4NE3A

Human mhf1-mhf2 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
93
structure length
93
Chain Sequence
SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Centromere protein S
publication title The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ne3A00
4XUJB 2NZDB 1P3KD 3TU4B 1S32B 1P3BB 4XZQB 4Z66B 3UTBA 5F99C 3X1UA 5B2JA 5DNMA 5AV6C 4NE5A 4J8WA 3REHB 3C1BB 3LZ0C 5B0YC 4ZUXA 4KUDB 3WTPC 3W96A 3X1TC 3WAAD 3A6ND 2NQBA 2LY8A 3B6FD 3AZKC 5AVBD 3B0CW 3VH6A 4WNNB 5AVCC 4J8UA 1P3LD 2FJ7C 4WU8B 3MGRD 3A6NB 3B0DC 3MVDB 2AROA 2YFVA 4UUZA 5AVBB 5GT0C 1AOIA 3KUYD 1WWIA 1U35C 1M1AC 5BNXA 4KGCC 2PYOC 3AZEC 2CWEA 5AV8D 4QLCD 3RELA 4AWLC 5B24C 3AZIC 3AV1C 4J8VB 4WZSB 1P3FB 3B6GD 4J8XB 4Z5TA 3LZ1A 3KUYB 4XUJC 2NZDC 1TZYA 1M19B 5B40D 1EQZC 5CPID 4XZQC 4Z66C 1ZLAD 5AV8B 3C1CD 3R45A 3AZHC 3KWQD 3UT9D 1KX5D 1F66C 3WKJD 5B2ID 5E5AD 5B32B 3REKA 1P3KC 5B40B 5CPIB 3W97D 3C1CB 2HUEC 5CPJA 3MGSA 3KWQB 1P3GD 1KX5B 3MNNA 2F8NA 3AZNA 4LD9D 4JJND 1M18A 4H9QB 3WAAC 3A6NC 5BS7C 3B6FC 5B32G 3VH5W 2YFWA 4WU9A 5AY8D 5AVBC 3B0CT 4CAYB 3REIB 3UTAD 1ID3A 2CV5D 1P3LC 3MGRC 3KXBB 2BYKB 4Z2MH 4YS3A 3X1VA 1P34A 5JRGD 3UTAB 5C3IB 3W98D 3KUYC 3AZMD 3AZGB 1M19C 4X23A 4H9NA 4NFTA 5AV8C 5F99B 2HIOD 3W99D 4QLCC 5FUGA 3LJAB 3AN2A 5AV6A 4G91C 3B6GC 5CPKA 3LZ0B 3WTPB 2BYMB 5B0YA 3X1TB 1P3PA 4H9RA 5B33A 5B40C 1P3AD 5CPIC 1ZLAC 1P3MD 5B1MD 3NQUA 3C1CC 3AZKB 3KWQC 3O62A 3AFAA 1KX5C 3VH5A 3WA9A 1KX3D 5B2IC 3AV2A 4HGAB 4YM6D 5AVCA 3B0DB 2FJ7A 1TAFB 5AV5D 5CP6A 3W97C 2JSSA 3MGPD 1P3GC 5B31D 1P3OA 1M1AB 1U35A 5AV9D 4JJNC 4KGCA 4YM6B 2PYOA 3AZEA 3AYWB 2L5AA 5BNVA 1ULYA 5AV5B 3AZIB 5G49B 3AV1B 1P3IA 5AY8C 3MGPB 5C3IC 3UTAC 1KX4A 5B31B 3AZGC 3LELB 5B1LD 3AZFA 2CV5C 2NZDA 1EQZB 4H9OB 3TU4A 1S32A 1P3BA 3AZHB 1N1JA 4XZQA 4Z66A 3LJAC 1F66B 3REHA 3C1BA 5GSUA 3AZMC 4KUDA 3X1UD 5B2JD 1P3KB 4J8WD 5B31G 3W99C 4G92B 2HUEB 4ZUXD 3KSYA 1JFIA 5B0ZA 2NQBD 4WNNA 4HGAC 5GXQA 3WAAB 4WU8A 4J8WB 1P3MC 3B6FB 3MVDA 5DNNA 1HTAA 4J8UD 5AVBA 4DRAA 1KX3C 2F8NH 2NQBB 2AROD 5JA4B 1P3LB 4YM6C 3MGRB 1HQ3A 3AYWC 1AOID 5AV5C 3VH6T 3MGPC 1P3FA 4J8VA 4J8XA 5B31C 3LELC 3KUYA 3RELD 5AV9C 2AROB 3REJD 1M19A 4QLCB 3AZLD 4Z5TD 5AV8A 3LZ1D 4G91B 3B6GB 1TZYD 5KDMA 3MGQA 2RVQD 5B32A 3REJB 1ZLAB 1BH8B 4G92C 4E45A 5CPIA 3AZLB 3C1CA 3UT9B 3NQJB 3REKD 3KWQA 1KX5A 4KHAB 3WKJB 1H3OB 5B2IB 5E5AB 5GT3D 4M6BA 1Q9CA 3X1UC 3R45B 4H9QA 5CPJD 3MGSD 4J8WC 3MNND 3W97B 5BT1D 4H9SC 4ZUXC 1P3GB 4CAYA 3REIA 4CSRB 1M18D 2NQBC 3V9RA 5GT3B 4LD9B 4JJNB 4WU9D 3MGSB 1ID3D 3KXBA 2BYKA 3MNNB 5AY8B 4J8UC 3AZGA 4YS3D 2CV5B 3X1VD 2AROC 4H9PB 4E44A 1AOIC 1R4VA 5F99A 3LJAA 5JRGB 4X23D 3W98B 3AZMB 3LZ0A 3WTPA 2BYMA 3RELC 3X1TA 3AZJD 3REJC 3AN2D 5AV6D 2HIOB 5CPKD 3AZLC 3W99B 4Z5TC 4EO5C 3UT9C 3AZKA 5B0YD 1P3PD 1TZYC 3WKJC 5B33D 4X23B 5E5AC 1BFMA 2RVQC 1P3AB 3O62D 3AFAD 3AZJB 3WA9D 1P3MB 5B1MB 5CPKB 3AV2D 5GT0A 5AVCD 1KX3B 2FJ7D 5B33B 5GT3C 4LD9C 5CP6D 1M1AA 3X1SD 5CPJC 3MGSC 4YM6A 3AFAB 1P3OD 3MNNC 3VH5T 3AYWA 5BT1C 1BH9B 5B24A 3AZIA 3AV1A 5G49A 3MGPA 1M18C 4KGCD 2PYOD 3AZED 4XUJA 3LELA 5AV9B 3B0BA 1P3ID 1EQZA 4H9OA 4WU9C 3X1SB 1KX4D 1ID3C 3AZHA 4R8PD 5JRGC 1F66A 3AZFD 2NZDD 3W98C 3TU4D 1KU5A 1S32D 3UTBD 1P3BD 5B1LB 5DNMD 4YS3C 3X1VC 1P3KA 5BO0B 2HIOC 4R8PB 3C1BD 5GSUD 3REHD 3W96D 4KUDD 1A7WA 4X23C 3UTBB 3X1UB 1N1JB 5B2JB 5DNMB 1P3AC 3AZJC 3WAAA 3A6NA 3AN2C 5B1MC 5B0ZD 5BS7A 5CPKC 3B6FA 4ZUXB 5GSUB 4H9SA 5GXQD 3W96B 1P3PC 5B33C 4WU8D 1B6WA 3MVDD 5JA4A 5DNND 1P3LA 3O62C 3AFAC 3MGRA 3WA9C 1JFIB 5B0ZB 4J8UB 3AV2C 5GXQB 1HQ3D 5CP6C 2YFVB 4UUZB 1P3FD 3X1SC 5DNNB 4ZBJB 4J8VD 1AOIB 4J8XD 1P3OC 4QLCA 5CHLB 5BNXB 3B6GA 1M19D 2F8NK 1HQ3B 5B1LC 3RELB 1P3IC 5B40A 3REJA 1ZLAA 1KX4C 1BH8A 4Z5TB 4R8PC 4EO5B 3LZ1B 3AZLA 3MGQD 3UT9A 1TZYB 5B32D 3NQJA 3AZFC 4KHAA 3WKJA 1H3OA 3TU4C 5B2IA 1S32C 3UTBC 5E5AA 1P3BC 5B2JC 5DNMC 4NE6A 3W97A 5KDMB 3REHC 3C1BC 5GSUC 3AZND 3W96C 3REKB 2F8ND 4KUDC 3MGQB 1P3GA 4CSRA 5GT3A 4LD9A 4JJNA 5CPJB 3REID 5B0ZC 2F8NB 5AY8A 3UTAA 5GXQC 3AZNB 2IO5B 1M18B 4WU8C 3KXBD 1P34D 2CV5A 3MVDC 2YFWB 4H9PA 4WU9B 5DNNC 4ZBJC 1ID3B 3AZGD 3V9RB 5JRGA 3W98A 1HQ3C 3AZMA 4YS3B 5F99D 3X1VB 1P34B 2F8NG 3LJAD 1P3FC 4J8VC 3LZ1C 4J8XC 2HIOA 3W99A 3LZ0D 3WTPD 3X1TD 4H9NB 1B67A 1F1EA 5FUGB 3AZKD 3AN2B 5AV6B 1P3AA 3AZJA 1TAFA 1P3MA 5B1MA 3REKC 5B0YB 3MGQC 1P3PB 5B32C 4H9RB 1WWSA 1KX3A 3NQUB 3O62B 3WA9B 3WTPE 5GT0D 4WV4B 5AV5A 1BH9A 1U35D 3AZNC 3AV2B 1M1AD 2IO5C 5AVCB 5B31A 2FJ7B 3AYWD 4NE3A 5CP6B 5AV9A 5B24D 3AZID 3AV1D 3VH6W 4DRBA 1P3OB 3X1SA 3REIC 5GT0B 4XUJD 3LELD 1U35B 4KGCB 1EQZD 2PYOB 3AZEB 4XZQD 4Z66D 3AZHD 3KXBC 5B1LA 5BNVB 1P34C 1P3IB 4AWLB 5B24B 1F66D 1KX4B 5BO0A 4Z2MG 4R8PA 3AZFB
chains in the Genus database with same CATH superfamily
4XUJB 2NZDB 1P3KD 3TU4B 1S32B 1P3BB 2J8PA 4XZQB 4Z66B 3UTBA 5F99C 3X1UA 5B2JA 5DNMA 5AV6C 4NE5A 4J8WA 3H0LC 3REHB 3C1BB 3LZ0C 5B0YC 4ZUXA 4KUDB 3WTPC 3W96A 3X1TC 3WAAD 3A6ND 2NQBA 2DF4C 2LY8A 3B6FD 3AZKC 5AVBD 3B0CW 3VH6A 4WNNB 5AVCC 4J8UA 3F6TA 3P5JB 1P3LD 2FJ7C 4WU8B 3MGRD 3A6NB 3B0DC 3MVDB 2AROA 2YFVA 4UUZA 2VQRA 5GT0C 5AVBB 1AOIA 3KUYD 1WWIA 1U35C 1M1AC 5BNXA 4KGCC 2PYOC 3AZEC 2CWEA 5AV8D 4QLCD 3RELA 4AWLC 5B24C 3AZIC 3AV1C 4J8VB 4WZSB 1P3FB 3B6GD 4J8XB 4Z5TA 3LZ1A 3KUYB 2ZY4A 4XUJC 2NZDC 1TZYA 1M19B 5B40D 1EQZC 3EG5B 5CPID 4XZQC 4Z66C 1ZLAD 2ZY5A 5AV8B 3C1CD 3R45A 3AZHC 3KWQD 3UT9D 1KX5D 1F66C 3WKJD 5B2ID 5E5AD 5B32B 3REKA 1P3KC 5B40B 5CPIB 3W97D 3C1CB 2HUEC 5CPJA 3MGSA 3KWQB 1P3GD 1KX5B 3MNNA 2F8NA 3AZNA 4LD9D 4JJND 1M18A 4H9QB 2ZY2A 3WAAC 3A6NC 5BS7C 3B6FC 3H0RC 5B32G 3VH5W 2YFWA 4WU9A 5AY8D 5AVBC 3B0CT 4CAYB 3REIB 3UTAD 1ID3A 2CV5D 1P3LC 3MGRC 3KXBB 2BYKB 4Z2MH 4YS3A 3X1VA 1P34A 5JRGD 3UTAB 5C3IB 3W98D 3KUYC 3AZMD 2Y2MA 3AZGB 1M19C 4X23A 4H9NA 4NFTA 5AV8C 5F99B 2HIOD 3W99D 4QLCC 5FUGA 3LJAB 3AN2A 5AV6A 4G91C 3B6GC 5CPKA 3LZ0B 3WTPB 2BYMB 5B0YA 3X1TB 1P3PA 4H9RA 5B33A 5B40C 1P3AD 5CPIC 1ZLAC 1P3MD 5B1MD 3NQUA 3C1CC 3AZKB 3KWQC 1Z2CB 3O62A 3AFAA 2Y2LA 3VH5A 1KX5C 3WA9A 1KX3D 5B2IC 3AV2A 4HGAB 4YM6D 5AVCA 3B0DB 2FJ7A 2Y2HA 1TAFB 5AV5D 5CP6A 3W97C 2JSSA 2FFFB 3MGPD 1P3GC 5B31D 1P3OA 1M1AB 1U35A 5AV9D 4JJNC 4KGCA 4YM6B 2PYOA 3AZEA 2Y2NA 3AYWB 2L5AA 5BNVA 1ULYA 5AV5B 3AZIB 5G49B 3AV1B 1P3IA 5AY8C 3MGPB 5C3IC 3UTAC 1KX4A 5B31B 3AZGC 3LELB 5B1LD 3AZFA 2CV5C 2NZDA 1EQZB 4H9OB 3TU4A 1S32A 1P3BA 3AZHB 1N1JA 4XZQA 4Z66A 3LJAC 1F66B 3REHA 3C1BA 5GSUA 3AZMC 1PZRA 4KUDA 3X1UD 3EPKA 5B2JD 1P3KB 4J8WD 5B31G 3W99C 4G92B 2HUEB 4ZUXD 3KSYA 1JFIA 5B0ZA 2NQBD 4WNNA 4HGAC 5GXQA 3WAAB 4WU8A 4J8WB 1P3MC 3B6FB 3MVDA 5DNNA 1HTAA 4J8UD 5AVBA 4DRAA 1KX3C 2F8NH 3KFUG 2NQBB 2G5HC 2AROD 5JA4B 1P3LB 4YM6C 3MGRB 1HQ3A 3AYWC 1AOID 5AV5C 3VH6T 3MGPC 1P3FA 4J8VA 4J8XA 5B31C 3LELC 3KUYA 3RELD 5AV9C 2AROB 3REJD 1M19A 3FDDA 4QLCB 3AZLD 4Z5TD 5AV8A 3LZ1D 2Y2KA 4G91B 3B6GB 1TZYD 5KDMA 3MGQA 2Y2IA 2RVQD 5B32A 3REJB 1ZLAB 4UPKA 1BH8B 4G92C 4E45A 5CPIA 3AZLB 3C1CA 3UT9B 3NQJB 3REKD 3KWQA 1KX5A 4KHAB 3WKJB 1H3OB 2Y2OA 5B2IB 5E5AB 5GT3D 4M6BA 1Q9CA 3X1UC 3R45B 4H9QA 5CPJD 3MGSD 4J8WC 3MNND 3W97B 1T3UA 5BT1D 4H9SC 4ZUXC 1P3GB 4CAYA 3REIA 4CSRB 1M18D 2NQBC 3V9RA 5GT3B 4LD9B 4JJNB 4WU9D 3MGSB 2RIQA 1ID3D 3KXBA 2BYKA 3MNNB 5AY8B 4J8UC 3AZGA 4YS3D 2CV5B 3X1VD 2AROC 4H9PB 4E44A 1AOIC 1R4VA 3A1IA 5F99A 3LJAA 5JRGB 4X23D 3W98B 3AZMB 3LZ0A 3WTPA 2BYMA 3RELC 3X1TA 3AZJD 3REJC 2W8SA 3AN2D 3A1KA 5AV6D 2HIOB 5CPKD 3AZLC 3W99B 4Z5TC 4EO5C 3UT9C 3AZKA 5B0YD 1P3PD 1TZYC 3WKJC 5B33D 4X23B 5E5AC 1BFMA 2RVQC 1P3AB 3O62D 3AFAD 3AZJB 3WA9D 1P3MB 5B1MB 5CPKB 3AV2D 5GT0A 5AVCD 1KX3B 2FJ7D 5B33B 5GT3C 4LD9C 5CP6D 1M1AA 3X1SD 3EPJA 3MGSC 5CPJC 4YM6A 3AFAB 1P3OD 3MNNC 3VH5T 3AYWA 2XD1A 5BT1C 1BH9B 5B24A 3AZIA 3AV1A 5G49A 2XD5A 3MGPA 1M18C 4KGCD 2PYOD 3AZED 4XUJA 3LELA 5AV9B 3B0BA 1P3ID 1EQZA 4H9OA 4WU9C 3X1SB 1KX4D 1ID3C 3AZHA 4R8PD 5JRGC 1F66A 3AZFD 2NZDD 3W98C 3TU4D 1KU5A 1S32D 3UTBD 1P3BD 5B1LB 5DNMD 4YS3C 3EPLA 3X1VC 1P3KA 5BO0B 2HIOC 4WJ3C 4R8PB 3C1BD 5GSUD 3REHD 3W96D 4KUDD 2Y2PA 1A7WA 4X23C 3UTBB 3X1UB 1N1JB 5B2JB 3H0MC 5DNMB 1P3AC 3AZJC 3WAAA 3A6NA 3AN2C 5B1MC 5B0ZD 5BS7A 5CPKC 3B6FA 4ZUXB 5GSUB 4H9SA 5GXQD 3W96B 1P3PC 5B33C 4WU8D 1B6WA 3MVDD 5JA4A 5DNND 1P3LA 3O62C 3AFAC 3MGRA 3WA9C 1JFIB 5B0ZB 4J8UB 3AV2C 5GXQB 1HQ3D 5CP6C 2YFVB 4UUZB 1P3FD 3X1SC 5DNNB 4ZBJB 4J8VD 1AOIB 4J8XD 1P3OC 4QLCA 2JCHA 5CHLB 5BNXB 3B6GA 1M19D 2F8NK 1HQ3B 5B1LC 3RELB 1P3IC 2BG1A 5B40A 3REJA 1ZLAA 1KX4C 1BH8A 4Z5TB 4R8PC 4EO5B 3LZ1B 3AZLA 3MGQD 3UT9A 1TZYB 5B32D 3NQJA 3AZFC 4KHAA 3WKJA 1H3OA 2DQNC 5B2IA 3TU4C 3UTBC 5E5AA 1S32C 1P3BC 5B2JC 3AL0C 5DNMC 3IP4C 2G5IC 4NE6A 3W97A 5KDMB 3REHC 3C1BC 5GSUC 3AZND 3W96C 3REKB 2F8ND 4KUDC 3MGQB 1P3GA 4CSRA 5GT3A 4LD9A 4JJNA 5CPJB 3REID 5B0ZC 2F8NB 5AY8A 3UTAA 5GXQC 3AZNB 2IO5B 1M18B 4WU8C 3KXBD 1P34D 2CV5A 3MVDC 2YFWB 4H9PA 4WU9B 5DNNC 4ZBJC 3EPHA 1ID3B 2JE5A 3AZGD 3V9RB 5JRGA 3W98A 1HQ3C 3AZMA 4YS3B 5F99D 3X1VB 1P34B 2F8NG 2Y2JA 3LJAD 1P3FC 4J8VC 3LZ1C 4J8XC 2HIOA 3W99A 3LZ0D 3WTPD 2Y2GA 3X1TD 4H9NB 1B67A 1F1EA 5FUGB 3AZKD 3AN2B 2UWXA 5AV6B 1P3AA 3AZJA 1TAFA 1W2EA 1P3MA 5B1MA 3REKC 5B0YB 3MGQC 1P3PB 5B32C 4H9RB 1WWSA 1KX3A 3NQUB 2F2AC 3O62B 3WA9B 3WTPE 5GT0D 4WV4B 5AV5A 1BH9A 1U35D 3AZNC 3AV2B 1M1AD 2IO5C 5AVCB 5B31A 2FJ7B 3AYWD 4NE3A 5CP6B 5AV9A 5B24D 3AZID 3AV1D 3VH6W 4DRBA 1P3OB 3X1SA 3REIC 5GT0B 4XUJD 3LELD 1U35B 4DQYB 4KGCB 1EQZD 2PYOB 3AZEB 4XZQD 4Z66D 3AZHD 3KXBC 5B1LA 5BNVB 1P34C 1P3IB 4AWLB 5B24B 2ZY3A 1KX4B 1F66D 5BO0A 2Y2QA 4Z2MG 4R8PA 3AZFB 2ZM5A
chains in the Genus database with same CATH topology
4XUJB 2NZDB 1P3KD 3TU4B 1S32B 1P3BB 2J8PA 4XZQB 4Z66B 3UTBA 5F99C 3X1UA 5B2JA 5DNMA 5AV6C 4NE5A 4J8WA 3H0LC 3REHB 3C1BB 3LZ0C 5B0YC 4ZUXA 4KUDB 3WTPC 3W96A 3X1TC 3WAAD 3A6ND 2NQBA 2DF4C 2LY8A 3B6FD 3AZKC 5AVBD 3B0CW 3VH6A 4WNNB 5AVCC 4J8UA 3F6TA 3P5JB 1P3LD 2FJ7C 4WU8B 3MGRD 3A6NB 3B0DC 3MVDB 2AROA 2YFVA 4UUZA 2VQRA 5GT0C 5AVBB 1AOIA 3KUYD 1WWIA 1U35C 1M1AC 5BNXA 4KGCC 2PYOC 3AZEC 2CWEA 5AV8D 4QLCD 3RELA 4AWLC 5B24C 3AZIC 3AV1C 4J8VB 4WZSB 1P3FB 3B6GD 4J8XB 4Z5TA 3LZ1A 3KUYB 2ZY4A 4XUJC 2NZDC 1TZYA 1M19B 5B40D 1EQZC 3EG5B 5CPID 4XZQC 4Z66C 1ZLAD 2ZY5A 5AV8B 3C1CD 3R45A 3AZHC 3KWQD 3UT9D 1KX5D 1F66C 3WKJD 5B2ID 5E5AD 5B32B 3REKA 1P3KC 5B40B 5CPIB 3W97D 3C1CB 2HUEC 5CPJA 3MGSA 3KWQB 1P3GD 1KX5B 3MNNA 2F8NA 3AZNA 4LD9D 4JJND 1M18A 4H9QB 2ZY2A 3WAAC 3A6NC 5BS7C 3B6FC 3H0RC 5B32G 3VH5W 2YFWA 4WU9A 5AY8D 5AVBC 3B0CT 4CAYB 3REIB 3UTAD 1ID3A 2CV5D 1P3LC 3MGRC 3KXBB 2BYKB 4Z2MH 4YS3A 3X1VA 1P34A 5JRGD 3UTAB 5C3IB 3W98D 3KUYC 3AZMD 2Y2MA 3AZGB 1M19C 4X23A 4H9NA 4NFTA 5AV8C 5F99B 2HIOD 3W99D 4QLCC 5FUGA 3LJAB 3AN2A 5AV6A 4G91C 3B6GC 5CPKA 3LZ0B 3WTPB 2BYMB 5B0YA 3X1TB 1P3PA 4H9RA 5B33A 5B40C 1P3AD 5CPIC 1ZLAC 1P3MD 5B1MD 3NQUA 3C1CC 3AZKB 3KWQC 1Z2CB 3O62A 3AFAA 2Y2LA 3VH5A 1KX5C 3WA9A 1KX3D 5B2IC 3AV2A 4HGAB 4YM6D 5AVCA 3B0DB 2FJ7A 2Y2HA 1TAFB 5AV5D 5CP6A 3W97C 2JSSA 2FFFB 3MGPD 1P3GC 5B31D 1P3OA 1M1AB 1U35A 5AV9D 4JJNC 4KGCA 4YM6B 2PYOA 3AZEA 2Y2NA 3AYWB 2L5AA 5BNVA 1ULYA 5AV5B 3AZIB 5G49B 3AV1B 1P3IA 5AY8C 3MGPB 5C3IC 3UTAC 1KX4A 5B31B 3AZGC 3LELB 5B1LD 3AZFA 2CV5C 2NZDA 1EQZB 4H9OB 3TU4A 1S32A 1P3BA 3AZHB 1N1JA 4XZQA 4Z66A 3LJAC 1F66B 3REHA 3C1BA 5GSUA 3AZMC 1PZRA 4KUDA 3X1UD 3EPKA 5B2JD 1P3KB 4J8WD 5B31G 3W99C 4G92B 2HUEB 4ZUXD 3KSYA 1JFIA 5B0ZA 2NQBD 4WNNA 4HGAC 5GXQA 3WAAB 4WU8A 4J8WB 1P3MC 3B6FB 3MVDA 5DNNA 1HTAA 4J8UD 5AVBA 4DRAA 1KX3C 2F8NH 3KFUG 2NQBB 2G5HC 2AROD 5JA4B 1P3LB 4YM6C 3MGRB 1HQ3A 3AYWC 1AOID 5AV5C 3VH6T 3MGPC 1P3FA 4J8VA 4J8XA 5B31C 3LELC 3KUYA 3RELD 5AV9C 2AROB 3REJD 1M19A 3FDDA 4QLCB 3AZLD 4Z5TD 5AV8A 3LZ1D 2Y2KA 4G91B 3B6GB 1TZYD 5KDMA 3MGQA 2Y2IA 2RVQD 5B32A 3REJB 1ZLAB 4UPKA 1BH8B 4G92C 4E45A 5CPIA 3AZLB 3C1CA 3UT9B 3NQJB 3REKD 3KWQA 1KX5A 4KHAB 3WKJB 1H3OB 2Y2OA 5B2IB 5E5AB 5GT3D 4M6BA 1Q9CA 3X1UC 3R45B 4H9QA 5CPJD 3MGSD 4J8WC 3MNND 3W97B 1T3UA 5BT1D 4H9SC 4ZUXC 1P3GB 4CAYA 3REIA 4CSRB 1M18D 2NQBC 3V9RA 5GT3B 4LD9B 4JJNB 4WU9D 3MGSB 2RIQA 1ID3D 3KXBA 2BYKA 3MNNB 5AY8B 4J8UC 3AZGA 4YS3D 2CV5B 3X1VD 2AROC 4H9PB 4E44A 1AOIC 1R4VA 3A1IA 5F99A 3LJAA 5JRGB 4X23D 3W98B 3AZMB 3LZ0A 3WTPA 2BYMA 3RELC 3X1TA 3AZJD 3REJC 2W8SA 3AN2D 3A1KA 5AV6D 2HIOB 5CPKD 3AZLC 3W99B 4Z5TC 4EO5C 3UT9C 3AZKA 5B0YD 1P3PD 1TZYC 3WKJC 5B33D 4X23B 5E5AC 1BFMA 2RVQC 1P3AB 3O62D 3AFAD 3AZJB 3WA9D 1P3MB 5B1MB 5CPKB 3AV2D 5GT0A 5AVCD 1KX3B 2FJ7D 5B33B 5GT3C 4LD9C 5CP6D 1M1AA 3X1SD 3EPJA 3MGSC 5CPJC 4YM6A 3AFAB 1P3OD 3MNNC 3VH5T 3AYWA 2XD1A 5BT1C 1BH9B 5B24A 3AZIA 3AV1A 5G49A 2XD5A 3MGPA 1M18C 4KGCD 2PYOD 3AZED 4XUJA 3LELA 5AV9B 3B0BA 1P3ID 1EQZA 4H9OA 4WU9C 3X1SB 1KX4D 1ID3C 3AZHA 4R8PD 5JRGC 1F66A 3AZFD 2NZDD 3W98C 3TU4D 1KU5A 1S32D 3UTBD 1P3BD 5B1LB 5DNMD 4YS3C 3EPLA 3X1VC 1P3KA 5BO0B 2HIOC 4WJ3C 4R8PB 3C1BD 5GSUD 3REHD 3W96D 4KUDD 2Y2PA 1A7WA 4X23C 3UTBB 3X1UB 1N1JB 5B2JB 3H0MC 5DNMB 1P3AC 3AZJC 3WAAA 3A6NA 3AN2C 5B1MC 5B0ZD 5BS7A 5CPKC 3B6FA 4ZUXB 5GSUB 4H9SA 5GXQD 3W96B 1P3PC 5B33C 4WU8D 1B6WA 3MVDD 5JA4A 5DNND 1P3LA 3O62C 3AFAC 3MGRA 3WA9C 1JFIB 5B0ZB 4J8UB 3AV2C 5GXQB 1HQ3D 5CP6C 2YFVB 4UUZB 1P3FD 3X1SC 5DNNB 4ZBJB 4J8VD 1AOIB 4J8XD 1P3OC 4QLCA 2JCHA 5CHLB 5BNXB 3B6GA 1M19D 2F8NK 1HQ3B 5B1LC 3RELB 1P3IC 2BG1A 5B40A 3REJA 1ZLAA 1KX4C 1BH8A 4Z5TB 4R8PC 4EO5B 3LZ1B 3AZLA 3MGQD 3UT9A 1TZYB 5B32D 3NQJA 3AZFC 4KHAA 3WKJA 1H3OA 2DQNC 5B2IA 3TU4C 3UTBC 5E5AA 1S32C 1P3BC 5B2JC 3AL0C 5DNMC 3IP4C 2G5IC 4NE6A 3W97A 5KDMB 3REHC 3C1BC 5GSUC 3AZND 3W96C 3REKB 2F8ND 4KUDC 3MGQB 1P3GA 4CSRA 5GT3A 4LD9A 4JJNA 5CPJB 3REID 5B0ZC 2F8NB 5AY8A 3UTAA 5GXQC 3AZNB 2IO5B 1M18B 4WU8C 3KXBD 1P34D 2CV5A 3MVDC 2YFWB 4H9PA 4WU9B 5DNNC 4ZBJC 3EPHA 1ID3B 2JE5A 3AZGD 3V9RB 5JRGA 3W98A 1HQ3C 3AZMA 4YS3B 5F99D 3X1VB 1P34B 2F8NG 2Y2JA 3LJAD 1P3FC 4J8VC 3LZ1C 4J8XC 2HIOA 3W99A 3LZ0D 3WTPD 2Y2GA 3X1TD 4H9NB 1B67A 1F1EA 5FUGB 3AZKD 3AN2B 2UWXA 5AV6B 1P3AA 3AZJA 1TAFA 1W2EA 1P3MA 5B1MA 3REKC 5B0YB 3MGQC 1P3PB 5B32C 4H9RB 1WWSA 1KX3A 3NQUB 2F2AC 3O62B 3WA9B 3WTPE 5GT0D 4WV4B 5AV5A 1BH9A 1U35D 3AZNC 3AV2B 1M1AD 2IO5C 5AVCB 5B31A 2FJ7B 3AYWD 4NE3A 5CP6B 5AV9A 5B24D 3AZID 3AV1D 3VH6W 4DRBA 1P3OB 3X1SA 3REIC 5GT0B 4XUJD 3LELD 1U35B 4DQYB 4KGCB 1EQZD 2PYOB 3AZEB 4XZQD 4Z66D 3AZHD 3KXBC 5B1LA 5BNVB 1P34C 1P3IB 4AWLB 5B24B 2ZY3A 1KX4B 1F66D 5BO0A 2Y2QA 4Z2MG 4R8PA 3AZFB 2ZM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUJ B;  2NZD B;  1P3K D;  3TU4 B;  1S32 B;  1P3B B;  4XZQ B;  4Z66 B;  3UTB A;  5F99 C;  3X1U A;  5B2J A;  5DNM A;  5AV6 C;  4NE5 A;  4J8W A;  3REH B;  3C1B B;  3LZ0 C;  5B0Y C;  4ZUX A;  4KUD B;  3WTP C;  3W96 A;  3X1T C;  3WAA D;  3A6N D;  2NQB A;  2LY8 A;  3B6F D;  3AZK C;  5AVB D;  3B0C W;  3VH6 A;  4WNN B;  5AVC C;  4J8U A;  1P3L D;  2FJ7 C;  4WU8 B;  3MGR D;  3A6N B;  3B0D C;  3MVD B;  2ARO A;  2YFV A;  4UUZ A;  5AVB B;  5GT0 C;  1AOI A;  3KUY D;  1WWI A;  1U35 C;  1M1A C;  5BNX A;  4KGC C;  2PYO C;  3AZE C;  2CWE A;  5AV8 D;  4QLC D;  3REL A;  4AWL C;  5B24 C;  3AZI C;  3AV1 C;  4J8V B;  4WZS B;  1P3F B;  3B6G D;  4J8X B;  4Z5T A;  3LZ1 A;  3KUY B;  4XUJ C;  2NZD C;  1TZY A;  1M19 B;  5B40 D;  1EQZ C;  5CPI D;  4XZQ C;  4Z66 C;  1ZLA D;  5AV8 B;  3C1C D;  3R45 A;  3AZH C;  3KWQ D;  3UT9 D;  1KX5 D;  1F66 C;  3WKJ D;  5B2I D;  5E5A D;  5B32 B;  3REK A;  1P3K C;  5B40 B;  5CPI B;  3W97 D;  3C1C B;  2HUE C;  5CPJ A;  3MGS A;  3KWQ B;  1P3G D;  1KX5 B;  3MNN A;  2F8N A;  3AZN A;  4LD9 D;  4JJN D;  1M18 A;  4H9Q B;  3WAA C;  3A6N C;  5BS7 C;  3B6F C;  5B32 G;  3VH5 W;  2YFW A;  4WU9 A;  5AY8 D;  5AVB C;  3B0C T;  4CAY B;  3REI B;  3UTA D;  1ID3 A;  2CV5 D;  1P3L C;  3MGR C;  3KXB B;  2BYK B;  4Z2M H;  4YS3 A;  3X1V A;  1P34 A;  5JRG D;  3UTA B;  5C3I B;  3W98 D;  3KUY C;  3AZM D;  3AZG B;  1M19 C;  4X23 A;  4H9N A;  4NFT A;  5AV8 C;  5F99 B;  2HIO D;  3W99 D;  4QLC C;  5FUG A;  3LJA B;  3AN2 A;  5AV6 A;  4G91 C;  3B6G C;  5CPK A;  3LZ0 B;  3WTP B;  2BYM B;  5B0Y A;  3X1T B;  1P3P A;  4H9R A;  5B33 A;  5B40 C;  1P3A D;  5CPI C;  1ZLA C;  1P3M D;  5B1M D;  3NQU A;  3C1C C;  3AZK B;  3KWQ C;  3O62 A;  3AFA A;  1KX5 C;  3VH5 A;  3WA9 A;  1KX3 D;  5B2I C;  3AV2 A;  4HGA B;  4YM6 D;  5AVC A;  3B0D B;  2FJ7 A;  1TAF B;  5AV5 D;  5CP6 A;  3W97 C;  2JSS A;  3MGP D;  1P3G C;  5B31 D;  1P3O A;  1M1A B;  1U35 A;  5AV9 D;  4JJN C;  4KGC A;  4YM6 B;  2PYO A;  3AZE A;  3AYW B;  2L5A A;  5BNV A;  1ULY A;  5AV5 B;  3AZI B;  5G49 B;  3AV1 B;  1P3I A;  5AY8 C;  3MGP B;  5C3I C;  3UTA C;  1KX4 A;  5B31 B;  3AZG C;  3LEL B;  5B1L D;  3AZF A;  2CV5 C;  2NZD A;  1EQZ B;  4H9O B;  3TU4 A;  1S32 A;  1P3B A;  3AZH B;  1N1J A;  4XZQ A;  4Z66 A;  3LJA C;  1F66 B;  3REH A;  3C1B A;  5GSU A;  3AZM C;  4KUD A;  3X1U D;  5B2J D;  1P3K B;  4J8W D;  5B31 G;  3W99 C;  4G92 B;  2HUE B;  4ZUX D;  3KSY A;  1JFI A;  5B0Z A;  2NQB D;  4WNN A;  4HGA C;  5GXQ A;  3WAA B;  4WU8 A;  4J8W B;  1P3M C;  3B6F B;  3MVD A;  5DNN A;  1HTA A;  4J8U D;  5AVB A;  4DRA A;  1KX3 C;  2F8N H;  2NQB B;  2ARO D;  5JA4 B;  1P3L B;  4YM6 C;  3MGR B;  1HQ3 A;  3AYW C;  1AOI D;  5AV5 C;  3VH6 T;  3MGP C;  1P3F A;  4J8V A;  4J8X A;  5B31 C;  3LEL C;  3KUY A;  3REL D;  5AV9 C;  2ARO B;  3REJ D;  1M19 A;  4QLC B;  3AZL D;  4Z5T D;  5AV8 A;  3LZ1 D;  4G91 B;  3B6G B;  1TZY D;  5KDM A;  3MGQ A;  2RVQ D;  5B32 A;  3REJ B;  1ZLA B;  1BH8 B;  4G92 C;  4E45 A;  5CPI A;  3AZL B;  3C1C A;  3UT9 B;  3NQJ B;  3REK D;  3KWQ A;  1KX5 A;  4KHA B;  3WKJ B;  1H3O B;  5B2I B;  5E5A B;  5GT3 D;  4M6B A;  1Q9C A;  3X1U C;  3R45 B;  4H9Q A;  5CPJ D;  3MGS D;  4J8W C;  3MNN D;  3W97 B;  5BT1 D;  4H9S C;  4ZUX C;  1P3G B;  4CAY A;  3REI A;  4CSR B;  1M18 D;  2NQB C;  3V9R A;  5GT3 B;  4LD9 B;  4JJN B;  4WU9 D;  3MGS B;  1ID3 D;  3KXB A;  2BYK A;  3MNN B;  5AY8 B;  4J8U C;  3AZG A;  4YS3 D;  2CV5 B;  3X1V D;  2ARO C;  4H9P B;  4E44 A;  1AOI C;  1R4V A;  5F99 A;  3LJA A;  5JRG B;  4X23 D;  3W98 B;  3AZM B;  3LZ0 A;  3WTP A;  2BYM A;  3REL C;  3X1T A;  3AZJ D;  3REJ C;  3AN2 D;  5AV6 D;  2HIO B;  5CPK D;  3AZL C;  3W99 B;  4Z5T C;  4EO5 C;  3UT9 C;  3AZK A;  5B0Y D;  1P3P D;  1TZY C;  3WKJ C;  5B33 D;  4X23 B;  5E5A C;  1BFM A;  2RVQ C;  1P3A B;  3O62 D;  3AFA D;  3AZJ B;  3WA9 D;  1P3M B;  5B1M B;  5CPK B;  3AV2 D;  5GT0 A;  5AVC D;  1KX3 B;  2FJ7 D;  5B33 B;  5GT3 C;  4LD9 C;  5CP6 D;  1M1A A;  3X1S D;  5CPJ C;  3MGS C;  4YM6 A;  3AFA B;  1P3O D;  3MNN C;  3VH5 T;  3AYW A;  5BT1 C;  1BH9 B;  5B24 A;  3AZI A;  3AV1 A;  5G49 A;  3MGP A;  1M18 C;  4KGC D;  2PYO D;  3AZE D;  4XUJ A;  3LEL A;  5AV9 B;  3B0B A;  1P3I D;  1EQZ A;  4H9O A;  4WU9 C;  3X1S B;  1KX4 D;  1ID3 C;  3AZH A;  4R8P D;  5JRG C;  1F66 A;  3AZF D;  2NZD D;  3W98 C;  3TU4 D;  1KU5 A;  1S32 D;  3UTB D;  1P3B D;  5B1L B;  5DNM D;  4YS3 C;  3X1V C;  1P3K A;  5BO0 B;  2HIO C;  4R8P B;  3C1B D;  5GSU D;  3REH D;  3W96 D;  4KUD D;  1A7W A;  4X23 C;  3UTB B;  3X1U B;  1N1J B;  5B2J B;  5DNM B;  1P3A C;  3AZJ C;  3WAA A;  3A6N A;  3AN2 C;  5B1M C;  5B0Z D;  5BS7 A;  5CPK C;  3B6F A;  4ZUX B;  5GSU B;  4H9S A;  5GXQ D;  3W96 B;  1P3P C;  5B33 C;  4WU8 D;  1B6W A;  3MVD D;  5JA4 A;  5DNN D;  1P3L A;  3O62 C;  3AFA C;  3MGR A;  3WA9 C;  1JFI B;  5B0Z B;  4J8U B;  3AV2 C;  5GXQ B;  1HQ3 D;  5CP6 C;  2YFV B;  4UUZ B;  1P3F D;  3X1S C;  5DNN B;  4ZBJ B;  4J8V D;  1AOI B;  4J8X D;  1P3O C;  4QLC A;  5CHL B;  5BNX B;  3B6G A;  1M19 D;  2F8N K;  1HQ3 B;  5B1L C;  3REL B;  1P3I C;  5B40 A;  3REJ A;  1ZLA A;  1KX4 C;  1BH8 A;  4Z5T B;  4R8P C;  4EO5 B;  3LZ1 B;  3AZL A;  3MGQ D;  3UT9 A;  1TZY B;  5B32 D;  3NQJ A;  3AZF C;  4KHA A;  3WKJ A;  1H3O A;  3TU4 C;  5B2I A;  1S32 C;  3UTB C;  5E5A A;  1P3B C;  5B2J C;  5DNM C;  4NE6 A;  3W97 A;  5KDM B;  3REH C;  3C1B C;  5GSU C;  3AZN D;  3W96 C;  3REK B;  2F8N D;  4KUD C;  3MGQ B;  1P3G A;  4CSR A;  5GT3 A;  4LD9 A;  4JJN A;  5CPJ B;  3REI D;  5B0Z C;  2F8N B;  5AY8 A;  3UTA A;  5GXQ C;  3AZN B;  2IO5 B;  1M18 B;  4WU8 C;  3KXB D;  1P34 D;  2CV5 A;  3MVD C;  2YFW B;  4H9P A;  4WU9 B;  5DNN C;  4ZBJ C;  1ID3 B;  3AZG D;  3V9R B;  5JRG A;  3W98 A;  1HQ3 C;  3AZM A;  4YS3 B;  5F99 D;  3X1V B;  1P34 B;  2F8N G;  3LJA D;  1P3F C;  4J8V C;  3LZ1 C;  4J8X C;  2HIO A;  3W99 A;  3LZ0 D;  3WTP D;  3X1T D;  4H9N B;  1B67 A;  1F1E A;  5FUG B;  3AZK D;  3AN2 B;  5AV6 B;  1P3A A;  3AZJ A;  1TAF A;  1P3M A;  5B1M A;  3REK C;  5B0Y B;  3MGQ C;  1P3P B;  5B32 C;  4H9R B;  1WWS A;  1KX3 A;  3NQU B;  3O62 B;  3WA9 B;  3WTP E;  5GT0 D;  4WV4 B;  5AV5 A;  1BH9 A;  1U35 D;  3AZN C;  3AV2 B;  1M1A D;  2IO5 C;  5AVC B;  5B31 A;  2FJ7 B;  3AYW D;  4NE3 A;  5CP6 B;  5AV9 A;  5B24 D;  3AZI D;  3AV1 D;  3VH6 W;  4DRB A;  1P3O B;  3X1S A;  3REI C;  5GT0 B;  4XUJ D;  3LEL D;  1U35 B;  4KGC B;  1EQZ D;  2PYO B;  3AZE B;  4XZQ D;  4Z66 D;  3AZH D;  3KXB C;  5B1L A;  5BNV B;  1P34 C;  1P3I B;  4AWL B;  5B24 B;  1F66 D;  1KX4 B;  5BO0 A;  4Z2M G;  4R8P A;  3AZF B; 
#chains in the Genus database with same CATH topology
 4XUJ B;  2NZD B;  1P3K D;  3TU4 B;  1S32 B;  1P3B B;  2J8P A;  4XZQ B;  4Z66 B;  3UTB A;  5F99 C;  3X1U A;  5B2J A;  5DNM A;  5AV6 C;  4NE5 A;  4J8W A;  3H0L C;  3REH B;  3C1B B;  3LZ0 C;  5B0Y C;  4ZUX A;  4KUD B;  3WTP C;  3W96 A;  3X1T C;  3WAA D;  3A6N D;  2NQB A;  2DF4 C;  2LY8 A;  3B6F D;  3AZK C;  5AVB D;  3B0C W;  3VH6 A;  4WNN B;  5AVC C;  4J8U A;  3F6T A;  3P5J B;  1P3L D;  2FJ7 C;  4WU8 B;  3MGR D;  3A6N B;  3B0D C;  3MVD B;  2ARO A;  2YFV A;  4UUZ A;  2VQR A;  5GT0 C;  5AVB B;  1AOI A;  3KUY D;  1WWI A;  1U35 C;  1M1A C;  5BNX A;  4KGC C;  2PYO C;  3AZE C;  2CWE A;  5AV8 D;  4QLC D;  3REL A;  4AWL C;  5B24 C;  3AZI C;  3AV1 C;  4J8V B;  4WZS B;  1P3F B;  3B6G D;  4J8X B;  4Z5T A;  3LZ1 A;  3KUY B;  2ZY4 A;  4XUJ C;  2NZD C;  1TZY A;  1M19 B;  5B40 D;  1EQZ C;  3EG5 B;  5CPI D;  4XZQ C;  4Z66 C;  1ZLA D;  2ZY5 A;  5AV8 B;  3C1C D;  3R45 A;  3AZH C;  3KWQ D;  3UT9 D;  1KX5 D;  1F66 C;  3WKJ D;  5B2I D;  5E5A D;  5B32 B;  3REK A;  1P3K C;  5B40 B;  5CPI B;  3W97 D;  3C1C B;  2HUE C;  5CPJ A;  3MGS A;  3KWQ B;  1P3G D;  1KX5 B;  3MNN A;  2F8N A;  3AZN A;  4LD9 D;  4JJN D;  1M18 A;  4H9Q B;  2ZY2 A;  3WAA C;  3A6N C;  5BS7 C;  3B6F C;  3H0R C;  5B32 G;  3VH5 W;  2YFW A;  4WU9 A;  5AY8 D;  5AVB C;  3B0C T;  4CAY B;  3REI B;  3UTA D;  1ID3 A;  2CV5 D;  1P3L C;  3MGR C;  3KXB B;  2BYK B;  4Z2M H;  4YS3 A;  3X1V A;  1P34 A;  5JRG D;  3UTA B;  5C3I B;  3W98 D;  3KUY C;  3AZM D;  2Y2M A;  3AZG B;  1M19 C;  4X23 A;  4H9N A;  4NFT A;  5AV8 C;  5F99 B;  2HIO D;  3W99 D;  4QLC C;  5FUG A;  3LJA B;  3AN2 A;  5AV6 A;  4G91 C;  3B6G C;  5CPK A;  3LZ0 B;  3WTP B;  2BYM B;  5B0Y A;  3X1T B;  1P3P A;  4H9R A;  5B33 A;  5B40 C;  1P3A D;  5CPI C;  1ZLA C;  1P3M D;  5B1M D;  3NQU A;  3C1C C;  3AZK B;  3KWQ C;  1Z2C B;  3O62 A;  3AFA A;  2Y2L A;  3VH5 A;  1KX5 C;  3WA9 A;  1KX3 D;  5B2I C;  3AV2 A;  4HGA B;  4YM6 D;  5AVC A;  3B0D B;  2FJ7 A;  2Y2H A;  1TAF B;  5AV5 D;  5CP6 A;  3W97 C;  2JSS A;  2FFF B;  3MGP D;  1P3G C;  5B31 D;  1P3O A;  1M1A B;  1U35 A;  5AV9 D;  4JJN C;  4KGC A;  4YM6 B;  2PYO A;  3AZE A;  2Y2N A;  3AYW B;  2L5A A;  5BNV A;  1ULY A;  5AV5 B;  3AZI B;  5G49 B;  3AV1 B;  1P3I A;  5AY8 C;  3MGP B;  5C3I C;  3UTA C;  1KX4 A;  5B31 B;  3AZG C;  3LEL B;  5B1L D;  3AZF A;  2CV5 C;  2NZD A;  1EQZ B;  4H9O B;  3TU4 A;  1S32 A;  1P3B A;  3AZH B;  1N1J A;  4XZQ A;  4Z66 A;  3LJA C;  1F66 B;  3REH A;  3C1B A;  5GSU A;  3AZM C;  1PZR A;  4KUD A;  3X1U D;  3EPK A;  5B2J D;  1P3K B;  4J8W D;  5B31 G;  3W99 C;  4G92 B;  2HUE B;  4ZUX D;  3KSY A;  1JFI A;  5B0Z A;  2NQB D;  4WNN A;  4HGA C;  5GXQ A;  3WAA B;  4WU8 A;  4J8W B;  1P3M C;  3B6F B;  3MVD A;  5DNN A;  1HTA A;  4J8U D;  5AVB A;  4DRA A;  1KX3 C;  2F8N H;  3KFU G;  2NQB B;  2G5H C;  2ARO D;  5JA4 B;  1P3L B;  4YM6 C;  3MGR B;  1HQ3 A;  3AYW C;  1AOI D;  5AV5 C;  3VH6 T;  3MGP C;  1P3F A;  4J8V A;  4J8X A;  5B31 C;  3LEL C;  3KUY A;  3REL D;  5AV9 C;  2ARO B;  3REJ D;  1M19 A;  3FDD A;  4QLC B;  3AZL D;  4Z5T D;  5AV8 A;  3LZ1 D;  2Y2K A;  4G91 B;  3B6G B;  1TZY D;  5KDM A;  3MGQ A;  2Y2I A;  2RVQ D;  5B32 A;  3REJ B;  1ZLA B;  4UPK A;  1BH8 B;  4G92 C;  4E45 A;  5CPI A;  3AZL B;  3C1C A;  3UT9 B;  3NQJ B;  3REK D;  3KWQ A;  1KX5 A;  4KHA B;  3WKJ B;  1H3O B;  2Y2O A;  5B2I B;  5E5A B;  5GT3 D;  4M6B A;  1Q9C A;  3X1U C;  3R45 B;  4H9Q A;  5CPJ D;  3MGS D;  4J8W C;  3MNN D;  3W97 B;  1T3U A;  5BT1 D;  4H9S C;  4ZUX C;  1P3G B;  4CAY A;  3REI A;  4CSR B;  1M18 D;  2NQB C;  3V9R A;  5GT3 B;  4LD9 B;  4JJN B;  4WU9 D;  3MGS B;  2RIQ A;  1ID3 D;  3KXB A;  2BYK A;  3MNN B;  5AY8 B;  4J8U C;  3AZG A;  4YS3 D;  2CV5 B;  3X1V D;  2ARO C;  4H9P B;  4E44 A;  1AOI C;  1R4V A;  3A1I A;  5F99 A;  3LJA A;  5JRG B;  4X23 D;  3W98 B;  3AZM B;  3LZ0 A;  3WTP A;  2BYM A;  3REL C;  3X1T A;  3AZJ D;  3REJ C;  2W8S A;  3AN2 D;  3A1K A;  5AV6 D;  2HIO B;  5CPK D;  3AZL C;  3W99 B;  4Z5T C;  4EO5 C;  3UT9 C;  3AZK A;  5B0Y D;  1P3P D;  1TZY C;  3WKJ C;  5B33 D;  4X23 B;  5E5A C;  1BFM A;  2RVQ C;  1P3A B;  3O62 D;  3AFA D;  3AZJ B;  3WA9 D;  1P3M B;  5B1M B;  5CPK B;  3AV2 D;  5GT0 A;  5AVC D;  1KX3 B;  2FJ7 D;  5B33 B;  5GT3 C;  4LD9 C;  5CP6 D;  1M1A A;  3X1S D;  3EPJ A;  3MGS C;  5CPJ C;  4YM6 A;  3AFA B;  1P3O D;  3MNN C;  3VH5 T;  3AYW A;  2XD1 A;  5BT1 C;  1BH9 B;  5B24 A;  3AZI A;  3AV1 A;  5G49 A;  2XD5 A;  3MGP A;  1M18 C;  4KGC D;  2PYO D;  3AZE D;  4XUJ A;  3LEL A;  5AV9 B;  3B0B A;  1P3I D;  1EQZ A;  4H9O A;  4WU9 C;  3X1S B;  1KX4 D;  1ID3 C;  3AZH A;  4R8P D;  5JRG C;  1F66 A;  3AZF D;  2NZD D;  3W98 C;  3TU4 D;  1KU5 A;  1S32 D;  3UTB D;  1P3B D;  5B1L B;  5DNM D;  4YS3 C;  3EPL A;  3X1V C;  1P3K A;  5BO0 B;  2HIO C;  4WJ3 C;  4R8P B;  3C1B D;  5GSU D;  3REH D;  3W96 D;  4KUD D;  2Y2P A;  1A7W A;  4X23 C;  3UTB B;  3X1U B;  1N1J B;  5B2J B;  3H0M C;  5DNM B;  1P3A C;  3AZJ C;  3WAA A;  3A6N A;  3AN2 C;  5B1M C;  5B0Z D;  5BS7 A;  5CPK C;  3B6F A;  4ZUX B;  5GSU B;  4H9S A;  5GXQ D;  3W96 B;  1P3P C;  5B33 C;  4WU8 D;  1B6W A;  3MVD D;  5JA4 A;  5DNN D;  1P3L A;  3O62 C;  3AFA C;  3MGR A;  3WA9 C;  1JFI B;  5B0Z B;  4J8U B;  3AV2 C;  5GXQ B;  1HQ3 D;  5CP6 C;  2YFV B;  4UUZ B;  1P3F D;  3X1S C;  5DNN B;  4ZBJ B;  4J8V D;  1AOI B;  4J8X D;  1P3O C;  4QLC A;  2JCH A;  5CHL B;  5BNX B;  3B6G A;  1M19 D;  2F8N K;  1HQ3 B;  5B1L C;  3REL B;  1P3I C;  2BG1 A;  5B40 A;  3REJ A;  1ZLA A;  1KX4 C;  1BH8 A;  4Z5T B;  4R8P C;  4EO5 B;  3LZ1 B;  3AZL A;  3MGQ D;  3UT9 A;  1TZY B;  5B32 D;  3NQJ A;  3AZF C;  4KHA A;  3WKJ A;  1H3O A;  2DQN C;  5B2I A;  3TU4 C;  3UTB C;  5E5A A;  1S32 C;  1P3B C;  5B2J C;  3AL0 C;  5DNM C;  3IP4 C;  2G5I C;  4NE6 A;  3W97 A;  5KDM B;  3REH C;  3C1B C;  5GSU C;  3AZN D;  3W96 C;  3REK B;  2F8N D;  4KUD C;  3MGQ B;  1P3G A;  4CSR A;  5GT3 A;  4LD9 A;  4JJN A;  5CPJ B;  3REI D;  5B0Z C;  2F8N B;  5AY8 A;  3UTA A;  5GXQ C;  3AZN B;  2IO5 B;  1M18 B;  4WU8 C;  3KXB D;  1P34 D;  2CV5 A;  3MVD C;  2YFW B;  4H9P A;  4WU9 B;  5DNN C;  4ZBJ C;  3EPH A;  1ID3 B;  2JE5 A;  3AZG D;  3V9R B;  5JRG A;  3W98 A;  1HQ3 C;  3AZM A;  4YS3 B;  5F99 D;  3X1V B;  1P34 B;  2F8N G;  2Y2J A;  3LJA D;  1P3F C;  4J8V C;  3LZ1 C;  4J8X C;  2HIO A;  3W99 A;  3LZ0 D;  3WTP D;  2Y2G A;  3X1T D;  4H9N B;  1B67 A;  1F1E A;  5FUG B;  3AZK D;  3AN2 B;  2UWX A;  5AV6 B;  1P3A A;  3AZJ A;  1TAF A;  1W2E A;  1P3M A;  5B1M A;  3REK C;  5B0Y B;  3MGQ C;  1P3P B;  5B32 C;  4H9R B;  1WWS A;  1KX3 A;  3NQU B;  2F2A C;  3O62 B;  3WA9 B;  3WTP E;  5GT0 D;  4WV4 B;  5AV5 A;  1BH9 A;  1U35 D;  3AZN C;  3AV2 B;  1M1A D;  2IO5 C;  5AVC B;  5B31 A;  2FJ7 B;  3AYW D;  4NE3 A;  5CP6 B;  5AV9 A;  5B24 D;  3AZI D;  3AV1 D;  3VH6 W;  4DRB A;  1P3O B;  3X1S A;  3REI C;  5GT0 B;  4XUJ D;  3LEL D;  1U35 B;  4DQY B;  4KGC B;  1EQZ D;  2PYO B;  3AZE B;  4XZQ D;  4Z66 D;  3AZH D;  3KXB C;  5B1L A;  5BNV B;  1P34 C;  1P3I B;  4AWL B;  5B24 B;  2ZY3 A;  1KX4 B;  1F66 D;  5BO0 A;  2Y2Q A;  4Z2M G;  4R8P A;  3AZF B;  2ZM5 A; 
#chains in the Genus database with same CATH homology
 4XUJ B;  2NZD B;  1P3K D;  3TU4 B;  1S32 B;  1P3B B;  2J8P A;  4XZQ B;  4Z66 B;  3UTB A;  5F99 C;  3X1U A;  5B2J A;  5DNM A;  5AV6 C;  4NE5 A;  4J8W A;  3H0L C;  3REH B;  3C1B B;  3LZ0 C;  5B0Y C;  4ZUX A;  4KUD B;  3WTP C;  3W96 A;  3X1T C;  3WAA D;  3A6N D;  2NQB A;  2DF4 C;  2LY8 A;  3B6F D;  3AZK C;  5AVB D;  3B0C W;  3VH6 A;  4WNN B;  5AVC C;  4J8U A;  3F6T A;  3P5J B;  1P3L D;  2FJ7 C;  4WU8 B;  3MGR D;  3A6N B;  3B0D C;  3MVD B;  2ARO A;  2YFV A;  4UUZ A;  2VQR A;  5GT0 C;  5AVB B;  1AOI A;  3KUY D;  1WWI A;  1U35 C;  1M1A C;  5BNX A;  4KGC C;  2PYO C;  3AZE C;  2CWE A;  5AV8 D;  4QLC D;  3REL A;  4AWL C;  5B24 C;  3AZI C;  3AV1 C;  4J8V B;  4WZS B;  1P3F B;  3B6G D;  4J8X B;  4Z5T A;  3LZ1 A;  3KUY B;  2ZY4 A;  4XUJ C;  2NZD C;  1TZY A;  1M19 B;  5B40 D;  1EQZ C;  3EG5 B;  5CPI D;  4XZQ C;  4Z66 C;  1ZLA D;  2ZY5 A;  5AV8 B;  3C1C D;  3R45 A;  3AZH C;  3KWQ D;  3UT9 D;  1KX5 D;  1F66 C;  3WKJ D;  5B2I D;  5E5A D;  5B32 B;  3REK A;  1P3K C;  5B40 B;  5CPI B;  3W97 D;  3C1C B;  2HUE C;  5CPJ A;  3MGS A;  3KWQ B;  1P3G D;  1KX5 B;  3MNN A;  2F8N A;  3AZN A;  4LD9 D;  4JJN D;  1M18 A;  4H9Q B;  2ZY2 A;  3WAA C;  3A6N C;  5BS7 C;  3B6F C;  3H0R C;  5B32 G;  3VH5 W;  2YFW A;  4WU9 A;  5AY8 D;  5AVB C;  3B0C T;  4CAY B;  3REI B;  3UTA D;  1ID3 A;  2CV5 D;  1P3L C;  3MGR C;  3KXB B;  2BYK B;  4Z2M H;  4YS3 A;  3X1V A;  1P34 A;  5JRG D;  3UTA B;  5C3I B;  3W98 D;  3KUY C;  3AZM D;  2Y2M A;  3AZG B;  1M19 C;  4X23 A;  4H9N A;  4NFT A;  5AV8 C;  5F99 B;  2HIO D;  3W99 D;  4QLC C;  5FUG A;  3LJA B;  3AN2 A;  5AV6 A;  4G91 C;  3B6G C;  5CPK A;  3LZ0 B;  3WTP B;  2BYM B;  5B0Y A;  3X1T B;  1P3P A;  4H9R A;  5B33 A;  5B40 C;  1P3A D;  5CPI C;  1ZLA C;  1P3M D;  5B1M D;  3NQU A;  3C1C C;  3AZK B;  3KWQ C;  1Z2C B;  3O62 A;  3AFA A;  2Y2L A;  3VH5 A;  1KX5 C;  3WA9 A;  1KX3 D;  5B2I C;  3AV2 A;  4HGA B;  4YM6 D;  5AVC A;  3B0D B;  2FJ7 A;  2Y2H A;  1TAF B;  5AV5 D;  5CP6 A;  3W97 C;  2JSS A;  2FFF B;  3MGP D;  1P3G C;  5B31 D;  1P3O A;  1M1A B;  1U35 A;  5AV9 D;  4JJN C;  4KGC A;  4YM6 B;  2PYO A;  3AZE A;  2Y2N A;  3AYW B;  2L5A A;  5BNV A;  1ULY A;  5AV5 B;  3AZI B;  5G49 B;  3AV1 B;  1P3I A;  5AY8 C;  3MGP B;  5C3I C;  3UTA C;  1KX4 A;  5B31 B;  3AZG C;  3LEL B;  5B1L D;  3AZF A;  2CV5 C;  2NZD A;  1EQZ B;  4H9O B;  3TU4 A;  1S32 A;  1P3B A;  3AZH B;  1N1J A;  4XZQ A;  4Z66 A;  3LJA C;  1F66 B;  3REH A;  3C1B A;  5GSU A;  3AZM C;  1PZR A;  4KUD A;  3X1U D;  3EPK A;  5B2J D;  1P3K B;  4J8W D;  5B31 G;  3W99 C;  4G92 B;  2HUE B;  4ZUX D;  3KSY A;  1JFI A;  5B0Z A;  2NQB D;  4WNN A;  4HGA C;  5GXQ A;  3WAA B;  4WU8 A;  4J8W B;  1P3M C;  3B6F B;  3MVD A;  5DNN A;  1HTA A;  4J8U D;  5AVB A;  4DRA A;  1KX3 C;  2F8N H;  3KFU G;  2NQB B;  2G5H C;  2ARO D;  5JA4 B;  1P3L B;  4YM6 C;  3MGR B;  1HQ3 A;  3AYW C;  1AOI D;  5AV5 C;  3VH6 T;  3MGP C;  1P3F A;  4J8V A;  4J8X A;  5B31 C;  3LEL C;  3KUY A;  3REL D;  5AV9 C;  2ARO B;  3REJ D;  1M19 A;  3FDD A;  4QLC B;  3AZL D;  4Z5T D;  5AV8 A;  3LZ1 D;  2Y2K A;  4G91 B;  3B6G B;  1TZY D;  5KDM A;  3MGQ A;  2Y2I A;  2RVQ D;  5B32 A;  3REJ B;  1ZLA B;  4UPK A;  1BH8 B;  4G92 C;  4E45 A;  5CPI A;  3AZL B;  3C1C A;  3UT9 B;  3NQJ B;  3REK D;  3KWQ A;  1KX5 A;  4KHA B;  3WKJ B;  1H3O B;  2Y2O A;  5B2I B;  5E5A B;  5GT3 D;  4M6B A;  1Q9C A;  3X1U C;  3R45 B;  4H9Q A;  5CPJ D;  3MGS D;  4J8W C;  3MNN D;  3W97 B;  1T3U A;  5BT1 D;  4H9S C;  4ZUX C;  1P3G B;  4CAY A;  3REI A;  4CSR B;  1M18 D;  2NQB C;  3V9R A;  5GT3 B;  4LD9 B;  4JJN B;  4WU9 D;  3MGS B;  2RIQ A;  1ID3 D;  3KXB A;  2BYK A;  3MNN B;  5AY8 B;  4J8U C;  3AZG A;  4YS3 D;  2CV5 B;  3X1V D;  2ARO C;  4H9P B;  4E44 A;  1AOI C;  1R4V A;  3A1I A;  5F99 A;  3LJA A;  5JRG B;  4X23 D;  3W98 B;  3AZM B;  3LZ0 A;  3WTP A;  2BYM A;  3REL C;  3X1T A;  3AZJ D;  3REJ C;  2W8S A;  3AN2 D;  3A1K A;  5AV6 D;  2HIO B;  5CPK D;  3AZL C;  3W99 B;  4Z5T C;  4EO5 C;  3UT9 C;  3AZK A;  5B0Y D;  1P3P D;  1TZY C;  3WKJ C;  5B33 D;  4X23 B;  5E5A C;  1BFM A;  2RVQ C;  1P3A B;  3O62 D;  3AFA D;  3AZJ B;  3WA9 D;  1P3M B;  5B1M B;  5CPK B;  3AV2 D;  5GT0 A;  5AVC D;  1KX3 B;  2FJ7 D;  5B33 B;  5GT3 C;  4LD9 C;  5CP6 D;  1M1A A;  3X1S D;  3EPJ A;  3MGS C;  5CPJ C;  4YM6 A;  3AFA B;  1P3O D;  3MNN C;  3VH5 T;  3AYW A;  2XD1 A;  5BT1 C;  1BH9 B;  5B24 A;  3AZI A;  3AV1 A;  5G49 A;  2XD5 A;  3MGP A;  1M18 C;  4KGC D;  2PYO D;  3AZE D;  4XUJ A;  3LEL A;  5AV9 B;  3B0B A;  1P3I D;  1EQZ A;  4H9O A;  4WU9 C;  3X1S B;  1KX4 D;  1ID3 C;  3AZH A;  4R8P D;  5JRG C;  1F66 A;  3AZF D;  2NZD D;  3W98 C;  3TU4 D;  1KU5 A;  1S32 D;  3UTB D;  1P3B D;  5B1L B;  5DNM D;  4YS3 C;  3EPL A;  3X1V C;  1P3K A;  5BO0 B;  2HIO C;  4WJ3 C;  4R8P B;  3C1B D;  5GSU D;  3REH D;  3W96 D;  4KUD D;  2Y2P A;  1A7W A;  4X23 C;  3UTB B;  3X1U B;  1N1J B;  5B2J B;  3H0M C;  5DNM B;  1P3A C;  3AZJ C;  3WAA A;  3A6N A;  3AN2 C;  5B1M C;  5B0Z D;  5BS7 A;  5CPK C;  3B6F A;  4ZUX B;  5GSU B;  4H9S A;  5GXQ D;  3W96 B;  1P3P C;  5B33 C;  4WU8 D;  1B6W A;  3MVD D;  5JA4 A;  5DNN D;  1P3L A;  3O62 C;  3AFA C;  3MGR A;  3WA9 C;  1JFI B;  5B0Z B;  4J8U B;  3AV2 C;  5GXQ B;  1HQ3 D;  5CP6 C;  2YFV B;  4UUZ B;  1P3F D;  3X1S C;  5DNN B;  4ZBJ B;  4J8V D;  1AOI B;  4J8X D;  1P3O C;  4QLC A;  2JCH A;  5CHL B;  5BNX B;  3B6G A;  1M19 D;  2F8N K;  1HQ3 B;  5B1L C;  3REL B;  1P3I C;  2BG1 A;  5B40 A;  3REJ A;  1ZLA A;  1KX4 C;  1BH8 A;  4Z5T B;  4R8P C;  4EO5 B;  3LZ1 B;  3AZL A;  3MGQ D;  3UT9 A;  1TZY B;  5B32 D;  3NQJ A;  3AZF C;  4KHA A;  3WKJ A;  1H3O A;  2DQN C;  5B2I A;  3TU4 C;  3UTB C;  5E5A A;  1S32 C;  1P3B C;  5B2J C;  3AL0 C;  5DNM C;  3IP4 C;  2G5I C;  4NE6 A;  3W97 A;  5KDM B;  3REH C;  3C1B C;  5GSU C;  3AZN D;  3W96 C;  3REK B;  2F8N D;  4KUD C;  3MGQ B;  1P3G A;  4CSR A;  5GT3 A;  4LD9 A;  4JJN A;  5CPJ B;  3REI D;  5B0Z C;  2F8N B;  5AY8 A;  3UTA A;  5GXQ C;  3AZN B;  2IO5 B;  1M18 B;  4WU8 C;  3KXB D;  1P34 D;  2CV5 A;  3MVD C;  2YFW B;  4H9P A;  4WU9 B;  5DNN C;  4ZBJ C;  3EPH A;  1ID3 B;  2JE5 A;  3AZG D;  3V9R B;  5JRG A;  3W98 A;  1HQ3 C;  3AZM A;  4YS3 B;  5F99 D;  3X1V B;  1P34 B;  2F8N G;  2Y2J A;  3LJA D;  1P3F C;  4J8V C;  3LZ1 C;  4J8X C;  2HIO A;  3W99 A;  3LZ0 D;  3WTP D;  2Y2G A;  3X1T D;  4H9N B;  1B67 A;  1F1E A;  5FUG B;  3AZK D;  3AN2 B;  2UWX A;  5AV6 B;  1P3A A;  3AZJ A;  1TAF A;  1W2E A;  1P3M A;  5B1M A;  3REK C;  5B0Y B;  3MGQ C;  1P3P B;  5B32 C;  4H9R B;  1WWS A;  1KX3 A;  3NQU B;  2F2A C;  3O62 B;  3WA9 B;  3WTP E;  5GT0 D;  4WV4 B;  5AV5 A;  1BH9 A;  1U35 D;  3AZN C;  3AV2 B;  1M1A D;  2IO5 C;  5AVC B;  5B31 A;  2FJ7 B;  3AYW D;  4NE3 A;  5CP6 B;  5AV9 A;  5B24 D;  3AZI D;  3AV1 D;  3VH6 W;  4DRB A;  1P3O B;  3X1S A;  3REI C;  5GT0 B;  4XUJ D;  3LEL D;  1U35 B;  4DQY B;  4KGC B;  1EQZ D;  2PYO B;  3AZE B;  4XZQ D;  4Z66 D;  3AZH D;  3KXB C;  5B1L A;  5BNV B;  1P34 C;  1P3I B;  4AWL B;  5B24 B;  2ZY3 A;  1KX4 B;  1F66 D;  5BO0 A;  2Y2Q A;  4Z2M G;  4R8P A;  3AZF B;  2ZM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...