3AN2 D;  5AY8 C;  5BS7 A;  5AV9 B;  4G92 C;  5B1L D;  2FJ7 B;  3WKJ B;  1P3L A;  1KX5 C;  4ZBJ B;  3AZI B;  3AV1 A;  2Y2H A;  2ZM5 A;  1M19 A;  3AZK A;  1P3O C;  3W96 D;  5AVC A;  2ARO D;  1P3F D;  4G91 C;  4H9S C;  3A1I A;  1P34 A;  5CPI B;  3AN2 C;  4M6B A;  3MGR D;  5B1L C;  3X1T B;  2F2A C;  5DNM A;  1R4V A;  5CPK C;  1AOI C;  1TZY B;  1HQ3 D;  2JSS A;  3X1S A;  3AZN D;  1HTA A;  5AV6 B;  3B0C W;  2ARO C;  3H0R C;  3W96 C;  1P3F C;  3AZG A;  1M1A D;  5B2I A;  3MNN D;  1P3I B;  5AY8 A;  4J8V B;  3KUY D;  5F99 B;  2ZY4 A;  3C1B B;  2DQN C;  3AZM B;  4R8P D;  3MGR C;  3UT9 C;  3KWQ B;  2ZY3 A;  4J8W B;  5BO0 A;  3WTP D;  3UTA D;  4Z66 D;  3UTB A;  1KX3 B;  3AZL C;  4J8U B;  1KX4 A;  1HQ3 C;  4H9S A;  3AZN C;  3VH6 W;  5E5A D;  1EQZ B;  3LEL C;  5FUG B;  4WZS B;  1M1A C;  1KX5 B;  3MNN C;  5GSU B;  3KUY C;  4JJN B;  4R8P C;  1AOI A;  4YM6 C;  5CPK A;  2HIO D;  4G91 B;  2CV5 A;  1P3G D;  3B6G D;  3WTP C;  3MGQ D;  3UTA C;  2G5H C;  4Z66 C;  3AZF D;  2ARO A;  4DRB A;  2BG1 A;  5CPJ D;  3AN2 B;  2PYO B;  4AWL B;  4HGA C;  4Z2M H;  5E5A C;  5B1L B;  2Y2J A;  2Y2Q A;  1ID3 A;  4H9O A;  5JRG A;  3UT9 A;  5B31 A;  3EPL A;  3W96 B;  3W98 B;  4LD9 D;  2HIO C;  4ZUX A;  4WNN A;  5CP6 A;  3AZL A;  3B6G C;  3MGQ C;  3AZF C;  1P3M B;  3LEL A;  1M18 A;  5CPJ C;  5B1M D;  3MVD D;  3VH5 W;  3C1C A;  3B0C T;  3LZ1 B;  3KUY A;  4XUJ D;  2NZD D;  4YM6 A;  4E44 A;  5BNV A;  1HQ3 B;  5G49 A;  1A7W A;  3WAA B;  1H3O A;  2F8N A;  1BH8 B;  1M1A B;  3AZJ D;  5E5A A;  1P3P D;  5B33 D;  4R8P B;  5B1M C;  3KXB D;  5B2J D;  3MVD C;  3V9R A;  3REL B;  3WTP B;  4XUJ C;  3REJ D;  3UTA B;  2YFV B;  1S32 D;  2HIO A;  5B24 A;  3EPH A;  4HGA B;  5BNX B;  4KGC B;  3REK D;  1JFI A;  5GXQ C;  5AV5 A;  5GT0 B;  5AV9 D;  3O62 C;  2FJ7 D;  5B33 C;  3KXB C;  3LZ0 A;  5B2J C;  4UUZ B;  1P3G B;  1P3B D;  3B6G B;  3REJ C;  3X1V C;  1BFM A;  3AZF B;  1S32 C;  5CPJ B;  3VH6 A;  4WV4 B;  5CPI D;  4CSR B;  3REK C;  4Z5T A;  3B6F D;  5AV9 C;  2FJ7 C;  3X1T D;  5JA4 B;  3VH5 T;  4ZBJ C;  2L5A A;  5B0Y B;  4LD9 B;  5GT3 B;  5AV6 D;  4WU8 B;  1P3K D;  2BYM B;  1P3I D;  3AZH B;  5B1M B;  5C3I B;  5GXQ A;  4J8V D;  3O62 A;  3AZM D;  5CPI C;  4XUJ B;  4H9R B;  1WWS A;  4CAY B;  5B33 A;  3AZE A;  3WTP E;  3KXB A;  5B2J A;  3B6F C;  2NZD B;  4J8W D;  3X1T C;  4EO5 B;  1PZR A;  4WJ3 C;  3X1V A;  1S32 A;  5B32 A;  1ULY A;  5AVB B;  5AV6 C;  3AZJ B;  1P3K C;  1P3P B;  2XD1 A;  1P3I C;  4J8V C;  5GSU D;  5F99 C;  3C1B C;  5AV8 D;  3AZM C;  4XZQ B;  3WKJ A;  3AZI A;  3KWQ C;  4J8W C;  2UWX A;  3EPK A;  1ZLA A;  4H9N A;  3REK B;  1KX3 C;  4NFT A;  4J8U C;  1P3A D;  2PYO D;  1EQZ C;  3AV2 B;  1BH9 B;  2YFW B;  5GSU C;  4JJN C;  5AV8 C;  1P3B B;  3R45 B;  3W98 D;  3A6N D;  1Q9C A;  1TZY A;  2NQB D;  5DNN B;  5AV6 A;  1P3M D;  4X23 B;  1U35 D;  2PYO C;  1T3U A;  4AWL C;  1P3I A;  4J8V A;  3LZ1 D;  3X1U D;  5F99 A;  3B6F B;  3C1B A;  3AZM A;  3LJA B;  1B67 A;  3AFA D;  3KWQ A;  3B0D B;  3WAA D;  4YS3 B;  1P3K B;  4H9P B;  3W98 C;  3A6N C;  1KX3 A;  1KU5 A;  4J8U A;  1EQZ A;  1P3M C;  1U35 C;  5FUG A;  1KX5 A;  5GSU A;  3LZ1 C;  3X1U C;  4JJN A;  2XD5 A;  3REL D;  4WU9 D;  1P3O A;  3REI D;  4H9Q B;  1P3L B;  3WAA C;  4KGC D;  1M19 B;  5GT0 D;  3AN2 A;  2PYO A;  5B1L A;  5AV8 B;  1P34 B;  3REL C;  4WU9 C;  3W96 A;  1P3F A;  3W98 A;  1P3A B;  3W97 B;  4KGC C;  5GT0 C;  3MGR A;  2BYK B;  4QLC D;  3AZG B;  5B0Y D;  5B2I B;  3A6N B;  5GT3 D;  3H0M C;  1P3G C;  4WU8 D;  1HQ3 A;  3AZN A;  5B0Z B;  2NQB B;  3WAA A;  1W2E A;  1U35 B;  3AZH D;  1BH8 A;  1M1A A;  3MNN A;  3AYW D;  2JCH A;  3X1U B;  3UTB B;  4R8P A;  4Z2M G;  3AFA B;  1TAF B;  3WTP A;  5B0Y C;  3UTA A;  3MGP D;  4Z66 A;  4LD9 C;  3AL0 C;  5AVB D;  5GT3 C;  4WU8 C;  4KGC A;  3AZH C;  2CV5 B;  5C3I C;  5GT0 A;  4XZQ D;  4KHA B;  2G5I C;  3EG5 B;  4WU9 B;  2NZD C;  3REI B;  4UUZ A;  1P3G A;  4EO5 C;  3REH D;  3B6G A;  3MGQ A;  3AZF A;  3KSY A;  5JRG B;  5CPJ A;  5AVB C;  2HUE B;  5B40 D;  3AV2 D;  3AZJ C;  1P3P C;  2Y2L A;  4ZUX B;  2J8P A;  2CWE A;  5CP6 B;  1Z2C B;  2IO5 C;  5JA4 A;  4XZQ C;  3C1C B;  5B0Y A;  2FFF B;  4LD9 A;  1F1E A;  5DNN D;  4X23 D;  1F66 B;  2BYM A;  5BNV B;  3FDD A;  5B1M A;  3MVD A;  5G49 B;  3AV2 C;  3LJA D;  4QLC B;  4XUJ A;  4H9R A;  4CAY A;  4J8X B;  2NZD A;  1P3B C;  4YS3 D;  2ZY5 A;  3WA9 B;  5KDM B;  3B0B A;  3V9R B;  5DNN C;  4NE3 A;  3AYW B;  3AZJ A; 
#chains in the Genus database with same CATH homology
 2Y2G A;  4X23 C;  1P3P A;  4KUD B;  3P5J B;  3LJA C;  4XZQ A;  1JFI B;  3REJ A;  5AV5 B;  3MGS B;  3MGP B;  3KFU G;  3B0D C;  3NQU B;  1P3L D;  1WWI A;  3AV1 D;  2Y2N A;  4YS3 C;  3LZ0 B;  4UPK A;  1M19 D;  3REK A;  3AZK D;  3VH5 A;  2F8N K;  5AVC D;  5AV9 A;  2FJ7 A;  2IO5 B;  1BH9 A;  2YFW A;  1P34 D;  1P3B A;  5BS7 C;  3R45 A;  3REH B;  2ZY2 A;  3W97 D;  1P3L C;  5DNN A;  5B40 B;  3AV1 C;  3NQJ B;  4X23 A;  5CPI A;  1M19 C;  2Y2M A;  5AVC C;  3B6F A;  3AZG D;  3X1T A;  5B2I D;  1P34 C;  5B0Z D;  3AZE B;  1P3K A;  4E45 A;  4H9P A;  1P3A C;  3W97 C;  3UTB D;  2W8S A;  1KX4 D;  5B32 G;  5B32 B;  3TU4 B;  4J8W A;  3AZG C;  5B2I C;  4H9Q A;  2Y2O A;  2NQB C;  5B0Z C;  1AOI D;  5CPK D;  3H0L C;  2CV5 D;  3W99 B;  1N1J B;  5AV8 A;  4H9N B;  3UTB C;  3IP4 C;  4DQY B;  1KX4 C;  1ZLA B;  3AFA C;  1ID3 D;  3AV1 B;  5JRG D;  3UT9 D;  5B31 D;  3AZK B;  3W97 A;  2RIQ A;  1P3A A;  5AVC B;  4ZUX D;  5CP6 D;  3AZL D;  2CV5 C;  2BYK A;  3LEL D;  1M18 D;  4NE5 A;  3C1C D;  3REI C;  3A6N A;  1B6W A;  2NQB A;  5B0Z A;  2JE5 A;  5DNM B;  4YM6 D;  1ID3 C;  1P3M A;  1F66 D;  5JRG C;  1U35 A;  5B31 C;  3X1S B;  2HUE C;  2VQR A;  3LZ1 A;  3X1U A;  2F8N D;  4ZUX C;  5CP6 C;  4J8X D;  5AY8 B;  4G92 B;  3AFA A;  1M18 C;  1TAF A;  3C1C C;  3WA9 D;  5BO0 B;  1P3O B;  1F66 C;  5B24 D;  2LY8 A;  1KX4 B;  4KUD D;  4QLC C;  4KHA A;  3REL A;  5AV5 D;  3MGS D;  4J8X C;  2YFV A;  4WU9 A;  3REI A;  5BNX A;  3LZ0 D;  1AOI B;  5CPK B;  3WA9 C;  3AYW C;  2ARO B;  2RVQ D;  1P3F B;  5B24 C;  4KUD C;  4Z5T D;  1ID3 B;  5AV5 C;  4H9O B;  3MGS C;  3MGP C;  2F8N H;  5CHL B;  3MGR B;  3UT9 B;  5B31 G;  5BT1 D;  5B31 B;  3LZ0 C;  1F66 A;  4CSR A;  4WNN B;  3AZL B;  3AZN B;  4DRA A;  3LEL B;  2RVQ C;  4QLC A;  1M18 B;  5GXQ D;  3A1K A;  3MNN B;  4J8X A;  3O62 D;  2Y2P A;  3KUY B;  5GT3 A;  3F6T A;  4WU8 A;  3AZE D;  4Z5T C;  3REH C;  3VH6 T;  4YM6 B;  3WA9 A;  5KDM A;  3AZH A;  5BT1 C;  5B40 C;  3X1V D;  1H3O B;  3AYW A;  4Z66 B;  2F8N B;  2F8N G;  5B32 D;  4KUD A;  3TU4 D;  5E5A B;  3MGS A;  3MGP A;  3NQU A;  5AVB A;  3WKJ D;  3AZE C;  3AZI D;  3W99 D;  2HIO B;  5B24 B;  3MGQ B;  1ZLA D;  3EPJ A;  5B32 C;  2Y2I A;  3TU4 C;  3REH A;  2DF4 C;  3WKJ C;  5B40 A;  3AZI C;  3AV2 A;  1TZY D;  3NQJ A;  3W99 C;  2Y2K A;  1ZLA C;  4Z5T B;  3MVD B;  5F99 D;  3C1B D;  5DNM D;  3KWQ D;  3X1S D;  3AZK C;  1TZY C;  3LJA A;  4J8U D;  1KX3 D;  5AY8 D;  5GXQ B;  1EQZ D;  3O62 B;  3TU4 A;  1KX5 D;  5B33 B;  4YS3 A;  3KXB B;  5B2J B;  4JJN D;  5DNM C;  1P3O D;  3REJ B;  3X1V B;  1S32 B;  3X1S C;  1N1J A;  3W99 A;  4NE6 A;  3AN2 D;  5AY8 C;  5BS7 A;  5AV9 B;  4G92 C;  5B1L D;  2FJ7 B;  3WKJ B;  1P3L A;  1KX5 C;  4ZBJ B;  3AZI B;  3AV1 A;  2Y2H A;  2ZM5 A;  1M19 A;  3AZK A;  1P3O C;  3W96 D;  5AVC A;  2ARO D;  1P3F D;  4G91 C;  4H9S C;  3A1I A;  1P34 A;  5CPI B;  3AN2 C;  4M6B A;  3MGR D;  5B1L C;  3X1T B;  2F2A C;  5DNM A;  1R4V A;  5CPK C;  1AOI C;  1TZY B;  1HQ3 D;  2JSS A;  3X1S A;  3AZN D;  1HTA A;  5AV6 B;  3B0C W;  2ARO C;  3H0R C;  3W96 C;  1P3F C;  3AZG A;  1M1A D;  5B2I A;  3MNN D;  1P3I B;  5AY8 A;  4J8V B;  3KUY D;  5F99 B;  2ZY4 A;  3C1B B;  2DQN C;  3AZM B;  4R8P D;  3MGR C;  3UT9 C;  3KWQ B;  2ZY3 A;  4J8W B;  5BO0 A;  3WTP D;  3UTA D;  4Z66 D;  3UTB A;  1KX3 B;  3AZL C;  4J8U B;  1KX4 A;  1HQ3 C;  4H9S A;  3AZN C;  3VH6 W;  5E5A D;  1EQZ B;  3LEL C;  5FUG B;  4WZS B;  1M1A C;  1KX5 B;  3MNN C;  5GSU B;  3KUY C;  4JJN B;  4R8P C;  1AOI A;  4YM6 C;  5CPK A;  2HIO D;  4G91 B;  2CV5 A;  1P3G D;  3B6G D;  3WTP C;  3MGQ D;  3UTA C;  2G5H C;  4Z66 C;  3AZF D;  2ARO A;  4DRB A;  2BG1 A;  5CPJ D;  3AN2 B;  2PYO B;  4AWL B;  4HGA C;  4Z2M H;  5E5A C;  5B1L B;  2Y2J A;  2Y2Q A;  1ID3 A;  4H9O A;  5JRG A;  3UT9 A;  5B31 A;  3EPL A;  3W96 B;  3W98 B;  4LD9 D;  2HIO C;  4ZUX A;  4WNN A;  5CP6 A;  3AZL A;  3B6G C;  3MGQ C;  3AZF C;  1P3M B;  3LEL A;  1M18 A;  5CPJ C;  5B1M D;  3MVD D;  3VH5 W;  3C1C A;  3B0C T;  3LZ1 B;  3KUY A;  4XUJ D;  2NZD D;  4YM6 A;  4E44 A;  5BNV A;  1HQ3 B;  5G49 A;  1A7W A;  3WAA B;  1H3O A;  2F8N A;  1BH8 B;  1M1A B;  3AZJ D;  5E5A A;  1P3P D;  5B33 D;  4R8P B;  5B1M C;  3KXB D;  5B2J D;  3MVD C;  3V9R A;  3REL B;  3WTP B;  4XUJ C;  3REJ D;  3UTA B;  2YFV B;  1S32 D;  2HIO A;  5B24 A;  3EPH A;  4HGA B;  5BNX B;  4KGC B;  3REK D;  1JFI A;  5GXQ C;  5AV5 A;  5GT0 B;  5AV9 D;  3O62 C;  2FJ7 D;  5B33 C;  3KXB C;  3LZ0 A;  5B2J C;  4UUZ B;  1P3G B;  1P3B D;  3B6G B;  3REJ C;  3X1V C;  1BFM A;  3AZF B;  1S32 C;  5CPJ B;  3VH6 A;  4WV4 B;  5CPI D;  4CSR B;  3REK C;  4Z5T A;  3B6F D;  5AV9 C;  2FJ7 C;  3X1T D;  5JA4 B;  3VH5 T;  4ZBJ C;  2L5A A;  5B0Y B;  4LD9 B;  5GT3 B;  5AV6 D;  4WU8 B;  1P3K D;  2BYM B;  1P3I D;  3AZH B;  5B1M B;  5C3I B;  5GXQ A;  4J8V D;  3O62 A;  3AZM D;  5CPI C;  4XUJ B;  4H9R B;  1WWS A;  4CAY B;  5B33 A;  3AZE A;  3WTP E;  3KXB A;  5B2J A;  3B6F C;  2NZD B;  4J8W D;  3X1T C;  4EO5 B;  1PZR A;  4WJ3 C;  3X1V A;  1S32 A;  5B32 A;  1ULY A;  5AVB B;  5AV6 C;  3AZJ B;  1P3K C;  1P3P B;  2XD1 A;  1P3I C;  4J8V C;  5GSU D;  5F99 C;  3C1B C;  5AV8 D;  3AZM C;  4XZQ B;  3WKJ A;  3AZI A;  3KWQ C;  4J8W C;  2UWX A;  3EPK A;  1ZLA A;  4H9N A;  3REK B;  1KX3 C;  4NFT A;  4J8U C;  1P3A D;  2PYO D;  1EQZ C;  3AV2 B;  1BH9 B;  2YFW B;  5GSU C;  4JJN C;  5AV8 C;  1P3B B;  3R45 B;  3W98 D;  3A6N D;  1Q9C A;  1TZY A;  2NQB D;  5DNN B;  5AV6 A;  1P3M D;  4X23 B;  1U35 D;  2PYO C;  1T3U A;  4AWL C;  1P3I A;  4J8V A;  3LZ1 D;  3X1U D;  5F99 A;  3B6F B;  3C1B A;  3AZM A;  3LJA B;  1B67 A;  3AFA D;  3KWQ A;  3B0D B;  3WAA D;  4YS3 B;  1P3K B;  4H9P B;  3W98 C;  3A6N C;  1KX3 A;  1KU5 A;  4J8U A;  1EQZ A;  1P3M C;  1U35 C;  5FUG A;  1KX5 A;  5GSU A;  3LZ1 C;  3X1U C;  4JJN A;  2XD5 A;  3REL D;  4WU9 D;  1P3O A;  3REI D;  4H9Q B;  1P3L B;  3WAA C;  4KGC D;  1M19 B;  5GT0 D;  3AN2 A;  2PYO A;  5B1L A;  5AV8 B;  1P34 B;  3REL C;  4WU9 C;  3W96 A;  1P3F A;  3W98 A;  1P3A B;  3W97 B;  4KGC C;  5GT0 C;  3MGR A;  2BYK B;  4QLC D;  3AZG B;  5B0Y D;  5B2I B;  3A6N B;  5GT3 D;  3H0M C;  1P3G C;  4WU8 D;  1HQ3 A;  3AZN A;  5B0Z B;  2NQB B;  3WAA A;  1W2E A;  1U35 B;  3AZH D;  1BH8 A;  1M1A A;  3MNN A;  3AYW D;  2JCH A;  3X1U B;  3UTB B;  4R8P A;  4Z2M G;  3AFA B;  1TAF B;  3WTP A;  5B0Y C;  3UTA A;  3MGP D;  4Z66 A;  4LD9 C;  3AL0 C;  5AVB D;  5GT3 C;  4WU8 C;  4KGC A;  3AZH C;  2CV5 B;  5C3I C;  5GT0 A;  4XZQ D;  4KHA B;  2G5I C;  3EG5 B;  4WU9 B;  2NZD C;  3REI B;  4UUZ A;  1P3G A;  4EO5 C;  3REH D;  3B6G A;  3MGQ A;  3AZF A;  3KSY A;  5JRG B;  5CPJ A;  5AVB C;  2HUE B;  5B40 D;  3AV2 D;  3AZJ C;  1P3P C;  2Y2L A;  4ZUX B;  2J8P A;  2CWE A;  5CP6 B;  1Z2C B;  2IO5 C;  5JA4 A;  4XZQ C;  3C1C B;  5B0Y A;  2FFF B;  4LD9 A;  1F1E A;  5DNN D;  4X23 D;  1F66 B;  2BYM A;  5BNV B;  3FDD A;  5B1M A;  3MVD A;  5G49 B;  3AV2 C;  3LJA D;  4QLC B;  4XUJ A;  4H9R A;  4CAY A;  4J8X B;  2NZD A;  1P3B C;  4YS3 D;  2ZY5 A;  3WA9 B;  5KDM B;  3B0B A;  3V9R B;  5DNN C;  4NE3 A;  3AYW B;  3AZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...