4NE3A

Human mhf1-mhf2 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
93
structure length
93
Chain Sequence
SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 30
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ne3A00
5GT0B 5B33A 3AZJA 3AZGA 3B0DC 1TZYB 5CPJC 3LJAD 1B67A 1TAFB 4Z66C 3WA9B 3LZ0A 4CAYA 5AV9B 3LELA 2HIOA 1U35B 4XUJA 1HQ3D 5CPKD 1AOIB 2CV5A 1A7WA 1F1EA 3O62A 3TU4B 5B2JC 3RELA 5AV8C 3X1UC 2BYKA 3W97C 3REKB 3AZKA 4CSRA 3MNNB 1F66D 1WWSA 1M18B 5AVCA 1P3PB 3W98A 5CHLB 1P3IB 1Q9CA 3MVDC 4ZUXA 5B1LD 2PYOB 3AZNA 3WKJC 2JSSA 3MGSC 2RVQD 1EQZA 1M1AC 3A6ND 2YFVB 3WTPD 5B33C 3AZJC 3AZGC 3AZLA 3B0CT 1KX3B 5FUGB 1ID3D 4XZQA 5B31B 3LZ0C 5B24A 3C1CA 4G92B 1P3LB 2HUEB 5B0ZB 3LELC 5CP6A 2HIOC 3X1TA 2YFWB 1P3KC 4XUJC 5CPIC 4LD9B 2CV5C 3VH6T 3AV1B 4M6BA 3KWQB 3AZFB 3MGPD 3UTBD 4YS3A 3RELC 5B1MA 3NQJA 5AY8A 5B2IB 3C1BA 4J8VA 5B32B 1M19B 4J8UB 5AVCC 3W98C 4Z2MG 5E5AA 3AV2A 3MGRA 4QLCA 2FJ7D 1KU5A 3REHD 4NE5A 5GXQD 4ZUXC 5GT0D 3UT9B 4J8XC 5BT1C 3AZNC 1TZYD 3MGQB 1EQZC 1BH9B 4WU8A 5JA4B 1AOID 4XZQC 4EO5B 5B24C 3WAAA 1P3OA 1P3IC 5CP6C 3X1TC 2F8NA 1HQ3B 5CPKB 3REKD 5B0YD 3MNND 1P3AD 1M18D 5DNNA 5AY8C 4G91B 1P3PD 3C1BC 1S32A 5AVBD 4J8VC 4X23A 5JRGC 3AZEB 1KX5A 2PYOD 5AV5A 5E5AC 3AV2C 3VH5W 4QLCC 2NZDA 3AZHD 3AFAC 4KGCD 3VH6W 1P3FC 2F8NK 4Z66A 4H9PA 3B6GD 5B0ZD 3A6NB 3WTPB 4H9NB 1F66A 4WU8C 4LD9D 3NQUA 1ID3B 3REIA 3VH6A 1P3OC 1BH8B 3AN2B 4Z5TB 4H9QB 2AROD 1ZLAA 3UTAA 5DNMA 3UTBB 3B6FD 5BO0A 5B32D 5DNNC 4J8UD 5BNVA 4J8WD 5F99D 1P3GD 3LJAC 3MVDA 4X23C 5G49A 1KX5C 5GT3A 2LY8A 3AZMA 3KXBB 3WKJA 4H9SA 2FJ7B 4DRBA 3MGQD 5AV6D 5GXQB 3MGPA 2NQBB 4H9OB 1P3MD 4E45A 1F66C 4R8PD 1KX4D 1P3KA 5CPIA 2IO5B 3REIC 4KHAB 3AZID 4WNNB 3KUYD 4H9RB 5B40D 3REHA 4YM6A 1ZLAC 3UTAC 5GT0A 3B0BA 5B1LC 5DNMC 1TZYA 3WA9A 3O62B 1TAFA 5B0YB 3X1VB 2RVQC 1P3AB 1B6WA 1HTAA 3AZED 5AV9A 1P34D 2BYKB 2F8NH 1U35A 5AVBB 1ID3C 4NE6A 4JJND 3W96D 5GT3C 2L5AA 3TU4A 3AZMC 4H9SC 4J8XA 5GSUB 2BYMA 3WTPE 3REJD 1N1JB 3AZHB 3LZ1D 4UUZA 3MGPC 3MNNA 4KGCB 4HGAC 5CPJD 4AWLB 1P3BD 3B6GB 3VH5T 1P3IA 3AN2D 4Z5TD 3AZLB 1JFIB 3C1CB 2PYOA 4ZBJB 5C3IC 3W99B 2FJ7C 5B2JD 3REHC 4YM6C 2AROB 5GXQC 5AV8D 3AYWD 5GT0C 3X1UD 3W97D 1TZYC 1KX3A 5FUGA 3WA9C 5B31A 3B6FB 5B1MB 5JRGA 5AV9C 1P3LA 5B0ZA 3KXBD 4J8WB 1U35C 4LD9A 5F99B 1P3GB 1AOIC 3AV1A 3KWQA 3AFAA 3AZFA 3TU4C 5KDMB 1P3FA 3X1SD 2NQBD 5B2IA 3MGSD 4KUDD 3REKC 5AV6B 1M1AD 3MNNC 5B33D 1M18C 3AZJD 1R4VA 1M19A 5BNXB 1P3MB 1P3PC 3LZ0D 3LELD 4R8PB 2HIOD 1KX4B 4XUJD 2CV5D 5B31G 2PYOC 3UT9A 3AZIB 5BS7A 3O62D 3KUYB 3X1VD 5B40B 3RELD 1BH9A 4KGCC 3AZKD 5JA4A 1KX3C 1ULYA 3LJAA 5B31C 4G92C 1P3LC 2HUEC 5AVCD 5B0ZC 4WU9B 1P34B 4LD9C 3W98D 1HQ3A 5GSUD 3V9RB 5CPKA 3AV1C 3KWQC 4JJNB 3W96B 3AZFC 4ZUXD 3AZND 5BT1D 5B2IC 3REJB 2F8NG 2NZDB 3LZ1B 3VH5A 1H3OB 3AZLD 5B32C 3B0DB 3R45B 1M19C 4J8UC 5CPJB 4Z66B 3C1CD 3W99D 1P3BB 5CP6D 3X1TD 3NQUB 5B1LA 3UT9C 5BS7C 4YS3D 5B2JB 3MGQC 5B1MD 5AY8D 5AV8B 3A6NA 4H9NA 3WTPA 3X1UB 3C1BD 3AYWB 3W97B 1ID3A 4EO5C 5BO0B 4J8VD 1BH8A 4Z5TA 4H9QA 5E5AD 1HQ3C 3AV2D 3MGRD 5CPKC 4QLCD 3MVDB 3UTBA 3WKJB 1BFMA 3X1SB 4G91C 3MGSB 4KUDB 1M1AB 5B33B 4WU8D 3AZJB 3AZGB 3AZEC 4WV4B 4CAYB 4DRAA 3LZ0B 3WAAD 1P3OD 3LELB 2FJ7A 2F8ND 2HIOB 4XUJB 5CPIB 5GXQA 2CV5B 4H9OA 3RELB 5DNND 4WU9D 3WTPC 3A6NC 1S32D 3AZKB 1AOIA 4CSRB 4KHAA 4X23D 1P3BC 1KX5D 4WNNA 5AVCB 3AN2C 4H9RA 4Z5TC 5AV5D 3W98B 2NZDD 3KSYA 3REKA 4ZUXB 5B0YA 3UTBC 3X1VA 1P3AA 1M18A 4J8XB 3AZNB 2BYMB 4Z66D 2CWEA 3AYWC 1P3PA 1EQZB 5AVBA 4UUZB 4XZQB 3REID 3KXBC 5B24B 5GSUA 5CP6B 3X1TB 1N1JA 3AZHA 1ZLAD 2YFVA 3UTAD 4KGCA 5DNMD 3X1SC 2NQBC 4YS3B 4KUDC 3NQJB 5AY8B 3B6GA 3C1BB 2YFWA 2IO5C 1WWIA 1JFIA 4J8VB 3MVDD 3W99A 5GT3D 5JRGB 3AZMD 3WKJD 5E5AB 2AROA 3AV2B 3MGRB 4QLCB 3AFAB 3O62C 5B0YC 1P3AC 3X1VC 3B6FA 3AZGD 5B32A 1P3FB 4J8UA 4J8WA 4NE3A 5AVBC 5F99A 3AZKC 1P3GA 4WU8B 1P3KD 5CPID 5KDMA 3WAAB 1P3OB 5GSUC 2F8NB 3MGQA 3AZHC 5AV6A 4YM6D 3WA9D 5BNXA 1P3MA 4AWLC 5DNNB 3B6GC 5AV9D 4R8PA 1KX4A 3AZLC 1U35D 1S32B 3LJAB 3C1CC 4ZBJC 5B32G 4X23B 3W99C 3AZIA 1KX5B 3TU4D 3KUYA 5B40A 5AV5B 4J8XD 2AROC 1EQZD 4YS3C 3B6FC 4E44A 5B1MC 3AZEA 4WU9A 4XZQD 1P34A 5B24D 4J8WC 5F99C 4H9PB 1P3GC 1P3ID 3V9RA 1F66B 3W96A 4JJNA 3B0CW 4WZSB 3REIB 3MGRC 3REJA 3LZ1A 5AV6C 4KUDA 1ZLAB 3UTAB 5B1LB 1H3OA 5DNMB 3R45A 1KX3D 5CPJA 1P3MC 5B31D 1P3BA 5JRGD 1P3LD 3AN2A 4R8PC 1KX4C 5BNVB 3AV1D 3KWQD 3WAAC 5G49B 3AFAD 5GT3B 3AZFD 3AZIC 3KUYC 3AZMB 5B2JA 5B40C 1P3FD 4Z2MH 5AV8A 5B2ID 3AYWA 3X1UA 3W97A 3MGPB 4HGAB 1M19D 4WU9C 1P34C 3KXBA 1S32C 1P3KB 3W96C 4JJNC 5AV5C 5C3IB 4NFTA 3UT9D 3X1SA 2NQBA 3REJC 2NZDC 3MGSA 3LZ1C 3REHB 1M1AA 4YM6B
chains in the Genus database with same CATH superfamily
5GT0B 5B33A 3AZJA 3FDDA 3AZGA 3B0DC 1TZYB 5CPJC 3LJAD 1B67A 1TAFB 4Z66C 3WA9B 3LZ0A 4CAYA 5AV9B 3LELA 2HIOA 1U35B 4XUJA 1HQ3D 5CPKD 1AOIB 2CV5A 1A7WA 1F1EA 3O62A 3TU4B 5B2JC 2ZY2A 3RELA 5AV8C 3X1UC 2BYKA 3W97C 3REKB 3AZKA 4CSRA 3MNNB 1F66D 2F2AC 1WWSA 1M18B 5AVCA 1P3PB 3W98A 5CHLB 1P3IB 1Q9CA 3MVDC 4ZUXA 5B1LD 2PYOB 3AZNA 3WKJC 2W8SA 2JSSA 3MGSC 2RVQD 1EQZA 1M1AC 3A6ND 2YFVB 3WTPD 5B33C 3AZJC 3AZGC 3AZLA 3B0CT 1KX3B 5FUGB 1ID3D 4XZQA 5B31B 3LZ0C 5B24A 3C1CA 4G92B 3AL0C 1P3LB 2HUEB 5B0ZB 3LELC 5CP6A 2HIOC 3X1TA 2YFWB 1P3KC 4XUJC 5CPIC 4LD9B 2CV5C 3VH6T 3AV1B 4M6BA 3KWQB 3AZFB 3MGPD 3UTBD 4YS3A 3RELC 5B1MA 3NQJA 5AY8A 5B2IB 3C1BA 4J8VA 5B32B 1M19B 4J8UB 5AVCC 2ZY5A 3W98C 4UPKA 4Z2MG 5E5AA 3AV2A 3MGRA 4QLCA 2FJ7D 1KU5A 3REHD 4NE5A 5GXQD 2UWXA 4ZUXC 5GT0D 4WJ3C 3UT9B 4J8XC 5BT1C 3AZNC 1TZYD 3MGQB 1T3UA 1EQZC 1BH9B 4WU8A 5JA4B 1AOID 4XZQC 4EO5B 2Y2OA 5B24C 3WAAA 1P3OA 1P3IC 2J8PA 5CP6C 3X1TC 2F8NA 1HQ3B 5CPKB 3REKD 2Y2QA 2RIQA 5B0YD 3MNND 1P3AD 2FFFB 1M18D 5DNNA 5AY8C 2XD1A 4G91B 2ZY4A 1P3PD 3C1BC 1S32A 5AVBD 4J8VC 4X23A 5JRGC 3AZEB 1KX5A 2PYOD 5AV5A 5E5AC 3AV2C 3VH5W 4QLCC 3EPHA 2NZDA 3AZHD 3AFAC 4KGCD 3VH6W 1P3FC 2F8NK 4Z66A 2Y2KA 1PZRA 3H0LC 4H9PA 3B6GD 3H0MC 5B0ZD 3A6NB 3WTPB 4H9NB 1F66A 4WU8C 4LD9D 3NQUA 2Y2PA 1ID3B 3REIA 3VH6A 1P3OC 1BH8B 3AN2B 4Z5TB 4H9QB 2AROD 1ZLAA 3F6TA 3UTAA 5DNMA 2Y2NA 3UTBB 3B6FD 5BO0A 5B32D 5DNNC 4J8UD 5BNVA 4J8WD 5F99D 1P3GD 3LJAC 3MVDA 4X23C 5G49A 1KX5C 5GT3A 2LY8A 3AZMA 3KXBB 3WKJA 4H9SA 2FJ7B 4DRBA 3MGQD 5AV6D 5GXQB 3MGPA 2NQBB 4H9OB 1P3MD 4E45A 1Z2CB 1F66C 4R8PD 1KX4D 1P3KA 5CPIA 2IO5B 3REIC 4KHAB 3AZID 4WNNB 3KUYD 4H9RB 5B40D 3REHA 4YM6A 1ZLAC 3UTAC 5GT0A 3B0BA 5B1LC 5DNMC 1TZYA 3WA9A 3O62B 1TAFA 5B0YB 3X1VB 2RVQC 1P3AB 1B6WA 1HTAA 3AZED 5AV9A 1P34D 2BYKB 2F8NH 1U35A 3EPKA 5AVBB 1ID3C 4NE6A 4JJND 3W96D 5GT3C 2L5AA 3TU4A 3AZMC 4H9SC 4J8XA 5GSUB 2BYMA 3WTPE 3REJD 1N1JB 3AZHB 3LZ1D 4UUZA 3MGPC 2XD5A 3MNNA 4KGCB 4HGAC 5CPJD 4AWLB 1P3BD 3B6GB 3VH5T 1P3IA 3AN2D 4Z5TD 3AZLB 1JFIB 3C1CB 2PYOA 4ZBJB 5C3IC 3W99B 2FJ7C 5B2JD 3REHC 4YM6C 2AROB 5GXQC 5AV8D 3AYWD 5GT0C 3X1UD 3W97D 1TZYC 3P5JB 1KX3A 5FUGA 3WA9C 5B31A 3B6FB 5B1MB 5JRGA 5AV9C 1P3LA 5B0ZA 3KXBD 4J8WB 1U35C 4LD9A 5F99B 2Y2IA 1P3GB 2Y2HA 1AOIC 3AV1A 3KWQA 3AFAA 3AZFA 3TU4C 5KDMB 1P3FA 3X1SD 2NQBD 5B2IA 3MGSD 4KUDD 3REKC 5AV6B 1M1AD 3MNNC 5B33D 1M18C 3AZJD 1R4VA 1M19A 5BNXB 1P3MB 1P3PC 3LZ0D 3LELD 4R8PB 2HIOD 1KX4B 4XUJD 2CV5D 5B31G 2PYOC 3UT9A 3AZIB 5BS7A 3O62D 3KUYB 3X1VD 5B40B 3RELD 1W2EA 1BH9A 4KGCC 3AZKD 5JA4A 1KX3C 1ULYA 3LJAA 5B31C 3EPJA 2DF4C 4G92C 1P3LC 2HUEC 5AVCD 5B0ZC 4WU9B 1P34B 4LD9C 3W98D 1HQ3A 5GSUD 3V9RB 5CPKA 3AV1C 3KWQC 4JJNB 3W96B 3AZFC 4ZUXD 3AZND 5BT1D 5B2IC 3REJB 2F8NG 2NZDB 3LZ1B 3VH5A 1H3OB 3AZLD 5B32C 3B0DB 3R45B 1M19C 4J8UC 5CPJB 3IP4C 4Z66B 3C1CD 3W99D 1P3BB 5CP6D 3X1TD 2ZM5A 3NQUB 5B1LA 3UT9C 5BS7C 2JCHA 2DQNC 3A1IA 4YS3D 5B2JB 3MGQC 5B1MD 5AY8D 5AV8B 3A6NA 4H9NA 3WTPA 3X1UB 3C1BD 3AYWB 3W97B 1ID3A 4EO5C 5BO0B 4J8VD 1BH8A 4Z5TA 4H9QA 5E5AD 1HQ3C 3AV2D 3MGRD 5CPKC 4QLCD 2G5IC 3MVDB 3UTBA 3WKJB 1BFMA 3X1SB 4G91C 3MGSB 4KUDB 1M1AB 5B33B 4WU8D 3AZJB 3AZGB 3AZEC 4WV4B 4CAYB 4DRAA 3LZ0B 3WAAD 1P3OD 3LELB 2FJ7A 2F8ND 2HIOB 4XUJB 5CPIB 5GXQA 2CV5B 4H9OA 3RELB 5DNND 4WU9D 3WTPC 3A6NC 1S32D 3AZKB 1AOIA 4CSRB 2G5HC 4KHAA 4X23D 1P3BC 1KX5D 4WNNA 5AVCB 3AN2C 4H9RA 4Z5TC 5AV5D 3W98B 2NZDD 3KSYA 3REKA 4ZUXB 5B0YA 3UTBC 3X1VA 1P3AA 1M18A 4J8XB 3AZNB 3EG5B 2BYMB 4Z66D 2CWEA 3AYWC 1P3PA 1EQZB 5AVBA 4UUZB 3A1KA 4XZQB 3REID 3KXBC 5B24B 5GSUA 5CP6B 3X1TB 1N1JA 3AZHA 1ZLAD 2YFVA 3UTAD 2Y2LA 4KGCA 5DNMD 3H0RC 3X1SC 2NQBC 4YS3B 4KUDC 3NQJB 5AY8B 3B6GA 3EPLA 3C1BB 2YFWA 2IO5C 1WWIA 1JFIA 4J8VB 3MVDD 3W99A 5GT3D 5JRGB 2Y2JA 3AZMD 3WKJD 5E5AB 2AROA 3AV2B 3MGRB 4QLCB 2BG1A 3AFAB 3O62C 5B0YC 1P3AC 3X1VC 3B6FA 3AZGD 5B32A 1P3FB 4J8UA 4J8WA 4NE3A 5AVBC 5F99A 3AZKC 1P3GA 4WU8B 1P3KD 5CPID 5KDMA 3WAAB 1P3OB 5GSUC 2F8NB 3MGQA 3AZHC 5AV6A 4YM6D 3WA9D 5BNXA 1P3MA 4AWLC 5DNNB 3B6GC 5AV9D 4R8PA 1KX4A 3AZLC 1U35D 1S32B 3LJAB 2Y2GA 3C1CC 4ZBJC 5B32G 4X23B 3W99C 3AZIA 1KX5B 3TU4D 2JE5A 3KUYA 5B40A 5AV5B 4J8XD 2AROC 1EQZD 4YS3C 3B6FC 4E44A 5B1MC 3AZEA 4WU9A 4XZQD 1P34A 5B24D 4J8WC 5F99C 4H9PB 1P3GC 1P3ID 3V9RA 1F66B 3W96A 4JJNA 3B0CW 4WZSB 3REIB 3MGRC 3REJA 3LZ1A 5AV6C 4KUDA 1ZLAB 3UTAB 5B1LB 1H3OA 5DNMB 3R45A 1KX3D 5CPJA 1P3MC 5B31D 1P3BA 5JRGD 1P3LD 3AN2A 4R8PC 1KX4C 5BNVB 3KFUG 3AV1D 3KWQD 3WAAC 5G49B 3AFAD 5GT3B 3AZFD 3AZIC 3KUYC 3AZMB 5B2JA 5B40C 1P3FD 4Z2MH 5AV8A 5B2ID 3AYWA 3X1UA 3W97A 2Y2MA 3MGPB 2VQRA 2ZY3A 4HGAB 1M19D 4WU9C 1P34C 3KXBA 1S32C 4DQYB 1P3KB 3W96C 4JJNC 5AV5C 5C3IB 4NFTA 3UT9D 3X1SA 2NQBA 3REJC 2NZDC 3MGSA 3LZ1C 3REHB 1M1AA 4YM6B
chains in the Genus database with same CATH topology
5GT0B 5B33A 3AZJA 3FDDA 3AZGA 3B0DC 1TZYB 5CPJC 3LJAD 1B67A 1TAFB 4Z66C 3WA9B 3LZ0A 4CAYA 5AV9B 3LELA 2HIOA 1U35B 4XUJA 1HQ3D 5CPKD 1AOIB 2CV5A 1A7WA 1F1EA 3O62A 3TU4B 5B2JC 2ZY2A 3RELA 5AV8C 3X1UC 2BYKA 3W97C 3REKB 3AZKA 4CSRA 3MNNB 1F66D 2F2AC 1WWSA 1M18B 5AVCA 1P3PB 3W98A 5CHLB 1P3IB 1Q9CA 3MVDC 4ZUXA 5B1LD 2PYOB 3AZNA 3WKJC 2W8SA 2JSSA 3MGSC 2RVQD 1EQZA 1M1AC 3A6ND 2YFVB 3WTPD 5B33C 3AZJC 3AZGC 3AZLA 3B0CT 1KX3B 5FUGB 1ID3D 4XZQA 5B31B 3LZ0C 5B24A 3C1CA 4G92B 3AL0C 1P3LB 2HUEB 5B0ZB 3LELC 5CP6A 2HIOC 3X1TA 2YFWB 1P3KC 4XUJC 5CPIC 4LD9B 2CV5C 3VH6T 3AV1B 4M6BA 3KWQB 3AZFB 3MGPD 3UTBD 4YS3A 3RELC 5B1MA 3NQJA 5AY8A 5B2IB 3C1BA 4J8VA 5B32B 1M19B 4J8UB 5AVCC 2ZY5A 3W98C 4UPKA 4Z2MG 5E5AA 3AV2A 3MGRA 4QLCA 2FJ7D 1KU5A 3REHD 4NE5A 5GXQD 2UWXA 4ZUXC 5GT0D 4WJ3C 3UT9B 4J8XC 5BT1C 3AZNC 1TZYD 3MGQB 1T3UA 1EQZC 1BH9B 4WU8A 5JA4B 1AOID 4XZQC 4EO5B 2Y2OA 5B24C 3WAAA 1P3OA 1P3IC 2J8PA 5CP6C 3X1TC 2F8NA 1HQ3B 5CPKB 3REKD 2Y2QA 2RIQA 5B0YD 3MNND 1P3AD 2FFFB 1M18D 5DNNA 5AY8C 2XD1A 4G91B 2ZY4A 1P3PD 3C1BC 1S32A 5AVBD 4J8VC 4X23A 5JRGC 3AZEB 1KX5A 2PYOD 5AV5A 5E5AC 3AV2C 3VH5W 4QLCC 3EPHA 2NZDA 3AZHD 3AFAC 4KGCD 3VH6W 1P3FC 2F8NK 4Z66A 2Y2KA 1PZRA 3H0LC 4H9PA 3B6GD 3H0MC 5B0ZD 3A6NB 3WTPB 4H9NB 1F66A 4WU8C 4LD9D 3NQUA 2Y2PA 1ID3B 3REIA 3VH6A 1P3OC 1BH8B 3AN2B 4Z5TB 4H9QB 2AROD 1ZLAA 3F6TA 3UTAA 5DNMA 2Y2NA 3UTBB 3B6FD 5BO0A 5B32D 5DNNC 4J8UD 5BNVA 4J8WD 5F99D 1P3GD 3LJAC 3MVDA 4X23C 5G49A 1KX5C 5GT3A 2LY8A 3AZMA 3KXBB 3WKJA 4H9SA 2FJ7B 4DRBA 3MGQD 5AV6D 5GXQB 3MGPA 2NQBB 4H9OB 1P3MD 4E45A 1Z2CB 1F66C 4R8PD 1KX4D 1P3KA 5CPIA 2IO5B 3REIC 4KHAB 3AZID 4WNNB 3KUYD 4H9RB 5B40D 3REHA 4YM6A 1ZLAC 3UTAC 5GT0A 3B0BA 5B1LC 5DNMC 1TZYA 3WA9A 3O62B 1TAFA 5B0YB 3X1VB 2RVQC 1P3AB 1B6WA 1HTAA 3AZED 5AV9A 1P34D 2BYKB 2F8NH 1U35A 3EPKA 5AVBB 1ID3C 4NE6A 4JJND 3W96D 5GT3C 2L5AA 3TU4A 3AZMC 4H9SC 4J8XA 5GSUB 2BYMA 3WTPE 3REJD 1N1JB 3AZHB 3LZ1D 4UUZA 3MGPC 2XD5A 3MNNA 4KGCB 4HGAC 5CPJD 4AWLB 1P3BD 3B6GB 3VH5T 1P3IA 3AN2D 4Z5TD 3AZLB 1JFIB 3C1CB 2PYOA 4ZBJB 5C3IC 3W99B 2FJ7C 5B2JD 3REHC 4YM6C 2AROB 5GXQC 5AV8D 3AYWD 5GT0C 3X1UD 3W97D 1TZYC 3P5JB 1KX3A 5FUGA 3WA9C 5B31A 3B6FB 5B1MB 5JRGA 5AV9C 1P3LA 5B0ZA 3KXBD 4J8WB 1U35C 4LD9A 5F99B 2Y2IA 1P3GB 2Y2HA 1AOIC 3AV1A 3KWQA 3AFAA 3AZFA 3TU4C 5KDMB 1P3FA 3X1SD 2NQBD 5B2IA 3MGSD 4KUDD 3REKC 5AV6B 1M1AD 3MNNC 5B33D 1M18C 3AZJD 1R4VA 1M19A 5BNXB 1P3MB 1P3PC 3LZ0D 3LELD 4R8PB 2HIOD 1KX4B 4XUJD 2CV5D 5B31G 2PYOC 3UT9A 3AZIB 5BS7A 3O62D 3KUYB 3X1VD 5B40B 3RELD 1W2EA 1BH9A 4KGCC 3AZKD 5JA4A 1KX3C 1ULYA 3LJAA 5B31C 3EPJA 2DF4C 4G92C 1P3LC 2HUEC 5AVCD 5B0ZC 4WU9B 1P34B 4LD9C 3W98D 1HQ3A 5GSUD 3V9RB 5CPKA 3AV1C 3KWQC 4JJNB 3W96B 3AZFC 4ZUXD 3AZND 5BT1D 5B2IC 3REJB 2F8NG 2NZDB 3LZ1B 3VH5A 1H3OB 3AZLD 5B32C 3B0DB 3R45B 1M19C 4J8UC 5CPJB 3IP4C 4Z66B 3C1CD 3W99D 1P3BB 5CP6D 3X1TD 2ZM5A 3NQUB 5B1LA 3UT9C 5BS7C 2JCHA 2DQNC 3A1IA 4YS3D 5B2JB 3MGQC 5B1MD 5AY8D 5AV8B 3A6NA 4H9NA 3WTPA 3X1UB 3C1BD 3AYWB 3W97B 1ID3A 4EO5C 5BO0B 4J8VD 1BH8A 4Z5TA 4H9QA 5E5AD 1HQ3C 3AV2D 3MGRD 5CPKC 4QLCD 2G5IC 3MVDB 3UTBA 3WKJB 1BFMA 3X1SB 4G91C 3MGSB 4KUDB 1M1AB 5B33B 4WU8D 3AZJB 3AZGB 3AZEC 4WV4B 4CAYB 4DRAA 3LZ0B 3WAAD 1P3OD 3LELB 2FJ7A 2F8ND 2HIOB 4XUJB 5CPIB 5GXQA 2CV5B 4H9OA 3RELB 5DNND 4WU9D 3WTPC 3A6NC 1S32D 3AZKB 1AOIA 4CSRB 2G5HC 4KHAA 4X23D 1P3BC 1KX5D 4WNNA 5AVCB 3AN2C 4H9RA 4Z5TC 5AV5D 3W98B 2NZDD 3KSYA 3REKA 4ZUXB 5B0YA 3UTBC 3X1VA 1P3AA 1M18A 4J8XB 3AZNB 3EG5B 2BYMB 4Z66D 2CWEA 3AYWC 1P3PA 1EQZB 5AVBA 4UUZB 3A1KA 4XZQB 3REID 3KXBC 5B24B 5GSUA 5CP6B 3X1TB 1N1JA 3AZHA 1ZLAD 2YFVA 3UTAD 2Y2LA 4KGCA 5DNMD 3H0RC 3X1SC 2NQBC 4YS3B 4KUDC 3NQJB 5AY8B 3B6GA 3EPLA 3C1BB 2YFWA 2IO5C 1WWIA 1JFIA 4J8VB 3MVDD 3W99A 5GT3D 5JRGB 2Y2JA 3AZMD 3WKJD 5E5AB 2AROA 3AV2B 3MGRB 4QLCB 2BG1A 3AFAB 3O62C 5B0YC 1P3AC 3X1VC 3B6FA 3AZGD 5B32A 1P3FB 4J8UA 4J8WA 4NE3A 5AVBC 5F99A 3AZKC 1P3GA 4WU8B 1P3KD 5CPID 5KDMA 3WAAB 1P3OB 5GSUC 2F8NB 3MGQA 3AZHC 5AV6A 4YM6D 3WA9D 5BNXA 1P3MA 4AWLC 5DNNB 3B6GC 5AV9D 4R8PA 1KX4A 3AZLC 1U35D 1S32B 3LJAB 2Y2GA 3C1CC 4ZBJC 5B32G 4X23B 3W99C 3AZIA 1KX5B 3TU4D 2JE5A 3KUYA 5B40A 5AV5B 4J8XD 2AROC 1EQZD 4YS3C 3B6FC 4E44A 5B1MC 3AZEA 4WU9A 4XZQD 1P34A 5B24D 4J8WC 5F99C 4H9PB 1P3GC 1P3ID 3V9RA 1F66B 3W96A 4JJNA 3B0CW 4WZSB 3REIB 3MGRC 3REJA 3LZ1A 5AV6C 4KUDA 1ZLAB 3UTAB 5B1LB 1H3OA 5DNMB 3R45A 1KX3D 5CPJA 1P3MC 5B31D 1P3BA 5JRGD 1P3LD 3AN2A 4R8PC 1KX4C 5BNVB 3KFUG 3AV1D 3KWQD 3WAAC 5G49B 3AFAD 5GT3B 3AZFD 3AZIC 3KUYC 3AZMB 5B2JA 5B40C 1P3FD 4Z2MH 5AV8A 5B2ID 3AYWA 3X1UA 3W97A 2Y2MA 3MGPB 2VQRA 2ZY3A 4HGAB 1M19D 4WU9C 1P34C 3KXBA 1S32C 4DQYB 1P3KB 3W96C 4JJNC 5AV5C 5C3IB 4NFTA 3UT9D 3X1SA 2NQBA 3REJC 2NZDC 3MGSA 3LZ1C 3REHB 1M1AA 4YM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 B;  5B33 A;  3AZJ A;  3AZG A;  3B0D C;  1TZY B;  5CPJ C;  3LJA D;  1B67 A;  1TAF B;  4Z66 C;  3WA9 B;  3LZ0 A;  4CAY A;  5AV9 B;  3LEL A;  2HIO A;  1U35 B;  4XUJ A;  1HQ3 D;  5CPK D;  1AOI B;  2CV5 A;  1A7W A;  1F1E A;  3O62 A;  3TU4 B;  5B2J C;  3REL A;  5AV8 C;  3X1U C;  2BYK A;  3W97 C;  3REK B;  3AZK A;  4CSR A;  3MNN B;  1F66 D;  1WWS A;  1M18 B;  5AVC A;  1P3P B;  3W98 A;  5CHL B;  1P3I B;  1Q9C A;  3MVD C;  4ZUX A;  5B1L D;  2PYO B;  3AZN A;  3WKJ C;  2JSS A;  3MGS C;  2RVQ D;  1EQZ A;  1M1A C;  3A6N D;  2YFV B;  3WTP D;  5B33 C;  3AZJ C;  3AZG C;  3AZL A;  3B0C T;  1KX3 B;  5FUG B;  1ID3 D;  4XZQ A;  5B31 B;  3LZ0 C;  5B24 A;  3C1C A;  4G92 B;  1P3L B;  2HUE B;  5B0Z B;  3LEL C;  5CP6 A;  2HIO C;  3X1T A;  2YFW B;  1P3K C;  4XUJ C;  5CPI C;  4LD9 B;  2CV5 C;  3VH6 T;  3AV1 B;  4M6B A;  3KWQ B;  3AZF B;  3MGP D;  3UTB D;  4YS3 A;  3REL C;  5B1M A;  3NQJ A;  5AY8 A;  5B2I B;  3C1B A;  4J8V A;  5B32 B;  1M19 B;  4J8U B;  5AVC C;  3W98 C;  4Z2M G;  5E5A A;  3AV2 A;  3MGR A;  4QLC A;  2FJ7 D;  1KU5 A;  3REH D;  4NE5 A;  5GXQ D;  4ZUX C;  5GT0 D;  3UT9 B;  4J8X C;  5BT1 C;  3AZN C;  1TZY D;  3MGQ B;  1EQZ C;  1BH9 B;  4WU8 A;  5JA4 B;  1AOI D;  4XZQ C;  4EO5 B;  5B24 C;  3WAA A;  1P3O A;  1P3I C;  5CP6 C;  3X1T C;  2F8N A;  1HQ3 B;  5CPK B;  3REK D;  5B0Y D;  3MNN D;  1P3A D;  1M18 D;  5DNN A;  5AY8 C;  4G91 B;  1P3P D;  3C1B C;  1S32 A;  5AVB D;  4J8V C;  4X23 A;  5JRG C;  3AZE B;  1KX5 A;  2PYO D;  5AV5 A;  5E5A C;  3AV2 C;  3VH5 W;  4QLC C;  2NZD A;  3AZH D;  3AFA C;  4KGC D;  3VH6 W;  1P3F C;  2F8N K;  4Z66 A;  4H9P A;  3B6G D;  5B0Z D;  3A6N B;  3WTP B;  4H9N B;  1F66 A;  4WU8 C;  4LD9 D;  3NQU A;  1ID3 B;  3REI A;  3VH6 A;  1P3O C;  1BH8 B;  3AN2 B;  4Z5T B;  4H9Q B;  2ARO D;  1ZLA A;  3UTA A;  5DNM A;  3UTB B;  3B6F D;  5BO0 A;  5B32 D;  5DNN C;  4J8U D;  5BNV A;  4J8W D;  5F99 D;  1P3G D;  3LJA C;  3MVD A;  4X23 C;  5G49 A;  1KX5 C;  5GT3 A;  2LY8 A;  3AZM A;  3KXB B;  3WKJ A;  4H9S A;  2FJ7 B;  4DRB A;  3MGQ D;  5AV6 D;  5GXQ B;  3MGP A;  2NQB B;  4H9O B;  1P3M D;  4E45 A;  1F66 C;  4R8P D;  1KX4 D;  1P3K A;  5CPI A;  2IO5 B;  3REI C;  4KHA B;  3AZI D;  4WNN B;  3KUY D;  4H9R B;  5B40 D;  3REH A;  4YM6 A;  1ZLA C;  3UTA C;  5GT0 A;  3B0B A;  5B1L C;  5DNM C;  1TZY A;  3WA9 A;  3O62 B;  1TAF A;  5B0Y B;  3X1V B;  2RVQ C;  1P3A B;  1B6W A;  1HTA A;  3AZE D;  5AV9 A;  1P34 D;  2BYK B;  2F8N H;  1U35 A;  5AVB B;  1ID3 C;  4NE6 A;  4JJN D;  3W96 D;  5GT3 C;  2L5A A;  3TU4 A;  3AZM C;  4H9S C;  4J8X A;  5GSU B;  2BYM A;  3WTP E;  3REJ D;  1N1J B;  3AZH B;  3LZ1 D;  4UUZ A;  3MGP C;  3MNN A;  4KGC B;  4HGA C;  5CPJ D;  4AWL B;  1P3B D;  3B6G B;  3VH5 T;  1P3I A;  3AN2 D;  4Z5T D;  3AZL B;  1JFI B;  3C1C B;  2PYO A;  4ZBJ B;  5C3I C;  3W99 B;  2FJ7 C;  5B2J D;  3REH C;  4YM6 C;  2ARO B;  5GXQ C;  5AV8 D;  3AYW D;  5GT0 C;  3X1U D;  3W97 D;  1TZY C;  1KX3 A;  5FUG A;  3WA9 C;  5B31 A;  3B6F B;  5B1M B;  5JRG A;  5AV9 C;  1P3L A;  5B0Z A;  3KXB D;  4J8W B;  1U35 C;  4LD9 A;  5F99 B;  1P3G B;  1AOI C;  3AV1 A;  3KWQ A;  3AFA A;  3AZF A;  3TU4 C;  5KDM B;  1P3F A;  3X1S D;  2NQB D;  5B2I A;  3MGS D;  4KUD D;  3REK C;  5AV6 B;  1M1A D;  3MNN C;  5B33 D;  1M18 C;  3AZJ D;  1R4V A;  1M19 A;  5BNX B;  1P3M B;  1P3P C;  3LZ0 D;  3LEL D;  4R8P B;  2HIO D;  1KX4 B;  4XUJ D;  2CV5 D;  5B31 G;  2PYO C;  3UT9 A;  3AZI B;  5BS7 A;  3O62 D;  3KUY B;  3X1V D;  5B40 B;  3REL D;  1BH9 A;  4KGC C;  3AZK D;  5JA4 A;  1KX3 C;  1ULY A;  3LJA A;  5B31 C;  4G92 C;  1P3L C;  2HUE C;  5AVC D;  5B0Z C;  4WU9 B;  1P34 B;  4LD9 C;  3W98 D;  1HQ3 A;  5GSU D;  3V9R B;  5CPK A;  3AV1 C;  3KWQ C;  4JJN B;  3W96 B;  3AZF C;  4ZUX D;  3AZN D;  5BT1 D;  5B2I C;  3REJ B;  2F8N G;  2NZD B;  3LZ1 B;  3VH5 A;  1H3O B;  3AZL D;  5B32 C;  3B0D B;  3R45 B;  1M19 C;  4J8U C;  5CPJ B;  4Z66 B;  3C1C D;  3W99 D;  1P3B B;  5CP6 D;  3X1T D;  3NQU B;  5B1L A;  3UT9 C;  5BS7 C;  4YS3 D;  5B2J B;  3MGQ C;  5B1M D;  5AY8 D;  5AV8 B;  3A6N A;  4H9N A;  3WTP A;  3X1U B;  3C1B D;  3AYW B;  3W97 B;  1ID3 A;  4EO5 C;  5BO0 B;  4J8V D;  1BH8 A;  4Z5T A;  4H9Q A;  5E5A D;  1HQ3 C;  3AV2 D;  3MGR D;  5CPK C;  4QLC D;  3MVD B;  3UTB A;  3WKJ B;  1BFM A;  3X1S B;  4G91 C;  3MGS B;  4KUD B;  1M1A B;  5B33 B;  4WU8 D;  3AZJ B;  3AZG B;  3AZE C;  4WV4 B;  4CAY B;  4DRA A;  3LZ0 B;  3WAA D;  1P3O D;  3LEL B;  2FJ7 A;  2F8N D;  2HIO B;  4XUJ B;  5CPI B;  5GXQ A;  2CV5 B;  4H9O A;  3REL B;  5DNN D;  4WU9 D;  3WTP C;  3A6N C;  1S32 D;  3AZK B;  1AOI A;  4CSR B;  4KHA A;  4X23 D;  1P3B C;  1KX5 D;  4WNN A;  5AVC B;  3AN2 C;  4H9R A;  4Z5T C;  5AV5 D;  3W98 B;  2NZD D;  3KSY A;  3REK A;  4ZUX B;  5B0Y A;  3UTB C;  3X1V A;  1P3A A;  1M18 A;  4J8X B;  3AZN B;  2BYM B;  4Z66 D;  2CWE A;  3AYW C;  1P3P A;  1EQZ B;  5AVB A;  4UUZ B;  4XZQ B;  3REI D;  3KXB C;  5B24 B;  5GSU A;  5CP6 B;  3X1T B;  1N1J A;  3AZH A;  1ZLA D;  2YFV A;  3UTA D;  4KGC A;  5DNM D;  3X1S C;  2NQB C;  4YS3 B;  4KUD C;  3NQJ B;  5AY8 B;  3B6G A;  3C1B B;  2YFW A;  2IO5 C;  1WWI A;  1JFI A;  4J8V B;  3MVD D;  3W99 A;  5GT3 D;  5JRG B;  3AZM D;  3WKJ D;  5E5A B;  2ARO A;  3AV2 B;  3MGR B;  4QLC B;  3AFA B;  3O62 C;  5B0Y C;  1P3A C;  3X1V C;  3B6F A;  3AZG D;  5B32 A;  1P3F B;  4J8U A;  4J8W A;  4NE3 A;  5AVB C;  5F99 A;  3AZK C;  1P3G A;  4WU8 B;  1P3K D;  5CPI D;  5KDM A;  3WAA B;  1P3O B;  5GSU C;  2F8N B;  3MGQ A;  3AZH C;  5AV6 A;  4YM6 D;  3WA9 D;  5BNX A;  1P3M A;  4AWL C;  5DNN B;  3B6G C;  5AV9 D;  4R8P A;  1KX4 A;  3AZL C;  1U35 D;  1S32 B;  3LJA B;  3C1C C;  4ZBJ C;  5B32 G;  4X23 B;  3W99 C;  3AZI A;  1KX5 B;  3TU4 D;  3KUY A;  5B40 A;  5AV5 B;  4J8X D;  2ARO C;  1EQZ D;  4YS3 C;  3B6F C;  4E44 A;  5B1M C;  3AZE A;  4WU9 A;  4XZQ D;  1P34 A;  5B24 D;  4J8W C;  5F99 C;  4H9P B;  1P3G C;  1P3I D;  3V9R A;  1F66 B;  3W96 A;  4JJN A;  3B0C W;  4WZS B;  3REI B;  3MGR C;  3REJ A;  3LZ1 A;  5AV6 C;  4KUD A;  1ZLA B;  3UTA B;  5B1L B;  1H3O A;  5DNM B;  3R45 A;  1KX3 D;  5CPJ A;  1P3M C;  5B31 D;  1P3B A;  5JRG D;  1P3L D;  3AN2 A;  4R8P C;  1KX4 C;  5BNV B;  3AV1 D;  3KWQ D;  3WAA C;  5G49 B;  3AFA D;  5GT3 B;  3AZF D;  3AZI C;  3KUY C;  3AZM B;  5B2J A;  5B40 C;  1P3F D;  4Z2M H;  5AV8 A;  5B2I D;  3AYW A;  3X1U A;  3W97 A;  3MGP B;  4HGA B;  1M19 D;  4WU9 C;  1P34 C;  3KXB A;  1S32 C;  1P3K B;  3W96 C;  4JJN C;  5AV5 C;  5C3I B;  4NFT A;  3UT9 D;  3X1S A;  2NQB A;  3REJ C;  2NZD C;  3MGS A;  3LZ1 C;  3REH B;  1M1A A;  4YM6 B; 
#chains in the Genus database with same CATH topology
 5GT0 B;  5B33 A;  3AZJ A;  3FDD A;  3AZG A;  3B0D C;  1TZY B;  5CPJ C;  3LJA D;  1B67 A;  1TAF B;  4Z66 C;  3WA9 B;  3LZ0 A;  4CAY A;  5AV9 B;  3LEL A;  2HIO A;  1U35 B;  4XUJ A;  1HQ3 D;  5CPK D;  1AOI B;  2CV5 A;  1A7W A;  1F1E A;  3O62 A;  3TU4 B;  5B2J C;  2ZY2 A;  3REL A;  5AV8 C;  3X1U C;  2BYK A;  3W97 C;  3REK B;  3AZK A;  4CSR A;  3MNN B;  1F66 D;  2F2A C;  1WWS A;  1M18 B;  5AVC A;  1P3P B;  3W98 A;  5CHL B;  1P3I B;  1Q9C A;  3MVD C;  4ZUX A;  5B1L D;  2PYO B;  3AZN A;  3WKJ C;  2W8S A;  2JSS A;  3MGS C;  2RVQ D;  1EQZ A;  1M1A C;  3A6N D;  2YFV B;  3WTP D;  5B33 C;  3AZJ C;  3AZG C;  3AZL A;  3B0C T;  1KX3 B;  5FUG B;  1ID3 D;  4XZQ A;  5B31 B;  3LZ0 C;  5B24 A;  3C1C A;  4G92 B;  3AL0 C;  1P3L B;  2HUE B;  5B0Z B;  3LEL C;  5CP6 A;  2HIO C;  3X1T A;  2YFW B;  1P3K C;  4XUJ C;  5CPI C;  4LD9 B;  2CV5 C;  3VH6 T;  3AV1 B;  4M6B A;  3KWQ B;  3AZF B;  3MGP D;  3UTB D;  4YS3 A;  3REL C;  5B1M A;  3NQJ A;  5AY8 A;  5B2I B;  3C1B A;  4J8V A;  5B32 B;  1M19 B;  4J8U B;  5AVC C;  2ZY5 A;  3W98 C;  4UPK A;  4Z2M G;  5E5A A;  3AV2 A;  3MGR A;  4QLC A;  2FJ7 D;  1KU5 A;  3REH D;  4NE5 A;  5GXQ D;  2UWX A;  4ZUX C;  5GT0 D;  4WJ3 C;  3UT9 B;  4J8X C;  5BT1 C;  3AZN C;  1TZY D;  3MGQ B;  1T3U A;  1EQZ C;  1BH9 B;  4WU8 A;  5JA4 B;  1AOI D;  4XZQ C;  4EO5 B;  2Y2O A;  5B24 C;  3WAA A;  1P3O A;  1P3I C;  2J8P A;  5CP6 C;  3X1T C;  2F8N A;  1HQ3 B;  5CPK B;  3REK D;  2Y2Q A;  2RIQ A;  5B0Y D;  3MNN D;  1P3A D;  2FFF B;  1M18 D;  5DNN A;  5AY8 C;  2XD1 A;  4G91 B;  2ZY4 A;  1P3P D;  3C1B C;  1S32 A;  5AVB D;  4J8V C;  4X23 A;  5JRG C;  3AZE B;  1KX5 A;  2PYO D;  5AV5 A;  5E5A C;  3AV2 C;  3VH5 W;  4QLC C;  3EPH A;  2NZD A;  3AZH D;  3AFA C;  4KGC D;  3VH6 W;  1P3F C;  2F8N K;  4Z66 A;  2Y2K A;  1PZR A;  3H0L C;  4H9P A;  3B6G D;  3H0M C;  5B0Z D;  3A6N B;  3WTP B;  4H9N B;  1F66 A;  4WU8 C;  4LD9 D;  3NQU A;  2Y2P A;  1ID3 B;  3REI A;  3VH6 A;  1P3O C;  1BH8 B;  3AN2 B;  4Z5T B;  4H9Q B;  2ARO D;  1ZLA A;  3F6T A;  3UTA A;  5DNM A;  2Y2N A;  3UTB B;  3B6F D;  5BO0 A;  5B32 D;  5DNN C;  4J8U D;  5BNV A;  4J8W D;  5F99 D;  1P3G D;  3LJA C;  3MVD A;  4X23 C;  5G49 A;  1KX5 C;  5GT3 A;  2LY8 A;  3AZM A;  3KXB B;  3WKJ A;  4H9S A;  2FJ7 B;  4DRB A;  3MGQ D;  5AV6 D;  5GXQ B;  3MGP A;  2NQB B;  4H9O B;  1P3M D;  4E45 A;  1Z2C B;  1F66 C;  4R8P D;  1KX4 D;  1P3K A;  5CPI A;  2IO5 B;  3REI C;  4KHA B;  3AZI D;  4WNN B;  3KUY D;  4H9R B;  5B40 D;  3REH A;  4YM6 A;  1ZLA C;  3UTA C;  5GT0 A;  3B0B A;  5B1L C;  5DNM C;  1TZY A;  3WA9 A;  3O62 B;  1TAF A;  5B0Y B;  3X1V B;  2RVQ C;  1P3A B;  1B6W A;  1HTA A;  3AZE D;  5AV9 A;  1P34 D;  2BYK B;  2F8N H;  1U35 A;  3EPK A;  5AVB B;  1ID3 C;  4NE6 A;  4JJN D;  3W96 D;  5GT3 C;  2L5A A;  3TU4 A;  3AZM C;  4H9S C;  4J8X A;  5GSU B;  2BYM A;  3WTP E;  3REJ D;  1N1J B;  3AZH B;  3LZ1 D;  4UUZ A;  3MGP C;  2XD5 A;  3MNN A;  4KGC B;  4HGA C;  5CPJ D;  4AWL B;  1P3B D;  3B6G B;  3VH5 T;  1P3I A;  3AN2 D;  4Z5T D;  3AZL B;  1JFI B;  3C1C B;  2PYO A;  4ZBJ B;  5C3I C;  3W99 B;  2FJ7 C;  5B2J D;  3REH C;  4YM6 C;  2ARO B;  5GXQ C;  5AV8 D;  3AYW D;  5GT0 C;  3X1U D;  3W97 D;  1TZY C;  3P5J B;  1KX3 A;  5FUG A;  3WA9 C;  5B31 A;  3B6F B;  5B1M B;  5JRG A;  5AV9 C;  1P3L A;  5B0Z A;  3KXB D;  4J8W B;  1U35 C;  4LD9 A;  5F99 B;  2Y2I A;  1P3G B;  2Y2H A;  1AOI C;  3AV1 A;  3KWQ A;  3AFA A;  3AZF A;  3TU4 C;  5KDM B;  1P3F A;  3X1S D;  2NQB D;  5B2I A;  3MGS D;  4KUD D;  3REK C;  5AV6 B;  1M1A D;  3MNN C;  5B33 D;  1M18 C;  3AZJ D;  1R4V A;  1M19 A;  5BNX B;  1P3M B;  1P3P C;  3LZ0 D;  3LEL D;  4R8P B;  2HIO D;  1KX4 B;  4XUJ D;  2CV5 D;  5B31 G;  2PYO C;  3UT9 A;  3AZI B;  5BS7 A;  3O62 D;  3KUY B;  3X1V D;  5B40 B;  3REL D;  1W2E A;  1BH9 A;  4KGC C;  3AZK D;  5JA4 A;  1KX3 C;  1ULY A;  3LJA A;  5B31 C;  3EPJ A;  2DF4 C;  4G92 C;  1P3L C;  2HUE C;  5AVC D;  5B0Z C;  4WU9 B;  1P34 B;  4LD9 C;  3W98 D;  1HQ3 A;  5GSU D;  3V9R B;  5CPK A;  3AV1 C;  3KWQ C;  4JJN B;  3W96 B;  3AZF C;  4ZUX D;  3AZN D;  5BT1 D;  5B2I C;  3REJ B;  2F8N G;  2NZD B;  3LZ1 B;  3VH5 A;  1H3O B;  3AZL D;  5B32 C;  3B0D B;  3R45 B;  1M19 C;  4J8U C;  5CPJ B;  3IP4 C;  4Z66 B;  3C1C D;  3W99 D;  1P3B B;  5CP6 D;  3X1T D;  2ZM5 A;  3NQU B;  5B1L A;  3UT9 C;  5BS7 C;  2JCH A;  2DQN C;  3A1I A;  4YS3 D;  5B2J B;  3MGQ C;  5B1M D;  5AY8 D;  5AV8 B;  3A6N A;  4H9N A;  3WTP A;  3X1U B;  3C1B D;  3AYW B;  3W97 B;  1ID3 A;  4EO5 C;  5BO0 B;  4J8V D;  1BH8 A;  4Z5T A;  4H9Q A;  5E5A D;  1HQ3 C;  3AV2 D;  3MGR D;  5CPK C;  4QLC D;  2G5I C;  3MVD B;  3UTB A;  3WKJ B;  1BFM A;  3X1S B;  4G91 C;  3MGS B;  4KUD B;  1M1A B;  5B33 B;  4WU8 D;  3AZJ B;  3AZG B;  3AZE C;  4WV4 B;  4CAY B;  4DRA A;  3LZ0 B;  3WAA D;  1P3O D;  3LEL B;  2FJ7 A;  2F8N D;  2HIO B;  4XUJ B;  5CPI B;  5GXQ A;  2CV5 B;  4H9O A;  3REL B;  5DNN D;  4WU9 D;  3WTP C;  3A6N C;  1S32 D;  3AZK B;  1AOI A;  4CSR B;  2G5H C;  4KHA A;  4X23 D;  1P3B C;  1KX5 D;  4WNN A;  5AVC B;  3AN2 C;  4H9R A;  4Z5T C;  5AV5 D;  3W98 B;  2NZD D;  3KSY A;  3REK A;  4ZUX B;  5B0Y A;  3UTB C;  3X1V A;  1P3A A;  1M18 A;  4J8X B;  3AZN B;  3EG5 B;  2BYM B;  4Z66 D;  2CWE A;  3AYW C;  1P3P A;  1EQZ B;  5AVB A;  4UUZ B;  3A1K A;  4XZQ B;  3REI D;  3KXB C;  5B24 B;  5GSU A;  5CP6 B;  3X1T B;  1N1J A;  3AZH A;  1ZLA D;  2YFV A;  3UTA D;  2Y2L A;  4KGC A;  5DNM D;  3H0R C;  3X1S C;  2NQB C;  4YS3 B;  4KUD C;  3NQJ B;  5AY8 B;  3B6G A;  3EPL A;  3C1B B;  2YFW A;  2IO5 C;  1WWI A;  1JFI A;  4J8V B;  3MVD D;  3W99 A;  5GT3 D;  5JRG B;  2Y2J A;  3AZM D;  3WKJ D;  5E5A B;  2ARO A;  3AV2 B;  3MGR B;  4QLC B;  2BG1 A;  3AFA B;  3O62 C;  5B0Y C;  1P3A C;  3X1V C;  3B6F A;  3AZG D;  5B32 A;  1P3F B;  4J8U A;  4J8W A;  4NE3 A;  5AVB C;  5F99 A;  3AZK C;  1P3G A;  4WU8 B;  1P3K D;  5CPI D;  5KDM A;  3WAA B;  1P3O B;  5GSU C;  2F8N B;  3MGQ A;  3AZH C;  5AV6 A;  4YM6 D;  3WA9 D;  5BNX A;  1P3M A;  4AWL C;  5DNN B;  3B6G C;  5AV9 D;  4R8P A;  1KX4 A;  3AZL C;  1U35 D;  1S32 B;  3LJA B;  2Y2G A;  3C1C C;  4ZBJ C;  5B32 G;  4X23 B;  3W99 C;  3AZI A;  1KX5 B;  3TU4 D;  2JE5 A;  3KUY A;  5B40 A;  5AV5 B;  4J8X D;  2ARO C;  1EQZ D;  4YS3 C;  3B6F C;  4E44 A;  5B1M C;  3AZE A;  4WU9 A;  4XZQ D;  1P34 A;  5B24 D;  4J8W C;  5F99 C;  4H9P B;  1P3G C;  1P3I D;  3V9R A;  1F66 B;  3W96 A;  4JJN A;  3B0C W;  4WZS B;  3REI B;  3MGR C;  3REJ A;  3LZ1 A;  5AV6 C;  4KUD A;  1ZLA B;  3UTA B;  5B1L B;  1H3O A;  5DNM B;  3R45 A;  1KX3 D;  5CPJ A;  1P3M C;  5B31 D;  1P3B A;  5JRG D;  1P3L D;  3AN2 A;  4R8P C;  1KX4 C;  5BNV B;  3KFU G;  3AV1 D;  3KWQ D;  3WAA C;  5G49 B;  3AFA D;  5GT3 B;  3AZF D;  3AZI C;  3KUY C;  3AZM B;  5B2J A;  5B40 C;  1P3F D;  4Z2M H;  5AV8 A;  5B2I D;  3AYW A;  3X1U A;  3W97 A;  2Y2M A;  3MGP B;  2VQR A;  2ZY3 A;  4HGA B;  1M19 D;  4WU9 C;  1P34 C;  3KXB A;  1S32 C;  4DQY B;  1P3K B;  3W96 C;  4JJN C;  5AV5 C;  5C3I B;  4NFT A;  3UT9 D;  3X1S A;  2NQB A;  3REJ C;  2NZD C;  3MGS A;  3LZ1 C;  3REH B;  1M1A A;  4YM6 B; 
#chains in the Genus database with same CATH homology
 5GT0 B;  5B33 A;  3AZJ A;  3FDD A;  3AZG A;  3B0D C;  1TZY B;  5CPJ C;  3LJA D;  1B67 A;  1TAF B;  4Z66 C;  3WA9 B;  3LZ0 A;  4CAY A;  5AV9 B;  3LEL A;  2HIO A;  1U35 B;  4XUJ A;  1HQ3 D;  5CPK D;  1AOI B;  2CV5 A;  1A7W A;  1F1E A;  3O62 A;  3TU4 B;  5B2J C;  2ZY2 A;  3REL A;  5AV8 C;  3X1U C;  2BYK A;  3W97 C;  3REK B;  3AZK A;  4CSR A;  3MNN B;  1F66 D;  2F2A C;  1WWS A;  1M18 B;  5AVC A;  1P3P B;  3W98 A;  5CHL B;  1P3I B;  1Q9C A;  3MVD C;  4ZUX A;  5B1L D;  2PYO B;  3AZN A;  3WKJ C;  2W8S A;  2JSS A;  3MGS C;  2RVQ D;  1EQZ A;  1M1A C;  3A6N D;  2YFV B;  3WTP D;  5B33 C;  3AZJ C;  3AZG C;  3AZL A;  3B0C T;  1KX3 B;  5FUG B;  1ID3 D;  4XZQ A;  5B31 B;  3LZ0 C;  5B24 A;  3C1C A;  4G92 B;  3AL0 C;  1P3L B;  2HUE B;  5B0Z B;  3LEL C;  5CP6 A;  2HIO C;  3X1T A;  2YFW B;  1P3K C;  4XUJ C;  5CPI C;  4LD9 B;  2CV5 C;  3VH6 T;  3AV1 B;  4M6B A;  3KWQ B;  3AZF B;  3MGP D;  3UTB D;  4YS3 A;  3REL C;  5B1M A;  3NQJ A;  5AY8 A;  5B2I B;  3C1B A;  4J8V A;  5B32 B;  1M19 B;  4J8U B;  5AVC C;  2ZY5 A;  3W98 C;  4UPK A;  4Z2M G;  5E5A A;  3AV2 A;  3MGR A;  4QLC A;  2FJ7 D;  1KU5 A;  3REH D;  4NE5 A;  5GXQ D;  2UWX A;  4ZUX C;  5GT0 D;  4WJ3 C;  3UT9 B;  4J8X C;  5BT1 C;  3AZN C;  1TZY D;  3MGQ B;  1T3U A;  1EQZ C;  1BH9 B;  4WU8 A;  5JA4 B;  1AOI D;  4XZQ C;  4EO5 B;  2Y2O A;  5B24 C;  3WAA A;  1P3O A;  1P3I C;  2J8P A;  5CP6 C;  3X1T C;  2F8N A;  1HQ3 B;  5CPK B;  3REK D;  2Y2Q A;  2RIQ A;  5B0Y D;  3MNN D;  1P3A D;  2FFF B;  1M18 D;  5DNN A;  5AY8 C;  2XD1 A;  4G91 B;  2ZY4 A;  1P3P D;  3C1B C;  1S32 A;  5AVB D;  4J8V C;  4X23 A;  5JRG C;  3AZE B;  1KX5 A;  2PYO D;  5AV5 A;  5E5A C;  3AV2 C;  3VH5 W;  4QLC C;  3EPH A;  2NZD A;  3AZH D;  3AFA C;  4KGC D;  3VH6 W;  1P3F C;  2F8N K;  4Z66 A;  2Y2K A;  1PZR A;  3H0L C;  4H9P A;  3B6G D;  3H0M C;  5B0Z D;  3A6N B;  3WTP B;  4H9N B;  1F66 A;  4WU8 C;  4LD9 D;  3NQU A;  2Y2P A;  1ID3 B;  3REI A;  3VH6 A;  1P3O C;  1BH8 B;  3AN2 B;  4Z5T B;  4H9Q B;  2ARO D;  1ZLA A;  3F6T A;  3UTA A;  5DNM A;  2Y2N A;  3UTB B;  3B6F D;  5BO0 A;  5B32 D;  5DNN C;  4J8U D;  5BNV A;  4J8W D;  5F99 D;  1P3G D;  3LJA C;  3MVD A;  4X23 C;  5G49 A;  1KX5 C;  5GT3 A;  2LY8 A;  3AZM A;  3KXB B;  3WKJ A;  4H9S A;  2FJ7 B;  4DRB A;  3MGQ D;  5AV6 D;  5GXQ B;  3MGP A;  2NQB B;  4H9O B;  1P3M D;  4E45 A;  1Z2C B;  1F66 C;  4R8P D;  1KX4 D;  1P3K A;  5CPI A;  2IO5 B;  3REI C;  4KHA B;  3AZI D;  4WNN B;  3KUY D;  4H9R B;  5B40 D;  3REH A;  4YM6 A;  1ZLA C;  3UTA C;  5GT0 A;  3B0B A;  5B1L C;  5DNM C;  1TZY A;  3WA9 A;  3O62 B;  1TAF A;  5B0Y B;  3X1V B;  2RVQ C;  1P3A B;  1B6W A;  1HTA A;  3AZE D;  5AV9 A;  1P34 D;  2BYK B;  2F8N H;  1U35 A;  3EPK A;  5AVB B;  1ID3 C;  4NE6 A;  4JJN D;  3W96 D;  5GT3 C;  2L5A A;  3TU4 A;  3AZM C;  4H9S C;  4J8X A;  5GSU B;  2BYM A;  3WTP E;  3REJ D;  1N1J B;  3AZH B;  3LZ1 D;  4UUZ A;  3MGP C;  2XD5 A;  3MNN A;  4KGC B;  4HGA C;  5CPJ D;  4AWL B;  1P3B D;  3B6G B;  3VH5 T;  1P3I A;  3AN2 D;  4Z5T D;  3AZL B;  1JFI B;  3C1C B;  2PYO A;  4ZBJ B;  5C3I C;  3W99 B;  2FJ7 C;  5B2J D;  3REH C;  4YM6 C;  2ARO B;  5GXQ C;  5AV8 D;  3AYW D;  5GT0 C;  3X1U D;  3W97 D;  1TZY C;  3P5J B;  1KX3 A;  5FUG A;  3WA9 C;  5B31 A;  3B6F B;  5B1M B;  5JRG A;  5AV9 C;  1P3L A;  5B0Z A;  3KXB D;  4J8W B;  1U35 C;  4LD9 A;  5F99 B;  2Y2I A;  1P3G B;  2Y2H A;  1AOI C;  3AV1 A;  3KWQ A;  3AFA A;  3AZF A;  3TU4 C;  5KDM B;  1P3F A;  3X1S D;  2NQB D;  5B2I A;  3MGS D;  4KUD D;  3REK C;  5AV6 B;  1M1A D;  3MNN C;  5B33 D;  1M18 C;  3AZJ D;  1R4V A;  1M19 A;  5BNX B;  1P3M B;  1P3P C;  3LZ0 D;  3LEL D;  4R8P B;  2HIO D;  1KX4 B;  4XUJ D;  2CV5 D;  5B31 G;  2PYO C;  3UT9 A;  3AZI B;  5BS7 A;  3O62 D;  3KUY B;  3X1V D;  5B40 B;  3REL D;  1W2E A;  1BH9 A;  4KGC C;  3AZK D;  5JA4 A;  1KX3 C;  1ULY A;  3LJA A;  5B31 C;  3EPJ A;  2DF4 C;  4G92 C;  1P3L C;  2HUE C;  5AVC D;  5B0Z C;  4WU9 B;  1P34 B;  4LD9 C;  3W98 D;  1HQ3 A;  5GSU D;  3V9R B;  5CPK A;  3AV1 C;  3KWQ C;  4JJN B;  3W96 B;  3AZF C;  4ZUX D;  3AZN D;  5BT1 D;  5B2I C;  3REJ B;  2F8N G;  2NZD B;  3LZ1 B;  3VH5 A;  1H3O B;  3AZL D;  5B32 C;  3B0D B;  3R45 B;  1M19 C;  4J8U C;  5CPJ B;  3IP4 C;  4Z66 B;  3C1C D;  3W99 D;  1P3B B;  5CP6 D;  3X1T D;  2ZM5 A;  3NQU B;  5B1L A;  3UT9 C;  5BS7 C;  2JCH A;  2DQN C;  3A1I A;  4YS3 D;  5B2J B;  3MGQ C;  5B1M D;  5AY8 D;  5AV8 B;  3A6N A;  4H9N A;  3WTP A;  3X1U B;  3C1B D;  3AYW B;  3W97 B;  1ID3 A;  4EO5 C;  5BO0 B;  4J8V D;  1BH8 A;  4Z5T A;  4H9Q A;  5E5A D;  1HQ3 C;  3AV2 D;  3MGR D;  5CPK C;  4QLC D;  2G5I C;  3MVD B;  3UTB A;  3WKJ B;  1BFM A;  3X1S B;  4G91 C;  3MGS B;  4KUD B;  1M1A B;  5B33 B;  4WU8 D;  3AZJ B;  3AZG B;  3AZE C;  4WV4 B;  4CAY B;  4DRA A;  3LZ0 B;  3WAA D;  1P3O D;  3LEL B;  2FJ7 A;  2F8N D;  2HIO B;  4XUJ B;  5CPI B;  5GXQ A;  2CV5 B;  4H9O A;  3REL B;  5DNN D;  4WU9 D;  3WTP C;  3A6N C;  1S32 D;  3AZK B;  1AOI A;  4CSR B;  2G5H C;  4KHA A;  4X23 D;  1P3B C;  1KX5 D;  4WNN A;  5AVC B;  3AN2 C;  4H9R A;  4Z5T C;  5AV5 D;  3W98 B;  2NZD D;  3KSY A;  3REK A;  4ZUX B;  5B0Y A;  3UTB C;  3X1V A;  1P3A A;  1M18 A;  4J8X B;  3AZN B;  3EG5 B;  2BYM B;  4Z66 D;  2CWE A;  3AYW C;  1P3P A;  1EQZ B;  5AVB A;  4UUZ B;  3A1K A;  4XZQ B;  3REI D;  3KXB C;  5B24 B;  5GSU A;  5CP6 B;  3X1T B;  1N1J A;  3AZH A;  1ZLA D;  2YFV A;  3UTA D;  2Y2L A;  4KGC A;  5DNM D;  3H0R C;  3X1S C;  2NQB C;  4YS3 B;  4KUD C;  3NQJ B;  5AY8 B;  3B6G A;  3EPL A;  3C1B B;  2YFW A;  2IO5 C;  1WWI A;  1JFI A;  4J8V B;  3MVD D;  3W99 A;  5GT3 D;  5JRG B;  2Y2J A;  3AZM D;  3WKJ D;  5E5A B;  2ARO A;  3AV2 B;  3MGR B;  4QLC B;  2BG1 A;  3AFA B;  3O62 C;  5B0Y C;  1P3A C;  3X1V C;  3B6F A;  3AZG D;  5B32 A;  1P3F B;  4J8U A;  4J8W A;  4NE3 A;  5AVB C;  5F99 A;  3AZK C;  1P3G A;  4WU8 B;  1P3K D;  5CPI D;  5KDM A;  3WAA B;  1P3O B;  5GSU C;  2F8N B;  3MGQ A;  3AZH C;  5AV6 A;  4YM6 D;  3WA9 D;  5BNX A;  1P3M A;  4AWL C;  5DNN B;  3B6G C;  5AV9 D;  4R8P A;  1KX4 A;  3AZL C;  1U35 D;  1S32 B;  3LJA B;  2Y2G A;  3C1C C;  4ZBJ C;  5B32 G;  4X23 B;  3W99 C;  3AZI A;  1KX5 B;  3TU4 D;  2JE5 A;  3KUY A;  5B40 A;  5AV5 B;  4J8X D;  2ARO C;  1EQZ D;  4YS3 C;  3B6F C;  4E44 A;  5B1M C;  3AZE A;  4WU9 A;  4XZQ D;  1P34 A;  5B24 D;  4J8W C;  5F99 C;  4H9P B;  1P3G C;  1P3I D;  3V9R A;  1F66 B;  3W96 A;  4JJN A;  3B0C W;  4WZS B;  3REI B;  3MGR C;  3REJ A;  3LZ1 A;  5AV6 C;  4KUD A;  1ZLA B;  3UTA B;  5B1L B;  1H3O A;  5DNM B;  3R45 A;  1KX3 D;  5CPJ A;  1P3M C;  5B31 D;  1P3B A;  5JRG D;  1P3L D;  3AN2 A;  4R8P C;  1KX4 C;  5BNV B;  3KFU G;  3AV1 D;  3KWQ D;  3WAA C;  5G49 B;  3AFA D;  5GT3 B;  3AZF D;  3AZI C;  3KUY C;  3AZM B;  5B2J A;  5B40 C;  1P3F D;  4Z2M H;  5AV8 A;  5B2I D;  3AYW A;  3X1U A;  3W97 A;  2Y2M A;  3MGP B;  2VQR A;  2ZY3 A;  4HGA B;  1M19 D;  4WU9 C;  1P34 C;  3KXB A;  1S32 C;  4DQY B;  1P3K B;  3W96 C;  4JJN C;  5AV5 C;  5C3I B;  4NFT A;  3UT9 D;  3X1S A;  2NQB A;  3REJ C;  2NZD C;  3MGS A;  3LZ1 C;  3REH B;  1M1A A;  4YM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...