3X1VD

Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1vD00
3WKJC 2HIOC 4WV4B 3MGPB 1U35D 5CPID 3AZIA 3A6NB 5CPJB 4KUDC 4JJNA 1ID3B 4LD9D 1P3FC 2IO5C 5KDMA 1KX5A 5CPKA 1F66C 1P3KD 3WTPD 4WU9A 3MGPD 3MVDB 3KUYC 5CPJD 1ZLAA 3REJD 5B40D 4J8UB 3AZKC 3AZLC 5DNMB 3REKB 2NZDD 5B2JA 3AYWA 5AV9D 4E45A 5JRGC 5B32D 2AROA 3MGSC 1KX4C 2NQBA 5B1LA 3REKD 1P3LB 3AN2C 1P3GA 4WZSB 4KGCC 3W96A 1F66D 5AY8B 3RELD 4H9RA 3WTPE 3REID 1M1AD 3AV2C 5B32G 4R8PB 3AZKD 3AFAC 3TU4C 5B31B 5B0ZC 5GT3C 3AV1D 5AV5D 1HQ3D 5AV8C 4YM6A 3UTAA 4XUJC 3C1BA 4CAYB 3KWQD 5B33A 4YS3C 3W98B 1BH8A 3NQUA 3MGRC 3VH6W 3X1SA 3MGQC 3O62A 2PYOB 4J8VD 4ZUXC 1M19B 3AZJC 5B1MA 4J8WD 3AZFB 3AZNC 1P3IB 1P3BA 5FUGA 1AOIA 3AZIB 3AZHA 5B0ZD 4QLCC 5GT3D 4JJNB 1BFMA 1WWIA 4M6BA 1P34C 3B0DB 5KDMB 4Z66C 4XUJD 4AWLB 1P3ID 1KX5B 5CPKB 3REHA 4NFTA 4WU9B 1ZLAB 3LZ0A 4ZUXD 3NQJB 3AZND 1P3PC 5B2JB 5AVCA 3AYWB 5CPKD 3LZ1A 3C1CA 4H9NA 3W99C 4WU8A 1P3MA 5B2ID 3WAAC 5GXQA 5B24C 3LELC 3X1VA 3MNNC 3LJAA 2NQBB 5B1LB 4X23A 5GT0A 3X1UC 2F8NA 3AZMC 1P3GB 5F99C 3W96B 3B0BA 4H9RB 5AV6A 5B0YA 3W97D 3B6GD 5B1LD 3X1TC 1JFIA 4HGAB 3AZEC 1P3GD 2L5AA 4YM6B 3UTAB 3WKJA 3C1BB 1P3OC 2HIOA 4Z5TC 5B33B 3MNND 1BH8B 3NQUB 4KUDA 3X1SB 1A7WA 1U35C 1P3FA 4XZQD 3O62B 3UTAD 3WA9D 5B1MB 4LD9C 1KX3A 4J8XA 4EO5C 4Z2MG 3KUYA 1P3BB 5FUGB 5AVBD 1P3KC 1AOIB 3WTPC 3AZHB 3MGPC 1P3AD 2BYMA 5CP6D 3A6NC 3AZED 5CPJC 1ID3C 2NZDC 1P3OD 1S32B 4Z5TD 3MGSA 3REHB 5AV9C 1P3BD 4H9SC 1KX4A 5B32C 3LZ0B 3AN2A 3VH6T 4H9OB 3UT9A 2FJ7D 5DNNA 3REKC 5AVCB 1S32D 3LZ1B 3C1CB 4H9NB 3REHD 4WU8B 1P3MB 3RELC 4H9PA 5GXQB 3REIC 1M1AC 3AFAA 3TU4A 3A6ND 3X1VB 3LJAB 1EQZA 1BH9A 4X23B 5G49A 5GT0B 5AV8A 1ID3D 2F8NB 3AV1C 5AV5C 5AV6B 1HQ3C 5GSUA 2CV5A 2F8NH 3MGRA 3MVDD 3KWQC 5B0YB 5E5AA 3LJAD 3MGQA 4R8PC 4J8UD 1JFIB 5DNMD 3AZJA 1P3IA 4J8VC 5AV6D 3WKJB 4J8WC 2HIOB 4KUDB 3UTBA 1P3FB 1P34A 1P3LD 5AY8D 1KX3B 4J8XB 1P3IC 3KUYB 1M18A 1ULYA 4R8PD 2BYMB 5B31D 1P3PA 3W99A 1B67A 1KX3D 3B0DC 4J8XD 4AWLC 3WAAA 5B24A 5CPKC 3LELA 1KX4B 3KXBA 3W98D 5B2IC 3B6FA 3X1UA 3AN2B 3AZMA 2PYOD 3UT9B 5F99A 5DNNB 1M19D 3AZFD 3KSYA 5BT1D 3AYWC 5B31G 4NE5A 4H9PB 3X1TA 3AZID 3TU4B 1EQZB 1BH9B 4JJND 3W97C 2NQBC 5G49B 5AV8B 5B1LC 3UT9D 3B6GC 1TZYA 1KX5D 1P3GC 3AZGA 2AROB 5GSUB 2CV5B 4WU9D 3MGRB 5E5AB 1Q9CA 4KHAA 4DRAA 3MGQB 5CPIA 1U35A 1ZLAD 3AZJB 4HGAC 4LD9A 4XZQC 5B2JD 3AYWD 2AROD 5GSUD 3UTAC 2CV5D 3WA9C 1P3KA 3WTPA 5BNXA 2NQBD 5AVBC 3REJA 3UTBB 4NE3A 4CSRA 5B40A 1P34B 1B6WA 1P3AC 5CP6C 2NZDA 3W96D 5AV9A 4H9SA 5B32A 1F1EA 1P3BC 1M18B 2YFWA 1AOIC 1P3PB 3W99B 4YM6D 2FJ7C 4WNNA 4G92B 3RELA 1F66A 3WAAB 3VH6A 3C1BD 1S32C 3LELB 3REIA 1M1AA 5B33D 3KXBB 3REHC 3B6FB 3X1SD 3X1UB 3AZKA 1HTAA 3AZLA 3AZMB 3O62D 5F99B 3AV1A 5AV5A 1HQ3A 5B1MD 2LY8A 5JRGA 3LZ1C 3KWQA 3B6FD 3X1TB 5GXQC 1AOID 3AZHD 2HUEB 3MVDC 3LJAC 4X23C 1TZYB 4J8VA 1H3OA 4J8UC 4KGCA 5DNMC 3VH5W 4J8WA 3AZGB 5AV6C 3AV2A 4E44A 4KHAB 2CWEA 5CPIB 1U35B 3LZ0D 5B0ZA 5GT3A 1TZYD 4LD9B 1P3LC 5AVCD 3AZGD 4XUJA 3LZ1D 3C1CD 1R4VA 4G91B 5C3IB 4WU8D 1P3MD 5AY8C 4ZBJB 4YS3A 1P3KB 5GXQD 3WTPB 5BNXB 3X1VD 3REJB 4X23D 4CSRB 5B40B 5GT0D 4ZUXA 5BS7C 5BO0A 2F8ND 2NZDB 5B31C 3AZNA 5AV9B 1TAFA 4H9QA 5B32B 2YFVA 1KX3C 4J8XC 5B2IA 5B0YD 2YFWB 3W98C 4QLCA 3R45A 3NQJA 2IO5B 4Z66A 2PYOC 4WNNB 3RELB 1F66B 3WKJD 1M19C 3AZFC 5BT1C 2F8NG 2HIOD 3REIB 1M1AB 2F8NK 3B0CW 4KUDD 3W97A 5BNVA 5JA4A 3B6GA 1KU5A 3AZKB 3AZLB 3AZIC 1P3FD 3AV1B 5AV5B 4JJNC 1HQ3B 2BYKA 3UT9C 5JRGB 5DNNC 1KX5C 3MGSB 3KWQB 3KUYD 3MNNA 4WU9C 3AZLD 5CHLB 1EQZC 1ZLAC 4XZQA 4J8VB 1H3OB 4KGCB 5JRGD 4NE6A 3WA9A 4J8WB 5B2JC 3MGSD 3AV2B 1KX4D 2AROC 5GSUC 4UUZA 2CV5C 5AVBA 3AFAB 3VH5A 3AN2D 1P3AA 5E5AC 5CP6A 5B0ZB 5GT3B 3AZEA 3V9RA 4KGCD 1N1JA 5DNND 1WWSA 4XUJB 1P3OA 3AV2D 4Z5TA 3W96C 4YS3B 3AFAD 3TU4D 1EQZD 5AV8D 4ZUXB 5BO0B 3UTBC 2FJ7A 3AZNB 1TAFB 1S32A 4H9QB 3VH5T 4YS3D 4YM6C 2YFVB 5B2IB 2RVQC 3MGRD 3C1BC 3MGPA 5E5AD 5B33C 3MGQD 1M18C 4QLCB 3A6NA 5CPJA 3R45B 4H9OA 3X1SC 3AZJD 1ID3A 4Z66B 3O62C 5B1MC 4G92C 3KXBC 3MVDA 4QLCD 5BNVB 3W97B 5JA4B 3B6GB 3B6FC 3UTBD 4J8UA 3AZHC 1P34D 5DNMA 4Z66D 3REKA 2BYKB 4DRBA 2RVQD 4Z2MH 5B24B 1M18D 3MNNB 2HUEC 1P3PD 4XZQB 3LZ0C 1P3LA 1TZYC 3W99D 3WA9B 5AY8A 3WAAD 5AVCC 5B24D 3AZGC 3LELD 3C1CC 3KXBD 4UUZB 4WU8C 1P3MC 3B0CT 5AVBB 4R8PA 3X1UD 1P3AB 5BS7A 5CP6B 5CPIC 3AZMD 3AZEB 3V9RB 5B31A 3X1VC 5F99D 1N1JB 5GT0C 1P3OB 4Z5TB 4G91C 4CAYA 5C3IC 4ZBJC 3W98A 3X1TD 5B0YC 3REJC 2PYOA 5B40C 2FJ7B 1M19A 3AZFA 4EO5B 2JSSA
chains in the Genus database with same CATH superfamily
3H0RC 3WKJC 2HIOC 4WV4B 3MGPB 1U35D 5CPID 3AZIA 3A6NB 5CPJB 4KUDC 4JJNA 1ID3B 4LD9D 1P3FC 2IO5C 5KDMA 1KX5A 5CPKA 1F66C 2RIQA 1P3KD 3WTPD 4WU9A 3MGPD 3MVDB 3KUYC 5CPJD 1ZLAA 3REJD 5B40D 4J8UB 3AZKC 3AZLC 2Y2LA 5DNMB 3REKB 2NZDD 2Y2OA 5B2JA 3AYWA 5AV9D 4E45A 5JRGC 5B32D 2AROA 3MGSC 1KX4C 2G5HC 2NQBA 5B1LA 3REKD 1P3LB 3AN2C 2Y2MA 1P3GA 4WZSB 4KGCC 3W96A 1F66D 5AY8B 3RELD 4H9RA 3WTPE 3REID 2ZY4A 1M1AD 3AV2C 5B32G 4R8PB 3AZKD 2JE5A 3AFAC 3TU4C 5B31B 5B0ZC 5GT3C 3AV1D 5AV5D 1HQ3D 5AV8C 4YM6A 3UTAA 4XUJC 3C1BA 4CAYB 3KWQD 2DQNC 5B33A 4YS3C 3W98B 1BH8A 3NQUA 3MGRC 3VH6W 3X1SA 3MGQC 3O62A 2PYOB 3EG5B 4J8VD 4ZUXC 1M19B 3AZJC 5B1MA 4J8WD 3AZFB 3AZNC 1P3IB 1P3BA 5FUGA 1AOIA 3AZIB 3AZHA 5B0ZD 4QLCC 5GT3D 4JJNB 1BFMA 1WWIA 4M6BA 3A1IA 1P34C 3B0DB 5KDMB 4Z66C 4XUJD 4AWLB 1P3ID 1KX5B 5CPKB 3H0MC 3REHA 4NFTA 2UWXA 4WU9B 1ZLAB 3LZ0A 4ZUXD 3NQJB 3AZND 1P3PC 5B2JB 5AVCA 3AYWB 2Y2HA 5CPKD 3LZ1A 3C1CA 4H9NA 3W99C 4WU8A 1P3MA 5B2ID 3WAAC 5GXQA 5B24C 3LELC 3X1VA 3MNNC 3LJAA 2NQBB 5B1LB 4X23A 5GT0A 3X1UC 2F8NA 3AZMC 1P3GB 5F99C 3W96B 3B0BA 4H9RB 5AV6A 5B0YA 3W97D 3B6GD 5B1LD 3X1TC 1JFIA 4HGAB 3AZEC 1P3GD 2L5AA 4YM6B 3UTAB 3WKJA 3C1BB 1P3OC 2HIOA 4Z5TC 5B33B 3MNND 1BH8B 3NQUB 4KUDA 3X1SB 1A7WA 1U35C 1P3FA 4XZQD 3O62B 3UTAD 3WA9D 5B1MB 4LD9C 1KX3A 4J8XA 4EO5C 4Z2MG 3KUYA 1P3BB 5FUGB 5AVBD 1P3KC 1AOIB 3AL0C 3WTPC 3AZHB 3MGPC 1P3AD 2BYMA 5CP6D 3A6NC 3AZED 5CPJC 1ID3C 2NZDC 1P3OD 1S32B 4Z5TD 3MGSA 3REHB 5AV9C 1P3BD 4H9SC 1KX4A 5B32C 3LZ0B 3AN2A 3VH6T 4H9OB 3UT9A 2FJ7D 5DNNA 3REKC 2JCHA 5AVCB 1S32D 3LZ1B 3C1CB 4H9NB 3REHD 2F2AC 4WU8B 1P3MB 3RELC 4H9PA 5GXQB 3REIC 1M1AC 3AFAA 3TU4A 3A6ND 3X1VB 3LJAB 1EQZA 1BH9A 4X23B 5G49A 5GT0B 5AV8A 1ID3D 2F8NB 3AV1C 5AV5C 3F6TA 1HQ3C 5AV6B 5GSUA 3EPKA 2CV5A 2F8NH 3MGRA 3MVDD 3KWQC 5B0YB 5E5AA 3LJAD 3MGQA 4R8PC 4J8UD 1JFIB 5DNMD 3AZJA 1P3IA 4J8VC 5AV6D 4WJ3C 3WKJB 4J8WC 2HIOB 3A1KA 2G5IC 2ZM5A 4KUDB 3UTBA 1P3FB 1P34A 3H0LC 1P3LD 5AY8D 1KX3B 4J8XB 1P3IC 3KUYB 1M18A 1ULYA 4R8PD 2BYMB 3IP4C 5B31D 1P3PA 3W99A 1B67A 1KX3D 3B0DC 4J8XD 4AWLC 3WAAA 5B24A 5CPKC 3LELA 1KX4B 3KXBA 3W98D 5B2IC 3B6FA 3X1UA 3AN2B 3AZMA 2PYOD 3UT9B 5F99A 5DNNB 1M19D 3AZFD 3KSYA 5BT1D 3AYWC 5B31G 4DQYB 4NE5A 4H9PB 3X1TA 3AZID 3TU4B 1EQZB 1BH9B 4JJND 3W97C 2NQBC 5G49B 5AV8B 5B1LC 3UT9D 3B6GC 1TZYA 1KX5D 1P3GC 3AZGA 3KFUG 2AROB 2DF4C 5GSUB 2CV5B 4WU9D 3MGRB 2Y2KA 5E5AB 1Q9CA 4KHAA 4DRAA 3MGQB 5CPIA 1U35A 1ZLAD 3AZJB 4HGAC 4LD9A 4XZQC 5B2JD 3AYWD 2AROD 5GSUD 3UTAC 2CV5D 3WA9C 1P3KA 3WTPA 5BNXA 2NQBD 5AVBC 3REJA 3UTBB 4NE3A 4CSRA 5B40A 1P34B 1B6WA 1P3AC 5CP6C 2NZDA 3W96D 5AV9A 4H9SA 5B32A 1F1EA 2Y2JA 1P3BC 1M18B 2YFWA 1AOIC 2XD5A 1P3PB 4UPKA 3W99B 4YM6D 2FJ7C 4WNNA 4G92B 3FDDA 3RELA 1F66A 3VH6A 3C1BD 3WAAB 1S32C 3LELB 3REIA 1M1AA 5B33D 3KXBB 3REHC 3B6FB 3X1SD 3X1UB 3AZKA 1HTAA 3AZLA 3AZMB 3O62D 5F99B 3AV1A 5AV5A 2Y2QA 1HQ3A 5B1MD 2LY8A 5JRGA 2ZY3A 2ZY2A 3LZ1C 3KWQA 2Y2NA 3B6FD 3X1TB 5GXQC 1AOID 3AZHD 2HUEB 3MVDC 3LJAC 4X23C 1TZYB 4J8VA 1H3OA 4J8UC 4KGCA 5DNMC 3VH5W 4J8WA 3AZGB 5AV6C 3AV2A 4E44A 1Z2CB 4KHAB 2CWEA 5CPIB 1U35B 1W2EA 3LZ0D 5B0ZA 5GT3A 1TZYD 4LD9B 1P3LC 5AVCD 3AZGD 2XD1A 4XUJA 3LZ1D 1R4VA 3C1CD 2BG1A 4G91B 2Y2PA 5C3IB 4WU8D 5AY8C 4ZBJB 4YS3A 1P3KB 5GXQD 1P3MD 3WTPB 5BNXB 2ZY5A 3X1VD 3REJB 4X23D 4CSRB 5B40B 5GT0D 4ZUXA 5BS7C 5BO0A 2F8ND 2NZDB 5B31C 3AZNA 5AV9B 1TAFA 4H9QA 5B32B 2YFVA 1KX3C 4J8XC 5B2IA 2Y2GA 5B0YD 2YFWB 3W98C 4QLCA 3R45A 2Y2IA 3NQJA 2IO5B 4Z66A 2PYOC 4WNNB 3RELB 1F66B 3WKJD 1M19C 3P5JB 3AZFC 5BT1C 2F8NG 2HIOD 3REIB 1M1AB 2F8NK 3B0CW 4KUDD 3W97A 5BNVA 5JA4A 3B6GA 1KU5A 3AZKB 3AZLB 3AZIC 1P3FD 3AV1B 5AV5B 4JJNC 1HQ3B 2BYKA 3UT9C 5JRGB 5DNNC 1KX5C 3MGSB 3KWQB 1T3UA 3KUYD 3MNNA 4WU9C 3AZLD 5CHLB 1EQZC 1ZLAC 4XZQA 4J8VB 1H3OB 4KGCB 5JRGD 4NE6A 3WA9A 4J8WB 5B2JC 3MGSD 3AV2B 1KX4D 2AROC 5GSUC 4UUZA 2CV5C 5AVBA 3AFAB 3VH5A 3AN2D 1P3AA 5E5AC 5CP6A 5B0ZB 5GT3B 3AZEA 3V9RA 4KGCD 1N1JA 5DNND 1WWSA 4XUJB 1P3OA 2J8PA 3AV2D 4Z5TA 3W96C 4YS3B 3AFAD 3TU4D 1PZRA 1EQZD 5AV8D 4ZUXB 5BO0B 3UTBC 2FJ7A 3AZNB 1TAFB 1S32A 4H9QB 3VH5T 4YS3D 4YM6C 2YFVB 5B2IB 2RVQC 3MGRD 3C1BC 3MGPA 2W8SA 5E5AD 3MGQD 5B33C 1M18C 4QLCB 3A6NA 5CPJA 3R45B 4H9OA 3X1SC 3AZJD 1ID3A 4Z66B 3O62C 5B1MC 4G92C 3KXBC 3MVDA 4QLCD 5BNVB 3W97B 5JA4B 3B6GB 3B6FC 3UTBD 4J8UA 3AZHC 1P34D 5DNMA 4Z66D 3REKA 2BYKB 4DRBA 2RVQD 4Z2MH 5B24B 1M18D 3MNNB 2HUEC 1P3PD 4XZQB 3LZ0C 1P3LA 1TZYC 3W99D 3WA9B 5AY8A 3WAAD 3EPLA 5AVCC 5B24D 3AZGC 3LELD 3C1CC 3KXBD 4UUZB 4WU8C 1P3MC 3B0CT 5AVBB 4R8PA 3X1UD 1P3AB 5BS7A 5CP6B 5CPIC 3AZMD 3AZEB 3V9RB 5B31A 3X1VC 5F99D 1N1JB 5GT0C 3EPHA 1P3OB 4Z5TB 4G91C 4CAYA 5C3IC 4ZBJC 3W98A 3X1TD 3EPJA 5B0YC 3REJC 2PYOA 2VQRA 5B40C 2FJ7B 2FFFB 1M19A 3AZFA 4EO5B 2JSSA
chains in the Genus database with same CATH topology
3H0RC 3WKJC 2HIOC 4WV4B 3MGPB 1U35D 5CPID 3AZIA 3A6NB 5CPJB 4KUDC 4JJNA 1ID3B 4LD9D 1P3FC 2IO5C 5KDMA 1KX5A 5CPKA 1F66C 2RIQA 1P3KD 3WTPD 4WU9A 3MGPD 3MVDB 3KUYC 5CPJD 1ZLAA 3REJD 5B40D 4J8UB 3AZKC 3AZLC 2Y2LA 5DNMB 3REKB 2NZDD 2Y2OA 5B2JA 3AYWA 5AV9D 4E45A 5JRGC 5B32D 2AROA 3MGSC 1KX4C 2G5HC 2NQBA 5B1LA 3REKD 1P3LB 3AN2C 2Y2MA 1P3GA 4WZSB 4KGCC 3W96A 1F66D 5AY8B 3RELD 4H9RA 3WTPE 3REID 2ZY4A 1M1AD 3AV2C 5B32G 4R8PB 3AZKD 2JE5A 3AFAC 3TU4C 5B31B 5B0ZC 5GT3C 3AV1D 5AV5D 1HQ3D 5AV8C 4YM6A 3UTAA 4XUJC 3C1BA 4CAYB 3KWQD 2DQNC 5B33A 4YS3C 3W98B 1BH8A 3NQUA 3MGRC 3VH6W 3X1SA 3MGQC 3O62A 2PYOB 3EG5B 4J8VD 4ZUXC 1M19B 3AZJC 5B1MA 4J8WD 3AZFB 3AZNC 1P3IB 1P3BA 5FUGA 1AOIA 3AZIB 3AZHA 5B0ZD 4QLCC 5GT3D 4JJNB 1BFMA 1WWIA 4M6BA 3A1IA 1P34C 3B0DB 5KDMB 4Z66C 4XUJD 4AWLB 1P3ID 1KX5B 5CPKB 3H0MC 3REHA 4NFTA 2UWXA 4WU9B 1ZLAB 3LZ0A 4ZUXD 3NQJB 3AZND 1P3PC 5B2JB 5AVCA 3AYWB 2Y2HA 5CPKD 3LZ1A 3C1CA 4H9NA 3W99C 4WU8A 1P3MA 5B2ID 3WAAC 5GXQA 5B24C 3LELC 3X1VA 3MNNC 3LJAA 2NQBB 5B1LB 4X23A 5GT0A 3X1UC 2F8NA 3AZMC 1P3GB 5F99C 3W96B 3B0BA 4H9RB 5AV6A 5B0YA 3W97D 3B6GD 5B1LD 3X1TC 1JFIA 4HGAB 3AZEC 1P3GD 2L5AA 4YM6B 3UTAB 3WKJA 3C1BB 1P3OC 2HIOA 4Z5TC 5B33B 3MNND 1BH8B 3NQUB 4KUDA 3X1SB 1A7WA 1U35C 1P3FA 4XZQD 3O62B 3UTAD 3WA9D 5B1MB 4LD9C 1KX3A 4J8XA 4EO5C 4Z2MG 3KUYA 1P3BB 5FUGB 5AVBD 1P3KC 1AOIB 3AL0C 3WTPC 3AZHB 3MGPC 1P3AD 2BYMA 5CP6D 3A6NC 3AZED 5CPJC 1ID3C 2NZDC 1P3OD 1S32B 4Z5TD 3MGSA 3REHB 5AV9C 1P3BD 4H9SC 1KX4A 5B32C 3LZ0B 3AN2A 3VH6T 4H9OB 3UT9A 2FJ7D 5DNNA 3REKC 2JCHA 5AVCB 1S32D 3LZ1B 3C1CB 4H9NB 3REHD 2F2AC 4WU8B 1P3MB 3RELC 4H9PA 5GXQB 3REIC 1M1AC 3AFAA 3TU4A 3A6ND 3X1VB 3LJAB 1EQZA 1BH9A 4X23B 5G49A 5GT0B 5AV8A 1ID3D 2F8NB 3AV1C 5AV5C 3F6TA 1HQ3C 5AV6B 5GSUA 3EPKA 2CV5A 2F8NH 3MGRA 3MVDD 3KWQC 5B0YB 5E5AA 3LJAD 3MGQA 4R8PC 4J8UD 1JFIB 5DNMD 3AZJA 1P3IA 4J8VC 5AV6D 4WJ3C 3WKJB 4J8WC 2HIOB 3A1KA 2G5IC 2ZM5A 4KUDB 3UTBA 1P3FB 1P34A 3H0LC 1P3LD 5AY8D 1KX3B 4J8XB 1P3IC 3KUYB 1M18A 1ULYA 4R8PD 2BYMB 3IP4C 5B31D 1P3PA 3W99A 1B67A 1KX3D 3B0DC 4J8XD 4AWLC 3WAAA 5B24A 5CPKC 3LELA 1KX4B 3KXBA 3W98D 5B2IC 3B6FA 3X1UA 3AN2B 3AZMA 2PYOD 3UT9B 5F99A 5DNNB 1M19D 3AZFD 3KSYA 5BT1D 3AYWC 5B31G 4DQYB 4NE5A 4H9PB 3X1TA 3AZID 3TU4B 1EQZB 1BH9B 4JJND 3W97C 2NQBC 5G49B 5AV8B 5B1LC 3UT9D 3B6GC 1TZYA 1KX5D 1P3GC 3AZGA 3KFUG 2AROB 2DF4C 5GSUB 2CV5B 4WU9D 3MGRB 2Y2KA 5E5AB 1Q9CA 4KHAA 4DRAA 3MGQB 5CPIA 1U35A 1ZLAD 3AZJB 4HGAC 4LD9A 4XZQC 5B2JD 3AYWD 2AROD 5GSUD 3UTAC 2CV5D 3WA9C 1P3KA 3WTPA 5BNXA 2NQBD 5AVBC 3REJA 3UTBB 4NE3A 4CSRA 5B40A 1P34B 1B6WA 1P3AC 5CP6C 2NZDA 3W96D 5AV9A 4H9SA 5B32A 1F1EA 2Y2JA 1P3BC 1M18B 2YFWA 1AOIC 2XD5A 1P3PB 4UPKA 3W99B 4YM6D 2FJ7C 4WNNA 4G92B 3FDDA 3RELA 1F66A 3VH6A 3C1BD 3WAAB 1S32C 3LELB 3REIA 1M1AA 5B33D 3KXBB 3REHC 3B6FB 3X1SD 3X1UB 3AZKA 1HTAA 3AZLA 3AZMB 3O62D 5F99B 3AV1A 5AV5A 2Y2QA 1HQ3A 5B1MD 2LY8A 5JRGA 2ZY3A 2ZY2A 3LZ1C 3KWQA 2Y2NA 3B6FD 3X1TB 5GXQC 1AOID 3AZHD 2HUEB 3MVDC 3LJAC 4X23C 1TZYB 4J8VA 1H3OA 4J8UC 4KGCA 5DNMC 3VH5W 4J8WA 3AZGB 5AV6C 3AV2A 4E44A 1Z2CB 4KHAB 2CWEA 5CPIB 1U35B 1W2EA 3LZ0D 5B0ZA 5GT3A 1TZYD 4LD9B 1P3LC 5AVCD 3AZGD 2XD1A 4XUJA 3LZ1D 1R4VA 3C1CD 2BG1A 4G91B 2Y2PA 5C3IB 4WU8D 5AY8C 4ZBJB 4YS3A 1P3KB 5GXQD 1P3MD 3WTPB 5BNXB 2ZY5A 3X1VD 3REJB 4X23D 4CSRB 5B40B 5GT0D 4ZUXA 5BS7C 5BO0A 2F8ND 2NZDB 5B31C 3AZNA 5AV9B 1TAFA 4H9QA 5B32B 2YFVA 1KX3C 4J8XC 5B2IA 2Y2GA 5B0YD 2YFWB 3W98C 4QLCA 3R45A 2Y2IA 3NQJA 2IO5B 4Z66A 2PYOC 4WNNB 3RELB 1F66B 3WKJD 1M19C 3P5JB 3AZFC 5BT1C 2F8NG 2HIOD 3REIB 1M1AB 2F8NK 3B0CW 4KUDD 3W97A 5BNVA 5JA4A 3B6GA 1KU5A 3AZKB 3AZLB 3AZIC 1P3FD 3AV1B 5AV5B 4JJNC 1HQ3B 2BYKA 3UT9C 5JRGB 5DNNC 1KX5C 3MGSB 3KWQB 1T3UA 3KUYD 3MNNA 4WU9C 3AZLD 5CHLB 1EQZC 1ZLAC 4XZQA 4J8VB 1H3OB 4KGCB 5JRGD 4NE6A 3WA9A 4J8WB 5B2JC 3MGSD 3AV2B 1KX4D 2AROC 5GSUC 4UUZA 2CV5C 5AVBA 3AFAB 3VH5A 3AN2D 1P3AA 5E5AC 5CP6A 5B0ZB 5GT3B 3AZEA 3V9RA 4KGCD 1N1JA 5DNND 1WWSA 4XUJB 1P3OA 2J8PA 3AV2D 4Z5TA 3W96C 4YS3B 3AFAD 3TU4D 1PZRA 1EQZD 5AV8D 4ZUXB 5BO0B 3UTBC 2FJ7A 3AZNB 1TAFB 1S32A 4H9QB 3VH5T 4YS3D 4YM6C 2YFVB 5B2IB 2RVQC 3MGRD 3C1BC 3MGPA 2W8SA 5E5AD 3MGQD 5B33C 1M18C 4QLCB 3A6NA 5CPJA 3R45B 4H9OA 3X1SC 3AZJD 1ID3A 4Z66B 3O62C 5B1MC 4G92C 3KXBC 3MVDA 4QLCD 5BNVB 3W97B 5JA4B 3B6GB 3B6FC 3UTBD 4J8UA 3AZHC 1P34D 5DNMA 4Z66D 3REKA 2BYKB 4DRBA 2RVQD 4Z2MH 5B24B 1M18D 3MNNB 2HUEC 1P3PD 4XZQB 3LZ0C 1P3LA 1TZYC 3W99D 3WA9B 5AY8A 3WAAD 3EPLA 5AVCC 5B24D 3AZGC 3LELD 3C1CC 3KXBD 4UUZB 4WU8C 1P3MC 3B0CT 5AVBB 4R8PA 3X1UD 1P3AB 5BS7A 5CP6B 5CPIC 3AZMD 3AZEB 3V9RB 5B31A 3X1VC 5F99D 1N1JB 5GT0C 3EPHA 1P3OB 4Z5TB 4G91C 4CAYA 5C3IC 4ZBJC 3W98A 3X1TD 3EPJA 5B0YC 3REJC 2PYOA 2VQRA 5B40C 2FJ7B 2FFFB 1M19A 3AZFA 4EO5B 2JSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ C;  2HIO C;  4WV4 B;  3MGP B;  1U35 D;  5CPI D;  3AZI A;  3A6N B;  5CPJ B;  4KUD C;  4JJN A;  1ID3 B;  4LD9 D;  1P3F C;  2IO5 C;  5KDM A;  1KX5 A;  5CPK A;  1F66 C;  1P3K D;  3WTP D;  4WU9 A;  3MGP D;  3MVD B;  3KUY C;  5CPJ D;  1ZLA A;  3REJ D;  5B40 D;  4J8U B;  3AZK C;  3AZL C;  5DNM B;  3REK B;  2NZD D;  5B2J A;  3AYW A;  5AV9 D;  4E45 A;  5JRG C;  5B32 D;  2ARO A;  3MGS C;  1KX4 C;  2NQB A;  5B1L A;  3REK D;  1P3L B;  3AN2 C;  1P3G A;  4WZS B;  4KGC C;  3W96 A;  1F66 D;  5AY8 B;  3REL D;  4H9R A;  3WTP E;  3REI D;  1M1A D;  3AV2 C;  5B32 G;  4R8P B;  3AZK D;  3AFA C;  3TU4 C;  5B31 B;  5B0Z C;  5GT3 C;  3AV1 D;  5AV5 D;  1HQ3 D;  5AV8 C;  4YM6 A;  3UTA A;  4XUJ C;  3C1B A;  4CAY B;  3KWQ D;  5B33 A;  4YS3 C;  3W98 B;  1BH8 A;  3NQU A;  3MGR C;  3VH6 W;  3X1S A;  3MGQ C;  3O62 A;  2PYO B;  4J8V D;  4ZUX C;  1M19 B;  3AZJ C;  5B1M A;  4J8W D;  3AZF B;  3AZN C;  1P3I B;  1P3B A;  5FUG A;  1AOI A;  3AZI B;  3AZH A;  5B0Z D;  4QLC C;  5GT3 D;  4JJN B;  1BFM A;  1WWI A;  4M6B A;  1P34 C;  3B0D B;  5KDM B;  4Z66 C;  4XUJ D;  4AWL B;  1P3I D;  1KX5 B;  5CPK B;  3REH A;  4NFT A;  4WU9 B;  1ZLA B;  3LZ0 A;  4ZUX D;  3NQJ B;  3AZN D;  1P3P C;  5B2J B;  5AVC A;  3AYW B;  5CPK D;  3LZ1 A;  3C1C A;  4H9N A;  3W99 C;  4WU8 A;  1P3M A;  5B2I D;  3WAA C;  5GXQ A;  5B24 C;  3LEL C;  3X1V A;  3MNN C;  3LJA A;  2NQB B;  5B1L B;  4X23 A;  5GT0 A;  3X1U C;  2F8N A;  3AZM C;  1P3G B;  5F99 C;  3W96 B;  3B0B A;  4H9R B;  5AV6 A;  5B0Y A;  3W97 D;  3B6G D;  5B1L D;  3X1T C;  1JFI A;  4HGA B;  3AZE C;  1P3G D;  2L5A A;  4YM6 B;  3UTA B;  3WKJ A;  3C1B B;  1P3O C;  2HIO A;  4Z5T C;  5B33 B;  3MNN D;  1BH8 B;  3NQU B;  4KUD A;  3X1S B;  1A7W A;  1U35 C;  1P3F A;  4XZQ D;  3O62 B;  3UTA D;  3WA9 D;  5B1M B;  4LD9 C;  1KX3 A;  4J8X A;  4EO5 C;  4Z2M G;  3KUY A;  1P3B B;  5FUG B;  5AVB D;  1P3K C;  1AOI B;  3WTP C;  3AZH B;  3MGP C;  1P3A D;  2BYM A;  5CP6 D;  3A6N C;  3AZE D;  5CPJ C;  1ID3 C;  2NZD C;  1P3O D;  1S32 B;  4Z5T D;  3MGS A;  3REH B;  5AV9 C;  1P3B D;  4H9S C;  1KX4 A;  5B32 C;  3LZ0 B;  3AN2 A;  3VH6 T;  4H9O B;  3UT9 A;  2FJ7 D;  5DNN A;  3REK C;  5AVC B;  1S32 D;  3LZ1 B;  3C1C B;  4H9N B;  3REH D;  4WU8 B;  1P3M B;  3REL C;  4H9P A;  5GXQ B;  3REI C;  1M1A C;  3AFA A;  3TU4 A;  3A6N D;  3X1V B;  3LJA B;  1EQZ A;  1BH9 A;  4X23 B;  5G49 A;  5GT0 B;  5AV8 A;  1ID3 D;  2F8N B;  3AV1 C;  5AV5 C;  5AV6 B;  1HQ3 C;  5GSU A;  2CV5 A;  2F8N H;  3MGR A;  3MVD D;  3KWQ C;  5B0Y B;  5E5A A;  3LJA D;  3MGQ A;  4R8P C;  4J8U D;  1JFI B;  5DNM D;  3AZJ A;  1P3I A;  4J8V C;  5AV6 D;  3WKJ B;  4J8W C;  2HIO B;  4KUD B;  3UTB A;  1P3F B;  1P34 A;  1P3L D;  5AY8 D;  1KX3 B;  4J8X B;  1P3I C;  3KUY B;  1M18 A;  1ULY A;  4R8P D;  2BYM B;  5B31 D;  1P3P A;  3W99 A;  1B67 A;  1KX3 D;  3B0D C;  4J8X D;  4AWL C;  3WAA A;  5B24 A;  5CPK C;  3LEL A;  1KX4 B;  3KXB A;  3W98 D;  5B2I C;  3B6F A;  3X1U A;  3AN2 B;  3AZM A;  2PYO D;  3UT9 B;  5F99 A;  5DNN B;  1M19 D;  3AZF D;  3KSY A;  5BT1 D;  3AYW C;  5B31 G;  4NE5 A;  4H9P B;  3X1T A;  3AZI D;  3TU4 B;  1EQZ B;  1BH9 B;  4JJN D;  3W97 C;  2NQB C;  5G49 B;  5AV8 B;  5B1L C;  3UT9 D;  3B6G C;  1TZY A;  1KX5 D;  1P3G C;  3AZG A;  2ARO B;  5GSU B;  2CV5 B;  4WU9 D;  3MGR B;  5E5A B;  1Q9C A;  4KHA A;  4DRA A;  3MGQ B;  5CPI A;  1U35 A;  1ZLA D;  3AZJ B;  4HGA C;  4LD9 A;  4XZQ C;  5B2J D;  3AYW D;  2ARO D;  5GSU D;  3UTA C;  2CV5 D;  3WA9 C;  1P3K A;  3WTP A;  5BNX A;  2NQB D;  5AVB C;  3REJ A;  3UTB B;  4NE3 A;  4CSR A;  5B40 A;  1P34 B;  1B6W A;  1P3A C;  5CP6 C;  2NZD A;  3W96 D;  5AV9 A;  4H9S A;  5B32 A;  1F1E A;  1P3B C;  1M18 B;  2YFW A;  1AOI C;  1P3P B;  3W99 B;  4YM6 D;  2FJ7 C;  4WNN A;  4G92 B;  3REL A;  1F66 A;  3WAA B;  3VH6 A;  3C1B D;  1S32 C;  3LEL B;  3REI A;  1M1A A;  5B33 D;  3KXB B;  3REH C;  3B6F B;  3X1S D;  3X1U B;  3AZK A;  1HTA A;  3AZL A;  3AZM B;  3O62 D;  5F99 B;  3AV1 A;  5AV5 A;  1HQ3 A;  5B1M D;  2LY8 A;  5JRG A;  3LZ1 C;  3KWQ A;  3B6F D;  3X1T B;  5GXQ C;  1AOI D;  3AZH D;  2HUE B;  3MVD C;  3LJA C;  4X23 C;  1TZY B;  4J8V A;  1H3O A;  4J8U C;  4KGC A;  5DNM C;  3VH5 W;  4J8W A;  3AZG B;  5AV6 C;  3AV2 A;  4E44 A;  4KHA B;  2CWE A;  5CPI B;  1U35 B;  3LZ0 D;  5B0Z A;  5GT3 A;  1TZY D;  4LD9 B;  1P3L C;  5AVC D;  3AZG D;  4XUJ A;  3LZ1 D;  3C1C D;  1R4V A;  4G91 B;  5C3I B;  4WU8 D;  1P3M D;  5AY8 C;  4ZBJ B;  4YS3 A;  1P3K B;  5GXQ D;  3WTP B;  5BNX B;  3X1V D;  3REJ B;  4X23 D;  4CSR B;  5B40 B;  5GT0 D;  4ZUX A;  5BS7 C;  5BO0 A;  2F8N D;  2NZD B;  5B31 C;  3AZN A;  5AV9 B;  1TAF A;  4H9Q A;  5B32 B;  2YFV A;  1KX3 C;  4J8X C;  5B2I A;  5B0Y D;  2YFW B;  3W98 C;  4QLC A;  3R45 A;  3NQJ A;  2IO5 B;  4Z66 A;  2PYO C;  4WNN B;  3REL B;  1F66 B;  3WKJ D;  1M19 C;  3AZF C;  5BT1 C;  2F8N G;  2HIO D;  3REI B;  1M1A B;  2F8N K;  3B0C W;  4KUD D;  3W97 A;  5BNV A;  5JA4 A;  3B6G A;  1KU5 A;  3AZK B;  3AZL B;  3AZI C;  1P3F D;  3AV1 B;  5AV5 B;  4JJN C;  1HQ3 B;  2BYK A;  3UT9 C;  5JRG B;  5DNN C;  1KX5 C;  3MGS B;  3KWQ B;  3KUY D;  3MNN A;  4WU9 C;  3AZL D;  5CHL B;  1EQZ C;  1ZLA C;  4XZQ A;  4J8V B;  1H3O B;  4KGC B;  5JRG D;  4NE6 A;  3WA9 A;  4J8W B;  5B2J C;  3MGS D;  3AV2 B;  1KX4 D;  2ARO C;  5GSU C;  4UUZ A;  2CV5 C;  5AVB A;  3AFA B;  3VH5 A;  3AN2 D;  1P3A A;  5E5A C;  5CP6 A;  5B0Z B;  5GT3 B;  3AZE A;  3V9R A;  4KGC D;  1N1J A;  5DNN D;  1WWS A;  4XUJ B;  1P3O A;  3AV2 D;  4Z5T A;  3W96 C;  4YS3 B;  3AFA D;  3TU4 D;  1EQZ D;  5AV8 D;  4ZUX B;  5BO0 B;  3UTB C;  2FJ7 A;  3AZN B;  1TAF B;  1S32 A;  4H9Q B;  3VH5 T;  4YS3 D;  4YM6 C;  2YFV B;  5B2I B;  2RVQ C;  3MGR D;  3C1B C;  3MGP A;  5E5A D;  5B33 C;  3MGQ D;  1M18 C;  4QLC B;  3A6N A;  5CPJ A;  3R45 B;  4H9O A;  3X1S C;  3AZJ D;  1ID3 A;  4Z66 B;  3O62 C;  5B1M C;  4G92 C;  3KXB C;  3MVD A;  4QLC D;  5BNV B;  3W97 B;  5JA4 B;  3B6G B;  3B6F C;  3UTB D;  4J8U A;  3AZH C;  1P34 D;  5DNM A;  4Z66 D;  3REK A;  2BYK B;  4DRB A;  2RVQ D;  4Z2M H;  5B24 B;  1M18 D;  3MNN B;  2HUE C;  1P3P D;  4XZQ B;  3LZ0 C;  1P3L A;  1TZY C;  3W99 D;  3WA9 B;  5AY8 A;  3WAA D;  5AVC C;  5B24 D;  3AZG C;  3LEL D;  3C1C C;  3KXB D;  4UUZ B;  4WU8 C;  1P3M C;  3B0C T;  5AVB B;  4R8P A;  3X1U D;  1P3A B;  5BS7 A;  5CP6 B;  5CPI C;  3AZM D;  3AZE B;  3V9R B;  5B31 A;  3X1V C;  5F99 D;  1N1J B;  5GT0 C;  1P3O B;  4Z5T B;  4G91 C;  4CAY A;  5C3I C;  4ZBJ C;  3W98 A;  3X1T D;  5B0Y C;  3REJ C;  2PYO A;  5B40 C;  2FJ7 B;  1M19 A;  3AZF A;  4EO5 B;  2JSS A; 
#chains in the Genus database with same CATH topology
 3H0R C;  3WKJ C;  2HIO C;  4WV4 B;  3MGP B;  1U35 D;  5CPI D;  3AZI A;  3A6N B;  5CPJ B;  4KUD C;  4JJN A;  1ID3 B;  4LD9 D;  1P3F C;  2IO5 C;  5KDM A;  1KX5 A;  5CPK A;  1F66 C;  2RIQ A;  1P3K D;  3WTP D;  4WU9 A;  3MGP D;  3MVD B;  3KUY C;  5CPJ D;  1ZLA A;  3REJ D;  5B40 D;  4J8U B;  3AZK C;  3AZL C;  2Y2L A;  5DNM B;  3REK B;  2NZD D;  2Y2O A;  5B2J A;  3AYW A;  5AV9 D;  4E45 A;  5JRG C;  5B32 D;  2ARO A;  3MGS C;  1KX4 C;  2G5H C;  2NQB A;  5B1L A;  3REK D;  1P3L B;  3AN2 C;  2Y2M A;  1P3G A;  4WZS B;  4KGC C;  3W96 A;  1F66 D;  5AY8 B;  3REL D;  4H9R A;  3WTP E;  3REI D;  2ZY4 A;  1M1A D;  3AV2 C;  5B32 G;  4R8P B;  3AZK D;  2JE5 A;  3AFA C;  3TU4 C;  5B31 B;  5B0Z C;  5GT3 C;  3AV1 D;  5AV5 D;  1HQ3 D;  5AV8 C;  4YM6 A;  3UTA A;  4XUJ C;  3C1B A;  4CAY B;  3KWQ D;  2DQN C;  5B33 A;  4YS3 C;  3W98 B;  1BH8 A;  3NQU A;  3MGR C;  3VH6 W;  3X1S A;  3MGQ C;  3O62 A;  2PYO B;  3EG5 B;  4J8V D;  4ZUX C;  1M19 B;  3AZJ C;  5B1M A;  4J8W D;  3AZF B;  3AZN C;  1P3I B;  1P3B A;  5FUG A;  1AOI A;  3AZI B;  3AZH A;  5B0Z D;  4QLC C;  5GT3 D;  4JJN B;  1BFM A;  1WWI A;  4M6B A;  3A1I A;  1P34 C;  3B0D B;  5KDM B;  4Z66 C;  4XUJ D;  4AWL B;  1P3I D;  1KX5 B;  5CPK B;  3H0M C;  3REH A;  4NFT A;  2UWX A;  4WU9 B;  1ZLA B;  3LZ0 A;  4ZUX D;  3NQJ B;  3AZN D;  1P3P C;  5B2J B;  5AVC A;  3AYW B;  2Y2H A;  5CPK D;  3LZ1 A;  3C1C A;  4H9N A;  3W99 C;  4WU8 A;  1P3M A;  5B2I D;  3WAA C;  5GXQ A;  5B24 C;  3LEL C;  3X1V A;  3MNN C;  3LJA A;  2NQB B;  5B1L B;  4X23 A;  5GT0 A;  3X1U C;  2F8N A;  3AZM C;  1P3G B;  5F99 C;  3W96 B;  3B0B A;  4H9R B;  5AV6 A;  5B0Y A;  3W97 D;  3B6G D;  5B1L D;  3X1T C;  1JFI A;  4HGA B;  3AZE C;  1P3G D;  2L5A A;  4YM6 B;  3UTA B;  3WKJ A;  3C1B B;  1P3O C;  2HIO A;  4Z5T C;  5B33 B;  3MNN D;  1BH8 B;  3NQU B;  4KUD A;  3X1S B;  1A7W A;  1U35 C;  1P3F A;  4XZQ D;  3O62 B;  3UTA D;  3WA9 D;  5B1M B;  4LD9 C;  1KX3 A;  4J8X A;  4EO5 C;  4Z2M G;  3KUY A;  1P3B B;  5FUG B;  5AVB D;  1P3K C;  1AOI B;  3AL0 C;  3WTP C;  3AZH B;  3MGP C;  1P3A D;  2BYM A;  5CP6 D;  3A6N C;  3AZE D;  5CPJ C;  1ID3 C;  2NZD C;  1P3O D;  1S32 B;  4Z5T D;  3MGS A;  3REH B;  5AV9 C;  1P3B D;  4H9S C;  1KX4 A;  5B32 C;  3LZ0 B;  3AN2 A;  3VH6 T;  4H9O B;  3UT9 A;  2FJ7 D;  5DNN A;  3REK C;  2JCH A;  5AVC B;  1S32 D;  3LZ1 B;  3C1C B;  4H9N B;  3REH D;  2F2A C;  4WU8 B;  1P3M B;  3REL C;  4H9P A;  5GXQ B;  3REI C;  1M1A C;  3AFA A;  3TU4 A;  3A6N D;  3X1V B;  3LJA B;  1EQZ A;  1BH9 A;  4X23 B;  5G49 A;  5GT0 B;  5AV8 A;  1ID3 D;  2F8N B;  3AV1 C;  5AV5 C;  3F6T A;  1HQ3 C;  5AV6 B;  5GSU A;  3EPK A;  2CV5 A;  2F8N H;  3MGR A;  3MVD D;  3KWQ C;  5B0Y B;  5E5A A;  3LJA D;  3MGQ A;  4R8P C;  4J8U D;  1JFI B;  5DNM D;  3AZJ A;  1P3I A;  4J8V C;  5AV6 D;  4WJ3 C;  3WKJ B;  4J8W C;  2HIO B;  3A1K A;  2G5I C;  2ZM5 A;  4KUD B;  3UTB A;  1P3F B;  1P34 A;  3H0L C;  1P3L D;  5AY8 D;  1KX3 B;  4J8X B;  1P3I C;  3KUY B;  1M18 A;  1ULY A;  4R8P D;  2BYM B;  3IP4 C;  5B31 D;  1P3P A;  3W99 A;  1B67 A;  1KX3 D;  3B0D C;  4J8X D;  4AWL C;  3WAA A;  5B24 A;  5CPK C;  3LEL A;  1KX4 B;  3KXB A;  3W98 D;  5B2I C;  3B6F A;  3X1U A;  3AN2 B;  3AZM A;  2PYO D;  3UT9 B;  5F99 A;  5DNN B;  1M19 D;  3AZF D;  3KSY A;  5BT1 D;  3AYW C;  5B31 G;  4DQY B;  4NE5 A;  4H9P B;  3X1T A;  3AZI D;  3TU4 B;  1EQZ B;  1BH9 B;  4JJN D;  3W97 C;  2NQB C;  5G49 B;  5AV8 B;  5B1L C;  3UT9 D;  3B6G C;  1TZY A;  1KX5 D;  1P3G C;  3AZG A;  3KFU G;  2ARO B;  2DF4 C;  5GSU B;  2CV5 B;  4WU9 D;  3MGR B;  2Y2K A;  5E5A B;  1Q9C A;  4KHA A;  4DRA A;  3MGQ B;  5CPI A;  1U35 A;  1ZLA D;  3AZJ B;  4HGA C;  4LD9 A;  4XZQ C;  5B2J D;  3AYW D;  2ARO D;  5GSU D;  3UTA C;  2CV5 D;  3WA9 C;  1P3K A;  3WTP A;  5BNX A;  2NQB D;  5AVB C;  3REJ A;  3UTB B;  4NE3 A;  4CSR A;  5B40 A;  1P34 B;  1B6W A;  1P3A C;  5CP6 C;  2NZD A;  3W96 D;  5AV9 A;  4H9S A;  5B32 A;  1F1E A;  2Y2J A;  1P3B C;  1M18 B;  2YFW A;  1AOI C;  2XD5 A;  1P3P B;  4UPK A;  3W99 B;  4YM6 D;  2FJ7 C;  4WNN A;  4G92 B;  3FDD A;  3REL A;  1F66 A;  3VH6 A;  3C1B D;  3WAA B;  1S32 C;  3LEL B;  3REI A;  1M1A A;  5B33 D;  3KXB B;  3REH C;  3B6F B;  3X1S D;  3X1U B;  3AZK A;  1HTA A;  3AZL A;  3AZM B;  3O62 D;  5F99 B;  3AV1 A;  5AV5 A;  2Y2Q A;  1HQ3 A;  5B1M D;  2LY8 A;  5JRG A;  2ZY3 A;  2ZY2 A;  3LZ1 C;  3KWQ A;  2Y2N A;  3B6F D;  3X1T B;  5GXQ C;  1AOI D;  3AZH D;  2HUE B;  3MVD C;  3LJA C;  4X23 C;  1TZY B;  4J8V A;  1H3O A;  4J8U C;  4KGC A;  5DNM C;  3VH5 W;  4J8W A;  3AZG B;  5AV6 C;  3AV2 A;  4E44 A;  1Z2C B;  4KHA B;  2CWE A;  5CPI B;  1U35 B;  1W2E A;  3LZ0 D;  5B0Z A;  5GT3 A;  1TZY D;  4LD9 B;  1P3L C;  5AVC D;  3AZG D;  2XD1 A;  4XUJ A;  3LZ1 D;  1R4V A;  3C1C D;  2BG1 A;  4G91 B;  2Y2P A;  5C3I B;  4WU8 D;  5AY8 C;  4ZBJ B;  4YS3 A;  1P3K B;  5GXQ D;  1P3M D;  3WTP B;  5BNX B;  2ZY5 A;  3X1V D;  3REJ B;  4X23 D;  4CSR B;  5B40 B;  5GT0 D;  4ZUX A;  5BS7 C;  5BO0 A;  2F8N D;  2NZD B;  5B31 C;  3AZN A;  5AV9 B;  1TAF A;  4H9Q A;  5B32 B;  2YFV A;  1KX3 C;  4J8X C;  5B2I A;  2Y2G A;  5B0Y D;  2YFW B;  3W98 C;  4QLC A;  3R45 A;  2Y2I A;  3NQJ A;  2IO5 B;  4Z66 A;  2PYO C;  4WNN B;  3REL B;  1F66 B;  3WKJ D;  1M19 C;  3P5J B;  3AZF C;  5BT1 C;  2F8N G;  2HIO D;  3REI B;  1M1A B;  2F8N K;  3B0C W;  4KUD D;  3W97 A;  5BNV A;  5JA4 A;  3B6G A;  1KU5 A;  3AZK B;  3AZL B;  3AZI C;  1P3F D;  3AV1 B;  5AV5 B;  4JJN C;  1HQ3 B;  2BYK A;  3UT9 C;  5JRG B;  5DNN C;  1KX5 C;  3MGS B;  3KWQ B;  1T3U A;  3KUY D;  3MNN A;  4WU9 C;  3AZL D;  5CHL B;  1EQZ C;  1ZLA C;  4XZQ A;  4J8V B;  1H3O B;  4KGC B;  5JRG D;  4NE6 A;  3WA9 A;  4J8W B;  5B2J C;  3MGS D;  3AV2 B;  1KX4 D;  2ARO C;  5GSU C;  4UUZ A;  2CV5 C;  5AVB A;  3AFA B;  3VH5 A;  3AN2 D;  1P3A A;  5E5A C;  5CP6 A;  5B0Z B;  5GT3 B;  3AZE A;  3V9R A;  4KGC D;  1N1J A;  5DNN D;  1WWS A;  4XUJ B;  1P3O A;  2J8P A;  3AV2 D;  4Z5T A;  3W96 C;  4YS3 B;  3AFA D;  3TU4 D;  1PZR A;  1EQZ D;  5AV8 D;  4ZUX B;  5BO0 B;  3UTB C;  2FJ7 A;  3AZN B;  1TAF B;  1S32 A;  4H9Q B;  3VH5 T;  4YS3 D;  4YM6 C;  2YFV B;  5B2I B;  2RVQ C;  3MGR D;  3C1B C;  3MGP A;  2W8S A;  5E5A D;  3MGQ D;  5B33 C;  1M18 C;  4QLC B;  3A6N A;  5CPJ A;  3R45 B;  4H9O A;  3X1S C;  3AZJ D;  1ID3 A;  4Z66 B;  3O62 C;  5B1M C;  4G92 C;  3KXB C;  3MVD A;  4QLC D;  5BNV B;  3W97 B;  5JA4 B;  3B6G B;  3B6F C;  3UTB D;  4J8U A;  3AZH C;  1P34 D;  5DNM A;  4Z66 D;  3REK A;  2BYK B;  4DRB A;  2RVQ D;  4Z2M H;  5B24 B;  1M18 D;  3MNN B;  2HUE C;  1P3P D;  4XZQ B;  3LZ0 C;  1P3L A;  1TZY C;  3W99 D;  3WA9 B;  5AY8 A;  3WAA D;  3EPL A;  5AVC C;  5B24 D;  3AZG C;  3LEL D;  3C1C C;  3KXB D;  4UUZ B;  4WU8 C;  1P3M C;  3B0C T;  5AVB B;  4R8P A;  3X1U D;  1P3A B;  5BS7 A;  5CP6 B;  5CPI C;  3AZM D;  3AZE B;  3V9R B;  5B31 A;  3X1V C;  5F99 D;  1N1J B;  5GT0 C;  3EPH A;  1P3O B;  4Z5T B;  4G91 C;  4CAY A;  5C3I C;  4ZBJ C;  3W98 A;  3X1T D;  3EPJ A;  5B0Y C;  3REJ C;  2PYO A;  2VQR A;  5B40 C;  2FJ7 B;  2FFF B;  1M19 A;  3AZF A;  4EO5 B;  2JSS A; 
#chains in the Genus database with same CATH homology
 3H0R C;  3WKJ C;  2HIO C;  4WV4 B;  3MGP B;  1U35 D;  5CPI D;  3AZI A;  3A6N B;  5CPJ B;  4KUD C;  4JJN A;  1ID3 B;  4LD9 D;  1P3F C;  2IO5 C;  5KDM A;  1KX5 A;  5CPK A;  1F66 C;  2RIQ A;  1P3K D;  3WTP D;  4WU9 A;  3MGP D;  3MVD B;  3KUY C;  5CPJ D;  1ZLA A;  3REJ D;  5B40 D;  4J8U B;  3AZK C;  3AZL C;  2Y2L A;  5DNM B;  3REK B;  2NZD D;  2Y2O A;  5B2J A;  3AYW A;  5AV9 D;  4E45 A;  5JRG C;  5B32 D;  2ARO A;  3MGS C;  1KX4 C;  2G5H C;  2NQB A;  5B1L A;  3REK D;  1P3L B;  3AN2 C;  2Y2M A;  1P3G A;  4WZS B;  4KGC C;  3W96 A;  1F66 D;  5AY8 B;  3REL D;  4H9R A;  3WTP E;  3REI D;  2ZY4 A;  1M1A D;  3AV2 C;  5B32 G;  4R8P B;  3AZK D;  2JE5 A;  3AFA C;  3TU4 C;  5B31 B;  5B0Z C;  5GT3 C;  3AV1 D;  5AV5 D;  1HQ3 D;  5AV8 C;  4YM6 A;  3UTA A;  4XUJ C;  3C1B A;  4CAY B;  3KWQ D;  2DQN C;  5B33 A;  4YS3 C;  3W98 B;  1BH8 A;  3NQU A;  3MGR C;  3VH6 W;  3X1S A;  3MGQ C;  3O62 A;  2PYO B;  3EG5 B;  4J8V D;  4ZUX C;  1M19 B;  3AZJ C;  5B1M A;  4J8W D;  3AZF B;  3AZN C;  1P3I B;  1P3B A;  5FUG A;  1AOI A;  3AZI B;  3AZH A;  5B0Z D;  4QLC C;  5GT3 D;  4JJN B;  1BFM A;  1WWI A;  4M6B A;  3A1I A;  1P34 C;  3B0D B;  5KDM B;  4Z66 C;  4XUJ D;  4AWL B;  1P3I D;  1KX5 B;  5CPK B;  3H0M C;  3REH A;  4NFT A;  2UWX A;  4WU9 B;  1ZLA B;  3LZ0 A;  4ZUX D;  3NQJ B;  3AZN D;  1P3P C;  5B2J B;  5AVC A;  3AYW B;  2Y2H A;  5CPK D;  3LZ1 A;  3C1C A;  4H9N A;  3W99 C;  4WU8 A;  1P3M A;  5B2I D;  3WAA C;  5GXQ A;  5B24 C;  3LEL C;  3X1V A;  3MNN C;  3LJA A;  2NQB B;  5B1L B;  4X23 A;  5GT0 A;  3X1U C;  2F8N A;  3AZM C;  1P3G B;  5F99 C;  3W96 B;  3B0B A;  4H9R B;  5AV6 A;  5B0Y A;  3W97 D;  3B6G D;  5B1L D;  3X1T C;  1JFI A;  4HGA B;  3AZE C;  1P3G D;  2L5A A;  4YM6 B;  3UTA B;  3WKJ A;  3C1B B;  1P3O C;  2HIO A;  4Z5T C;  5B33 B;  3MNN D;  1BH8 B;  3NQU B;  4KUD A;  3X1S B;  1A7W A;  1U35 C;  1P3F A;  4XZQ D;  3O62 B;  3UTA D;  3WA9 D;  5B1M B;  4LD9 C;  1KX3 A;  4J8X A;  4EO5 C;  4Z2M G;  3KUY A;  1P3B B;  5FUG B;  5AVB D;  1P3K C;  1AOI B;  3AL0 C;  3WTP C;  3AZH B;  3MGP C;  1P3A D;  2BYM A;  5CP6 D;  3A6N C;  3AZE D;  5CPJ C;  1ID3 C;  2NZD C;  1P3O D;  1S32 B;  4Z5T D;  3MGS A;  3REH B;  5AV9 C;  1P3B D;  4H9S C;  1KX4 A;  5B32 C;  3LZ0 B;  3AN2 A;  3VH6 T;  4H9O B;  3UT9 A;  2FJ7 D;  5DNN A;  3REK C;  2JCH A;  5AVC B;  1S32 D;  3LZ1 B;  3C1C B;  4H9N B;  3REH D;  2F2A C;  4WU8 B;  1P3M B;  3REL C;  4H9P A;  5GXQ B;  3REI C;  1M1A C;  3AFA A;  3TU4 A;  3A6N D;  3X1V B;  3LJA B;  1EQZ A;  1BH9 A;  4X23 B;  5G49 A;  5GT0 B;  5AV8 A;  1ID3 D;  2F8N B;  3AV1 C;  5AV5 C;  3F6T A;  1HQ3 C;  5AV6 B;  5GSU A;  3EPK A;  2CV5 A;  2F8N H;  3MGR A;  3MVD D;  3KWQ C;  5B0Y B;  5E5A A;  3LJA D;  3MGQ A;  4R8P C;  4J8U D;  1JFI B;  5DNM D;  3AZJ A;  1P3I A;  4J8V C;  5AV6 D;  4WJ3 C;  3WKJ B;  4J8W C;  2HIO B;  3A1K A;  2G5I C;  2ZM5 A;  4KUD B;  3UTB A;  1P3F B;  1P34 A;  3H0L C;  1P3L D;  5AY8 D;  1KX3 B;  4J8X B;  1P3I C;  3KUY B;  1M18 A;  1ULY A;  4R8P D;  2BYM B;  3IP4 C;  5B31 D;  1P3P A;  3W99 A;  1B67 A;  1KX3 D;  3B0D C;  4J8X D;  4AWL C;  3WAA A;  5B24 A;  5CPK C;  3LEL A;  1KX4 B;  3KXB A;  3W98 D;  5B2I C;  3B6F A;  3X1U A;  3AN2 B;  3AZM A;  2PYO D;  3UT9 B;  5F99 A;  5DNN B;  1M19 D;  3AZF D;  3KSY A;  5BT1 D;  3AYW C;  5B31 G;  4DQY B;  4NE5 A;  4H9P B;  3X1T A;  3AZI D;  3TU4 B;  1EQZ B;  1BH9 B;  4JJN D;  3W97 C;  2NQB C;  5G49 B;  5AV8 B;  5B1L C;  3UT9 D;  3B6G C;  1TZY A;  1KX5 D;  1P3G C;  3AZG A;  3KFU G;  2ARO B;  2DF4 C;  5GSU B;  2CV5 B;  4WU9 D;  3MGR B;  2Y2K A;  5E5A B;  1Q9C A;  4KHA A;  4DRA A;  3MGQ B;  5CPI A;  1U35 A;  1ZLA D;  3AZJ B;  4HGA C;  4LD9 A;  4XZQ C;  5B2J D;  3AYW D;  2ARO D;  5GSU D;  3UTA C;  2CV5 D;  3WA9 C;  1P3K A;  3WTP A;  5BNX A;  2NQB D;  5AVB C;  3REJ A;  3UTB B;  4NE3 A;  4CSR A;  5B40 A;  1P34 B;  1B6W A;  1P3A C;  5CP6 C;  2NZD A;  3W96 D;  5AV9 A;  4H9S A;  5B32 A;  1F1E A;  2Y2J A;  1P3B C;  1M18 B;  2YFW A;  1AOI C;  2XD5 A;  1P3P B;  4UPK A;  3W99 B;  4YM6 D;  2FJ7 C;  4WNN A;  4G92 B;  3FDD A;  3REL A;  1F66 A;  3VH6 A;  3C1B D;  3WAA B;  1S32 C;  3LEL B;  3REI A;  1M1A A;  5B33 D;  3KXB B;  3REH C;  3B6F B;  3X1S D;  3X1U B;  3AZK A;  1HTA A;  3AZL A;  3AZM B;  3O62 D;  5F99 B;  3AV1 A;  5AV5 A;  2Y2Q A;  1HQ3 A;  5B1M D;  2LY8 A;  5JRG A;  2ZY3 A;  2ZY2 A;  3LZ1 C;  3KWQ A;  2Y2N A;  3B6F D;  3X1T B;  5GXQ C;  1AOI D;  3AZH D;  2HUE B;  3MVD C;  3LJA C;  4X23 C;  1TZY B;  4J8V A;  1H3O A;  4J8U C;  4KGC A;  5DNM C;  3VH5 W;  4J8W A;  3AZG B;  5AV6 C;  3AV2 A;  4E44 A;  1Z2C B;  4KHA B;  2CWE A;  5CPI B;  1U35 B;  1W2E A;  3LZ0 D;  5B0Z A;  5GT3 A;  1TZY D;  4LD9 B;  1P3L C;  5AVC D;  3AZG D;  2XD1 A;  4XUJ A;  3LZ1 D;  1R4V A;  3C1C D;  2BG1 A;  4G91 B;  2Y2P A;  5C3I B;  4WU8 D;  5AY8 C;  4ZBJ B;  4YS3 A;  1P3K B;  5GXQ D;  1P3M D;  3WTP B;  5BNX B;  2ZY5 A;  3X1V D;  3REJ B;  4X23 D;  4CSR B;  5B40 B;  5GT0 D;  4ZUX A;  5BS7 C;  5BO0 A;  2F8N D;  2NZD B;  5B31 C;  3AZN A;  5AV9 B;  1TAF A;  4H9Q A;  5B32 B;  2YFV A;  1KX3 C;  4J8X C;  5B2I A;  2Y2G A;  5B0Y D;  2YFW B;  3W98 C;  4QLC A;  3R45 A;  2Y2I A;  3NQJ A;  2IO5 B;  4Z66 A;  2PYO C;  4WNN B;  3REL B;  1F66 B;  3WKJ D;  1M19 C;  3P5J B;  3AZF C;  5BT1 C;  2F8N G;  2HIO D;  3REI B;  1M1A B;  2F8N K;  3B0C W;  4KUD D;  3W97 A;  5BNV A;  5JA4 A;  3B6G A;  1KU5 A;  3AZK B;  3AZL B;  3AZI C;  1P3F D;  3AV1 B;  5AV5 B;  4JJN C;  1HQ3 B;  2BYK A;  3UT9 C;  5JRG B;  5DNN C;  1KX5 C;  3MGS B;  3KWQ B;  1T3U A;  3KUY D;  3MNN A;  4WU9 C;  3AZL D;  5CHL B;  1EQZ C;  1ZLA C;  4XZQ A;  4J8V B;  1H3O B;  4KGC B;  5JRG D;  4NE6 A;  3WA9 A;  4J8W B;  5B2J C;  3MGS D;  3AV2 B;  1KX4 D;  2ARO C;  5GSU C;  4UUZ A;  2CV5 C;  5AVB A;  3AFA B;  3VH5 A;  3AN2 D;  1P3A A;  5E5A C;  5CP6 A;  5B0Z B;  5GT3 B;  3AZE A;  3V9R A;  4KGC D;  1N1J A;  5DNN D;  1WWS A;  4XUJ B;  1P3O A;  2J8P A;  3AV2 D;  4Z5T A;  3W96 C;  4YS3 B;  3AFA D;  3TU4 D;  1PZR A;  1EQZ D;  5AV8 D;  4ZUX B;  5BO0 B;  3UTB C;  2FJ7 A;  3AZN B;  1TAF B;  1S32 A;  4H9Q B;  3VH5 T;  4YS3 D;  4YM6 C;  2YFV B;  5B2I B;  2RVQ C;  3MGR D;  3C1B C;  3MGP A;  2W8S A;  5E5A D;  3MGQ D;  5B33 C;  1M18 C;  4QLC B;  3A6N A;  5CPJ A;  3R45 B;  4H9O A;  3X1S C;  3AZJ D;  1ID3 A;  4Z66 B;  3O62 C;  5B1M C;  4G92 C;  3KXB C;  3MVD A;  4QLC D;  5BNV B;  3W97 B;  5JA4 B;  3B6G B;  3B6F C;  3UTB D;  4J8U A;  3AZH C;  1P34 D;  5DNM A;  4Z66 D;  3REK A;  2BYK B;  4DRB A;  2RVQ D;  4Z2M H;  5B24 B;  1M18 D;  3MNN B;  2HUE C;  1P3P D;  4XZQ B;  3LZ0 C;  1P3L A;  1TZY C;  3W99 D;  3WA9 B;  5AY8 A;  3WAA D;  3EPL A;  5AVC C;  5B24 D;  3AZG C;  3LEL D;  3C1C C;  3KXB D;  4UUZ B;  4WU8 C;  1P3M C;  3B0C T;  5AVB B;  4R8P A;  3X1U D;  1P3A B;  5BS7 A;  5CP6 B;  5CPI C;  3AZM D;  3AZE B;  3V9R B;  5B31 A;  3X1V C;  5F99 D;  1N1J B;  5GT0 C;  3EPH A;  1P3O B;  4Z5T B;  4G91 C;  4CAY A;  5C3I C;  4ZBJ C;  3W98 A;  3X1T D;  3EPJ A;  5B0Y C;  3REJ C;  2PYO A;  2VQR A;  5B40 C;  2FJ7 B;  2FFF B;  1M19 A;  3AZF A;  4EO5 B;  2JSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...