4NE3A

Human mhf1-mhf2 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
93
structure length
93
Chain Sequence
SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 30
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ne3A00
5AV8A 4YS3D 1F66D 5B2JA 5GXQA 3V9RB 4CSRA 2HUEC 4KHAB 3RELC 3W98C 5AVCC 3LZ0D 3KWQD 3C1CD 4ZUXB 4J8VA 4H9OB 3AV2B 4WU9C 4Z2MH 1TAFA 5DNNB 5B33B 4QLCB 1P34A 4KUDA 1N1JA 5CPID 5C3IC 4G92B 5F99C 3AZHD 5B32G 5B2IB 1P3LD 5B32A 3B6FD 4YM6D 3B0CT 4AWLB 1M19B 5B1MC 3WKJA 3AZFC 5GSUA 3AZGB 1P3OD 3X1SB 3AN2B 1P3IA 3MGRB 4H9NB 3AZEB 4ZBJC 5GT0A 3AZKC 2BYMA 4J8UB 3VH5T 3R45A 5AY8A 1ULYA 5B40D 4H9PA 5B24D 4WZSB 3UTBB 3AV1B 3LELC 2NZDB 1TZYD 4J8XB 5B0YB 1P3BD 1KX5D 5AV9B 3UT9A 3LJAA 5AV8C 1P3KD 1KU5A 5B2JC 5GXQC 4WV4B 5AV5A 5B1LD 1M18D 4Z66A 5CPJB 2L5AA 1HQ3B 3REJA 5CPKB 4WU8B 2CV5A 1ID3B 5JRGB 3REID 3REKA 3B6GB 1P3PA 5AV6B 4J8VC 3C1BB 3VH5A 1P3FA 1AOIB 1P34C 4KUDC 1A7WA 3VH6T 3MGPB 4YS3B 4J8WB 1F66B 2LY8A 3WA9A 5B32C 4ZUXD 3WKJC 5GSUC 5DNND 3C1CA 4QLCD 3LZ0B 3KWQB 1BH8B 1P3IC 2PYOD 4NE3A 5GT0C 4X23A 5AVBB 5AY8C 4G91B 1BH9B 5CPIB 2AROA 1JFIB 3REHB 3AZGD 3B6FA 1P3LA 1U35D 4YM6A 2NQBD 3VH6A 4H9RA 3X1SD 5DNMB 3UT9C 3AN2D 3AZNA 3NQUA 3O62A 3MGRD 3LJAC 3X1TA 1P3MA 1P3OA 1R4VA 4NE6A 1EQZA 3LZ1D 5CP6D 4WNNA 5AV5C 3X1UA 4Z66C 4XUJB 3AV1D 4R8PB 3REJC 2NZDD 4J8XD 4CAYA 5B40A 5B0YD 2CV5C 5AV9D 3AZJD 3MGSB 3REKC 1P3PC 3RELB 1P3BA 1B67A 1P3FC 5AVCB 1KX5B 3W99A 3WAAB 5CPJD 3AZIA 1HQ3D 4E44A 3AZMC 1P3KA 2F8NH 4WU9B 4WU8D 3AFAB 1ID3D 5B1LA 1M18A 3WA9C 3B6GD 3W96D 3C1BD 5B0ZB 3C1CC 1WWIA 5E5AA 5BNXB 2FJ7B 4UUZB 1M1AB 4J8WD 3V9RA 4X23C 1H3OB 4KHAA 3B0CW 2AROC 3A6NB 4ZBJB 4NE5A 5CHLB 4Z5TD 1P3LC 3B6FC 4YM6C 4ZUXA 3W97A 1ZLAD 3AV2A 3AZLD 1P3GB 2YFVB 3UTAB 3AZNC 3O62C 3X1TC 5DNNA 1P3MC 5B33A 1P3OC 2IO5B 1EQZC 5AVBD 1KX3D 3VH5W 3X1UC 5BNVA 2PYOB 3REHD 5B2IA 5G49A 1M19A 5B40C 5GXQB 4EO5C 5DNMD 3AZGA 3AYWA 1U35B 1P3BC 2NQBB 3X1SA 3AN2A 3W99C 3WTPB 3MGRA 4H9NA 3AZEA 4XUJD 3AZIC 4J8VB 4E45A 4R8PD 1P3KC 4J8UA 3LZ1B 5CP6B 1TAFB 5B1LC 1M18C 3MGSD 3UTBA 1P34B 3AV1A 4KUDB 4XZQB 3RELD 5B0YA 3X1VB 5AVCD 3WAAD 5E5AC 3AZJB 3MVDB 3VH6W 1HTAA 4DRBA 4WU9D 1KX4B 3AFAD 3WKJB 5GSUB 1S32A 4JJNA 5CPJA 1HQ3A 2RVQD 5CPKA 4WU8A 5B0ZD 1ID3A 5JRGA 5F99D 3B6GA 2BYMB 4ZUXC 2FJ7D 5AV6A 3W97C 1M1AD 3AV2C 3W96B 4NFTA 4HGAB 1AOIA 5DNNC 3MGQB 5B33C 1P3AB 3MGPA 3AZMA 2HIOB 4YS3A 4G92C 4J8WA 3KUYB 1F66A 3UT9B 3A6ND 5B2IC 4AWLC 1M19C 1P3GD 3UTAD 5GT3B 5B31B 3AZGC 3AYWC 3LZ0A 3KWQA 4Z5TB 5KDMB 1ZLAB 3MNNB 4LD9B 3X1SC 3AN2C 3AZLB 3MGRC 3AZEC 2F8NB 3B0DC 4J8UC 5BO0A 2YFWB 5AVBA 5B2JD 5GXQD 3KXBB 5CPIA 1KX3B 3UTBC 3REHA 3AV1C 3AZHA 5B0YC 5DNMA 3WTPD 1Q9CA 4J8VD 4H9QB 4KGCB 3TU4B 1S32C 4XUJA 4JJNC 5CPJC 1HQ3C 1P34D 4R8PA 4KUDD 5CPKC 4XZQD 4WU8C 1ID3C 3X1VD 5JRGC 3MGSA 5B24A 3B6GC 5FUGB 5AV6C 4X23B 4Z2MG 3MVDD 3C1BC 1KX4D 2HUEB 3WKJD 1TZYA 1AOIC 3W98B 1KX5A 5GSUD 3MGPC 4YS3C 4J8WC 1P3ID 2BYKB 3AFAA 1F66C 3O62B 5BS7A 4M6BA 5AY8D 5B0ZA 3NQJB 5C3IB 3MGQD 5JA4A 5BNXA 5F99B 3LZ0C 3KWQC 2FJ7A 3REIA 1P3AD 4UUZA 2HIOD 3KUYD 5B1MB 3UT9D 3AZFB 1H3OA 5AVBC 5CPIC 3W99B 5GT3D 3A6NA 5B31D 3REHC 3AZIB 5BT1D 3AZHC 3AZKB 3MNND 1P3GA 4LD9D 4H9OA 2YFVA 5DNMC 3UTAA 2F8ND 1P3PD 4QLCA 3LELB 1P3FD 3KXBD 2F8NK 4XUJC 2PYOA 4R8PC 5AV8B 5B2JB 3MGSC 5B24C 3WA9D 4CSRB 1U35A 4KGCD 4H9SA 2NQBA 1TZYC 3TU4D 3WAAC 1KX5C 3WTPA 3W97B 3AFAC 3LZ1A 5CP6A 1WWSA 4X23D 2RVQC 5BS7C 4XZQA 5B0ZC 1N1JB 3X1VA 2AROD 4J8XA 2NZDA 3W98D 5BNVB 5AV9A 3AZJA 2FJ7C 5G49B 3REIC 1M1AC 5B32B 1BFMA 3MVDA 1KX4A 3AZND 3O62D 3X1TD 1P3MD 3AYWB 1EQZD 3A6NC 1P3IB 3X1UD 5GT0B 3B0DB 1P3GC 3W96A 3UTAC 3R45B 5AY8B 5B1MD 3C1BA 4H9PB 3MGQA 3AZFD 4QLCC 2IO5C 1P3AA 2HIOA 3KUYA 3W99D 2PYOC 3AZID 3LJAB 3AZKD 5GT3A 5B31G 1S32B 5B31A 5AV5B 4JJNB 4Z66B 4Z5TA 1U35C 4H9SC 5KDMA 3LELD 3MNNA 1BH8A 3REJB 1ZLAA 4LD9A 2NQBC 3AZLA 3WTPC 2CV5B 2F8NG 2F8NA 5E5AD 3REKB 1P3PB 2YFWA 5AV8D 2JSSA 3LZ1C 5CP6C 3KXBA 1KX3A 1P3FB 1BH9A 1JFIA 1B6WA 4XZQC 3AZMB 2NZDC 3X1VC 4J8XC 5AV9C 3AZJC 3WA9B 3W97D 3MVDC 4H9QA 3AV2D 1KX4C 4KGCA 3TU4A 5B33D 3C1CB 5FUGA 5B2ID 5BO0B 5B32D 1M19D 3W96C 3RELA 4HGAC 3W98A 2AROB 3MGQC 5AVCA 3WAAA 3AYWD 3AZHB 3B6FB 1P3AC 1P3LB 4YM6B 2HIOC 3KUYC 2BYKA 4WU9A 4H9RB 3AZNB 3AZED 3NQUB 3X1TB 5GT0D 1P3MB 4J8UD 1P3OB 1EQZB 5GT3C 3NQJA 4WNNB 5B31C 3WTPE 4DRAA 3X1UB 3UTBD 5BT1C 5F99A 4Z5TC 1ZLAC 3MNNC 4LD9C 1F1EA 1M1AA 3AZLC 4CAYB 5B40B 5B1MA 4EO5B 5B24B 3AZFA 3LJAD 1TZYB 3KXBC 1KX3C 1P3BB 4G91C 1S32D 5AV5D 3B0BA 4JJND 4Z66D 3AZKA 5CPKD 3REJD 2CWEA 1P3KB 5JRGD 2CV5D 5B1LB 1M18B 5AV6D 3REKD 3KSYA 4KGCC 3LELA 3TU4C 1AOID 5JA4B 3REIB 5E5AB 3MGPD 3AZMD
chains in the Genus database with same CATH superfamily
5AV8A 4YS3D 1F66D 2RIQA 5B2JA 5GXQA 3V9RB 4CSRA 2HUEC 4KHAB 3RELC 3W98C 5AVCC 3LZ0D 3KWQD 3C1CD 4ZUXB 4J8VA 2Y2PA 4H9OB 3AV2B 4WU9C 4Z2MH 1TAFA 5DNNB 5B33B 4QLCB 1P34A 4KUDA 1N1JA 5CPID 5C3IC 4G92B 5F99C 2Y2OA 3EPKA 5B32G 5B2IB 3AZHD 5B32A 1P3LD 4YM6D 3B6FD 3B0CT 4AWLB 1M19B 5B1MC 3WKJA 3AZFC 5GSUA 3AZGB 1P3OD 3X1SB 3AN2B 1P3IA 3MGRB 4H9NB 3AZEB 4ZBJC 5GT0A 3AZKC 2BYMA 4J8UB 3VH5T 3R45A 2ZY5A 1ULYA 5AY8A 4H9PA 5B40D 5B24D 4WZSB 3UTBB 3AV1B 3LELC 2NZDB 1TZYD 2JCHA 4J8XB 5B0YB 1P3BD 1KX5D 5AV9B 3UT9A 3LJAA 5AV8C 1P3KD 1KU5A 5B2JC 5GXQC 4WV4B 5AV5A 5B1LD 1M18D 4Z66A 5CPJB 2L5AA 1HQ3B 3REJA 5CPKB 4WU8B 2CV5A 1ID3B 5JRGB 3REID 3REKA 3B6GB 1P3PA 5AV6B 4J8VC 3C1BB 2ZY4A 3VH5A 1P3FA 1AOIB 2BG1A 1P34C 4KUDC 1A7WA 3VH6T 3MGPB 4YS3B 4J8WB 1F66B 2LY8A 3WA9A 5B32C 4ZUXD 3WKJC 5GSUC 5DNND 3C1CA 4QLCD 3LZ0B 3KWQB 1BH8B 1PZRA 1P3IC 2PYOD 4NE3A 5GT0C 4X23A 5AVBB 5AY8C 4G91B 1BH9B 5CPIB 2AROA 1JFIB 3REHB 3AZGD 3B6FA 1P3LA 1U35D 4YM6A 2NQBD 3VH6A 4H9RA 3X1SD 5DNMB 3UT9C 3AN2D 3AZNA 3NQUA 3O62A 3MGRD 3LJAC 3X1TA 1P3MA 1P3OA 1R4VA 4NE6A 1EQZA 3LZ1D 5CP6D 4WNNA 5AV5C 3X1UA 4Z66C 4XUJB 3AV1D 4R8PB 3REJC 2NZDD 4J8XD 4CAYA 5B40A 5B0YD 2CV5C 5AV9D 3P5JB 3MGSB 3AZJD 3REKC 1P3PC 3RELB 1P3BA 1B67A 1P3FC 5AVCB 1KX5B 3W99A 3WAAB 5CPJD 3AZIA 1HQ3D 4E44A 3AZMC 1P3KA 2F8NH 4WU9B 4WU8D 3AFAB 1ID3D 5B1LA 1M18A 3WA9C 2G5HC 3B6GD 3W96D 3C1BD 5B0ZB 2VQRA 3C1CC 1WWIA 5E5AA 5BNXB 2FJ7B 4UUZB 1M1AB 4J8WD 2JE5A 3V9RA 4X23C 1H3OB 4KHAA 3B0CW 3IP4C 2AROC 2Y2NA 3A6NB 4ZBJB 4NE5A 5CHLB 4Z5TD 1P3LC 3B6FC 4YM6C 4ZUXA 3W97A 1ZLAD 3KFUG 3AV2A 3AZLD 1P3GB 2DQNC 2YFVB 3UTAB 3AZNC 3O62C 3X1TC 5DNNA 1P3MC 5B33A 1P3OC 2IO5B 1EQZC 5AVBD 1KX3D 3VH5W 2ZY2A 3X1UC 5BNVA 2PYOB 3REHD 5B2IA 5G49A 1M19A 5B40C 5GXQB 4EO5C 5DNMD 3AZGA 3AYWA 1U35B 3EG5B 1P3BC 2NQBB 3X1SA 3AN2A 3W99C 3WTPB 3MGRA 4H9NA 3AZEA 4XUJD 3AZIC 4J8VB 4E45A 4R8PD 1P3KC 3EPLA 4J8UA 3LZ1B 5CP6B 1TAFB 5B1LC 1M18C 3MGSD 3UTBA 1P34B 3AV1A 4KUDB 4XZQB 3RELD 5B0YA 3X1VB 2XD1A 5AVCD 3WAAD 5E5AC 3AZJB 3MVDB 3VH6W 1HTAA 4DRBA 4WU9D 1KX4B 3AFAD 3WKJB 2DF4C 5GSUB 1S32A 4JJNA 5CPJA 1HQ3A 2RVQD 5CPKA 4WU8A 5B0ZD 1ID3A 5JRGA 5F99D 3B6GA 2BYMB 4ZUXC 2FJ7D 5AV6A 3W97C 1M1AD 3AV2C 3W96B 4NFTA 4HGAB 1AOIA 5DNNC 3MGQB 3F6TA 5B33C 1P3AB 3MGPA 3AZMA 2HIOB 4YS3A 4G92C 4J8WA 3KUYB 1F66A 3UT9B 3A6ND 5B2IC 4AWLC 1M19C 3H0RC 2Y2LA 1P3GD 3H0LC 3UTAD 5GT3B 5B31B 3AZGC 3AYWC 3A1IA 3LZ0A 3KWQA 4Z5TB 5KDMB 1ZLAB 3MNNB 4LD9B 3X1SC 3AN2C 3AZLB 3MGRC 3AZEC 2F8NB 3B0DC 4J8UC 5BO0A 2YFWB 5AVBA 5B2JD 2XD5A 5GXQD 3KXBB 5CPIA 1KX3B 3UTBC 3REHA 3AV1C 3AZHA 5B0YC 5DNMA 3WTPD 1Q9CA 4J8VD 4H9QB 4KGCB 3TU4B 3H0MC 1S32C 2J8PA 4XUJA 4JJNC 5CPJC 1HQ3C 1P34D 4R8PA 4KUDD 5CPKC 4XZQD 4WU8C 1ID3C 3X1VD 5JRGC 3MGSA 5B24A 3B6GC 5FUGB 5AV6C 4X23B 4Z2MG 3MVDD 3C1BC 1KX4D 2HUEB 3WKJD 1TZYA 1AOIC 3W98B 1KX5A 5GSUD 3MGPC 4YS3C 4J8WC 1P3ID 2BYKB 3AFAA 1F66C 3O62B 3EPJA 5BS7A 4M6BA 5AY8D 5B0ZA 2Y2JA 3NQJB 5C3IB 3MGQD 5JA4A 5BNXA 5F99B 3LZ0C 3KWQC 2FJ7A 3REIA 1P3AD 4UUZA 2HIOD 3KUYD 5B1MB 3UT9D 3AZFB 1H3OA 5AVBC 5CPIC 3W99B 5GT3D 3A6NA 5B31D 3REHC 2UWXA 3AZIB 5BT1D 3AZHC 3AZKB 3MNND 1P3GA 2Y2HA 4H9OA 2YFVA 5DNMC 3UTAA 4LD9D 2F8ND 1P3PD 4QLCA 3LELB 1P3FD 3KXBD 2F8NK 4XUJC 2PYOA 4R8PC 5AV8B 2Y2KA 5B2JB 3MGSC 5B24C 3WA9D 1T3UA 4CSRB 1U35A 4KGCD 4H9SA 2NQBA 1TZYC 3TU4D 3WAAC 1KX5C 3WTPA 3W97B 3AFAC 3LZ1A 5CP6A 3AL0C 1WWSA 4X23D 2RVQC 5BS7C 4XZQA 5B0ZC 1N1JB 3X1VA 2AROD 4J8XA 2NZDA 3W98D 5BNVB 2Y2IA 5AV9A 3AZJA 2FJ7C 5G49B 3REIC 1M1AC 5B32B 1BFMA 3MVDA 1KX4A 3AZND 3O62D 3X1TD 1P3MD 3AYWB 1EQZD 3A6NC 1P3IB 3X1UD 5GT0B 3B0DB 1P3GC 3W96A 3UTAC 3R45B 5AY8B 5B1MD 3C1BA 4H9PB 3MGQA 3AZFD 4QLCC 2IO5C 1P3AA 2HIOA 3KUYA 3W99D 2PYOC 3AZID 3LJAB 3AZKD 4WJ3C 2ZM5A 5GT3A 5B31G 1S32B 5B31A 5AV5B 2F2AC 4JJNB 1W2EA 4Z66B 4Z5TA 1U35C 4H9SC 5KDMA 3LELD 3MNNA 1BH8A 3REJB 1ZLAA 4LD9A 2NQBC 3AZLA 3WTPC 2CV5B 2F8NG 2F8NA 5E5AD 3REKB 2G5IC 2Y2GA 1P3PB 2Y2MA 2YFWA 5AV8D 2JSSA 3LZ1C 5CP6C 3KXBA 1KX3A 1P3FB 1BH9A 1JFIA 1B6WA 4XZQC 3AZMB 2NZDC 3X1VC 4J8XC 5AV9C 4DQYB 3AZJC 3A1KA 3WA9B 2W8SA 3W97D 3MVDC 4H9QA 3AV2D 2Y2QA 1KX4C 4KGCA 3TU4A 5B33D 3C1CB 5FUGA 4UPKA 5B2ID 5BO0B 5B32D 1M19D 3W96C 3RELA 4HGAC 3W98A 2AROB 3MGQC 5AVCA 3WAAA 3AYWD 3AZHB 3B6FB 1P3AC 1P3LB 4YM6B 2HIOC 3KUYC 2BYKA 4WU9A 4H9RB 3AZNB 3AZED 3NQUB 3X1TB 5GT0D 1P3MB 4J8UD 1P3OB 1EQZB 2FFFB 5GT3C 3NQJA 4WNNB 5B31C 3WTPE 4DRAA 3X1UB 3UTBD 5BT1C 5F99A 4Z5TC 1ZLAC 3MNNC 4LD9C 1F1EA 1M1AA 3AZLC 4CAYB 5B40B 5B1MA 4EO5B 5B24B 3AZFA 3LJAD 1TZYB 3KXBC 1KX3C 1P3BB 2ZY3A 4G91C 1S32D 3EPHA 5AV5D 3B0BA 4JJND 4Z66D 3AZKA 5CPKD 3REJD 2CWEA 1P3KB 5JRGD 2CV5D 5B1LB 1M18B 5AV6D 3REKD 3KSYA 4KGCC 3LELA 3TU4C 1AOID 5JA4B 3FDDA 3REIB 5E5AB 1Z2CB 3MGPD 3AZMD
chains in the Genus database with same CATH topology
5AV8A 4YS3D 1F66D 2RIQA 5B2JA 5GXQA 3V9RB 4CSRA 2HUEC 4KHAB 3RELC 3W98C 5AVCC 3LZ0D 3KWQD 3C1CD 4ZUXB 4J8VA 2Y2PA 4H9OB 3AV2B 4WU9C 4Z2MH 1TAFA 5DNNB 5B33B 4QLCB 1P34A 4KUDA 1N1JA 5CPID 5C3IC 4G92B 5F99C 2Y2OA 3EPKA 5B32G 5B2IB 3AZHD 5B32A 1P3LD 4YM6D 3B6FD 3B0CT 4AWLB 1M19B 5B1MC 3WKJA 3AZFC 5GSUA 3AZGB 1P3OD 3X1SB 3AN2B 1P3IA 3MGRB 4H9NB 3AZEB 4ZBJC 5GT0A 3AZKC 2BYMA 4J8UB 3VH5T 3R45A 2ZY5A 1ULYA 5AY8A 4H9PA 5B40D 5B24D 4WZSB 3UTBB 3AV1B 3LELC 2NZDB 1TZYD 2JCHA 4J8XB 5B0YB 1P3BD 1KX5D 5AV9B 3UT9A 3LJAA 5AV8C 1P3KD 1KU5A 5B2JC 5GXQC 4WV4B 5AV5A 5B1LD 1M18D 4Z66A 5CPJB 2L5AA 1HQ3B 3REJA 5CPKB 4WU8B 2CV5A 1ID3B 5JRGB 3REID 3REKA 3B6GB 1P3PA 5AV6B 4J8VC 3C1BB 2ZY4A 3VH5A 1P3FA 1AOIB 2BG1A 1P34C 4KUDC 1A7WA 3VH6T 3MGPB 4YS3B 4J8WB 1F66B 2LY8A 3WA9A 5B32C 4ZUXD 3WKJC 5GSUC 5DNND 3C1CA 4QLCD 3LZ0B 3KWQB 1BH8B 1PZRA 1P3IC 2PYOD 4NE3A 5GT0C 4X23A 5AVBB 5AY8C 4G91B 1BH9B 5CPIB 2AROA 1JFIB 3REHB 3AZGD 3B6FA 1P3LA 1U35D 4YM6A 2NQBD 3VH6A 4H9RA 3X1SD 5DNMB 3UT9C 3AN2D 3AZNA 3NQUA 3O62A 3MGRD 3LJAC 3X1TA 1P3MA 1P3OA 1R4VA 4NE6A 1EQZA 3LZ1D 5CP6D 4WNNA 5AV5C 3X1UA 4Z66C 4XUJB 3AV1D 4R8PB 3REJC 2NZDD 4J8XD 4CAYA 5B40A 5B0YD 2CV5C 5AV9D 3P5JB 3MGSB 3AZJD 3REKC 1P3PC 3RELB 1P3BA 1B67A 1P3FC 5AVCB 1KX5B 3W99A 3WAAB 5CPJD 3AZIA 1HQ3D 4E44A 3AZMC 1P3KA 2F8NH 4WU9B 4WU8D 3AFAB 1ID3D 5B1LA 1M18A 3WA9C 2G5HC 3B6GD 3W96D 3C1BD 5B0ZB 2VQRA 3C1CC 1WWIA 5E5AA 5BNXB 2FJ7B 4UUZB 1M1AB 4J8WD 2JE5A 3V9RA 4X23C 1H3OB 4KHAA 3B0CW 3IP4C 2AROC 2Y2NA 3A6NB 4ZBJB 4NE5A 5CHLB 4Z5TD 1P3LC 3B6FC 4YM6C 4ZUXA 3W97A 1ZLAD 3KFUG 3AV2A 3AZLD 1P3GB 2DQNC 2YFVB 3UTAB 3AZNC 3O62C 3X1TC 5DNNA 1P3MC 5B33A 1P3OC 2IO5B 1EQZC 5AVBD 1KX3D 3VH5W 2ZY2A 3X1UC 5BNVA 2PYOB 3REHD 5B2IA 5G49A 1M19A 5B40C 5GXQB 4EO5C 5DNMD 3AZGA 3AYWA 1U35B 3EG5B 1P3BC 2NQBB 3X1SA 3AN2A 3W99C 3WTPB 3MGRA 4H9NA 3AZEA 4XUJD 3AZIC 4J8VB 4E45A 4R8PD 1P3KC 3EPLA 4J8UA 3LZ1B 5CP6B 1TAFB 5B1LC 1M18C 3MGSD 3UTBA 1P34B 3AV1A 4KUDB 4XZQB 3RELD 5B0YA 3X1VB 2XD1A 5AVCD 3WAAD 5E5AC 3AZJB 3MVDB 3VH6W 1HTAA 4DRBA 4WU9D 1KX4B 3AFAD 3WKJB 2DF4C 5GSUB 1S32A 4JJNA 5CPJA 1HQ3A 2RVQD 5CPKA 4WU8A 5B0ZD 1ID3A 5JRGA 5F99D 3B6GA 2BYMB 4ZUXC 2FJ7D 5AV6A 3W97C 1M1AD 3AV2C 3W96B 4NFTA 4HGAB 1AOIA 5DNNC 3MGQB 3F6TA 5B33C 1P3AB 3MGPA 3AZMA 2HIOB 4YS3A 4G92C 4J8WA 3KUYB 1F66A 3UT9B 3A6ND 5B2IC 4AWLC 1M19C 3H0RC 2Y2LA 1P3GD 3H0LC 3UTAD 5GT3B 5B31B 3AZGC 3AYWC 3A1IA 3LZ0A 3KWQA 4Z5TB 5KDMB 1ZLAB 3MNNB 4LD9B 3X1SC 3AN2C 3AZLB 3MGRC 3AZEC 2F8NB 3B0DC 4J8UC 5BO0A 2YFWB 5AVBA 5B2JD 2XD5A 5GXQD 3KXBB 5CPIA 1KX3B 3UTBC 3REHA 3AV1C 3AZHA 5B0YC 5DNMA 3WTPD 1Q9CA 4J8VD 4H9QB 4KGCB 3TU4B 3H0MC 1S32C 2J8PA 4XUJA 4JJNC 5CPJC 1HQ3C 1P34D 4R8PA 4KUDD 5CPKC 4XZQD 4WU8C 1ID3C 3X1VD 5JRGC 3MGSA 5B24A 3B6GC 5FUGB 5AV6C 4X23B 4Z2MG 3MVDD 3C1BC 1KX4D 2HUEB 3WKJD 1TZYA 1AOIC 3W98B 1KX5A 5GSUD 3MGPC 4YS3C 4J8WC 1P3ID 2BYKB 3AFAA 1F66C 3O62B 3EPJA 5BS7A 4M6BA 5AY8D 5B0ZA 2Y2JA 3NQJB 5C3IB 3MGQD 5JA4A 5BNXA 5F99B 3LZ0C 3KWQC 2FJ7A 3REIA 1P3AD 4UUZA 2HIOD 3KUYD 5B1MB 3UT9D 3AZFB 1H3OA 5AVBC 5CPIC 3W99B 5GT3D 3A6NA 5B31D 3REHC 2UWXA 3AZIB 5BT1D 3AZHC 3AZKB 3MNND 1P3GA 2Y2HA 4H9OA 2YFVA 5DNMC 3UTAA 4LD9D 2F8ND 1P3PD 4QLCA 3LELB 1P3FD 3KXBD 2F8NK 4XUJC 2PYOA 4R8PC 5AV8B 2Y2KA 5B2JB 3MGSC 5B24C 3WA9D 1T3UA 4CSRB 1U35A 4KGCD 4H9SA 2NQBA 1TZYC 3TU4D 3WAAC 1KX5C 3WTPA 3W97B 3AFAC 3LZ1A 5CP6A 3AL0C 1WWSA 4X23D 2RVQC 5BS7C 4XZQA 5B0ZC 1N1JB 3X1VA 2AROD 4J8XA 2NZDA 3W98D 5BNVB 2Y2IA 5AV9A 3AZJA 2FJ7C 5G49B 3REIC 1M1AC 5B32B 1BFMA 3MVDA 1KX4A 3AZND 3O62D 3X1TD 1P3MD 3AYWB 1EQZD 3A6NC 1P3IB 3X1UD 5GT0B 3B0DB 1P3GC 3W96A 3UTAC 3R45B 5AY8B 5B1MD 3C1BA 4H9PB 3MGQA 3AZFD 4QLCC 2IO5C 1P3AA 2HIOA 3KUYA 3W99D 2PYOC 3AZID 3LJAB 3AZKD 4WJ3C 2ZM5A 5GT3A 5B31G 1S32B 5B31A 5AV5B 2F2AC 4JJNB 1W2EA 4Z66B 4Z5TA 1U35C 4H9SC 5KDMA 3LELD 3MNNA 1BH8A 3REJB 1ZLAA 4LD9A 2NQBC 3AZLA 3WTPC 2CV5B 2F8NG 2F8NA 5E5AD 3REKB 2G5IC 2Y2GA 1P3PB 2Y2MA 2YFWA 5AV8D 2JSSA 3LZ1C 5CP6C 3KXBA 1KX3A 1P3FB 1BH9A 1JFIA 1B6WA 4XZQC 3AZMB 2NZDC 3X1VC 4J8XC 5AV9C 4DQYB 3AZJC 3A1KA 3WA9B 2W8SA 3W97D 3MVDC 4H9QA 3AV2D 2Y2QA 1KX4C 4KGCA 3TU4A 5B33D 3C1CB 5FUGA 4UPKA 5B2ID 5BO0B 5B32D 1M19D 3W96C 3RELA 4HGAC 3W98A 2AROB 3MGQC 5AVCA 3WAAA 3AYWD 3AZHB 3B6FB 1P3AC 1P3LB 4YM6B 2HIOC 3KUYC 2BYKA 4WU9A 4H9RB 3AZNB 3AZED 3NQUB 3X1TB 5GT0D 1P3MB 4J8UD 1P3OB 1EQZB 2FFFB 5GT3C 3NQJA 4WNNB 5B31C 3WTPE 4DRAA 3X1UB 3UTBD 5BT1C 5F99A 4Z5TC 1ZLAC 3MNNC 4LD9C 1F1EA 1M1AA 3AZLC 4CAYB 5B40B 5B1MA 4EO5B 5B24B 3AZFA 3LJAD 1TZYB 3KXBC 1KX3C 1P3BB 2ZY3A 4G91C 1S32D 3EPHA 5AV5D 3B0BA 4JJND 4Z66D 3AZKA 5CPKD 3REJD 2CWEA 1P3KB 5JRGD 2CV5D 5B1LB 1M18B 5AV6D 3REKD 3KSYA 4KGCC 3LELA 3TU4C 1AOID 5JA4B 3FDDA 3REIB 5E5AB 1Z2CB 3MGPD 3AZMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV8 A;  4YS3 D;  1F66 D;  5B2J A;  5GXQ A;  3V9R B;  4CSR A;  2HUE C;  4KHA B;  3REL C;  3W98 C;  5AVC C;  3LZ0 D;  3KWQ D;  3C1C D;  4ZUX B;  4J8V A;  4H9O B;  3AV2 B;  4WU9 C;  4Z2M H;  1TAF A;  5DNN B;  5B33 B;  4QLC B;  1P34 A;  4KUD A;  1N1J A;  5CPI D;  5C3I C;  4G92 B;  5F99 C;  3AZH D;  5B32 G;  5B2I B;  1P3L D;  5B32 A;  3B6F D;  4YM6 D;  3B0C T;  4AWL B;  1M19 B;  5B1M C;  3WKJ A;  3AZF C;  5GSU A;  3AZG B;  1P3O D;  3X1S B;  3AN2 B;  1P3I A;  3MGR B;  4H9N B;  3AZE B;  4ZBJ C;  5GT0 A;  3AZK C;  2BYM A;  4J8U B;  3VH5 T;  3R45 A;  5AY8 A;  1ULY A;  5B40 D;  4H9P A;  5B24 D;  4WZS B;  3UTB B;  3AV1 B;  3LEL C;  2NZD B;  1TZY D;  4J8X B;  5B0Y B;  1P3B D;  1KX5 D;  5AV9 B;  3UT9 A;  3LJA A;  5AV8 C;  1P3K D;  1KU5 A;  5B2J C;  5GXQ C;  4WV4 B;  5AV5 A;  5B1L D;  1M18 D;  4Z66 A;  5CPJ B;  2L5A A;  1HQ3 B;  3REJ A;  5CPK B;  4WU8 B;  2CV5 A;  1ID3 B;  5JRG B;  3REI D;  3REK A;  3B6G B;  1P3P A;  5AV6 B;  4J8V C;  3C1B B;  3VH5 A;  1P3F A;  1AOI B;  1P34 C;  4KUD C;  1A7W A;  3VH6 T;  3MGP B;  4YS3 B;  4J8W B;  1F66 B;  2LY8 A;  3WA9 A;  5B32 C;  4ZUX D;  3WKJ C;  5GSU C;  5DNN D;  3C1C A;  4QLC D;  3LZ0 B;  3KWQ B;  1BH8 B;  1P3I C;  2PYO D;  4NE3 A;  5GT0 C;  4X23 A;  5AVB B;  5AY8 C;  4G91 B;  1BH9 B;  5CPI B;  2ARO A;  1JFI B;  3REH B;  3AZG D;  3B6F A;  1P3L A;  1U35 D;  4YM6 A;  2NQB D;  3VH6 A;  4H9R A;  3X1S D;  5DNM B;  3UT9 C;  3AN2 D;  3AZN A;  3NQU A;  3O62 A;  3MGR D;  3LJA C;  3X1T A;  1P3M A;  1P3O A;  1R4V A;  4NE6 A;  1EQZ A;  3LZ1 D;  5CP6 D;  4WNN A;  5AV5 C;  3X1U A;  4Z66 C;  4XUJ B;  3AV1 D;  4R8P B;  3REJ C;  2NZD D;  4J8X D;  4CAY A;  5B40 A;  5B0Y D;  2CV5 C;  5AV9 D;  3AZJ D;  3MGS B;  3REK C;  1P3P C;  3REL B;  1P3B A;  1B67 A;  1P3F C;  5AVC B;  1KX5 B;  3W99 A;  3WAA B;  5CPJ D;  3AZI A;  1HQ3 D;  4E44 A;  3AZM C;  1P3K A;  2F8N H;  4WU9 B;  4WU8 D;  3AFA B;  1ID3 D;  5B1L A;  1M18 A;  3WA9 C;  3B6G D;  3W96 D;  3C1B D;  5B0Z B;  3C1C C;  1WWI A;  5E5A A;  5BNX B;  2FJ7 B;  4UUZ B;  1M1A B;  4J8W D;  3V9R A;  4X23 C;  1H3O B;  4KHA A;  3B0C W;  2ARO C;  3A6N B;  4ZBJ B;  4NE5 A;  5CHL B;  4Z5T D;  1P3L C;  3B6F C;  4YM6 C;  4ZUX A;  3W97 A;  1ZLA D;  3AV2 A;  3AZL D;  1P3G B;  2YFV B;  3UTA B;  3AZN C;  3O62 C;  3X1T C;  5DNN A;  1P3M C;  5B33 A;  1P3O C;  2IO5 B;  1EQZ C;  5AVB D;  1KX3 D;  3VH5 W;  3X1U C;  5BNV A;  2PYO B;  3REH D;  5B2I A;  5G49 A;  1M19 A;  5B40 C;  5GXQ B;  4EO5 C;  5DNM D;  3AZG A;  3AYW A;  1U35 B;  1P3B C;  2NQB B;  3X1S A;  3AN2 A;  3W99 C;  3WTP B;  3MGR A;  4H9N A;  3AZE A;  4XUJ D;  3AZI C;  4J8V B;  4E45 A;  4R8P D;  1P3K C;  4J8U A;  3LZ1 B;  5CP6 B;  1TAF B;  5B1L C;  1M18 C;  3MGS D;  3UTB A;  1P34 B;  3AV1 A;  4KUD B;  4XZQ B;  3REL D;  5B0Y A;  3X1V B;  5AVC D;  3WAA D;  5E5A C;  3AZJ B;  3MVD B;  3VH6 W;  1HTA A;  4DRB A;  4WU9 D;  1KX4 B;  3AFA D;  3WKJ B;  5GSU B;  1S32 A;  4JJN A;  5CPJ A;  1HQ3 A;  2RVQ D;  5CPK A;  4WU8 A;  5B0Z D;  1ID3 A;  5JRG A;  5F99 D;  3B6G A;  2BYM B;  4ZUX C;  2FJ7 D;  5AV6 A;  3W97 C;  1M1A D;  3AV2 C;  3W96 B;  4NFT A;  4HGA B;  1AOI A;  5DNN C;  3MGQ B;  5B33 C;  1P3A B;  3MGP A;  3AZM A;  2HIO B;  4YS3 A;  4G92 C;  4J8W A;  3KUY B;  1F66 A;  3UT9 B;  3A6N D;  5B2I C;  4AWL C;  1M19 C;  1P3G D;  3UTA D;  5GT3 B;  5B31 B;  3AZG C;  3AYW C;  3LZ0 A;  3KWQ A;  4Z5T B;  5KDM B;  1ZLA B;  3MNN B;  4LD9 B;  3X1S C;  3AN2 C;  3AZL B;  3MGR C;  3AZE C;  2F8N B;  3B0D C;  4J8U C;  5BO0 A;  2YFW B;  5AVB A;  5B2J D;  5GXQ D;  3KXB B;  5CPI A;  1KX3 B;  3UTB C;  3REH A;  3AV1 C;  3AZH A;  5B0Y C;  5DNM A;  3WTP D;  1Q9C A;  4J8V D;  4H9Q B;  4KGC B;  3TU4 B;  1S32 C;  4XUJ A;  4JJN C;  5CPJ C;  1HQ3 C;  1P34 D;  4R8P A;  4KUD D;  5CPK C;  4XZQ D;  4WU8 C;  1ID3 C;  3X1V D;  5JRG C;  3MGS A;  5B24 A;  3B6G C;  5FUG B;  5AV6 C;  4X23 B;  4Z2M G;  3MVD D;  3C1B C;  1KX4 D;  2HUE B;  3WKJ D;  1TZY A;  1AOI C;  3W98 B;  1KX5 A;  5GSU D;  3MGP C;  4YS3 C;  4J8W C;  1P3I D;  2BYK B;  3AFA A;  1F66 C;  3O62 B;  5BS7 A;  4M6B A;  5AY8 D;  5B0Z A;  3NQJ B;  5C3I B;  3MGQ D;  5JA4 A;  5BNX A;  5F99 B;  3LZ0 C;  3KWQ C;  2FJ7 A;  3REI A;  1P3A D;  4UUZ A;  2HIO D;  3KUY D;  5B1M B;  3UT9 D;  3AZF B;  1H3O A;  5AVB C;  5CPI C;  3W99 B;  5GT3 D;  3A6N A;  5B31 D;  3REH C;  3AZI B;  5BT1 D;  3AZH C;  3AZK B;  3MNN D;  1P3G A;  4LD9 D;  4H9O A;  2YFV A;  5DNM C;  3UTA A;  2F8N D;  1P3P D;  4QLC A;  3LEL B;  1P3F D;  3KXB D;  2F8N K;  4XUJ C;  2PYO A;  4R8P C;  5AV8 B;  5B2J B;  3MGS C;  5B24 C;  3WA9 D;  4CSR B;  1U35 A;  4KGC D;  4H9S A;  2NQB A;  1TZY C;  3TU4 D;  3WAA C;  1KX5 C;  3WTP A;  3W97 B;  3AFA C;  3LZ1 A;  5CP6 A;  1WWS A;  4X23 D;  2RVQ C;  5BS7 C;  4XZQ A;  5B0Z C;  1N1J B;  3X1V A;  2ARO D;  4J8X A;  2NZD A;  3W98 D;  5BNV B;  5AV9 A;  3AZJ A;  2FJ7 C;  5G49 B;  3REI C;  1M1A C;  5B32 B;  1BFM A;  3MVD A;  1KX4 A;  3AZN D;  3O62 D;  3X1T D;  1P3M D;  3AYW B;  1EQZ D;  3A6N C;  1P3I B;  3X1U D;  5GT0 B;  3B0D B;  1P3G C;  3W96 A;  3UTA C;  3R45 B;  5AY8 B;  5B1M D;  3C1B A;  4H9P B;  3MGQ A;  3AZF D;  4QLC C;  2IO5 C;  1P3A A;  2HIO A;  3KUY A;  3W99 D;  2PYO C;  3AZI D;  3LJA B;  3AZK D;  5GT3 A;  5B31 G;  1S32 B;  5B31 A;  5AV5 B;  4JJN B;  4Z66 B;  4Z5T A;  1U35 C;  4H9S C;  5KDM A;  3LEL D;  3MNN A;  1BH8 A;  3REJ B;  1ZLA A;  4LD9 A;  2NQB C;  3AZL A;  3WTP C;  2CV5 B;  2F8N G;  2F8N A;  5E5A D;  3REK B;  1P3P B;  2YFW A;  5AV8 D;  2JSS A;  3LZ1 C;  5CP6 C;  3KXB A;  1KX3 A;  1P3F B;  1BH9 A;  1JFI A;  1B6W A;  4XZQ C;  3AZM B;  2NZD C;  3X1V C;  4J8X C;  5AV9 C;  3AZJ C;  3WA9 B;  3W97 D;  3MVD C;  4H9Q A;  3AV2 D;  1KX4 C;  4KGC A;  3TU4 A;  5B33 D;  3C1C B;  5FUG A;  5B2I D;  5BO0 B;  5B32 D;  1M19 D;  3W96 C;  3REL A;  4HGA C;  3W98 A;  2ARO B;  3MGQ C;  5AVC A;  3WAA A;  3AYW D;  3AZH B;  3B6F B;  1P3A C;  1P3L B;  4YM6 B;  2HIO C;  3KUY C;  2BYK A;  4WU9 A;  4H9R B;  3AZN B;  3AZE D;  3NQU B;  3X1T B;  5GT0 D;  1P3M B;  4J8U D;  1P3O B;  1EQZ B;  5GT3 C;  3NQJ A;  4WNN B;  5B31 C;  3WTP E;  4DRA A;  3X1U B;  3UTB D;  5BT1 C;  5F99 A;  4Z5T C;  1ZLA C;  3MNN C;  4LD9 C;  1F1E A;  1M1A A;  3AZL C;  4CAY B;  5B40 B;  5B1M A;  4EO5 B;  5B24 B;  3AZF A;  3LJA D;  1TZY B;  3KXB C;  1KX3 C;  1P3B B;  4G91 C;  1S32 D;  5AV5 D;  3B0B A;  4JJN D;  4Z66 D;  3AZK A;  5CPK D;  3REJ D;  2CWE A;  1P3K B;  5JRG D;  2CV5 D;  5B1L B;  1M18 B;  5AV6 D;  3REK D;  3KSY A;  4KGC C;  3LEL A;  3TU4 C;  1AOI D;  5JA4 B;  3REI B;  5E5A B;  3MGP D;  3AZM D; 
#chains in the Genus database with same CATH topology
 5AV8 A;  4YS3 D;  1F66 D;  2RIQ A;  5B2J A;  5GXQ A;  3V9R B;  4CSR A;  2HUE C;  4KHA B;  3REL C;  3W98 C;  5AVC C;  3LZ0 D;  3KWQ D;  3C1C D;  4ZUX B;  4J8V A;  2Y2P A;  4H9O B;  3AV2 B;  4WU9 C;  4Z2M H;  1TAF A;  5DNN B;  5B33 B;  4QLC B;  1P34 A;  4KUD A;  1N1J A;  5CPI D;  5C3I C;  4G92 B;  5F99 C;  2Y2O A;  3EPK A;  5B32 G;  5B2I B;  3AZH D;  5B32 A;  1P3L D;  4YM6 D;  3B6F D;  3B0C T;  4AWL B;  1M19 B;  5B1M C;  3WKJ A;  3AZF C;  5GSU A;  3AZG B;  1P3O D;  3X1S B;  3AN2 B;  1P3I A;  3MGR B;  4H9N B;  3AZE B;  4ZBJ C;  5GT0 A;  3AZK C;  2BYM A;  4J8U B;  3VH5 T;  3R45 A;  2ZY5 A;  1ULY A;  5AY8 A;  4H9P A;  5B40 D;  5B24 D;  4WZS B;  3UTB B;  3AV1 B;  3LEL C;  2NZD B;  1TZY D;  2JCH A;  4J8X B;  5B0Y B;  1P3B D;  1KX5 D;  5AV9 B;  3UT9 A;  3LJA A;  5AV8 C;  1P3K D;  1KU5 A;  5B2J C;  5GXQ C;  4WV4 B;  5AV5 A;  5B1L D;  1M18 D;  4Z66 A;  5CPJ B;  2L5A A;  1HQ3 B;  3REJ A;  5CPK B;  4WU8 B;  2CV5 A;  1ID3 B;  5JRG B;  3REI D;  3REK A;  3B6G B;  1P3P A;  5AV6 B;  4J8V C;  3C1B B;  2ZY4 A;  3VH5 A;  1P3F A;  1AOI B;  2BG1 A;  1P34 C;  4KUD C;  1A7W A;  3VH6 T;  3MGP B;  4YS3 B;  4J8W B;  1F66 B;  2LY8 A;  3WA9 A;  5B32 C;  4ZUX D;  3WKJ C;  5GSU C;  5DNN D;  3C1C A;  4QLC D;  3LZ0 B;  3KWQ B;  1BH8 B;  1PZR A;  1P3I C;  2PYO D;  4NE3 A;  5GT0 C;  4X23 A;  5AVB B;  5AY8 C;  4G91 B;  1BH9 B;  5CPI B;  2ARO A;  1JFI B;  3REH B;  3AZG D;  3B6F A;  1P3L A;  1U35 D;  4YM6 A;  2NQB D;  3VH6 A;  4H9R A;  3X1S D;  5DNM B;  3UT9 C;  3AN2 D;  3AZN A;  3NQU A;  3O62 A;  3MGR D;  3LJA C;  3X1T A;  1P3M A;  1P3O A;  1R4V A;  4NE6 A;  1EQZ A;  3LZ1 D;  5CP6 D;  4WNN A;  5AV5 C;  3X1U A;  4Z66 C;  4XUJ B;  3AV1 D;  4R8P B;  3REJ C;  2NZD D;  4J8X D;  4CAY A;  5B40 A;  5B0Y D;  2CV5 C;  5AV9 D;  3P5J B;  3MGS B;  3AZJ D;  3REK C;  1P3P C;  3REL B;  1P3B A;  1B67 A;  1P3F C;  5AVC B;  1KX5 B;  3W99 A;  3WAA B;  5CPJ D;  3AZI A;  1HQ3 D;  4E44 A;  3AZM C;  1P3K A;  2F8N H;  4WU9 B;  4WU8 D;  3AFA B;  1ID3 D;  5B1L A;  1M18 A;  3WA9 C;  2G5H C;  3B6G D;  3W96 D;  3C1B D;  5B0Z B;  2VQR A;  3C1C C;  1WWI A;  5E5A A;  5BNX B;  2FJ7 B;  4UUZ B;  1M1A B;  4J8W D;  2JE5 A;  3V9R A;  4X23 C;  1H3O B;  4KHA A;  3B0C W;  3IP4 C;  2ARO C;  2Y2N A;  3A6N B;  4ZBJ B;  4NE5 A;  5CHL B;  4Z5T D;  1P3L C;  3B6F C;  4YM6 C;  4ZUX A;  3W97 A;  1ZLA D;  3KFU G;  3AV2 A;  3AZL D;  1P3G B;  2DQN C;  2YFV B;  3UTA B;  3AZN C;  3O62 C;  3X1T C;  5DNN A;  1P3M C;  5B33 A;  1P3O C;  2IO5 B;  1EQZ C;  5AVB D;  1KX3 D;  3VH5 W;  2ZY2 A;  3X1U C;  5BNV A;  2PYO B;  3REH D;  5B2I A;  5G49 A;  1M19 A;  5B40 C;  5GXQ B;  4EO5 C;  5DNM D;  3AZG A;  3AYW A;  1U35 B;  3EG5 B;  1P3B C;  2NQB B;  3X1S A;  3AN2 A;  3W99 C;  3WTP B;  3MGR A;  4H9N A;  3AZE A;  4XUJ D;  3AZI C;  4J8V B;  4E45 A;  4R8P D;  1P3K C;  3EPL A;  4J8U A;  3LZ1 B;  5CP6 B;  1TAF B;  5B1L C;  1M18 C;  3MGS D;  3UTB A;  1P34 B;  3AV1 A;  4KUD B;  4XZQ B;  3REL D;  5B0Y A;  3X1V B;  2XD1 A;  5AVC D;  3WAA D;  5E5A C;  3AZJ B;  3MVD B;  3VH6 W;  1HTA A;  4DRB A;  4WU9 D;  1KX4 B;  3AFA D;  3WKJ B;  2DF4 C;  5GSU B;  1S32 A;  4JJN A;  5CPJ A;  1HQ3 A;  2RVQ D;  5CPK A;  4WU8 A;  5B0Z D;  1ID3 A;  5JRG A;  5F99 D;  3B6G A;  2BYM B;  4ZUX C;  2FJ7 D;  5AV6 A;  3W97 C;  1M1A D;  3AV2 C;  3W96 B;  4NFT A;  4HGA B;  1AOI A;  5DNN C;  3MGQ B;  3F6T A;  5B33 C;  1P3A B;  3MGP A;  3AZM A;  2HIO B;  4YS3 A;  4G92 C;  4J8W A;  3KUY B;  1F66 A;  3UT9 B;  3A6N D;  5B2I C;  4AWL C;  1M19 C;  3H0R C;  2Y2L A;  1P3G D;  3H0L C;  3UTA D;  5GT3 B;  5B31 B;  3AZG C;  3AYW C;  3A1I A;  3LZ0 A;  3KWQ A;  4Z5T B;  5KDM B;  1ZLA B;  3MNN B;  4LD9 B;  3X1S C;  3AN2 C;  3AZL B;  3MGR C;  3AZE C;  2F8N B;  3B0D C;  4J8U C;  5BO0 A;  2YFW B;  5AVB A;  5B2J D;  2XD5 A;  5GXQ D;  3KXB B;  5CPI A;  1KX3 B;  3UTB C;  3REH A;  3AV1 C;  3AZH A;  5B0Y C;  5DNM A;  3WTP D;  1Q9C A;  4J8V D;  4H9Q B;  4KGC B;  3TU4 B;  3H0M C;  1S32 C;  2J8P A;  4XUJ A;  4JJN C;  5CPJ C;  1HQ3 C;  1P34 D;  4R8P A;  4KUD D;  5CPK C;  4XZQ D;  4WU8 C;  1ID3 C;  3X1V D;  5JRG C;  3MGS A;  5B24 A;  3B6G C;  5FUG B;  5AV6 C;  4X23 B;  4Z2M G;  3MVD D;  3C1B C;  1KX4 D;  2HUE B;  3WKJ D;  1TZY A;  1AOI C;  3W98 B;  1KX5 A;  5GSU D;  3MGP C;  4YS3 C;  4J8W C;  1P3I D;  2BYK B;  3AFA A;  1F66 C;  3O62 B;  3EPJ A;  5BS7 A;  4M6B A;  5AY8 D;  5B0Z A;  2Y2J A;  3NQJ B;  5C3I B;  3MGQ D;  5JA4 A;  5BNX A;  5F99 B;  3LZ0 C;  3KWQ C;  2FJ7 A;  3REI A;  1P3A D;  4UUZ A;  2HIO D;  3KUY D;  5B1M B;  3UT9 D;  3AZF B;  1H3O A;  5AVB C;  5CPI C;  3W99 B;  5GT3 D;  3A6N A;  5B31 D;  3REH C;  2UWX A;  3AZI B;  5BT1 D;  3AZH C;  3AZK B;  3MNN D;  1P3G A;  2Y2H A;  4H9O A;  2YFV A;  5DNM C;  3UTA A;  4LD9 D;  2F8N D;  1P3P D;  4QLC A;  3LEL B;  1P3F D;  3KXB D;  2F8N K;  4XUJ C;  2PYO A;  4R8P C;  5AV8 B;  2Y2K A;  5B2J B;  3MGS C;  5B24 C;  3WA9 D;  1T3U A;  4CSR B;  1U35 A;  4KGC D;  4H9S A;  2NQB A;  1TZY C;  3TU4 D;  3WAA C;  1KX5 C;  3WTP A;  3W97 B;  3AFA C;  3LZ1 A;  5CP6 A;  3AL0 C;  1WWS A;  4X23 D;  2RVQ C;  5BS7 C;  4XZQ A;  5B0Z C;  1N1J B;  3X1V A;  2ARO D;  4J8X A;  2NZD A;  3W98 D;  5BNV B;  2Y2I A;  5AV9 A;  3AZJ A;  2FJ7 C;  5G49 B;  3REI C;  1M1A C;  5B32 B;  1BFM A;  3MVD A;  1KX4 A;  3AZN D;  3O62 D;  3X1T D;  1P3M D;  3AYW B;  1EQZ D;  3A6N C;  1P3I B;  3X1U D;  5GT0 B;  3B0D B;  1P3G C;  3W96 A;  3UTA C;  3R45 B;  5AY8 B;  5B1M D;  3C1B A;  4H9P B;  3MGQ A;  3AZF D;  4QLC C;  2IO5 C;  1P3A A;  2HIO A;  3KUY A;  3W99 D;  2PYO C;  3AZI D;  3LJA B;  3AZK D;  4WJ3 C;  2ZM5 A;  5GT3 A;  5B31 G;  1S32 B;  5B31 A;  5AV5 B;  2F2A C;  4JJN B;  1W2E A;  4Z66 B;  4Z5T A;  1U35 C;  4H9S C;  5KDM A;  3LEL D;  3MNN A;  1BH8 A;  3REJ B;  1ZLA A;  4LD9 A;  2NQB C;  3AZL A;  3WTP C;  2CV5 B;  2F8N G;  2F8N A;  5E5A D;  3REK B;  2G5I C;  2Y2G A;  1P3P B;  2Y2M A;  2YFW A;  5AV8 D;  2JSS A;  3LZ1 C;  5CP6 C;  3KXB A;  1KX3 A;  1P3F B;  1BH9 A;  1JFI A;  1B6W A;  4XZQ C;  3AZM B;  2NZD C;  3X1V C;  4J8X C;  5AV9 C;  4DQY B;  3AZJ C;  3A1K A;  3WA9 B;  2W8S A;  3W97 D;  3MVD C;  4H9Q A;  3AV2 D;  2Y2Q A;  1KX4 C;  4KGC A;  3TU4 A;  5B33 D;  3C1C B;  5FUG A;  4UPK A;  5B2I D;  5BO0 B;  5B32 D;  1M19 D;  3W96 C;  3REL A;  4HGA C;  3W98 A;  2ARO B;  3MGQ C;  5AVC A;  3WAA A;  3AYW D;  3AZH B;  3B6F B;  1P3A C;  1P3L B;  4YM6 B;  2HIO C;  3KUY C;  2BYK A;  4WU9 A;  4H9R B;  3AZN B;  3AZE D;  3NQU B;  3X1T B;  5GT0 D;  1P3M B;  4J8U D;  1P3O B;  1EQZ B;  2FFF B;  5GT3 C;  3NQJ A;  4WNN B;  5B31 C;  3WTP E;  4DRA A;  3X1U B;  3UTB D;  5BT1 C;  5F99 A;  4Z5T C;  1ZLA C;  3MNN C;  4LD9 C;  1F1E A;  1M1A A;  3AZL C;  4CAY B;  5B40 B;  5B1M A;  4EO5 B;  5B24 B;  3AZF A;  3LJA D;  1TZY B;  3KXB C;  1KX3 C;  1P3B B;  2ZY3 A;  4G91 C;  1S32 D;  3EPH A;  5AV5 D;  3B0B A;  4JJN D;  4Z66 D;  3AZK A;  5CPK D;  3REJ D;  2CWE A;  1P3K B;  5JRG D;  2CV5 D;  5B1L B;  1M18 B;  5AV6 D;  3REK D;  3KSY A;  4KGC C;  3LEL A;  3TU4 C;  1AOI D;  5JA4 B;  3FDD A;  3REI B;  5E5A B;  1Z2C B;  3MGP D;  3AZM D; 
#chains in the Genus database with same CATH homology
 5AV8 A;  4YS3 D;  1F66 D;  2RIQ A;  5B2J A;  5GXQ A;  3V9R B;  4CSR A;  2HUE C;  4KHA B;  3REL C;  3W98 C;  5AVC C;  3LZ0 D;  3KWQ D;  3C1C D;  4ZUX B;  4J8V A;  2Y2P A;  4H9O B;  3AV2 B;  4WU9 C;  4Z2M H;  1TAF A;  5DNN B;  5B33 B;  4QLC B;  1P34 A;  4KUD A;  1N1J A;  5CPI D;  5C3I C;  4G92 B;  5F99 C;  2Y2O A;  3EPK A;  5B32 G;  5B2I B;  3AZH D;  5B32 A;  1P3L D;  4YM6 D;  3B6F D;  3B0C T;  4AWL B;  1M19 B;  5B1M C;  3WKJ A;  3AZF C;  5GSU A;  3AZG B;  1P3O D;  3X1S B;  3AN2 B;  1P3I A;  3MGR B;  4H9N B;  3AZE B;  4ZBJ C;  5GT0 A;  3AZK C;  2BYM A;  4J8U B;  3VH5 T;  3R45 A;  2ZY5 A;  1ULY A;  5AY8 A;  4H9P A;  5B40 D;  5B24 D;  4WZS B;  3UTB B;  3AV1 B;  3LEL C;  2NZD B;  1TZY D;  2JCH A;  4J8X B;  5B0Y B;  1P3B D;  1KX5 D;  5AV9 B;  3UT9 A;  3LJA A;  5AV8 C;  1P3K D;  1KU5 A;  5B2J C;  5GXQ C;  4WV4 B;  5AV5 A;  5B1L D;  1M18 D;  4Z66 A;  5CPJ B;  2L5A A;  1HQ3 B;  3REJ A;  5CPK B;  4WU8 B;  2CV5 A;  1ID3 B;  5JRG B;  3REI D;  3REK A;  3B6G B;  1P3P A;  5AV6 B;  4J8V C;  3C1B B;  2ZY4 A;  3VH5 A;  1P3F A;  1AOI B;  2BG1 A;  1P34 C;  4KUD C;  1A7W A;  3VH6 T;  3MGP B;  4YS3 B;  4J8W B;  1F66 B;  2LY8 A;  3WA9 A;  5B32 C;  4ZUX D;  3WKJ C;  5GSU C;  5DNN D;  3C1C A;  4QLC D;  3LZ0 B;  3KWQ B;  1BH8 B;  1PZR A;  1P3I C;  2PYO D;  4NE3 A;  5GT0 C;  4X23 A;  5AVB B;  5AY8 C;  4G91 B;  1BH9 B;  5CPI B;  2ARO A;  1JFI B;  3REH B;  3AZG D;  3B6F A;  1P3L A;  1U35 D;  4YM6 A;  2NQB D;  3VH6 A;  4H9R A;  3X1S D;  5DNM B;  3UT9 C;  3AN2 D;  3AZN A;  3NQU A;  3O62 A;  3MGR D;  3LJA C;  3X1T A;  1P3M A;  1P3O A;  1R4V A;  4NE6 A;  1EQZ A;  3LZ1 D;  5CP6 D;  4WNN A;  5AV5 C;  3X1U A;  4Z66 C;  4XUJ B;  3AV1 D;  4R8P B;  3REJ C;  2NZD D;  4J8X D;  4CAY A;  5B40 A;  5B0Y D;  2CV5 C;  5AV9 D;  3P5J B;  3MGS B;  3AZJ D;  3REK C;  1P3P C;  3REL B;  1P3B A;  1B67 A;  1P3F C;  5AVC B;  1KX5 B;  3W99 A;  3WAA B;  5CPJ D;  3AZI A;  1HQ3 D;  4E44 A;  3AZM C;  1P3K A;  2F8N H;  4WU9 B;  4WU8 D;  3AFA B;  1ID3 D;  5B1L A;  1M18 A;  3WA9 C;  2G5H C;  3B6G D;  3W96 D;  3C1B D;  5B0Z B;  2VQR A;  3C1C C;  1WWI A;  5E5A A;  5BNX B;  2FJ7 B;  4UUZ B;  1M1A B;  4J8W D;  2JE5 A;  3V9R A;  4X23 C;  1H3O B;  4KHA A;  3B0C W;  3IP4 C;  2ARO C;  2Y2N A;  3A6N B;  4ZBJ B;  4NE5 A;  5CHL B;  4Z5T D;  1P3L C;  3B6F C;  4YM6 C;  4ZUX A;  3W97 A;  1ZLA D;  3KFU G;  3AV2 A;  3AZL D;  1P3G B;  2DQN C;  2YFV B;  3UTA B;  3AZN C;  3O62 C;  3X1T C;  5DNN A;  1P3M C;  5B33 A;  1P3O C;  2IO5 B;  1EQZ C;  5AVB D;  1KX3 D;  3VH5 W;  2ZY2 A;  3X1U C;  5BNV A;  2PYO B;  3REH D;  5B2I A;  5G49 A;  1M19 A;  5B40 C;  5GXQ B;  4EO5 C;  5DNM D;  3AZG A;  3AYW A;  1U35 B;  3EG5 B;  1P3B C;  2NQB B;  3X1S A;  3AN2 A;  3W99 C;  3WTP B;  3MGR A;  4H9N A;  3AZE A;  4XUJ D;  3AZI C;  4J8V B;  4E45 A;  4R8P D;  1P3K C;  3EPL A;  4J8U A;  3LZ1 B;  5CP6 B;  1TAF B;  5B1L C;  1M18 C;  3MGS D;  3UTB A;  1P34 B;  3AV1 A;  4KUD B;  4XZQ B;  3REL D;  5B0Y A;  3X1V B;  2XD1 A;  5AVC D;  3WAA D;  5E5A C;  3AZJ B;  3MVD B;  3VH6 W;  1HTA A;  4DRB A;  4WU9 D;  1KX4 B;  3AFA D;  3WKJ B;  2DF4 C;  5GSU B;  1S32 A;  4JJN A;  5CPJ A;  1HQ3 A;  2RVQ D;  5CPK A;  4WU8 A;  5B0Z D;  1ID3 A;  5JRG A;  5F99 D;  3B6G A;  2BYM B;  4ZUX C;  2FJ7 D;  5AV6 A;  3W97 C;  1M1A D;  3AV2 C;  3W96 B;  4NFT A;  4HGA B;  1AOI A;  5DNN C;  3MGQ B;  3F6T A;  5B33 C;  1P3A B;  3MGP A;  3AZM A;  2HIO B;  4YS3 A;  4G92 C;  4J8W A;  3KUY B;  1F66 A;  3UT9 B;  3A6N D;  5B2I C;  4AWL C;  1M19 C;  3H0R C;  2Y2L A;  1P3G D;  3H0L C;  3UTA D;  5GT3 B;  5B31 B;  3AZG C;  3AYW C;  3A1I A;  3LZ0 A;  3KWQ A;  4Z5T B;  5KDM B;  1ZLA B;  3MNN B;  4LD9 B;  3X1S C;  3AN2 C;  3AZL B;  3MGR C;  3AZE C;  2F8N B;  3B0D C;  4J8U C;  5BO0 A;  2YFW B;  5AVB A;  5B2J D;  2XD5 A;  5GXQ D;  3KXB B;  5CPI A;  1KX3 B;  3UTB C;  3REH A;  3AV1 C;  3AZH A;  5B0Y C;  5DNM A;  3WTP D;  1Q9C A;  4J8V D;  4H9Q B;  4KGC B;  3TU4 B;  3H0M C;  1S32 C;  2J8P A;  4XUJ A;  4JJN C;  5CPJ C;  1HQ3 C;  1P34 D;  4R8P A;  4KUD D;  5CPK C;  4XZQ D;  4WU8 C;  1ID3 C;  3X1V D;  5JRG C;  3MGS A;  5B24 A;  3B6G C;  5FUG B;  5AV6 C;  4X23 B;  4Z2M G;  3MVD D;  3C1B C;  1KX4 D;  2HUE B;  3WKJ D;  1TZY A;  1AOI C;  3W98 B;  1KX5 A;  5GSU D;  3MGP C;  4YS3 C;  4J8W C;  1P3I D;  2BYK B;  3AFA A;  1F66 C;  3O62 B;  3EPJ A;  5BS7 A;  4M6B A;  5AY8 D;  5B0Z A;  2Y2J A;  3NQJ B;  5C3I B;  3MGQ D;  5JA4 A;  5BNX A;  5F99 B;  3LZ0 C;  3KWQ C;  2FJ7 A;  3REI A;  1P3A D;  4UUZ A;  2HIO D;  3KUY D;  5B1M B;  3UT9 D;  3AZF B;  1H3O A;  5AVB C;  5CPI C;  3W99 B;  5GT3 D;  3A6N A;  5B31 D;  3REH C;  2UWX A;  3AZI B;  5BT1 D;  3AZH C;  3AZK B;  3MNN D;  1P3G A;  2Y2H A;  4H9O A;  2YFV A;  5DNM C;  3UTA A;  4LD9 D;  2F8N D;  1P3P D;  4QLC A;  3LEL B;  1P3F D;  3KXB D;  2F8N K;  4XUJ C;  2PYO A;  4R8P C;  5AV8 B;  2Y2K A;  5B2J B;  3MGS C;  5B24 C;  3WA9 D;  1T3U A;  4CSR B;  1U35 A;  4KGC D;  4H9S A;  2NQB A;  1TZY C;  3TU4 D;  3WAA C;  1KX5 C;  3WTP A;  3W97 B;  3AFA C;  3LZ1 A;  5CP6 A;  3AL0 C;  1WWS A;  4X23 D;  2RVQ C;  5BS7 C;  4XZQ A;  5B0Z C;  1N1J B;  3X1V A;  2ARO D;  4J8X A;  2NZD A;  3W98 D;  5BNV B;  2Y2I A;  5AV9 A;  3AZJ A;  2FJ7 C;  5G49 B;  3REI C;  1M1A C;  5B32 B;  1BFM A;  3MVD A;  1KX4 A;  3AZN D;  3O62 D;  3X1T D;  1P3M D;  3AYW B;  1EQZ D;  3A6N C;  1P3I B;  3X1U D;  5GT0 B;  3B0D B;  1P3G C;  3W96 A;  3UTA C;  3R45 B;  5AY8 B;  5B1M D;  3C1B A;  4H9P B;  3MGQ A;  3AZF D;  4QLC C;  2IO5 C;  1P3A A;  2HIO A;  3KUY A;  3W99 D;  2PYO C;  3AZI D;  3LJA B;  3AZK D;  4WJ3 C;  2ZM5 A;  5GT3 A;  5B31 G;  1S32 B;  5B31 A;  5AV5 B;  2F2A C;  4JJN B;  1W2E A;  4Z66 B;  4Z5T A;  1U35 C;  4H9S C;  5KDM A;  3LEL D;  3MNN A;  1BH8 A;  3REJ B;  1ZLA A;  4LD9 A;  2NQB C;  3AZL A;  3WTP C;  2CV5 B;  2F8N G;  2F8N A;  5E5A D;  3REK B;  2G5I C;  2Y2G A;  1P3P B;  2Y2M A;  2YFW A;  5AV8 D;  2JSS A;  3LZ1 C;  5CP6 C;  3KXB A;  1KX3 A;  1P3F B;  1BH9 A;  1JFI A;  1B6W A;  4XZQ C;  3AZM B;  2NZD C;  3X1V C;  4J8X C;  5AV9 C;  4DQY B;  3AZJ C;  3A1K A;  3WA9 B;  2W8S A;  3W97 D;  3MVD C;  4H9Q A;  3AV2 D;  2Y2Q A;  1KX4 C;  4KGC A;  3TU4 A;  5B33 D;  3C1C B;  5FUG A;  4UPK A;  5B2I D;  5BO0 B;  5B32 D;  1M19 D;  3W96 C;  3REL A;  4HGA C;  3W98 A;  2ARO B;  3MGQ C;  5AVC A;  3WAA A;  3AYW D;  3AZH B;  3B6F B;  1P3A C;  1P3L B;  4YM6 B;  2HIO C;  3KUY C;  2BYK A;  4WU9 A;  4H9R B;  3AZN B;  3AZE D;  3NQU B;  3X1T B;  5GT0 D;  1P3M B;  4J8U D;  1P3O B;  1EQZ B;  2FFF B;  5GT3 C;  3NQJ A;  4WNN B;  5B31 C;  3WTP E;  4DRA A;  3X1U B;  3UTB D;  5BT1 C;  5F99 A;  4Z5T C;  1ZLA C;  3MNN C;  4LD9 C;  1F1E A;  1M1A A;  3AZL C;  4CAY B;  5B40 B;  5B1M A;  4EO5 B;  5B24 B;  3AZF A;  3LJA D;  1TZY B;  3KXB C;  1KX3 C;  1P3B B;  2ZY3 A;  4G91 C;  1S32 D;  3EPH A;  5AV5 D;  3B0B A;  4JJN D;  4Z66 D;  3AZK A;  5CPK D;  3REJ D;  2CWE A;  1P3K B;  5JRG D;  2CV5 D;  5B1L B;  1M18 B;  5AV6 D;  3REK D;  3KSY A;  4KGC C;  3LEL A;  3TU4 C;  1AOI D;  5JA4 B;  3FDD A;  3REI B;  5E5A B;  1Z2C B;  3MGP D;  3AZM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...