3X1SB

Crystal structure of the nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1sB00
3AZFB 1P3GC 5GXQB 1P3GA 2NQBD 3LZ1A 3MGRC 3VH6A 3UTAC 3NQUB 3AV2B 5B32G 5GSUD 3AV1D 1U35C 5E5AD 1U35A 1P3LD 4HGAB 2FJ7C 2FJ7A 3AZIC 1P3MA 4YM6B 3MNNB 3WKJA 4Z2MH 1TAFB 5CP6A 5DNNB 3AFAA 3AZLC 5AVCB 4KHAB 3LZ1D 3AZLA 1P3GD 1M19B 3MGRD 4XZQC 5JRGC 5JRGA 1M18B 3W99B 1U35D 3W98B 2FJ7D 1P3MD 5B31B 5AV6C 5AV6A 4J8XB 1B67A 3WKJD 4X23B 3X1TB 3B6GC 5GT0A 3AZLD 3WTPE 5B24C 5B24A 1BH9B 3UT9C 3REJA 3UT9A 5JRGD 5CPKC 5AVBA 3RELB 1BH8A 3X1UB 5AV6D 4R8PC 4H9QA 4R8PA 4Z5TC 1P3KB 4Z5TA 5GT0D 5B2IC 5B2IA 5B24D 1P3BA 3REKB 1P3AC 4QLCB 5JA4A 3REJD 3UT9D 3AN2A 5GT3C 5CPKD 1HQ3C 5AVBD 1P3IB 3MVDA 4E44A 5AY8B 5B0YB 5B0ZC 5B0ZA 4R8PD 3W97C 4Z5TD 3UTBB 5B1MA 4LD9B 1P3PB 5B2ID 4YS3B 3B0DB 3WAAC 4DRAA 1P3BD 1P3AD 3AZFA 5GXQA 3KWQC 3X1SB 5B1LC 5B1LA 3TU4B 3MVDD 3AV2C 3NQUA 3AV2A 2BYKB 5B0ZD 4H9RB 4YM6A 5CPJB 3W97D 5B1MD 3MNNA 4H9OA 4AWLB 3AZFD 5DNNA 5GXQD 5AVCA 4KHAA 3KWQD 4KGCB 3B6FB 2RVQD 2NZDC 5B1LD 3AV2D 1M18A 4H9PB 3W99C 3LJAC 3W99A 3W98A 5B31A 4YM6D 3R45B 4H9NB 4X23C 3MNND 4X23A 3X1TA 5BNXB 5DNND 3AZMC 5AVCD 4G91C 1P3OB 3AZJC 1BH9A 5AV5C 3AZJA 2NZDD 5KDMB 1M18D 3W99D 3W98D 3LELB 3X1UA 5B31D 2HIOC 3MGPB 2HIOA 4X23D 3X1TD 1ULYA 4E45A 3AZMD 5AV8B 3REKA 3AZJD 4QLCA 3WTPC 1P3IC 1P3IA 5B2JB 1TZYC 3REIB 4ZBJB 5AY8A 3X1UD 4KUDB 3AZKB 2HIOD 4J8VC 3UTBA 1P3PC 1JFIB 1P3PA 4LD9A 4YS3A 5AV9B 3LZ0C 3REKD 3O62B 4QLCD 1KX3C 1P3ID 3AYWC 3X1SA 3TU4A 2BYKA 2PYOC 3WA9B 2PYOA 5F99B 2YFWA 4EO5B 4Z66B 3AZNB 3UTBD 5GSUC 1F66B 1P3PD 4G92C 4YS3D 4LD9D 1KX4B 1P3LC 3LZ0D 3AZGB 4ZUXB 4KGCA 1KX3D 4J8UB 5BT1D 5B33B 3AYWD 1M1AB 3TU4D 3LZ1C 2PYOD 4DRBA 2LY8A 3C1BB 5B40B 3R45A 4H9NA 3VH6W 3MGSB 1P3MC 4NFTA 3WKJC 2HUEC 5CP6C 3AFAC 3MGQB 1KX5B 3LELA 1N1JB 4NE3A 5CPIB 3AZEB 5G49B 2IO5C 5GT0C 1Q9CA 5CP6D 3A6NB 5B2JC 3AFAD 5B2JA 3W96B 5B32B 3REIA 3REJC 2BYMB 3LELD 5AVBC 3AZHB 3REHB 2L5AA 5AV9A 5FUGB 3KXBB 3O62A 4WU8B 1S32B 5B2JD 3KUYB 1P3BC 4CSRB 1H3OB 3AN2C 3WA9A 5F99A 4Z66A 4CAYA 3AZNA 3MVDC 1F66A 1KX4A 2F8NG 1B6WA 1WWIA 3AZGA 1P3FB 5B1MC 5C3IB 4J8UA 5B33A 3AZFC 5GXQC 3AN2D 2CV5B 3WA9D 1HTAA 2RVQC 5F99D 3C1CB 1EQZB 3C1BA 2AROB 4Z66D 3B0BA 5B40C 5B40A 4HGAC 3AZGD 4YM6C 3MNNC 1AOIB 5B33D 4WZSB 1TAFA 5DNNC 3MGQA 1F1EA 5AVCC 1KX5A 1M19C 5DNMB 1M19A 3C1BD 5BNVB 5B40D 1M18C 4NE6A 1N1JA 4WU9B 3W98C 2YFVB 4Z2MG 3X1VB 5B31C 4UUZB 4J8XC 4J8XA 4XUJB 3AZEA 3X1TC 5G49A 3W96A 1ID3B 1KX5D 2NQBB 1M19D 2BYMA 3RELC 3AZHA 3RELA 4JJNB 3AV1B 5E5AB 3X1UC 3NQJB 1R4VA 1ZLAB 5FUGA 3KXBA 4J8XD 1BFMA 4WU8C 3AZED 4WU8A 1P3KC 1S32A 1P3KA 3W96D 1P3GB 3VH5A 3REKC 3VH6T 4CSRA 1H3OA 4QLCC 3MGRB 3VH5W 3UTAB 3RELD 1U35B 5AY8C 2FJ7B 5B0YC 4J8WB 5B0YA 3AZIB 4WU8D 1S32D 1P3KD 1P3FA 3UTBC 4LD9C 4YS3C 3AZLB 3B0DC 4XZQB 5JRGB 1EQZA 5BT1C 3X1SC 2AROA 3TU4C 1KU5A 5AY8D 5B0YD 5AV6B 4H9RA 3B0CT 3B6GB 5CPJC 1P3FD 5CPJA 1AOIA 5B24B 4AWLC 3UT9B 4KGCC 3B6FC 3B6FA 5CPKB 1EQZD 4WNNB 5DNMA 5BNVA 3X1SD 2AROD 4H9PA 2YFVA 3X1VA 4R8PB 4UUZA 4Z5TB 5CPJD 1AOID 4XUJA 5B2IB 2F8NH 4NE5A 1ID3A 1P3AB 5BNXA 4KGCD 1P3OC 5GT3B 1P3OA 3B6FD 5DNMD 1HQ3B 5KDMA 4JJNA 3AV1A 3LELC 3X1VD 1ZLAC 3NQJA 1ZLAA 3MGPC 3W97B 3MGPA 4XUJD 3WAAB 1ID3D 5B31G 3V9RB 5AV8C 3KWQB 5AV8A 1P3OD 3MGRA 5B1LB 3UTAA 4JJND 3B0CW 3REIC 4ZBJC 4KUDC 4J8WC 4KUDA 4J8WA 3AZIA 3AZKC 3KSYA 3MGPD 3AZKA 1ZLAD 4H9OB 1JFIA 1A7WA 5AV9C 5AV8D 3O62C 2NZDB 4XZQA 3UTAD 3LJAB 3REID 1P34B 2CWEA 2F8NK 4J8WD 3AZID 3WA9C 5F99C 3AZKD 4KUDD 4EO5C 4Z66C 3AZNC 3B6GA 1F66C 1KX4C 3AZMB 4G91B 5AV9D 4M6BA 3O62D 5AV5B 3AZJB 3AZGC 4ZUXC 4XZQD 4ZUXA 5CPKA 4WNNA 4J8UC 5B33C 1M1AC 1M1AA 5BO0B 2HIOB 3C1BC 3AZND 3B6GD 1F66D 3VH5T 1KX4D 3MGSC 1P3AA 3MGSA 4ZUXD 3WTPB 5GT3A 1HQ3A 4J8UD 1M1AD 1TZYB 3MGQC 1KX5C 4J8VB 2F8NB 3W97A 4H9SC 5CPIC 4H9SA 3LZ0B 5CPIA 3WAAA 3MGSD 3V9RA 3KWQA 5GT3D 1KX3B 3AZEC 1HQ3D 3AYWB 3W96C 3A6NC 3MGQD 3A6NA 5B32C 5B32A 2PYOB 2YFWB 3AZHC 3REHC 3REHA 5GSUB 4G92B 3WAAD 5CPID 1P3LB 3KXBC 1S32C 2NZDA 3A6ND 3LZ1B 3LJAA 3KUYA 5B32D 3KUYC 1P34C 1P34A 3AZHD 3REHD 3AZMA 1P3MB 3KXBD 3WKJB 5AV5A 2HUEB 1P3FC 5C3IC 5CP6B 3AFAB 3LJAD 3KUYD 2CV5C 1P34D 2CV5A 5BO0A 1EQZC 3C1CC 3C1CA 2AROC 5AV5D 1AOIC 3WTPA 5GT0B 2IO5B 2JSSA 1TZYA 2CV5D 3REJB 5DNMC 5AVBB 3C1CD 4J8VA 2F8NA 1BH8B 4WU9C 4WU9A 5CHLB 3X1VC 3LZ0A 4H9QB 4WV4B 3WTPD 4XUJC 1KX3A 3AYWA 1P3BB 1ID3C 1TZYD 3AN2B 5JA4B 2NQBA 2NQBC 4J8VD 4CAYB 2F8ND 5BS7C 3MVDB 5BS7A 5GSUA 1WWSA 4JJNC 4WU9D 3AV1C 5E5AC 5E5AA 5B0ZB 1P3LA 5B1MB
chains in the Genus database with same CATH superfamily
3AZFB 1P3GC 5GXQB 1P3GA 2NQBD 3LZ1A 3MGRC 3VH6A 3UTAC 2JE5A 3NQUB 3AV2B 5B32G 5GSUD 3AV1D 1U35C 5E5AD 1U35A 1P3LD 4HGAB 2FJ7C 2FJ7A 3AZIC 1P3MA 4YM6B 3MNNB 3WKJA 4Z2MH 1TAFB 2VQRA 5CP6A 5DNNB 3AFAA 3AZLC 5AVCB 4KHAB 3LZ1D 3AZLA 1P3GD 2DF4C 1M19B 3MGRD 4XZQC 5JRGC 5JRGA 1M18B 3W99B 1U35D 3W98B 2FJ7D 1P3MD 5B31B 5AV6C 5AV6A 4J8XB 1B67A 3WKJD 4X23B 3X1TB 3B6GC 5GT0A 3AZLD 3WTPE 5B24C 5B24A 1BH9B 3UT9C 3REJA 3UT9A 5JRGD 5CPKC 5AVBA 3RELB 1BH8A 3X1UB 5AV6D 4R8PC 4H9QA 4R8PA 4Z5TC 2DQNC 2Y2KA 4Z5TA 1P3KB 5GT0D 5B2IC 5B2IA 5B24D 1P3BA 2Y2OA 3REKB 1P3AC 4QLCB 5JA4A 3REJD 3UT9D 3AN2A 5GT3C 5CPKD 1HQ3C 5AVBD 1P3IB 3FDDA 3MVDA 4E44A 5AY8B 2Y2HA 5B0YB 5B0ZC 5B0ZA 4R8PD 3P5JB 3W97C 4Z5TD 3UTBB 5B1MA 4LD9B 1P3PB 5B2ID 4YS3B 3B0DB 3WAAC 4DRAA 1P3BD 1P3AD 3AZFA 5GXQA 3KWQC 2FFFB 3X1SB 5B1LC 5B1LA 3TU4B 3MVDD 3AV2C 3NQUA 3AV2A 2XD1A 2BYKB 5B0ZD 4H9RB 4YM6A 2RIQA 5CPJB 3W97D 5B1MD 3MNNA 4H9OA 4AWLB 3AZFD 5DNNA 5GXQD 5AVCA 4KHAA 3KWQD 4KGCB 3B6FB 2RVQD 2NZDC 2ZM5A 5B1LD 3AV2D 1M18A 4H9PB 3W99C 3LJAC 3W99A 3W98A 5B31A 4YM6D 3R45B 4H9NB 4X23C 3MNND 4X23A 2ZY2A 3EPJA 3X1TA 5BNXB 5DNND 3AZMC 5AVCD 4G91C 1P3OB 3AZJC 1BH9A 5AV5C 3AZJA 2NZDD 5KDMB 1M18D 2Y2GA 3W99D 3KFUG 3W98D 3LELB 3X1UA 5B31D 2HIOC 3EG5B 2HIOA 3MGPB 4X23D 3X1TD 1ULYA 4E45A 3AZMD 5AV8B 3REKA 3AZJD 2BG1A 4QLCA 3WTPC 1P3IC 1P3IA 1PZRA 5B2JB 1TZYC 3REIB 4ZBJB 5AY8A 3X1UD 4KUDB 3AZKB 2HIOD 4J8VC 3UTBA 1P3PC 1JFIB 1P3PA 4LD9A 4YS3A 5AV9B 3LZ0C 3REKD 3O62B 4UPKA 4QLCD 2G5IC 1KX3C 1P3ID 3AYWC 3X1SA 3TU4A 2BYKA 2PYOC 3WA9B 2PYOA 5F99B 2YFWA 4EO5B 4Z66B 3AZNB 3UTBD 5GSUC 1F66B 1P3PD 4G92C 4YS3D 4LD9D 1KX4B 1P3LC 3LZ0D 3AZGB 3A1KA 4ZUXB 4KGCA 1KX3D 4J8UB 5BT1D 5B33B 3AYWD 1M1AB 3TU4D 3LZ1C 2F2AC 2Y2LA 4DRBA 2PYOD 2LY8A 3C1BB 5B40B 3R45A 4H9NA 3VH6W 3MGSB 1P3MC 4NFTA 3WKJC 2HUEC 5CP6C 3AFAC 3MGQB 1KX5B 3H0LC 3H0MC 3LELA 2G5HC 1N1JB 4NE3A 5CPIB 2Y2NA 2ZY4A 3AZEB 5G49B 2IO5C 5GT0C 1Q9CA 5CP6D 3A6NB 5B2JC 3AFAD 5B2JA 3W96B 5B32B 3REIA 3REJC 2BYMB 3LELD 5AVBC 3AZHB 3REHB 2L5AA 5AV9A 5FUGB 3KXBB 3O62A 4WU8B 3EPKA 1S32B 2UWXA 2Y2MA 5B2JD 3KUYB 1P3BC 4CSRB 1H3OB 3AN2C 2Y2JA 3WA9A 5F99A 4Z66A 4CAYA 3AZNA 3MVDC 3IP4C 1F66A 1KX4A 2F8NG 1B6WA 1WWIA 3AZGA 1P3FB 5B1MC 5C3IB 4J8UA 5B33A 3AZFC 5GXQC 3AN2D 2CV5B 4DQYB 3WA9D 1HTAA 1T3UA 2RVQC 5F99D 3C1CB 3C1BA 1EQZB 2AROB 4Z66D 3B0BA 5B40C 1W2EA 5B40A 3EPHA 2J8PA 4HGAC 3AZGD 4YM6C 3MNNC 1AOIB 5B33D 4WZSB 1TAFA 5DNNC 3MGQA 1F1EA 5AVCC 1KX5A 1M19C 5DNMB 1M19A 3C1BD 5BNVB 5B40D 1M18C 4NE6A 1N1JA 4WU9B 3W98C 2YFVB 4Z2MG 3X1VB 5B31C 4UUZB 4J8XC 4J8XA 4XUJB 3AZEA 3X1TC 5G49A 3W96A 1ID3B 1KX5D 2NQBB 1M19D 2BYMA 2JCHA 3RELC 3AZHA 3RELA 4JJNB 3AV1B 5E5AB 3X1UC 3NQJB 1R4VA 1ZLAB 5FUGA 3KXBA 4J8XD 1BFMA 4WU8C 3AZED 4WU8A 1P3KC 1S32A 1P3KA 3W96D 1P3GB 3VH5A 3REKC 3VH6T 4CSRA 1H3OA 4QLCC 3MGRB 3VH5W 3UTAB 3RELD 1U35B 5AY8C 2FJ7B 5B0YC 4J8WB 5B0YA 3AZIB 4WU8D 1S32D 1P3KD 1P3FA 3UTBC 4LD9C 4YS3C 2ZY5A 3B0DC 3AZLB 2Y2PA 2Y2IA 4XZQB 5JRGB 1EQZA 5BT1C 3X1SC 2AROA 3TU4C 1KU5A 5AY8D 5B0YD 5AV6B 4H9RA 3B0CT 3B6GB 5CPJC 1P3FD 5CPJA 1AOIA 5B24B 4AWLC 3UT9B 4KGCC 3B6FC 3B6FA 5CPKB 1EQZD 4WNNB 5DNMA 5BNVA 2AROD 3X1SD 4H9PA 2YFVA 3X1VA 4R8PB 4UUZA 4Z5TB 5CPJD 1AOID 4XUJA 5B2IB 2F8NH 4NE5A 1ID3A 1P3AB 5BNXA 4KGCD 1P3OC 5GT3B 1P3OA 3B6FD 5DNMD 1HQ3B 5KDMA 4JJNA 3AV1A 4WJ3C 3H0RC 3LELC 3X1VD 1ZLAC 3NQJA 1ZLAA 3MGPC 3W97B 3MGPA 4XUJD 3WAAB 1ID3D 5B31G 3V9RB 5AV8C 3KWQB 5AV8A 1P3OD 3MGRA 5B1LB 3UTAA 4JJND 3B0CW 3REIC 4ZBJC 4KUDC 4J8WC 4KUDA 4J8WA 3AZIA 3AZKC 3KSYA 3MGPD 3AZKA 1ZLAD 4H9OB 1JFIA 1A7WA 5AV9C 5AV8D 3O62C 2NZDB 4XZQA 3UTAD 3LJAB 3REID 1P34B 2CWEA 2F8NK 4J8WD 3AZID 3WA9C 5F99C 3AZKD 4KUDD 4EO5C 4Z66C 3AZNC 3B6GA 1F66C 1KX4C 3AZMB 4G91B 5AV9D 4M6BA 3O62D 5AV5B 3AZJB 3AZGC 4ZUXC 4XZQD 4ZUXA 5CPKA 4WNNA 4J8UC 5B33C 1M1AC 1M1AA 5BO0B 3A1IA 2HIOB 3C1BC 3AZND 3B6GD 1F66D 3VH5T 1KX4D 3MGSC 1P3AA 3MGSA 4ZUXD 3WTPB 5GT3A 1HQ3A 4J8UD 2XD5A 1M1AD 1TZYB 3MGQC 1KX5C 4J8VB 2F8NB 3W97A 4H9SC 5CPIC 4H9SA 3LZ0B 5CPIA 3WAAA 3MGSD 3V9RA 3KWQA 5GT3D 1KX3B 3AZEC 1HQ3D 3AYWB 3W96C 3A6NC 3MGQD 3A6NA 5B32C 5B32A 2PYOB 2YFWB 3AZHC 3REHC 3REHA 5GSUB 4G92B 3WAAD 5CPID 1P3LB 3KXBC 1S32C 2NZDA 3A6ND 3LZ1B 3LJAA 3KUYA 5B32D 3KUYC 1P34C 1P34A 3AZHD 3REHD 3AZMA 1P3MB 3KXBD 3WKJB 5AV5A 2HUEB 1P3FC 2W8SA 5C3IC 5CP6B 3AFAB 3LJAD 3KUYD 2CV5C 1P34D 2CV5A 5BO0A 1EQZC 3C1CC 3C1CA 2AROC 2Y2QA 5AV5D 1AOIC 3WTPA 5GT0B 2IO5B 2JSSA 1TZYA 2CV5D 3REJB 5DNMC 5AVBB 3C1CD 4J8VA 2F8NA 1BH8B 4WU9C 4WU9A 5CHLB 3X1VC 1Z2CB 4H9QB 3LZ0A 3F6TA 4WV4B 3WTPD 4XUJC 1KX3A 3AYWA 1P3BB 1ID3C 1TZYD 2ZY3A 3AN2B 5JA4B 2NQBA 2NQBC 3AL0C 3EPLA 4J8VD 4CAYB 2F8ND 5BS7C 3MVDB 5BS7A 5GSUA 1WWSA 4JJNC 4WU9D 3AV1C 5E5AC 5E5AA 5B0ZB 1P3LA 5B1MB
chains in the Genus database with same CATH topology
3AZFB 1P3GC 5GXQB 1P3GA 2NQBD 3LZ1A 3MGRC 3VH6A 3UTAC 2JE5A 3NQUB 3AV2B 5B32G 5GSUD 3AV1D 1U35C 5E5AD 1U35A 1P3LD 4HGAB 2FJ7C 2FJ7A 3AZIC 1P3MA 4YM6B 3MNNB 3WKJA 4Z2MH 1TAFB 2VQRA 5CP6A 5DNNB 3AFAA 3AZLC 5AVCB 4KHAB 3LZ1D 3AZLA 1P3GD 2DF4C 1M19B 3MGRD 4XZQC 5JRGC 5JRGA 1M18B 3W99B 1U35D 3W98B 2FJ7D 1P3MD 5B31B 5AV6C 5AV6A 4J8XB 1B67A 3WKJD 4X23B 3X1TB 3B6GC 5GT0A 3AZLD 3WTPE 5B24C 5B24A 1BH9B 3UT9C 3REJA 3UT9A 5JRGD 5CPKC 5AVBA 3RELB 1BH8A 3X1UB 5AV6D 4R8PC 4H9QA 4R8PA 4Z5TC 2DQNC 2Y2KA 4Z5TA 1P3KB 5GT0D 5B2IC 5B2IA 5B24D 1P3BA 2Y2OA 3REKB 1P3AC 4QLCB 5JA4A 3REJD 3UT9D 3AN2A 5GT3C 5CPKD 1HQ3C 5AVBD 1P3IB 3FDDA 3MVDA 4E44A 5AY8B 2Y2HA 5B0YB 5B0ZC 5B0ZA 4R8PD 3P5JB 3W97C 4Z5TD 3UTBB 5B1MA 4LD9B 1P3PB 5B2ID 4YS3B 3B0DB 3WAAC 4DRAA 1P3BD 1P3AD 3AZFA 5GXQA 3KWQC 2FFFB 3X1SB 5B1LC 5B1LA 3TU4B 3MVDD 3AV2C 3NQUA 3AV2A 2XD1A 2BYKB 5B0ZD 4H9RB 4YM6A 2RIQA 5CPJB 3W97D 5B1MD 3MNNA 4H9OA 4AWLB 3AZFD 5DNNA 5GXQD 5AVCA 4KHAA 3KWQD 4KGCB 3B6FB 2RVQD 2NZDC 2ZM5A 5B1LD 3AV2D 1M18A 4H9PB 3W99C 3LJAC 3W99A 3W98A 5B31A 4YM6D 3R45B 4H9NB 4X23C 3MNND 4X23A 2ZY2A 3EPJA 3X1TA 5BNXB 5DNND 3AZMC 5AVCD 4G91C 1P3OB 3AZJC 1BH9A 5AV5C 3AZJA 2NZDD 5KDMB 1M18D 2Y2GA 3W99D 3KFUG 3W98D 3LELB 3X1UA 5B31D 2HIOC 3EG5B 2HIOA 3MGPB 4X23D 3X1TD 1ULYA 4E45A 3AZMD 5AV8B 3REKA 3AZJD 2BG1A 4QLCA 3WTPC 1P3IC 1P3IA 1PZRA 5B2JB 1TZYC 3REIB 4ZBJB 5AY8A 3X1UD 4KUDB 3AZKB 2HIOD 4J8VC 3UTBA 1P3PC 1JFIB 1P3PA 4LD9A 4YS3A 5AV9B 3LZ0C 3REKD 3O62B 4UPKA 4QLCD 2G5IC 1KX3C 1P3ID 3AYWC 3X1SA 3TU4A 2BYKA 2PYOC 3WA9B 2PYOA 5F99B 2YFWA 4EO5B 4Z66B 3AZNB 3UTBD 5GSUC 1F66B 1P3PD 4G92C 4YS3D 4LD9D 1KX4B 1P3LC 3LZ0D 3AZGB 3A1KA 4ZUXB 4KGCA 1KX3D 4J8UB 5BT1D 5B33B 3AYWD 1M1AB 3TU4D 3LZ1C 2F2AC 2Y2LA 4DRBA 2PYOD 2LY8A 3C1BB 5B40B 3R45A 4H9NA 3VH6W 3MGSB 1P3MC 4NFTA 3WKJC 2HUEC 5CP6C 3AFAC 3MGQB 1KX5B 3H0LC 3H0MC 3LELA 2G5HC 1N1JB 4NE3A 5CPIB 2Y2NA 2ZY4A 3AZEB 5G49B 2IO5C 5GT0C 1Q9CA 5CP6D 3A6NB 5B2JC 3AFAD 5B2JA 3W96B 5B32B 3REIA 3REJC 2BYMB 3LELD 5AVBC 3AZHB 3REHB 2L5AA 5AV9A 5FUGB 3KXBB 3O62A 4WU8B 3EPKA 1S32B 2UWXA 2Y2MA 5B2JD 3KUYB 1P3BC 4CSRB 1H3OB 3AN2C 2Y2JA 3WA9A 5F99A 4Z66A 4CAYA 3AZNA 3MVDC 3IP4C 1F66A 1KX4A 2F8NG 1B6WA 1WWIA 3AZGA 1P3FB 5B1MC 5C3IB 4J8UA 5B33A 3AZFC 5GXQC 3AN2D 2CV5B 4DQYB 3WA9D 1HTAA 1T3UA 2RVQC 5F99D 3C1CB 3C1BA 1EQZB 2AROB 4Z66D 3B0BA 5B40C 1W2EA 5B40A 3EPHA 2J8PA 4HGAC 3AZGD 4YM6C 3MNNC 1AOIB 5B33D 4WZSB 1TAFA 5DNNC 3MGQA 1F1EA 5AVCC 1KX5A 1M19C 5DNMB 1M19A 3C1BD 5BNVB 5B40D 1M18C 4NE6A 1N1JA 4WU9B 3W98C 2YFVB 4Z2MG 3X1VB 5B31C 4UUZB 4J8XC 4J8XA 4XUJB 3AZEA 3X1TC 5G49A 3W96A 1ID3B 1KX5D 2NQBB 1M19D 2BYMA 2JCHA 3RELC 3AZHA 3RELA 4JJNB 3AV1B 5E5AB 3X1UC 3NQJB 1R4VA 1ZLAB 5FUGA 3KXBA 4J8XD 1BFMA 4WU8C 3AZED 4WU8A 1P3KC 1S32A 1P3KA 3W96D 1P3GB 3VH5A 3REKC 3VH6T 4CSRA 1H3OA 4QLCC 3MGRB 3VH5W 3UTAB 3RELD 1U35B 5AY8C 2FJ7B 5B0YC 4J8WB 5B0YA 3AZIB 4WU8D 1S32D 1P3KD 1P3FA 3UTBC 4LD9C 4YS3C 2ZY5A 3B0DC 3AZLB 2Y2PA 2Y2IA 4XZQB 5JRGB 1EQZA 5BT1C 3X1SC 2AROA 3TU4C 1KU5A 5AY8D 5B0YD 5AV6B 4H9RA 3B0CT 3B6GB 5CPJC 1P3FD 5CPJA 1AOIA 5B24B 4AWLC 3UT9B 4KGCC 3B6FC 3B6FA 5CPKB 1EQZD 4WNNB 5DNMA 5BNVA 2AROD 3X1SD 4H9PA 2YFVA 3X1VA 4R8PB 4UUZA 4Z5TB 5CPJD 1AOID 4XUJA 5B2IB 2F8NH 4NE5A 1ID3A 1P3AB 5BNXA 4KGCD 1P3OC 5GT3B 1P3OA 3B6FD 5DNMD 1HQ3B 5KDMA 4JJNA 3AV1A 4WJ3C 3H0RC 3LELC 3X1VD 1ZLAC 3NQJA 1ZLAA 3MGPC 3W97B 3MGPA 4XUJD 3WAAB 1ID3D 5B31G 3V9RB 5AV8C 3KWQB 5AV8A 1P3OD 3MGRA 5B1LB 3UTAA 4JJND 3B0CW 3REIC 4ZBJC 4KUDC 4J8WC 4KUDA 4J8WA 3AZIA 3AZKC 3KSYA 3MGPD 3AZKA 1ZLAD 4H9OB 1JFIA 1A7WA 5AV9C 5AV8D 3O62C 2NZDB 4XZQA 3UTAD 3LJAB 3REID 1P34B 2CWEA 2F8NK 4J8WD 3AZID 3WA9C 5F99C 3AZKD 4KUDD 4EO5C 4Z66C 3AZNC 3B6GA 1F66C 1KX4C 3AZMB 4G91B 5AV9D 4M6BA 3O62D 5AV5B 3AZJB 3AZGC 4ZUXC 4XZQD 4ZUXA 5CPKA 4WNNA 4J8UC 5B33C 1M1AC 1M1AA 5BO0B 3A1IA 2HIOB 3C1BC 3AZND 3B6GD 1F66D 3VH5T 1KX4D 3MGSC 1P3AA 3MGSA 4ZUXD 3WTPB 5GT3A 1HQ3A 4J8UD 2XD5A 1M1AD 1TZYB 3MGQC 1KX5C 4J8VB 2F8NB 3W97A 4H9SC 5CPIC 4H9SA 3LZ0B 5CPIA 3WAAA 3MGSD 3V9RA 3KWQA 5GT3D 1KX3B 3AZEC 1HQ3D 3AYWB 3W96C 3A6NC 3MGQD 3A6NA 5B32C 5B32A 2PYOB 2YFWB 3AZHC 3REHC 3REHA 5GSUB 4G92B 3WAAD 5CPID 1P3LB 3KXBC 1S32C 2NZDA 3A6ND 3LZ1B 3LJAA 3KUYA 5B32D 3KUYC 1P34C 1P34A 3AZHD 3REHD 3AZMA 1P3MB 3KXBD 3WKJB 5AV5A 2HUEB 1P3FC 2W8SA 5C3IC 5CP6B 3AFAB 3LJAD 3KUYD 2CV5C 1P34D 2CV5A 5BO0A 1EQZC 3C1CC 3C1CA 2AROC 2Y2QA 5AV5D 1AOIC 3WTPA 5GT0B 2IO5B 2JSSA 1TZYA 2CV5D 3REJB 5DNMC 5AVBB 3C1CD 4J8VA 2F8NA 1BH8B 4WU9C 4WU9A 5CHLB 3X1VC 1Z2CB 4H9QB 3LZ0A 3F6TA 4WV4B 3WTPD 4XUJC 1KX3A 3AYWA 1P3BB 1ID3C 1TZYD 2ZY3A 3AN2B 5JA4B 2NQBA 2NQBC 3AL0C 3EPLA 4J8VD 4CAYB 2F8ND 5BS7C 3MVDB 5BS7A 5GSUA 1WWSA 4JJNC 4WU9D 3AV1C 5E5AC 5E5AA 5B0ZB 1P3LA 5B1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZF B;  1P3G C;  5GXQ B;  1P3G A;  2NQB D;  3LZ1 A;  3MGR C;  3VH6 A;  3UTA C;  3NQU B;  3AV2 B;  5B32 G;  5GSU D;  3AV1 D;  1U35 C;  5E5A D;  1U35 A;  1P3L D;  4HGA B;  2FJ7 C;  2FJ7 A;  3AZI C;  1P3M A;  4YM6 B;  3MNN B;  3WKJ A;  4Z2M H;  1TAF B;  5CP6 A;  5DNN B;  3AFA A;  3AZL C;  5AVC B;  4KHA B;  3LZ1 D;  3AZL A;  1P3G D;  1M19 B;  3MGR D;  4XZQ C;  5JRG C;  5JRG A;  1M18 B;  3W99 B;  1U35 D;  3W98 B;  2FJ7 D;  1P3M D;  5B31 B;  5AV6 C;  5AV6 A;  4J8X B;  1B67 A;  3WKJ D;  4X23 B;  3X1T B;  3B6G C;  5GT0 A;  3AZL D;  3WTP E;  5B24 C;  5B24 A;  1BH9 B;  3UT9 C;  3REJ A;  3UT9 A;  5JRG D;  5CPK C;  5AVB A;  3REL B;  1BH8 A;  3X1U B;  5AV6 D;  4R8P C;  4H9Q A;  4R8P A;  4Z5T C;  1P3K B;  4Z5T A;  5GT0 D;  5B2I C;  5B2I A;  5B24 D;  1P3B A;  3REK B;  1P3A C;  4QLC B;  5JA4 A;  3REJ D;  3UT9 D;  3AN2 A;  5GT3 C;  5CPK D;  1HQ3 C;  5AVB D;  1P3I B;  3MVD A;  4E44 A;  5AY8 B;  5B0Y B;  5B0Z C;  5B0Z A;  4R8P D;  3W97 C;  4Z5T D;  3UTB B;  5B1M A;  4LD9 B;  1P3P B;  5B2I D;  4YS3 B;  3B0D B;  3WAA C;  4DRA A;  1P3B D;  1P3A D;  3AZF A;  5GXQ A;  3KWQ C;  3X1S B;  5B1L C;  5B1L A;  3TU4 B;  3MVD D;  3AV2 C;  3NQU A;  3AV2 A;  2BYK B;  5B0Z D;  4H9R B;  4YM6 A;  5CPJ B;  3W97 D;  5B1M D;  3MNN A;  4H9O A;  4AWL B;  3AZF D;  5DNN A;  5GXQ D;  5AVC A;  4KHA A;  3KWQ D;  4KGC B;  3B6F B;  2RVQ D;  2NZD C;  5B1L D;  3AV2 D;  1M18 A;  4H9P B;  3W99 C;  3LJA C;  3W99 A;  3W98 A;  5B31 A;  4YM6 D;  3R45 B;  4H9N B;  4X23 C;  3MNN D;  4X23 A;  3X1T A;  5BNX B;  5DNN D;  3AZM C;  5AVC D;  4G91 C;  1P3O B;  3AZJ C;  1BH9 A;  5AV5 C;  3AZJ A;  2NZD D;  5KDM B;  1M18 D;  3W99 D;  3W98 D;  3LEL B;  3X1U A;  5B31 D;  2HIO C;  3MGP B;  2HIO A;  4X23 D;  3X1T D;  1ULY A;  4E45 A;  3AZM D;  5AV8 B;  3REK A;  3AZJ D;  4QLC A;  3WTP C;  1P3I C;  1P3I A;  5B2J B;  1TZY C;  3REI B;  4ZBJ B;  5AY8 A;  3X1U D;  4KUD B;  3AZK B;  2HIO D;  4J8V C;  3UTB A;  1P3P C;  1JFI B;  1P3P A;  4LD9 A;  4YS3 A;  5AV9 B;  3LZ0 C;  3REK D;  3O62 B;  4QLC D;  1KX3 C;  1P3I D;  3AYW C;  3X1S A;  3TU4 A;  2BYK A;  2PYO C;  3WA9 B;  2PYO A;  5F99 B;  2YFW A;  4EO5 B;  4Z66 B;  3AZN B;  3UTB D;  5GSU C;  1F66 B;  1P3P D;  4G92 C;  4YS3 D;  4LD9 D;  1KX4 B;  1P3L C;  3LZ0 D;  3AZG B;  4ZUX B;  4KGC A;  1KX3 D;  4J8U B;  5BT1 D;  5B33 B;  3AYW D;  1M1A B;  3TU4 D;  3LZ1 C;  2PYO D;  4DRB A;  2LY8 A;  3C1B B;  5B40 B;  3R45 A;  4H9N A;  3VH6 W;  3MGS B;  1P3M C;  4NFT A;  3WKJ C;  2HUE C;  5CP6 C;  3AFA C;  3MGQ B;  1KX5 B;  3LEL A;  1N1J B;  4NE3 A;  5CPI B;  3AZE B;  5G49 B;  2IO5 C;  5GT0 C;  1Q9C A;  5CP6 D;  3A6N B;  5B2J C;  3AFA D;  5B2J A;  3W96 B;  5B32 B;  3REI A;  3REJ C;  2BYM B;  3LEL D;  5AVB C;  3AZH B;  3REH B;  2L5A A;  5AV9 A;  5FUG B;  3KXB B;  3O62 A;  4WU8 B;  1S32 B;  5B2J D;  3KUY B;  1P3B C;  4CSR B;  1H3O B;  3AN2 C;  3WA9 A;  5F99 A;  4Z66 A;  4CAY A;  3AZN A;  3MVD C;  1F66 A;  1KX4 A;  2F8N G;  1B6W A;  1WWI A;  3AZG A;  1P3F B;  5B1M C;  5C3I B;  4J8U A;  5B33 A;  3AZF C;  5GXQ C;  3AN2 D;  2CV5 B;  3WA9 D;  1HTA A;  2RVQ C;  5F99 D;  3C1C B;  1EQZ B;  3C1B A;  2ARO B;  4Z66 D;  3B0B A;  5B40 C;  5B40 A;  4HGA C;  3AZG D;  4YM6 C;  3MNN C;  1AOI B;  5B33 D;  4WZS B;  1TAF A;  5DNN C;  3MGQ A;  1F1E A;  5AVC C;  1KX5 A;  1M19 C;  5DNM B;  1M19 A;  3C1B D;  5BNV B;  5B40 D;  1M18 C;  4NE6 A;  1N1J A;  4WU9 B;  3W98 C;  2YFV B;  4Z2M G;  3X1V B;  5B31 C;  4UUZ B;  4J8X C;  4J8X A;  4XUJ B;  3AZE A;  3X1T C;  5G49 A;  3W96 A;  1ID3 B;  1KX5 D;  2NQB B;  1M19 D;  2BYM A;  3REL C;  3AZH A;  3REL A;  4JJN B;  3AV1 B;  5E5A B;  3X1U C;  3NQJ B;  1R4V A;  1ZLA B;  5FUG A;  3KXB A;  4J8X D;  1BFM A;  4WU8 C;  3AZE D;  4WU8 A;  1P3K C;  1S32 A;  1P3K A;  3W96 D;  1P3G B;  3VH5 A;  3REK C;  3VH6 T;  4CSR A;  1H3O A;  4QLC C;  3MGR B;  3VH5 W;  3UTA B;  3REL D;  1U35 B;  5AY8 C;  2FJ7 B;  5B0Y C;  4J8W B;  5B0Y A;  3AZI B;  4WU8 D;  1S32 D;  1P3K D;  1P3F A;  3UTB C;  4LD9 C;  4YS3 C;  3AZL B;  3B0D C;  4XZQ B;  5JRG B;  1EQZ A;  5BT1 C;  3X1S C;  2ARO A;  3TU4 C;  1KU5 A;  5AY8 D;  5B0Y D;  5AV6 B;  4H9R A;  3B0C T;  3B6G B;  5CPJ C;  1P3F D;  5CPJ A;  1AOI A;  5B24 B;  4AWL C;  3UT9 B;  4KGC C;  3B6F C;  3B6F A;  5CPK B;  1EQZ D;  4WNN B;  5DNM A;  5BNV A;  3X1S D;  2ARO D;  4H9P A;  2YFV A;  3X1V A;  4R8P B;  4UUZ A;  4Z5T B;  5CPJ D;  1AOI D;  4XUJ A;  5B2I B;  2F8N H;  4NE5 A;  1ID3 A;  1P3A B;  5BNX A;  4KGC D;  1P3O C;  5GT3 B;  1P3O A;  3B6F D;  5DNM D;  1HQ3 B;  5KDM A;  4JJN A;  3AV1 A;  3LEL C;  3X1V D;  1ZLA C;  3NQJ A;  1ZLA A;  3MGP C;  3W97 B;  3MGP A;  4XUJ D;  3WAA B;  1ID3 D;  5B31 G;  3V9R B;  5AV8 C;  3KWQ B;  5AV8 A;  1P3O D;  3MGR A;  5B1L B;  3UTA A;  4JJN D;  3B0C W;  3REI C;  4ZBJ C;  4KUD C;  4J8W C;  4KUD A;  4J8W A;  3AZI A;  3AZK C;  3KSY A;  3MGP D;  3AZK A;  1ZLA D;  4H9O B;  1JFI A;  1A7W A;  5AV9 C;  5AV8 D;  3O62 C;  2NZD B;  4XZQ A;  3UTA D;  3LJA B;  3REI D;  1P34 B;  2CWE A;  2F8N K;  4J8W D;  3AZI D;  3WA9 C;  5F99 C;  3AZK D;  4KUD D;  4EO5 C;  4Z66 C;  3AZN C;  3B6G A;  1F66 C;  1KX4 C;  3AZM B;  4G91 B;  5AV9 D;  4M6B A;  3O62 D;  5AV5 B;  3AZJ B;  3AZG C;  4ZUX C;  4XZQ D;  4ZUX A;  5CPK A;  4WNN A;  4J8U C;  5B33 C;  1M1A C;  1M1A A;  5BO0 B;  2HIO B;  3C1B C;  3AZN D;  3B6G D;  1F66 D;  3VH5 T;  1KX4 D;  3MGS C;  1P3A A;  3MGS A;  4ZUX D;  3WTP B;  5GT3 A;  1HQ3 A;  4J8U D;  1M1A D;  1TZY B;  3MGQ C;  1KX5 C;  4J8V B;  2F8N B;  3W97 A;  4H9S C;  5CPI C;  4H9S A;  3LZ0 B;  5CPI A;  3WAA A;  3MGS D;  3V9R A;  3KWQ A;  5GT3 D;  1KX3 B;  3AZE C;  1HQ3 D;  3AYW B;  3W96 C;  3A6N C;  3MGQ D;  3A6N A;  5B32 C;  5B32 A;  2PYO B;  2YFW B;  3AZH C;  3REH C;  3REH A;  5GSU B;  4G92 B;  3WAA D;  5CPI D;  1P3L B;  3KXB C;  1S32 C;  2NZD A;  3A6N D;  3LZ1 B;  3LJA A;  3KUY A;  5B32 D;  3KUY C;  1P34 C;  1P34 A;  3AZH D;  3REH D;  3AZM A;  1P3M B;  3KXB D;  3WKJ B;  5AV5 A;  2HUE B;  1P3F C;  5C3I C;  5CP6 B;  3AFA B;  3LJA D;  3KUY D;  2CV5 C;  1P34 D;  2CV5 A;  5BO0 A;  1EQZ C;  3C1C C;  3C1C A;  2ARO C;  5AV5 D;  1AOI C;  3WTP A;  5GT0 B;  2IO5 B;  2JSS A;  1TZY A;  2CV5 D;  3REJ B;  5DNM C;  5AVB B;  3C1C D;  4J8V A;  2F8N A;  1BH8 B;  4WU9 C;  4WU9 A;  5CHL B;  3X1V C;  3LZ0 A;  4H9Q B;  4WV4 B;  3WTP D;  4XUJ C;  1KX3 A;  3AYW A;  1P3B B;  1ID3 C;  1TZY D;  3AN2 B;  5JA4 B;  2NQB A;  2NQB C;  4J8V D;  4CAY B;  2F8N D;  5BS7 C;  3MVD B;  5BS7 A;  5GSU A;  1WWS A;  4JJN C;  4WU9 D;  3AV1 C;  5E5A C;  5E5A A;  5B0Z B;  1P3L A;  5B1M B; 
#chains in the Genus database with same CATH topology
 3AZF B;  1P3G C;  5GXQ B;  1P3G A;  2NQB D;  3LZ1 A;  3MGR C;  3VH6 A;  3UTA C;  2JE5 A;  3NQU B;  3AV2 B;  5B32 G;  5GSU D;  3AV1 D;  1U35 C;  5E5A D;  1U35 A;  1P3L D;  4HGA B;  2FJ7 C;  2FJ7 A;  3AZI C;  1P3M A;  4YM6 B;  3MNN B;  3WKJ A;  4Z2M H;  1TAF B;  2VQR A;  5CP6 A;  5DNN B;  3AFA A;  3AZL C;  5AVC B;  4KHA B;  3LZ1 D;  3AZL A;  1P3G D;  2DF4 C;  1M19 B;  3MGR D;  4XZQ C;  5JRG C;  5JRG A;  1M18 B;  3W99 B;  1U35 D;  3W98 B;  2FJ7 D;  1P3M D;  5B31 B;  5AV6 C;  5AV6 A;  4J8X B;  1B67 A;  3WKJ D;  4X23 B;  3X1T B;  3B6G C;  5GT0 A;  3AZL D;  3WTP E;  5B24 C;  5B24 A;  1BH9 B;  3UT9 C;  3REJ A;  3UT9 A;  5JRG D;  5CPK C;  5AVB A;  3REL B;  1BH8 A;  3X1U B;  5AV6 D;  4R8P C;  4H9Q A;  4R8P A;  4Z5T C;  2DQN C;  2Y2K A;  4Z5T A;  1P3K B;  5GT0 D;  5B2I C;  5B2I A;  5B24 D;  1P3B A;  2Y2O A;  3REK B;  1P3A C;  4QLC B;  5JA4 A;  3REJ D;  3UT9 D;  3AN2 A;  5GT3 C;  5CPK D;  1HQ3 C;  5AVB D;  1P3I B;  3FDD A;  3MVD A;  4E44 A;  5AY8 B;  2Y2H A;  5B0Y B;  5B0Z C;  5B0Z A;  4R8P D;  3P5J B;  3W97 C;  4Z5T D;  3UTB B;  5B1M A;  4LD9 B;  1P3P B;  5B2I D;  4YS3 B;  3B0D B;  3WAA C;  4DRA A;  1P3B D;  1P3A D;  3AZF A;  5GXQ A;  3KWQ C;  2FFF B;  3X1S B;  5B1L C;  5B1L A;  3TU4 B;  3MVD D;  3AV2 C;  3NQU A;  3AV2 A;  2XD1 A;  2BYK B;  5B0Z D;  4H9R B;  4YM6 A;  2RIQ A;  5CPJ B;  3W97 D;  5B1M D;  3MNN A;  4H9O A;  4AWL B;  3AZF D;  5DNN A;  5GXQ D;  5AVC A;  4KHA A;  3KWQ D;  4KGC B;  3B6F B;  2RVQ D;  2NZD C;  2ZM5 A;  5B1L D;  3AV2 D;  1M18 A;  4H9P B;  3W99 C;  3LJA C;  3W99 A;  3W98 A;  5B31 A;  4YM6 D;  3R45 B;  4H9N B;  4X23 C;  3MNN D;  4X23 A;  2ZY2 A;  3EPJ A;  3X1T A;  5BNX B;  5DNN D;  3AZM C;  5AVC D;  4G91 C;  1P3O B;  3AZJ C;  1BH9 A;  5AV5 C;  3AZJ A;  2NZD D;  5KDM B;  1M18 D;  2Y2G A;  3W99 D;  3KFU G;  3W98 D;  3LEL B;  3X1U A;  5B31 D;  2HIO C;  3EG5 B;  2HIO A;  3MGP B;  4X23 D;  3X1T D;  1ULY A;  4E45 A;  3AZM D;  5AV8 B;  3REK A;  3AZJ D;  2BG1 A;  4QLC A;  3WTP C;  1P3I C;  1P3I A;  1PZR A;  5B2J B;  1TZY C;  3REI B;  4ZBJ B;  5AY8 A;  3X1U D;  4KUD B;  3AZK B;  2HIO D;  4J8V C;  3UTB A;  1P3P C;  1JFI B;  1P3P A;  4LD9 A;  4YS3 A;  5AV9 B;  3LZ0 C;  3REK D;  3O62 B;  4UPK A;  4QLC D;  2G5I C;  1KX3 C;  1P3I D;  3AYW C;  3X1S A;  3TU4 A;  2BYK A;  2PYO C;  3WA9 B;  2PYO A;  5F99 B;  2YFW A;  4EO5 B;  4Z66 B;  3AZN B;  3UTB D;  5GSU C;  1F66 B;  1P3P D;  4G92 C;  4YS3 D;  4LD9 D;  1KX4 B;  1P3L C;  3LZ0 D;  3AZG B;  3A1K A;  4ZUX B;  4KGC A;  1KX3 D;  4J8U B;  5BT1 D;  5B33 B;  3AYW D;  1M1A B;  3TU4 D;  3LZ1 C;  2F2A C;  2Y2L A;  4DRB A;  2PYO D;  2LY8 A;  3C1B B;  5B40 B;  3R45 A;  4H9N A;  3VH6 W;  3MGS B;  1P3M C;  4NFT A;  3WKJ C;  2HUE C;  5CP6 C;  3AFA C;  3MGQ B;  1KX5 B;  3H0L C;  3H0M C;  3LEL A;  2G5H C;  1N1J B;  4NE3 A;  5CPI B;  2Y2N A;  2ZY4 A;  3AZE B;  5G49 B;  2IO5 C;  5GT0 C;  1Q9C A;  5CP6 D;  3A6N B;  5B2J C;  3AFA D;  5B2J A;  3W96 B;  5B32 B;  3REI A;  3REJ C;  2BYM B;  3LEL D;  5AVB C;  3AZH B;  3REH B;  2L5A A;  5AV9 A;  5FUG B;  3KXB B;  3O62 A;  4WU8 B;  3EPK A;  1S32 B;  2UWX A;  2Y2M A;  5B2J D;  3KUY B;  1P3B C;  4CSR B;  1H3O B;  3AN2 C;  2Y2J A;  3WA9 A;  5F99 A;  4Z66 A;  4CAY A;  3AZN A;  3MVD C;  3IP4 C;  1F66 A;  1KX4 A;  2F8N G;  1B6W A;  1WWI A;  3AZG A;  1P3F B;  5B1M C;  5C3I B;  4J8U A;  5B33 A;  3AZF C;  5GXQ C;  3AN2 D;  2CV5 B;  4DQY B;  3WA9 D;  1HTA A;  1T3U A;  2RVQ C;  5F99 D;  3C1C B;  3C1B A;  1EQZ B;  2ARO B;  4Z66 D;  3B0B A;  5B40 C;  1W2E A;  5B40 A;  3EPH A;  2J8P A;  4HGA C;  3AZG D;  4YM6 C;  3MNN C;  1AOI B;  5B33 D;  4WZS B;  1TAF A;  5DNN C;  3MGQ A;  1F1E A;  5AVC C;  1KX5 A;  1M19 C;  5DNM B;  1M19 A;  3C1B D;  5BNV B;  5B40 D;  1M18 C;  4NE6 A;  1N1J A;  4WU9 B;  3W98 C;  2YFV B;  4Z2M G;  3X1V B;  5B31 C;  4UUZ B;  4J8X C;  4J8X A;  4XUJ B;  3AZE A;  3X1T C;  5G49 A;  3W96 A;  1ID3 B;  1KX5 D;  2NQB B;  1M19 D;  2BYM A;  2JCH A;  3REL C;  3AZH A;  3REL A;  4JJN B;  3AV1 B;  5E5A B;  3X1U C;  3NQJ B;  1R4V A;  1ZLA B;  5FUG A;  3KXB A;  4J8X D;  1BFM A;  4WU8 C;  3AZE D;  4WU8 A;  1P3K C;  1S32 A;  1P3K A;  3W96 D;  1P3G B;  3VH5 A;  3REK C;  3VH6 T;  4CSR A;  1H3O A;  4QLC C;  3MGR B;  3VH5 W;  3UTA B;  3REL D;  1U35 B;  5AY8 C;  2FJ7 B;  5B0Y C;  4J8W B;  5B0Y A;  3AZI B;  4WU8 D;  1S32 D;  1P3K D;  1P3F A;  3UTB C;  4LD9 C;  4YS3 C;  2ZY5 A;  3B0D C;  3AZL B;  2Y2P A;  2Y2I A;  4XZQ B;  5JRG B;  1EQZ A;  5BT1 C;  3X1S C;  2ARO A;  3TU4 C;  1KU5 A;  5AY8 D;  5B0Y D;  5AV6 B;  4H9R A;  3B0C T;  3B6G B;  5CPJ C;  1P3F D;  5CPJ A;  1AOI A;  5B24 B;  4AWL C;  3UT9 B;  4KGC C;  3B6F C;  3B6F A;  5CPK B;  1EQZ D;  4WNN B;  5DNM A;  5BNV A;  2ARO D;  3X1S D;  4H9P A;  2YFV A;  3X1V A;  4R8P B;  4UUZ A;  4Z5T B;  5CPJ D;  1AOI D;  4XUJ A;  5B2I B;  2F8N H;  4NE5 A;  1ID3 A;  1P3A B;  5BNX A;  4KGC D;  1P3O C;  5GT3 B;  1P3O A;  3B6F D;  5DNM D;  1HQ3 B;  5KDM A;  4JJN A;  3AV1 A;  4WJ3 C;  3H0R C;  3LEL C;  3X1V D;  1ZLA C;  3NQJ A;  1ZLA A;  3MGP C;  3W97 B;  3MGP A;  4XUJ D;  3WAA B;  1ID3 D;  5B31 G;  3V9R B;  5AV8 C;  3KWQ B;  5AV8 A;  1P3O D;  3MGR A;  5B1L B;  3UTA A;  4JJN D;  3B0C W;  3REI C;  4ZBJ C;  4KUD C;  4J8W C;  4KUD A;  4J8W A;  3AZI A;  3AZK C;  3KSY A;  3MGP D;  3AZK A;  1ZLA D;  4H9O B;  1JFI A;  1A7W A;  5AV9 C;  5AV8 D;  3O62 C;  2NZD B;  4XZQ A;  3UTA D;  3LJA B;  3REI D;  1P34 B;  2CWE A;  2F8N K;  4J8W D;  3AZI D;  3WA9 C;  5F99 C;  3AZK D;  4KUD D;  4EO5 C;  4Z66 C;  3AZN C;  3B6G A;  1F66 C;  1KX4 C;  3AZM B;  4G91 B;  5AV9 D;  4M6B A;  3O62 D;  5AV5 B;  3AZJ B;  3AZG C;  4ZUX C;  4XZQ D;  4ZUX A;  5CPK A;  4WNN A;  4J8U C;  5B33 C;  1M1A C;  1M1A A;  5BO0 B;  3A1I A;  2HIO B;  3C1B C;  3AZN D;  3B6G D;  1F66 D;  3VH5 T;  1KX4 D;  3MGS C;  1P3A A;  3MGS A;  4ZUX D;  3WTP B;  5GT3 A;  1HQ3 A;  4J8U D;  2XD5 A;  1M1A D;  1TZY B;  3MGQ C;  1KX5 C;  4J8V B;  2F8N B;  3W97 A;  4H9S C;  5CPI C;  4H9S A;  3LZ0 B;  5CPI A;  3WAA A;  3MGS D;  3V9R A;  3KWQ A;  5GT3 D;  1KX3 B;  3AZE C;  1HQ3 D;  3AYW B;  3W96 C;  3A6N C;  3MGQ D;  3A6N A;  5B32 C;  5B32 A;  2PYO B;  2YFW B;  3AZH C;  3REH C;  3REH A;  5GSU B;  4G92 B;  3WAA D;  5CPI D;  1P3L B;  3KXB C;  1S32 C;  2NZD A;  3A6N D;  3LZ1 B;  3LJA A;  3KUY A;  5B32 D;  3KUY C;  1P34 C;  1P34 A;  3AZH D;  3REH D;  3AZM A;  1P3M B;  3KXB D;  3WKJ B;  5AV5 A;  2HUE B;  1P3F C;  2W8S A;  5C3I C;  5CP6 B;  3AFA B;  3LJA D;  3KUY D;  2CV5 C;  1P34 D;  2CV5 A;  5BO0 A;  1EQZ C;  3C1C C;  3C1C A;  2ARO C;  2Y2Q A;  5AV5 D;  1AOI C;  3WTP A;  5GT0 B;  2IO5 B;  2JSS A;  1TZY A;  2CV5 D;  3REJ B;  5DNM C;  5AVB B;  3C1C D;  4J8V A;  2F8N A;  1BH8 B;  4WU9 C;  4WU9 A;  5CHL B;  3X1V C;  1Z2C B;  4H9Q B;  3LZ0 A;  3F6T A;  4WV4 B;  3WTP D;  4XUJ C;  1KX3 A;  3AYW A;  1P3B B;  1ID3 C;  1TZY D;  2ZY3 A;  3AN2 B;  5JA4 B;  2NQB A;  2NQB C;  3AL0 C;  3EPL A;  4J8V D;  4CAY B;  2F8N D;  5BS7 C;  3MVD B;  5BS7 A;  5GSU A;  1WWS A;  4JJN C;  4WU9 D;  3AV1 C;  5E5A C;  5E5A A;  5B0Z B;  1P3L A;  5B1M B; 
#chains in the Genus database with same CATH homology
 3AZF B;  1P3G C;  5GXQ B;  1P3G A;  2NQB D;  3LZ1 A;  3MGR C;  3VH6 A;  3UTA C;  2JE5 A;  3NQU B;  3AV2 B;  5B32 G;  5GSU D;  3AV1 D;  1U35 C;  5E5A D;  1U35 A;  1P3L D;  4HGA B;  2FJ7 C;  2FJ7 A;  3AZI C;  1P3M A;  4YM6 B;  3MNN B;  3WKJ A;  4Z2M H;  1TAF B;  2VQR A;  5CP6 A;  5DNN B;  3AFA A;  3AZL C;  5AVC B;  4KHA B;  3LZ1 D;  3AZL A;  1P3G D;  2DF4 C;  1M19 B;  3MGR D;  4XZQ C;  5JRG C;  5JRG A;  1M18 B;  3W99 B;  1U35 D;  3W98 B;  2FJ7 D;  1P3M D;  5B31 B;  5AV6 C;  5AV6 A;  4J8X B;  1B67 A;  3WKJ D;  4X23 B;  3X1T B;  3B6G C;  5GT0 A;  3AZL D;  3WTP E;  5B24 C;  5B24 A;  1BH9 B;  3UT9 C;  3REJ A;  3UT9 A;  5JRG D;  5CPK C;  5AVB A;  3REL B;  1BH8 A;  3X1U B;  5AV6 D;  4R8P C;  4H9Q A;  4R8P A;  4Z5T C;  2DQN C;  2Y2K A;  4Z5T A;  1P3K B;  5GT0 D;  5B2I C;  5B2I A;  5B24 D;  1P3B A;  2Y2O A;  3REK B;  1P3A C;  4QLC B;  5JA4 A;  3REJ D;  3UT9 D;  3AN2 A;  5GT3 C;  5CPK D;  1HQ3 C;  5AVB D;  1P3I B;  3FDD A;  3MVD A;  4E44 A;  5AY8 B;  2Y2H A;  5B0Y B;  5B0Z C;  5B0Z A;  4R8P D;  3P5J B;  3W97 C;  4Z5T D;  3UTB B;  5B1M A;  4LD9 B;  1P3P B;  5B2I D;  4YS3 B;  3B0D B;  3WAA C;  4DRA A;  1P3B D;  1P3A D;  3AZF A;  5GXQ A;  3KWQ C;  2FFF B;  3X1S B;  5B1L C;  5B1L A;  3TU4 B;  3MVD D;  3AV2 C;  3NQU A;  3AV2 A;  2XD1 A;  2BYK B;  5B0Z D;  4H9R B;  4YM6 A;  2RIQ A;  5CPJ B;  3W97 D;  5B1M D;  3MNN A;  4H9O A;  4AWL B;  3AZF D;  5DNN A;  5GXQ D;  5AVC A;  4KHA A;  3KWQ D;  4KGC B;  3B6F B;  2RVQ D;  2NZD C;  2ZM5 A;  5B1L D;  3AV2 D;  1M18 A;  4H9P B;  3W99 C;  3LJA C;  3W99 A;  3W98 A;  5B31 A;  4YM6 D;  3R45 B;  4H9N B;  4X23 C;  3MNN D;  4X23 A;  2ZY2 A;  3EPJ A;  3X1T A;  5BNX B;  5DNN D;  3AZM C;  5AVC D;  4G91 C;  1P3O B;  3AZJ C;  1BH9 A;  5AV5 C;  3AZJ A;  2NZD D;  5KDM B;  1M18 D;  2Y2G A;  3W99 D;  3KFU G;  3W98 D;  3LEL B;  3X1U A;  5B31 D;  2HIO C;  3EG5 B;  2HIO A;  3MGP B;  4X23 D;  3X1T D;  1ULY A;  4E45 A;  3AZM D;  5AV8 B;  3REK A;  3AZJ D;  2BG1 A;  4QLC A;  3WTP C;  1P3I C;  1P3I A;  1PZR A;  5B2J B;  1TZY C;  3REI B;  4ZBJ B;  5AY8 A;  3X1U D;  4KUD B;  3AZK B;  2HIO D;  4J8V C;  3UTB A;  1P3P C;  1JFI B;  1P3P A;  4LD9 A;  4YS3 A;  5AV9 B;  3LZ0 C;  3REK D;  3O62 B;  4UPK A;  4QLC D;  2G5I C;  1KX3 C;  1P3I D;  3AYW C;  3X1S A;  3TU4 A;  2BYK A;  2PYO C;  3WA9 B;  2PYO A;  5F99 B;  2YFW A;  4EO5 B;  4Z66 B;  3AZN B;  3UTB D;  5GSU C;  1F66 B;  1P3P D;  4G92 C;  4YS3 D;  4LD9 D;  1KX4 B;  1P3L C;  3LZ0 D;  3AZG B;  3A1K A;  4ZUX B;  4KGC A;  1KX3 D;  4J8U B;  5BT1 D;  5B33 B;  3AYW D;  1M1A B;  3TU4 D;  3LZ1 C;  2F2A C;  2Y2L A;  4DRB A;  2PYO D;  2LY8 A;  3C1B B;  5B40 B;  3R45 A;  4H9N A;  3VH6 W;  3MGS B;  1P3M C;  4NFT A;  3WKJ C;  2HUE C;  5CP6 C;  3AFA C;  3MGQ B;  1KX5 B;  3H0L C;  3H0M C;  3LEL A;  2G5H C;  1N1J B;  4NE3 A;  5CPI B;  2Y2N A;  2ZY4 A;  3AZE B;  5G49 B;  2IO5 C;  5GT0 C;  1Q9C A;  5CP6 D;  3A6N B;  5B2J C;  3AFA D;  5B2J A;  3W96 B;  5B32 B;  3REI A;  3REJ C;  2BYM B;  3LEL D;  5AVB C;  3AZH B;  3REH B;  2L5A A;  5AV9 A;  5FUG B;  3KXB B;  3O62 A;  4WU8 B;  3EPK A;  1S32 B;  2UWX A;  2Y2M A;  5B2J D;  3KUY B;  1P3B C;  4CSR B;  1H3O B;  3AN2 C;  2Y2J A;  3WA9 A;  5F99 A;  4Z66 A;  4CAY A;  3AZN A;  3MVD C;  3IP4 C;  1F66 A;  1KX4 A;  2F8N G;  1B6W A;  1WWI A;  3AZG A;  1P3F B;  5B1M C;  5C3I B;  4J8U A;  5B33 A;  3AZF C;  5GXQ C;  3AN2 D;  2CV5 B;  4DQY B;  3WA9 D;  1HTA A;  1T3U A;  2RVQ C;  5F99 D;  3C1C B;  3C1B A;  1EQZ B;  2ARO B;  4Z66 D;  3B0B A;  5B40 C;  1W2E A;  5B40 A;  3EPH A;  2J8P A;  4HGA C;  3AZG D;  4YM6 C;  3MNN C;  1AOI B;  5B33 D;  4WZS B;  1TAF A;  5DNN C;  3MGQ A;  1F1E A;  5AVC C;  1KX5 A;  1M19 C;  5DNM B;  1M19 A;  3C1B D;  5BNV B;  5B40 D;  1M18 C;  4NE6 A;  1N1J A;  4WU9 B;  3W98 C;  2YFV B;  4Z2M G;  3X1V B;  5B31 C;  4UUZ B;  4J8X C;  4J8X A;  4XUJ B;  3AZE A;  3X1T C;  5G49 A;  3W96 A;  1ID3 B;  1KX5 D;  2NQB B;  1M19 D;  2BYM A;  2JCH A;  3REL C;  3AZH A;  3REL A;  4JJN B;  3AV1 B;  5E5A B;  3X1U C;  3NQJ B;  1R4V A;  1ZLA B;  5FUG A;  3KXB A;  4J8X D;  1BFM A;  4WU8 C;  3AZE D;  4WU8 A;  1P3K C;  1S32 A;  1P3K A;  3W96 D;  1P3G B;  3VH5 A;  3REK C;  3VH6 T;  4CSR A;  1H3O A;  4QLC C;  3MGR B;  3VH5 W;  3UTA B;  3REL D;  1U35 B;  5AY8 C;  2FJ7 B;  5B0Y C;  4J8W B;  5B0Y A;  3AZI B;  4WU8 D;  1S32 D;  1P3K D;  1P3F A;  3UTB C;  4LD9 C;  4YS3 C;  2ZY5 A;  3B0D C;  3AZL B;  2Y2P A;  2Y2I A;  4XZQ B;  5JRG B;  1EQZ A;  5BT1 C;  3X1S C;  2ARO A;  3TU4 C;  1KU5 A;  5AY8 D;  5B0Y D;  5AV6 B;  4H9R A;  3B0C T;  3B6G B;  5CPJ C;  1P3F D;  5CPJ A;  1AOI A;  5B24 B;  4AWL C;  3UT9 B;  4KGC C;  3B6F C;  3B6F A;  5CPK B;  1EQZ D;  4WNN B;  5DNM A;  5BNV A;  2ARO D;  3X1S D;  4H9P A;  2YFV A;  3X1V A;  4R8P B;  4UUZ A;  4Z5T B;  5CPJ D;  1AOI D;  4XUJ A;  5B2I B;  2F8N H;  4NE5 A;  1ID3 A;  1P3A B;  5BNX A;  4KGC D;  1P3O C;  5GT3 B;  1P3O A;  3B6F D;  5DNM D;  1HQ3 B;  5KDM A;  4JJN A;  3AV1 A;  4WJ3 C;  3H0R C;  3LEL C;  3X1V D;  1ZLA C;  3NQJ A;  1ZLA A;  3MGP C;  3W97 B;  3MGP A;  4XUJ D;  3WAA B;  1ID3 D;  5B31 G;  3V9R B;  5AV8 C;  3KWQ B;  5AV8 A;  1P3O D;  3MGR A;  5B1L B;  3UTA A;  4JJN D;  3B0C W;  3REI C;  4ZBJ C;  4KUD C;  4J8W C;  4KUD A;  4J8W A;  3AZI A;  3AZK C;  3KSY A;  3MGP D;  3AZK A;  1ZLA D;  4H9O B;  1JFI A;  1A7W A;  5AV9 C;  5AV8 D;  3O62 C;  2NZD B;  4XZQ A;  3UTA D;  3LJA B;  3REI D;  1P34 B;  2CWE A;  2F8N K;  4J8W D;  3AZI D;  3WA9 C;  5F99 C;  3AZK D;  4KUD D;  4EO5 C;  4Z66 C;  3AZN C;  3B6G A;  1F66 C;  1KX4 C;  3AZM B;  4G91 B;  5AV9 D;  4M6B A;  3O62 D;  5AV5 B;  3AZJ B;  3AZG C;  4ZUX C;  4XZQ D;  4ZUX A;  5CPK A;  4WNN A;  4J8U C;  5B33 C;  1M1A C;  1M1A A;  5BO0 B;  3A1I A;  2HIO B;  3C1B C;  3AZN D;  3B6G D;  1F66 D;  3VH5 T;  1KX4 D;  3MGS C;  1P3A A;  3MGS A;  4ZUX D;  3WTP B;  5GT3 A;  1HQ3 A;  4J8U D;  2XD5 A;  1M1A D;  1TZY B;  3MGQ C;  1KX5 C;  4J8V B;  2F8N B;  3W97 A;  4H9S C;  5CPI C;  4H9S A;  3LZ0 B;  5CPI A;  3WAA A;  3MGS D;  3V9R A;  3KWQ A;  5GT3 D;  1KX3 B;  3AZE C;  1HQ3 D;  3AYW B;  3W96 C;  3A6N C;  3MGQ D;  3A6N A;  5B32 C;  5B32 A;  2PYO B;  2YFW B;  3AZH C;  3REH C;  3REH A;  5GSU B;  4G92 B;  3WAA D;  5CPI D;  1P3L B;  3KXB C;  1S32 C;  2NZD A;  3A6N D;  3LZ1 B;  3LJA A;  3KUY A;  5B32 D;  3KUY C;  1P34 C;  1P34 A;  3AZH D;  3REH D;  3AZM A;  1P3M B;  3KXB D;  3WKJ B;  5AV5 A;  2HUE B;  1P3F C;  2W8S A;  5C3I C;  5CP6 B;  3AFA B;  3LJA D;  3KUY D;  2CV5 C;  1P34 D;  2CV5 A;  5BO0 A;  1EQZ C;  3C1C C;  3C1C A;  2ARO C;  2Y2Q A;  5AV5 D;  1AOI C;  3WTP A;  5GT0 B;  2IO5 B;  2JSS A;  1TZY A;  2CV5 D;  3REJ B;  5DNM C;  5AVB B;  3C1C D;  4J8V A;  2F8N A;  1BH8 B;  4WU9 C;  4WU9 A;  5CHL B;  3X1V C;  1Z2C B;  4H9Q B;  3LZ0 A;  3F6T A;  4WV4 B;  3WTP D;  4XUJ C;  1KX3 A;  3AYW A;  1P3B B;  1ID3 C;  1TZY D;  2ZY3 A;  3AN2 B;  5JA4 B;  2NQB A;  2NQB C;  3AL0 C;  3EPL A;  4J8V D;  4CAY B;  2F8N D;  5BS7 C;  3MVD B;  5BS7 A;  5GSU A;  1WWS A;  4JJN C;  4WU9 D;  3AV1 C;  5E5A C;  5E5A A;  5B0Z B;  1P3L A;  5B1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...