3X1VD

Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1vD00
1M1AC 5B0ZC 4WU9A 2AROA 2F8NA 3AZLD 3C1BD 5B1MA 3REJC 3LZ0B 5BS7C 1P3PB 3W97D 3W99D 3X1VD 5B2JA 3MGQD 4R8PB 3AFAC 1KU5A 4KGCA 3AZEC 1P3BA 2NZDA 1BFMA 5GSUC 4ZUXC 2YFVA 4G92C 4G91C 3MGRB 3AZNA 3MGPB 3WTPA 3W96D 3AZLC 3C1BC 3AZGD 5B31A 4LD9B 3REKB 3AV1D 2FJ7A 3W97C 3W99C 3X1VC 3MGQC 2HIOA 3NQUA 5JRGC 5B0ZA 3LJAD 1P3AD 5B0YB 3B6FB 5CPKD 3REJA 2CV5B 5GT3D 1M19A 4Z2MG 3AFAA 3UTBC 3AZEA 3W96C 4J8UD 1KX5B 4WNNA 2IO5B 3AZGC 3AV1C 4JJNA 3REIC 4J8XB 5GSUA 3KUYB 3WAAD 4ZUXA 1EQZD 4CSRA 1ZLAD 3WA9D 4NFTA 5CP6B 5AV6D 4H9QA 1P3AC 4M6BA 3AZLA 5B32B 3C1BA 5BO0B 4Z2MH 4XZQD 4NE6A 5DNMB 3B0DB 3W97A 5AV5C 3KWQD 3W99A 5GT3C 2AROD 3V9RA 3UT9B 2YFVB 1JFIB 1P3MB 5F99A 1AOID 3B6GA 4J8UC 3VH6A 3A6NC 1TZYC 5B1MD 3WTPB 5AV9D 3WAAC 5B2JD 1KX3D 1M18D 3O62C 1EQZC 2FJ7B 3X1SD 3TU4D 1P3BD 1ZLAC 4CAYA 5B32G 4YS3B 3WA9C 1N1JB 5E5AB 3AV2B 1M1AB 3R45A 3X1TD 3AZGA 3LZ1D 5AVCD 3AN2D 1P3KD 4XZQC 3KWQC 4J8WD 2AROC 4DRAA 3REJB 1AOIC 5B2IB 3LJAA 4Z66A 5B31D 3AZJB 5AV8A 5GT0D 5B1MC 1P3AA 5AV9C 3X1UD 3KSYA 5BNXB 5CPKA 5B2JC 1KX3C 1M18C 3X1SC 1P34B 3TU4C 1P3BC 1ID3B 3B0BA 1U35D 4J8UA 5CPIB 3X1TC 5AVCC 1H3OB 3LELD 3AN2C 3WAAA 4J8WC 3WKJB 2NQBB 1M19D 1EQZA 3X1VB 4Z5TD 3MGQB 3WA9A 4EO5C 5AV6A 5JRGB 5B31C 1B67A 4WZSB 3REHD 3RELB 4XUJB 3AZFD 3X1UC 2F8NK 1HQ3D 4KHAB 4XZQA 5B40D 4YM6D 2BYKB 3KWQA 1AOIA 4J8VB 1U35C 4CAYB 3AYWD 3UTAD 1P3LD 4H9RA 4QLCD 3UTBB 3W98B 3NQJB 1ULYA 3LELC 3W96B 5AV9A 1F66D 5DNND 5B24A 1KX3A 3AV1B 1M18A 1M19C 3REIB 3X1SA 5F99D 3TU4A 3B6GD 3AZKD 4Z5TC 2JSSA 5G49A 4JJNC 4ZBJC 3X1TA 3MGSB 5AVBD 1HQ3C 1P3OA 1BH8B 5AVCA 5C3IC 3LZ1A 3C1CD 3AZHD 3AN2A 5B40C 1P3KA 4YM6C 4X23D 5AY8B 4J8WA 3KXBD 5AV5B 4WU8A 5GT3B 1P3GB 3AYWC 5CHLB 1P3LC 4QLCC 5GT0A 5BNVA 3X1UA 1F66C 3A6NB 1TZYB 4KUDD 1BH9A 4UUZA 1TAFA 5F99C 3B6GC 3AZKC 3MNNB 1S32B 4Z66D 3O62B 5B1LA 1B6WA 5KDMA 5AV8D 1U35A 1ZLAB 5AVBC 5FUGB 1WWSA 3LELA 3C1CC 3AZHC 4AWLC 4DRBA 1P3PD 3VH6W 4Z5TA 4WU9B 4R8PD 2AROB 3REHA 2F8NB 1AOIB 3AZFA 4KUDC 1HQ3A 4H9RB 5B1MB 5B40A 1P3ID 4YM6A 3LJAC 5B2JB 4Z66C 5AV8C 4KGCB 1P3BB 3AYWA 3UTAA 1P3LA 2NZDB 4QLCA 5CPKC 3MGPD 1F66A 5DNNA 2LY8A 3REKD 5AVCB 4WV4B 3AN2B 2BYMA 1P3PC 3VH6T 2F8NG 3AZKA 4R8PC 3AZNB 5AVBA 5B24D 5B31B 3C1CA 3AZHA 1P3IC 3X1UB 4X23A 2HIOB 3NQUB 3KXBA 5AV6C 2CV5D 5B0ZB 4H9OA 5BT1D 1P3OD 3MGPC 1U35B 1KX5D 2YFWA 2F8NH 1KX4D 4KUDA 3REKC 3LELB 4J8XD 3KUYD 4WU8D 5GXQD 3AFAB 1M19B 5B31G 3AZEB 4Z5TB 4WNNB 5B24C 4NE3A 5B32D 4JJNB 5GSUB 1HQ3B 3LZ0A 4ZUXB 5B40B 5B1LD 5DNMD 1P3PA 4YM6B 4CSRB 2HUEC 2CV5C 4G92B 4G91B 4R8PA 3UT9D 1P3OC 4H9NA 3LZ1C 3MVDD 1P3MD 1P3FD 1P3KC 4H9QB 1KX5C 3AZLB 1KX4C 3C1BB 2IO5C 4QLCB 1P3IA 3KUYC 3W97B 4WU8C 3W99B 5GXQC 3V9RB 5GT0C 5F99B 3B6GB 4YS3D 3MGRA 5E5AD 3AV2D 1M1AD 5CPJD 3MGPA 5B32C 3AZMD 5JA4A 4LD9A 3REKA 1A7WA 3AZHB 5B1LC 5DNMC 4AWLB 3AZID 3UT9C 3MVDC 1P3MC 5B2ID 1P3FC 3R45B 3AZGB 3AZJD 4E45A 3B6FA 2CV5A 3REHC 1P34D 3AZFC 3LJAB 4YS3C 4E44A 1ID3D 4Z66B 5B33D 3AV2C 5AV8B 5CPJC 1P3AB 1KX5A 5CPID 1KX4A 3AZMC 5CPKB 4J8XA 3KUYA 3AZIC 3WKJD 2NQBD 5GXQA 3UTAC 5B2IC 4J8UB 5CP6A 5JRGD 3RELD 5DNNC 3AZJC 4H9NB 4XUJD 5B32A 3WAAB 5BO0A 1EQZB 2PYOD 5DNMA 1P3IB 1P34C 3WA9B 3UT9A 1ID3C 5AV6B 3MVDA 4J8VD 5B33C 1P3MA 1JFIA 1P3FA 5CPIC 3W98D 4X23C 3UTBD 3LZ0D 3KXBC 4XZQB 3KWQB 5JA4B 3WKJC 2NQBC 4H9SC 3REID 4YS3A 1N1JA 5E5AA 3RELC 3AV2A 1M1AA 5CPJA 4XUJC 5AV9B 3MGSD 3AZMA 5B24B 1KX3B 1R4VA 1M18B 2PYOC 4HGAC 5AY8D 3X1SB 3AZIA 3TU4B 1F1EA 3MGRD 5BS7A 5AV5D 4J8VC 2HUEB 5B2IA 5G49B 1P3GD 3X1TB 2L5AA 3W98C 3AZJA 1P3OB 4LD9D 3LZ1B 3LZ0C 1P3KB 3A6ND 1TZYD 5BNXA 1KX4B 4J8WB 1P34A 3WTPE 4WU8B 3MNND 1S32D 1ID3A 4EO5B 5GXQB 3O62D 4H9PA 5B33A 2RVQD 5GT0B 5BNVB 5CPIA 5B0YD 3MGSC 3B6FD 1WWIA 1BH9B 1H3OA 4UUZB 5AY8C 1TAFB 3WKJA 2NQBA 4H9SA 3MGRC 3B0CW 5B1LB 5KDMB 3X1VA 4WU9D 3MGQA 1P3GC 5JRGA 3RELA 2F8ND 3MVDB 4LD9C 4XUJA 1P3FB 4KHAA 2PYOA 2BYKA 4NE5A 3MNNC 1S32C 5CP6D 4J8VA 3REHB 4KGCD 2RVQC 3AZFB 4ZBJB 5B0YC 3W98A 3B6FC 2NZDD 3UTBA 3NQJA 5C3IB 3W96A 5CPJB 3AZMB 5BT1C 3AV1A 3B0CT 3REIA 3AZIB 4WU9C 3AYWB 3UTAB 1P3LB 3AZND 3WTPD 3MGSA 4J8XC 1F66B 1BH8A 5DNNB 3VH5W 2FJ7D 2BYMB 5AY8A 3AZKB 2HIOD 5CP6C 5AV5A 5B0ZD 4KGCC 5GT3A 1P3GA 1Q9CA 5AVBB 2NZDC 4H9PB 5B33B 3C1CB 1HTAA 2CWEA 3A6NA 1TZYA 3B0DC 4X23B 3REJD 3KXBB 4H9OB 3MNNA 1S32A 3O62A 3AFAD 3AZED 3AZNC 1ZLAA 3WTPC 2YFWB 5B0YA 4KUDB 5FUGA 3VH5T 4JJND 2FJ7C 3VH5A 5GSUD 2HIOC 4ZUXD 5E5AC 2PYOB 4HGAB
chains in the Genus database with same CATH superfamily
1M1AC 5B0ZC 4WU9A 2AROA 2F8NA 3AZLD 3C1BD 5B1MA 3REJC 3LZ0B 5BS7C 1P3PB 3W97D 3W99D 3X1VD 5B2JA 3MGQD 4R8PB 3AFAC 3P5JB 1KU5A 4KGCA 3AZEC 1P3BA 2W8SA 2NZDA 1BFMA 5GSUC 2Y2HA 4ZUXC 2YFVA 4G92C 4G91C 3MGRB 3AZNA 3MGPB 3WTPA 3W96D 3AZLC 3C1BC 3AZGD 5B31A 4LD9B 3REKB 3AV1D 2FJ7A 3W97C 3W99C 3X1VC 3MGQC 2HIOA 3NQUA 5JRGC 5B0ZA 3LJAD 3H0MC 1P3AD 4UPKA 5B0YB 3B6FB 5CPKD 3REJA 2CV5B 5GT3D 1M19A 4Z2MG 3AFAA 3UTBC 3H0RC 3AZEA 3W96C 4J8UD 1KX5B 4WNNA 2IO5B 3AZGC 3AV1C 4JJNA 3REIC 4J8XB 2ZY2A 5GSUA 3KUYB 3WAAD 4ZUXA 1EQZD 4CSRA 1ZLAD 3WA9D 4NFTA 5CP6B 5AV6D 4H9QA 1P3AC 4M6BA 3AZLA 5B32B 3C1BA 5BO0B 4Z2MH 4XZQD 4NE6A 5DNMB 3B0DB 3W97A 5AV5C 3KWQD 3W99A 5GT3C 2AROD 3V9RA 3UT9B 1W2EA 2YFVB 1JFIB 1P3MB 5F99A 1AOID 3B6GA 4J8UC 3VH6A 3A6NC 1TZYC 2F2AC 5B1MD 3WTPB 5AV9D 3WAAC 3A1IA 5B2JD 1KX3D 1PZRA 2Y2JA 3O62C 1M18D 1EQZC 2FJ7B 2DF4C 3X1SD 3TU4D 1P3BD 1ZLAC 4CAYA 5B32G 4YS3B 3WA9C 1N1JB 5E5AB 3AV2B 1M1AB 2G5IC 3R45A 3X1TD 3AZGA 1T3UA 3LZ1D 5AVCD 2JCHA 3EPKA 3AN2D 4XZQC 1P3KD 3KWQC 4J8WD 2AROC 4DRAA 3REJB 1AOIC 5B2IB 3LJAA 4Z66A 5B31D 3AZJB 5AV8A 5GT0D 5B1MC 1P3AA 5AV9C 3KSYA 3X1UD 5BNXB 5CPKA 5B2JC 1KX3C 1M18C 3X1SC 1P34B 3TU4C 1P3BC 1ID3B 3B0BA 1U35D 4J8UA 5CPIB 3X1TC 5AVCC 1H3OB 3LELD 3AN2C 3WAAA 4J8WC 3WKJB 2NQBB 1M19D 1EQZA 3X1VB 4Z5TD 3MGQB 3WA9A 4EO5C 5AV6A 5JRGB 5B31C 1B67A 4WZSB 3REHD 3RELB 4XUJB 3AZFD 3X1UC 2F8NK 1HQ3D 4WJ3C 4KHAB 4XZQA 5B40D 4YM6D 2BYKB 3KWQA 2J8PA 2Y2OA 1AOIA 4J8VB 1U35C 4CAYB 3AYWD 3UTAD 1P3LD 4H9RA 4QLCD 3UTBB 3H0LC 3W98B 3NQJB 1ULYA 3LELC 3W96B 5AV9A 1F66D 5DNND 5B24A 1KX3A 3AV1B 1M18A 1M19C 3REIB 3X1SA 5F99D 3TU4A 3B6GD 3AZKD 4Z5TC 2JSSA 5G49A 4JJNC 4ZBJC 3X1TA 3MGSB 5AVBD 1HQ3C 1P3OA 1BH8B 5AVCA 5C3IC 3LZ1A 3C1CD 3AZHD 3AN2A 5B40C 1P3KA 4YM6C 4X23D 5AY8B 4J8WA 3KXBD 5AV5B 4WU8A 5GT3B 1P3GB 3AYWC 5CHLB 1P3LC 4QLCC 5GT0A 5BNVA 3X1UA 1F66C 3A6NB 1TZYB 4KUDD 1BH9A 2DQNC 4UUZA 1TAFA 5F99C 3B6GC 3AZKC 3MNNB 1S32B 4Z66D 3O62B 2FFFB 5B1LA 1B6WA 5KDMA 5AV8D 1U35A 1ZLAB 5AVBC 5FUGB 1WWSA 3LELA 3C1CC 3AZHC 4AWLC 4DRBA 1P3PD 3VH6W 4Z5TA 4WU9B 4R8PD 2AROB 3REHA 3FDDA 1AOIB 2F8NB 3AZFA 4KUDC 1HQ3A 4H9RB 5B1MB 5B40A 1P3ID 4YM6A 3LJAC 5B2JB 4Z66C 5AV8C 2Y2GA 4KGCB 1P3BB 2XD1A 3AYWA 3UTAA 1P3LA 2NZDB 4QLCA 2BG1A 5CPKC 3MGPD 1F66A 5DNNA 2LY8A 3REKD 5AVCB 4WV4B 3AN2B 2BYMA 1P3PC 3VH6T 2F8NG 3AZKA 4R8PC 3AZNB 5AVBA 5B24D 5B31B 3C1CA 3AZHA 1P3IC 3X1UB 4X23A 2HIOB 3NQUB 3KXBA 5AV6C 2CV5D 5B0ZB 4H9OA 5BT1D 1P3OD 3MGPC 1U35B 1KX5D 2YFWA 2F8NH 1KX4D 4KUDA 3REKC 3LELB 4J8XD 3KUYD 4WU8D 2JE5A 3IP4C 5GXQD 3AFAB 1M19B 5B31G 3AZEB 4Z5TB 4WNNB 5B24C 4NE3A 5B32D 4JJNB 5GSUB 1HQ3B 3LZ0A 3EPJA 4ZUXB 5B40B 2VQRA 5B1LD 5DNMD 4YM6B 4CSRB 2HUEC 2CV5C 4G92B 1P3PA 4G91B 4R8PA 3UT9D 3EG5B 1P3OC 4H9NA 3LZ1C 3MVDD 1P3MD 1P3FD 1P3KC 4H9QB 1KX5C 3AZLB 1KX4C 3C1BB 2IO5C 2ZY5A 4QLCB 1P3IA 3KUYC 3W97B 4WU8C 3W99B 5GXQC 3V9RB 2G5HC 5GT0C 5F99B 3B6GB 4YS3D 3MGRA 2Y2NA 5E5AD 3AV2D 1M1AD 5CPJD 3MGPA 5B32C 4DQYB 3AZMD 5JA4A 4LD9A 3REKA 1A7WA 3AZHB 5B1LC 5DNMC 4AWLB 3AZID 3AL0C 3UT9C 3MVDC 1P3MC 5B2ID 1P3FC 3R45B 3AZGB 3AZJD 4E45A 2Y2IA 3B6FA 2CV5A 3REHC 1P34D 3AZFC 3LJAB 4YS3C 4E44A 1ID3D 4Z66B 5B33D 3AV2C 5AV8B 5CPJC 1P3AB 1KX5A 5CPID 1KX4A 3F6TA 3AZMC 2Y2MA 5CPKB 4J8XA 3KUYA 3AZIC 3WKJD 2NQBD 2ZY4A 5GXQA 3UTAC 5B2IC 4J8UB 2Y2KA 5CP6A 5JRGD 3RELD 5DNNC 3AZJC 4H9NB 4XUJD 2UWXA 5B32A 3WAAB 1Z2CB 5BO0A 1EQZB 2PYOD 5DNMA 1P3IB 1P34C 3WA9B 3UT9A 1ID3C 5AV6B 3MVDA 4J8VD 5B33C 1P3MA 1JFIA 1P3FA 3KFUG 5CPIC 3W98D 4X23C 3UTBD 3LZ0D 3KXBC 4XZQB 2RIQA 3KWQB 5JA4B 3WKJC 2NQBC 4H9SC 3REID 4YS3A 1N1JA 2XD5A 5E5AA 3RELC 3AV2A 1M1AA 5CPJA 4XUJC 5AV9B 3MGSD 3AZMA 5B24B 1KX3B 1R4VA 1M18B 2PYOC 4HGAC 5AY8D 3X1SB 3AZIA 3TU4B 1F1EA 3MGRD 5BS7A 5AV5D 4J8VC 2HUEB 5B2IA 5G49B 1P3GD 3X1TB 2L5AA 3W98C 3AZJA 1P3OB 4LD9D 3LZ1B 3LZ0C 1P3KB 3A6ND 1TZYD 5BNXA 1KX4B 4J8WB 1P34A 3WTPE 4WU8B 3MNND 1S32D 1ID3A 4EO5B 5GXQB 3O62D 4H9PA 3EPHA 5B33A 2RVQD 5GT0B 5BNVB 5CPIA 5B0YD 3MGSC 3B6FD 1WWIA 1BH9B 1H3OA 4UUZB 3EPLA 5AY8C 1TAFB 3WKJA 2NQBA 4H9SA 3MGRC 3B0CW 5B1LB 5KDMB 3X1VA 4WU9D 3MGQA 1P3GC 5JRGA 3RELA 2F8ND 3MVDB 4LD9C 4XUJA 1P3FB 4KHAA 2PYOA 2BYKA 4NE5A 3MNNC 1S32C 5CP6D 4J8VA 3REHB 4KGCD 2RVQC 2Y2QA 3AZFB 4ZBJB 5B0YC 3W98A 3B6FC 2NZDD 3UTBA 3NQJA 5C3IB 3W96A 5CPJB 2Y2LA 3AZMB 5BT1C 3AV1A 3B0CT 3REIA 2Y2PA 3AZIB 4WU9C 3AYWB 3UTAB 1P3LB 3AZND 3WTPD 3MGSA 4J8XC 1F66B 1BH8A 5DNNB 2ZY3A 3VH5W 2FJ7D 2BYMB 5AY8A 3AZKB 2HIOD 5CP6C 5AV5A 2ZM5A 5B0ZD 4KGCC 5GT3A 1P3GA 1Q9CA 5AVBB 2NZDC 3A1KA 4H9PB 5B33B 3C1CB 1HTAA 2CWEA 3A6NA 1TZYA 3B0DC 4X23B 3REJD 3KXBB 4H9OB 3MNNA 1S32A 3O62A 3AFAD 3AZED 3AZNC 1ZLAA 3WTPC 2YFWB 5B0YA 4KUDB 5FUGA 3VH5T 4JJND 2FJ7C 3VH5A 5GSUD 2HIOC 4ZUXD 5E5AC 2PYOB 4HGAB
chains in the Genus database with same CATH topology
1M1AC 5B0ZC 4WU9A 2AROA 2F8NA 3AZLD 3C1BD 5B1MA 3REJC 3LZ0B 5BS7C 1P3PB 3W97D 3W99D 3X1VD 5B2JA 3MGQD 4R8PB 3AFAC 3P5JB 1KU5A 4KGCA 3AZEC 1P3BA 2W8SA 2NZDA 1BFMA 5GSUC 2Y2HA 4ZUXC 2YFVA 4G92C 4G91C 3MGRB 3AZNA 3MGPB 3WTPA 3W96D 3AZLC 3C1BC 3AZGD 5B31A 4LD9B 3REKB 3AV1D 2FJ7A 3W97C 3W99C 3X1VC 3MGQC 2HIOA 3NQUA 5JRGC 5B0ZA 3LJAD 3H0MC 1P3AD 4UPKA 5B0YB 3B6FB 5CPKD 3REJA 2CV5B 5GT3D 1M19A 4Z2MG 3AFAA 3UTBC 3H0RC 3AZEA 3W96C 4J8UD 1KX5B 4WNNA 2IO5B 3AZGC 3AV1C 4JJNA 3REIC 4J8XB 2ZY2A 5GSUA 3KUYB 3WAAD 4ZUXA 1EQZD 4CSRA 1ZLAD 3WA9D 4NFTA 5CP6B 5AV6D 4H9QA 1P3AC 4M6BA 3AZLA 5B32B 3C1BA 5BO0B 4Z2MH 4XZQD 4NE6A 5DNMB 3B0DB 3W97A 5AV5C 3KWQD 3W99A 5GT3C 2AROD 3V9RA 3UT9B 1W2EA 2YFVB 1JFIB 1P3MB 5F99A 1AOID 3B6GA 4J8UC 3VH6A 3A6NC 1TZYC 2F2AC 5B1MD 3WTPB 5AV9D 3WAAC 3A1IA 5B2JD 1KX3D 1PZRA 2Y2JA 3O62C 1M18D 1EQZC 2FJ7B 2DF4C 3X1SD 3TU4D 1P3BD 1ZLAC 4CAYA 5B32G 4YS3B 3WA9C 1N1JB 5E5AB 3AV2B 1M1AB 2G5IC 3R45A 3X1TD 3AZGA 1T3UA 3LZ1D 5AVCD 2JCHA 3EPKA 3AN2D 4XZQC 1P3KD 3KWQC 4J8WD 2AROC 4DRAA 3REJB 1AOIC 5B2IB 3LJAA 4Z66A 5B31D 3AZJB 5AV8A 5GT0D 5B1MC 1P3AA 5AV9C 3KSYA 3X1UD 5BNXB 5CPKA 5B2JC 1KX3C 1M18C 3X1SC 1P34B 3TU4C 1P3BC 1ID3B 3B0BA 1U35D 4J8UA 5CPIB 3X1TC 5AVCC 1H3OB 3LELD 3AN2C 3WAAA 4J8WC 3WKJB 2NQBB 1M19D 1EQZA 3X1VB 4Z5TD 3MGQB 3WA9A 4EO5C 5AV6A 5JRGB 5B31C 1B67A 4WZSB 3REHD 3RELB 4XUJB 3AZFD 3X1UC 2F8NK 1HQ3D 4WJ3C 4KHAB 4XZQA 5B40D 4YM6D 2BYKB 3KWQA 2J8PA 2Y2OA 1AOIA 4J8VB 1U35C 4CAYB 3AYWD 3UTAD 1P3LD 4H9RA 4QLCD 3UTBB 3H0LC 3W98B 3NQJB 1ULYA 3LELC 3W96B 5AV9A 1F66D 5DNND 5B24A 1KX3A 3AV1B 1M18A 1M19C 3REIB 3X1SA 5F99D 3TU4A 3B6GD 3AZKD 4Z5TC 2JSSA 5G49A 4JJNC 4ZBJC 3X1TA 3MGSB 5AVBD 1HQ3C 1P3OA 1BH8B 5AVCA 5C3IC 3LZ1A 3C1CD 3AZHD 3AN2A 5B40C 1P3KA 4YM6C 4X23D 5AY8B 4J8WA 3KXBD 5AV5B 4WU8A 5GT3B 1P3GB 3AYWC 5CHLB 1P3LC 4QLCC 5GT0A 5BNVA 3X1UA 1F66C 3A6NB 1TZYB 4KUDD 1BH9A 2DQNC 4UUZA 1TAFA 5F99C 3B6GC 3AZKC 3MNNB 1S32B 4Z66D 3O62B 2FFFB 5B1LA 1B6WA 5KDMA 5AV8D 1U35A 1ZLAB 5AVBC 5FUGB 1WWSA 3LELA 3C1CC 3AZHC 4AWLC 4DRBA 1P3PD 3VH6W 4Z5TA 4WU9B 4R8PD 2AROB 3REHA 3FDDA 1AOIB 2F8NB 3AZFA 4KUDC 1HQ3A 4H9RB 5B1MB 5B40A 1P3ID 4YM6A 3LJAC 5B2JB 4Z66C 5AV8C 2Y2GA 4KGCB 1P3BB 2XD1A 3AYWA 3UTAA 1P3LA 2NZDB 4QLCA 2BG1A 5CPKC 3MGPD 1F66A 5DNNA 2LY8A 3REKD 5AVCB 4WV4B 3AN2B 2BYMA 1P3PC 3VH6T 2F8NG 3AZKA 4R8PC 3AZNB 5AVBA 5B24D 5B31B 3C1CA 3AZHA 1P3IC 3X1UB 4X23A 2HIOB 3NQUB 3KXBA 5AV6C 2CV5D 5B0ZB 4H9OA 5BT1D 1P3OD 3MGPC 1U35B 1KX5D 2YFWA 2F8NH 1KX4D 4KUDA 3REKC 3LELB 4J8XD 3KUYD 4WU8D 2JE5A 3IP4C 5GXQD 3AFAB 1M19B 5B31G 3AZEB 4Z5TB 4WNNB 5B24C 4NE3A 5B32D 4JJNB 5GSUB 1HQ3B 3LZ0A 3EPJA 4ZUXB 5B40B 2VQRA 5B1LD 5DNMD 4YM6B 4CSRB 2HUEC 2CV5C 4G92B 1P3PA 4G91B 4R8PA 3UT9D 3EG5B 1P3OC 4H9NA 3LZ1C 3MVDD 1P3MD 1P3FD 1P3KC 4H9QB 1KX5C 3AZLB 1KX4C 3C1BB 2IO5C 2ZY5A 4QLCB 1P3IA 3KUYC 3W97B 4WU8C 3W99B 5GXQC 3V9RB 2G5HC 5GT0C 5F99B 3B6GB 4YS3D 3MGRA 2Y2NA 5E5AD 3AV2D 1M1AD 5CPJD 3MGPA 5B32C 4DQYB 3AZMD 5JA4A 4LD9A 3REKA 1A7WA 3AZHB 5B1LC 5DNMC 4AWLB 3AZID 3AL0C 3UT9C 3MVDC 1P3MC 5B2ID 1P3FC 3R45B 3AZGB 3AZJD 4E45A 2Y2IA 3B6FA 2CV5A 3REHC 1P34D 3AZFC 3LJAB 4YS3C 4E44A 1ID3D 4Z66B 5B33D 3AV2C 5AV8B 5CPJC 1P3AB 1KX5A 5CPID 1KX4A 3F6TA 3AZMC 2Y2MA 5CPKB 4J8XA 3KUYA 3AZIC 3WKJD 2NQBD 2ZY4A 5GXQA 3UTAC 5B2IC 4J8UB 2Y2KA 5CP6A 5JRGD 3RELD 5DNNC 3AZJC 4H9NB 4XUJD 2UWXA 5B32A 3WAAB 1Z2CB 5BO0A 1EQZB 2PYOD 5DNMA 1P3IB 1P34C 3WA9B 3UT9A 1ID3C 5AV6B 3MVDA 4J8VD 5B33C 1P3MA 1JFIA 1P3FA 3KFUG 5CPIC 3W98D 4X23C 3UTBD 3LZ0D 3KXBC 4XZQB 2RIQA 3KWQB 5JA4B 3WKJC 2NQBC 4H9SC 3REID 4YS3A 1N1JA 2XD5A 5E5AA 3RELC 3AV2A 1M1AA 5CPJA 4XUJC 5AV9B 3MGSD 3AZMA 5B24B 1KX3B 1R4VA 1M18B 2PYOC 4HGAC 5AY8D 3X1SB 3AZIA 3TU4B 1F1EA 3MGRD 5BS7A 5AV5D 4J8VC 2HUEB 5B2IA 5G49B 1P3GD 3X1TB 2L5AA 3W98C 3AZJA 1P3OB 4LD9D 3LZ1B 3LZ0C 1P3KB 3A6ND 1TZYD 5BNXA 1KX4B 4J8WB 1P34A 3WTPE 4WU8B 3MNND 1S32D 1ID3A 4EO5B 5GXQB 3O62D 4H9PA 3EPHA 5B33A 2RVQD 5GT0B 5BNVB 5CPIA 5B0YD 3MGSC 3B6FD 1WWIA 1BH9B 1H3OA 4UUZB 3EPLA 5AY8C 1TAFB 3WKJA 2NQBA 4H9SA 3MGRC 3B0CW 5B1LB 5KDMB 3X1VA 4WU9D 3MGQA 1P3GC 5JRGA 3RELA 2F8ND 3MVDB 4LD9C 4XUJA 1P3FB 4KHAA 2PYOA 2BYKA 4NE5A 3MNNC 1S32C 5CP6D 4J8VA 3REHB 4KGCD 2RVQC 2Y2QA 3AZFB 4ZBJB 5B0YC 3W98A 3B6FC 2NZDD 3UTBA 3NQJA 5C3IB 3W96A 5CPJB 2Y2LA 3AZMB 5BT1C 3AV1A 3B0CT 3REIA 2Y2PA 3AZIB 4WU9C 3AYWB 3UTAB 1P3LB 3AZND 3WTPD 3MGSA 4J8XC 1F66B 1BH8A 5DNNB 2ZY3A 3VH5W 2FJ7D 2BYMB 5AY8A 3AZKB 2HIOD 5CP6C 5AV5A 2ZM5A 5B0ZD 4KGCC 5GT3A 1P3GA 1Q9CA 5AVBB 2NZDC 3A1KA 4H9PB 5B33B 3C1CB 1HTAA 2CWEA 3A6NA 1TZYA 3B0DC 4X23B 3REJD 3KXBB 4H9OB 3MNNA 1S32A 3O62A 3AFAD 3AZED 3AZNC 1ZLAA 3WTPC 2YFWB 5B0YA 4KUDB 5FUGA 3VH5T 4JJND 2FJ7C 3VH5A 5GSUD 2HIOC 4ZUXD 5E5AC 2PYOB 4HGAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1A C;  5B0Z C;  4WU9 A;  2ARO A;  2F8N A;  3AZL D;  3C1B D;  5B1M A;  3REJ C;  3LZ0 B;  5BS7 C;  1P3P B;  3W97 D;  3W99 D;  3X1V D;  5B2J A;  3MGQ D;  4R8P B;  3AFA C;  1KU5 A;  4KGC A;  3AZE C;  1P3B A;  2NZD A;  1BFM A;  5GSU C;  4ZUX C;  2YFV A;  4G92 C;  4G91 C;  3MGR B;  3AZN A;  3MGP B;  3WTP A;  3W96 D;  3AZL C;  3C1B C;  3AZG D;  5B31 A;  4LD9 B;  3REK B;  3AV1 D;  2FJ7 A;  3W97 C;  3W99 C;  3X1V C;  3MGQ C;  2HIO A;  3NQU A;  5JRG C;  5B0Z A;  3LJA D;  1P3A D;  5B0Y B;  3B6F B;  5CPK D;  3REJ A;  2CV5 B;  5GT3 D;  1M19 A;  4Z2M G;  3AFA A;  3UTB C;  3AZE A;  3W96 C;  4J8U D;  1KX5 B;  4WNN A;  2IO5 B;  3AZG C;  3AV1 C;  4JJN A;  3REI C;  4J8X B;  5GSU A;  3KUY B;  3WAA D;  4ZUX A;  1EQZ D;  4CSR A;  1ZLA D;  3WA9 D;  4NFT A;  5CP6 B;  5AV6 D;  4H9Q A;  1P3A C;  4M6B A;  3AZL A;  5B32 B;  3C1B A;  5BO0 B;  4Z2M H;  4XZQ D;  4NE6 A;  5DNM B;  3B0D B;  3W97 A;  5AV5 C;  3KWQ D;  3W99 A;  5GT3 C;  2ARO D;  3V9R A;  3UT9 B;  2YFV B;  1JFI B;  1P3M B;  5F99 A;  1AOI D;  3B6G A;  4J8U C;  3VH6 A;  3A6N C;  1TZY C;  5B1M D;  3WTP B;  5AV9 D;  3WAA C;  5B2J D;  1KX3 D;  1M18 D;  3O62 C;  1EQZ C;  2FJ7 B;  3X1S D;  3TU4 D;  1P3B D;  1ZLA C;  4CAY A;  5B32 G;  4YS3 B;  3WA9 C;  1N1J B;  5E5A B;  3AV2 B;  1M1A B;  3R45 A;  3X1T D;  3AZG A;  3LZ1 D;  5AVC D;  3AN2 D;  1P3K D;  4XZQ C;  3KWQ C;  4J8W D;  2ARO C;  4DRA A;  3REJ B;  1AOI C;  5B2I B;  3LJA A;  4Z66 A;  5B31 D;  3AZJ B;  5AV8 A;  5GT0 D;  5B1M C;  1P3A A;  5AV9 C;  3X1U D;  3KSY A;  5BNX B;  5CPK A;  5B2J C;  1KX3 C;  1M18 C;  3X1S C;  1P34 B;  3TU4 C;  1P3B C;  1ID3 B;  3B0B A;  1U35 D;  4J8U A;  5CPI B;  3X1T C;  5AVC C;  1H3O B;  3LEL D;  3AN2 C;  3WAA A;  4J8W C;  3WKJ B;  2NQB B;  1M19 D;  1EQZ A;  3X1V B;  4Z5T D;  3MGQ B;  3WA9 A;  4EO5 C;  5AV6 A;  5JRG B;  5B31 C;  1B67 A;  4WZS B;  3REH D;  3REL B;  4XUJ B;  3AZF D;  3X1U C;  2F8N K;  1HQ3 D;  4KHA B;  4XZQ A;  5B40 D;  4YM6 D;  2BYK B;  3KWQ A;  1AOI A;  4J8V B;  1U35 C;  4CAY B;  3AYW D;  3UTA D;  1P3L D;  4H9R A;  4QLC D;  3UTB B;  3W98 B;  3NQJ B;  1ULY A;  3LEL C;  3W96 B;  5AV9 A;  1F66 D;  5DNN D;  5B24 A;  1KX3 A;  3AV1 B;  1M18 A;  1M19 C;  3REI B;  3X1S A;  5F99 D;  3TU4 A;  3B6G D;  3AZK D;  4Z5T C;  2JSS A;  5G49 A;  4JJN C;  4ZBJ C;  3X1T A;  3MGS B;  5AVB D;  1HQ3 C;  1P3O A;  1BH8 B;  5AVC A;  5C3I C;  3LZ1 A;  3C1C D;  3AZH D;  3AN2 A;  5B40 C;  1P3K A;  4YM6 C;  4X23 D;  5AY8 B;  4J8W A;  3KXB D;  5AV5 B;  4WU8 A;  5GT3 B;  1P3G B;  3AYW C;  5CHL B;  1P3L C;  4QLC C;  5GT0 A;  5BNV A;  3X1U A;  1F66 C;  3A6N B;  1TZY B;  4KUD D;  1BH9 A;  4UUZ A;  1TAF A;  5F99 C;  3B6G C;  3AZK C;  3MNN B;  1S32 B;  4Z66 D;  3O62 B;  5B1L A;  1B6W A;  5KDM A;  5AV8 D;  1U35 A;  1ZLA B;  5AVB C;  5FUG B;  1WWS A;  3LEL A;  3C1C C;  3AZH C;  4AWL C;  4DRB A;  1P3P D;  3VH6 W;  4Z5T A;  4WU9 B;  4R8P D;  2ARO B;  3REH A;  2F8N B;  1AOI B;  3AZF A;  4KUD C;  1HQ3 A;  4H9R B;  5B1M B;  5B40 A;  1P3I D;  4YM6 A;  3LJA C;  5B2J B;  4Z66 C;  5AV8 C;  4KGC B;  1P3B B;  3AYW A;  3UTA A;  1P3L A;  2NZD B;  4QLC A;  5CPK C;  3MGP D;  1F66 A;  5DNN A;  2LY8 A;  3REK D;  5AVC B;  4WV4 B;  3AN2 B;  2BYM A;  1P3P C;  3VH6 T;  2F8N G;  3AZK A;  4R8P C;  3AZN B;  5AVB A;  5B24 D;  5B31 B;  3C1C A;  3AZH A;  1P3I C;  3X1U B;  4X23 A;  2HIO B;  3NQU B;  3KXB A;  5AV6 C;  2CV5 D;  5B0Z B;  4H9O A;  5BT1 D;  1P3O D;  3MGP C;  1U35 B;  1KX5 D;  2YFW A;  2F8N H;  1KX4 D;  4KUD A;  3REK C;  3LEL B;  4J8X D;  3KUY D;  4WU8 D;  5GXQ D;  3AFA B;  1M19 B;  5B31 G;  3AZE B;  4Z5T B;  4WNN B;  5B24 C;  4NE3 A;  5B32 D;  4JJN B;  5GSU B;  1HQ3 B;  3LZ0 A;  4ZUX B;  5B40 B;  5B1L D;  5DNM D;  1P3P A;  4YM6 B;  4CSR B;  2HUE C;  2CV5 C;  4G92 B;  4G91 B;  4R8P A;  3UT9 D;  1P3O C;  4H9N A;  3LZ1 C;  3MVD D;  1P3M D;  1P3F D;  1P3K C;  4H9Q B;  1KX5 C;  3AZL B;  1KX4 C;  3C1B B;  2IO5 C;  4QLC B;  1P3I A;  3KUY C;  3W97 B;  4WU8 C;  3W99 B;  5GXQ C;  3V9R B;  5GT0 C;  5F99 B;  3B6G B;  4YS3 D;  3MGR A;  5E5A D;  3AV2 D;  1M1A D;  5CPJ D;  3MGP A;  5B32 C;  3AZM D;  5JA4 A;  4LD9 A;  3REK A;  1A7W A;  3AZH B;  5B1L C;  5DNM C;  4AWL B;  3AZI D;  3UT9 C;  3MVD C;  1P3M C;  5B2I D;  1P3F C;  3R45 B;  3AZG B;  3AZJ D;  4E45 A;  3B6F A;  2CV5 A;  3REH C;  1P34 D;  3AZF C;  3LJA B;  4YS3 C;  4E44 A;  1ID3 D;  4Z66 B;  5B33 D;  3AV2 C;  5AV8 B;  5CPJ C;  1P3A B;  1KX5 A;  5CPI D;  1KX4 A;  3AZM C;  5CPK B;  4J8X A;  3KUY A;  3AZI C;  3WKJ D;  2NQB D;  5GXQ A;  3UTA C;  5B2I C;  4J8U B;  5CP6 A;  5JRG D;  3REL D;  5DNN C;  3AZJ C;  4H9N B;  4XUJ D;  5B32 A;  3WAA B;  5BO0 A;  1EQZ B;  2PYO D;  5DNM A;  1P3I B;  1P34 C;  3WA9 B;  3UT9 A;  1ID3 C;  5AV6 B;  3MVD A;  4J8V D;  5B33 C;  1P3M A;  1JFI A;  1P3F A;  5CPI C;  3W98 D;  4X23 C;  3UTB D;  3LZ0 D;  3KXB C;  4XZQ B;  3KWQ B;  5JA4 B;  3WKJ C;  2NQB C;  4H9S C;  3REI D;  4YS3 A;  1N1J A;  5E5A A;  3REL C;  3AV2 A;  1M1A A;  5CPJ A;  4XUJ C;  5AV9 B;  3MGS D;  3AZM A;  5B24 B;  1KX3 B;  1R4V A;  1M18 B;  2PYO C;  4HGA C;  5AY8 D;  3X1S B;  3AZI A;  3TU4 B;  1F1E A;  3MGR D;  5BS7 A;  5AV5 D;  4J8V C;  2HUE B;  5B2I A;  5G49 B;  1P3G D;  3X1T B;  2L5A A;  3W98 C;  3AZJ A;  1P3O B;  4LD9 D;  3LZ1 B;  3LZ0 C;  1P3K B;  3A6N D;  1TZY D;  5BNX A;  1KX4 B;  4J8W B;  1P34 A;  3WTP E;  4WU8 B;  3MNN D;  1S32 D;  1ID3 A;  4EO5 B;  5GXQ B;  3O62 D;  4H9P A;  5B33 A;  2RVQ D;  5GT0 B;  5BNV B;  5CPI A;  5B0Y D;  3MGS C;  3B6F D;  1WWI A;  1BH9 B;  1H3O A;  4UUZ B;  5AY8 C;  1TAF B;  3WKJ A;  2NQB A;  4H9S A;  3MGR C;  3B0C W;  5B1L B;  5KDM B;  3X1V A;  4WU9 D;  3MGQ A;  1P3G C;  5JRG A;  3REL A;  2F8N D;  3MVD B;  4LD9 C;  4XUJ A;  1P3F B;  4KHA A;  2PYO A;  2BYK A;  4NE5 A;  3MNN C;  1S32 C;  5CP6 D;  4J8V A;  3REH B;  4KGC D;  2RVQ C;  3AZF B;  4ZBJ B;  5B0Y C;  3W98 A;  3B6F C;  2NZD D;  3UTB A;  3NQJ A;  5C3I B;  3W96 A;  5CPJ B;  3AZM B;  5BT1 C;  3AV1 A;  3B0C T;  3REI A;  3AZI B;  4WU9 C;  3AYW B;  3UTA B;  1P3L B;  3AZN D;  3WTP D;  3MGS A;  4J8X C;  1F66 B;  1BH8 A;  5DNN B;  3VH5 W;  2FJ7 D;  2BYM B;  5AY8 A;  3AZK B;  2HIO D;  5CP6 C;  5AV5 A;  5B0Z D;  4KGC C;  5GT3 A;  1P3G A;  1Q9C A;  5AVB B;  2NZD C;  4H9P B;  5B33 B;  3C1C B;  1HTA A;  2CWE A;  3A6N A;  1TZY A;  3B0D C;  4X23 B;  3REJ D;  3KXB B;  4H9O B;  3MNN A;  1S32 A;  3O62 A;  3AFA D;  3AZE D;  3AZN C;  1ZLA A;  3WTP C;  2YFW B;  5B0Y A;  4KUD B;  5FUG A;  3VH5 T;  4JJN D;  2FJ7 C;  3VH5 A;  5GSU D;  2HIO C;  4ZUX D;  5E5A C;  2PYO B;  4HGA B; 
#chains in the Genus database with same CATH topology
 1M1A C;  5B0Z C;  4WU9 A;  2ARO A;  2F8N A;  3AZL D;  3C1B D;  5B1M A;  3REJ C;  3LZ0 B;  5BS7 C;  1P3P B;  3W97 D;  3W99 D;  3X1V D;  5B2J A;  3MGQ D;  4R8P B;  3AFA C;  3P5J B;  1KU5 A;  4KGC A;  3AZE C;  1P3B A;  2W8S A;  2NZD A;  1BFM A;  5GSU C;  2Y2H A;  4ZUX C;  2YFV A;  4G92 C;  4G91 C;  3MGR B;  3AZN A;  3MGP B;  3WTP A;  3W96 D;  3AZL C;  3C1B C;  3AZG D;  5B31 A;  4LD9 B;  3REK B;  3AV1 D;  2FJ7 A;  3W97 C;  3W99 C;  3X1V C;  3MGQ C;  2HIO A;  3NQU A;  5JRG C;  5B0Z A;  3LJA D;  3H0M C;  1P3A D;  4UPK A;  5B0Y B;  3B6F B;  5CPK D;  3REJ A;  2CV5 B;  5GT3 D;  1M19 A;  4Z2M G;  3AFA A;  3UTB C;  3H0R C;  3AZE A;  3W96 C;  4J8U D;  1KX5 B;  4WNN A;  2IO5 B;  3AZG C;  3AV1 C;  4JJN A;  3REI C;  4J8X B;  2ZY2 A;  5GSU A;  3KUY B;  3WAA D;  4ZUX A;  1EQZ D;  4CSR A;  1ZLA D;  3WA9 D;  4NFT A;  5CP6 B;  5AV6 D;  4H9Q A;  1P3A C;  4M6B A;  3AZL A;  5B32 B;  3C1B A;  5BO0 B;  4Z2M H;  4XZQ D;  4NE6 A;  5DNM B;  3B0D B;  3W97 A;  5AV5 C;  3KWQ D;  3W99 A;  5GT3 C;  2ARO D;  3V9R A;  3UT9 B;  1W2E A;  2YFV B;  1JFI B;  1P3M B;  5F99 A;  1AOI D;  3B6G A;  4J8U C;  3VH6 A;  3A6N C;  1TZY C;  2F2A C;  5B1M D;  3WTP B;  5AV9 D;  3WAA C;  3A1I A;  5B2J D;  1KX3 D;  1PZR A;  2Y2J A;  3O62 C;  1M18 D;  1EQZ C;  2FJ7 B;  2DF4 C;  3X1S D;  3TU4 D;  1P3B D;  1ZLA C;  4CAY A;  5B32 G;  4YS3 B;  3WA9 C;  1N1J B;  5E5A B;  3AV2 B;  1M1A B;  2G5I C;  3R45 A;  3X1T D;  3AZG A;  1T3U A;  3LZ1 D;  5AVC D;  2JCH A;  3EPK A;  3AN2 D;  4XZQ C;  1P3K D;  3KWQ C;  4J8W D;  2ARO C;  4DRA A;  3REJ B;  1AOI C;  5B2I B;  3LJA A;  4Z66 A;  5B31 D;  3AZJ B;  5AV8 A;  5GT0 D;  5B1M C;  1P3A A;  5AV9 C;  3KSY A;  3X1U D;  5BNX B;  5CPK A;  5B2J C;  1KX3 C;  1M18 C;  3X1S C;  1P34 B;  3TU4 C;  1P3B C;  1ID3 B;  3B0B A;  1U35 D;  4J8U A;  5CPI B;  3X1T C;  5AVC C;  1H3O B;  3LEL D;  3AN2 C;  3WAA A;  4J8W C;  3WKJ B;  2NQB B;  1M19 D;  1EQZ A;  3X1V B;  4Z5T D;  3MGQ B;  3WA9 A;  4EO5 C;  5AV6 A;  5JRG B;  5B31 C;  1B67 A;  4WZS B;  3REH D;  3REL B;  4XUJ B;  3AZF D;  3X1U C;  2F8N K;  1HQ3 D;  4WJ3 C;  4KHA B;  4XZQ A;  5B40 D;  4YM6 D;  2BYK B;  3KWQ A;  2J8P A;  2Y2O A;  1AOI A;  4J8V B;  1U35 C;  4CAY B;  3AYW D;  3UTA D;  1P3L D;  4H9R A;  4QLC D;  3UTB B;  3H0L C;  3W98 B;  3NQJ B;  1ULY A;  3LEL C;  3W96 B;  5AV9 A;  1F66 D;  5DNN D;  5B24 A;  1KX3 A;  3AV1 B;  1M18 A;  1M19 C;  3REI B;  3X1S A;  5F99 D;  3TU4 A;  3B6G D;  3AZK D;  4Z5T C;  2JSS A;  5G49 A;  4JJN C;  4ZBJ C;  3X1T A;  3MGS B;  5AVB D;  1HQ3 C;  1P3O A;  1BH8 B;  5AVC A;  5C3I C;  3LZ1 A;  3C1C D;  3AZH D;  3AN2 A;  5B40 C;  1P3K A;  4YM6 C;  4X23 D;  5AY8 B;  4J8W A;  3KXB D;  5AV5 B;  4WU8 A;  5GT3 B;  1P3G B;  3AYW C;  5CHL B;  1P3L C;  4QLC C;  5GT0 A;  5BNV A;  3X1U A;  1F66 C;  3A6N B;  1TZY B;  4KUD D;  1BH9 A;  2DQN C;  4UUZ A;  1TAF A;  5F99 C;  3B6G C;  3AZK C;  3MNN B;  1S32 B;  4Z66 D;  3O62 B;  2FFF B;  5B1L A;  1B6W A;  5KDM A;  5AV8 D;  1U35 A;  1ZLA B;  5AVB C;  5FUG B;  1WWS A;  3LEL A;  3C1C C;  3AZH C;  4AWL C;  4DRB A;  1P3P D;  3VH6 W;  4Z5T A;  4WU9 B;  4R8P D;  2ARO B;  3REH A;  3FDD A;  1AOI B;  2F8N B;  3AZF A;  4KUD C;  1HQ3 A;  4H9R B;  5B1M B;  5B40 A;  1P3I D;  4YM6 A;  3LJA C;  5B2J B;  4Z66 C;  5AV8 C;  2Y2G A;  4KGC B;  1P3B B;  2XD1 A;  3AYW A;  3UTA A;  1P3L A;  2NZD B;  4QLC A;  2BG1 A;  5CPK C;  3MGP D;  1F66 A;  5DNN A;  2LY8 A;  3REK D;  5AVC B;  4WV4 B;  3AN2 B;  2BYM A;  1P3P C;  3VH6 T;  2F8N G;  3AZK A;  4R8P C;  3AZN B;  5AVB A;  5B24 D;  5B31 B;  3C1C A;  3AZH A;  1P3I C;  3X1U B;  4X23 A;  2HIO B;  3NQU B;  3KXB A;  5AV6 C;  2CV5 D;  5B0Z B;  4H9O A;  5BT1 D;  1P3O D;  3MGP C;  1U35 B;  1KX5 D;  2YFW A;  2F8N H;  1KX4 D;  4KUD A;  3REK C;  3LEL B;  4J8X D;  3KUY D;  4WU8 D;  2JE5 A;  3IP4 C;  5GXQ D;  3AFA B;  1M19 B;  5B31 G;  3AZE B;  4Z5T B;  4WNN B;  5B24 C;  4NE3 A;  5B32 D;  4JJN B;  5GSU B;  1HQ3 B;  3LZ0 A;  3EPJ A;  4ZUX B;  5B40 B;  2VQR A;  5B1L D;  5DNM D;  4YM6 B;  4CSR B;  2HUE C;  2CV5 C;  4G92 B;  1P3P A;  4G91 B;  4R8P A;  3UT9 D;  3EG5 B;  1P3O C;  4H9N A;  3LZ1 C;  3MVD D;  1P3M D;  1P3F D;  1P3K C;  4H9Q B;  1KX5 C;  3AZL B;  1KX4 C;  3C1B B;  2IO5 C;  2ZY5 A;  4QLC B;  1P3I A;  3KUY C;  3W97 B;  4WU8 C;  3W99 B;  5GXQ C;  3V9R B;  2G5H C;  5GT0 C;  5F99 B;  3B6G B;  4YS3 D;  3MGR A;  2Y2N A;  5E5A D;  3AV2 D;  1M1A D;  5CPJ D;  3MGP A;  5B32 C;  4DQY B;  3AZM D;  5JA4 A;  4LD9 A;  3REK A;  1A7W A;  3AZH B;  5B1L C;  5DNM C;  4AWL B;  3AZI D;  3AL0 C;  3UT9 C;  3MVD C;  1P3M C;  5B2I D;  1P3F C;  3R45 B;  3AZG B;  3AZJ D;  4E45 A;  2Y2I A;  3B6F A;  2CV5 A;  3REH C;  1P34 D;  3AZF C;  3LJA B;  4YS3 C;  4E44 A;  1ID3 D;  4Z66 B;  5B33 D;  3AV2 C;  5AV8 B;  5CPJ C;  1P3A B;  1KX5 A;  5CPI D;  1KX4 A;  3F6T A;  3AZM C;  2Y2M A;  5CPK B;  4J8X A;  3KUY A;  3AZI C;  3WKJ D;  2NQB D;  2ZY4 A;  5GXQ A;  3UTA C;  5B2I C;  4J8U B;  2Y2K A;  5CP6 A;  5JRG D;  3REL D;  5DNN C;  3AZJ C;  4H9N B;  4XUJ D;  2UWX A;  5B32 A;  3WAA B;  1Z2C B;  5BO0 A;  1EQZ B;  2PYO D;  5DNM A;  1P3I B;  1P34 C;  3WA9 B;  3UT9 A;  1ID3 C;  5AV6 B;  3MVD A;  4J8V D;  5B33 C;  1P3M A;  1JFI A;  1P3F A;  3KFU G;  5CPI C;  3W98 D;  4X23 C;  3UTB D;  3LZ0 D;  3KXB C;  4XZQ B;  2RIQ A;  3KWQ B;  5JA4 B;  3WKJ C;  2NQB C;  4H9S C;  3REI D;  4YS3 A;  1N1J A;  2XD5 A;  5E5A A;  3REL C;  3AV2 A;  1M1A A;  5CPJ A;  4XUJ C;  5AV9 B;  3MGS D;  3AZM A;  5B24 B;  1KX3 B;  1R4V A;  1M18 B;  2PYO C;  4HGA C;  5AY8 D;  3X1S B;  3AZI A;  3TU4 B;  1F1E A;  3MGR D;  5BS7 A;  5AV5 D;  4J8V C;  2HUE B;  5B2I A;  5G49 B;  1P3G D;  3X1T B;  2L5A A;  3W98 C;  3AZJ A;  1P3O B;  4LD9 D;  3LZ1 B;  3LZ0 C;  1P3K B;  3A6N D;  1TZY D;  5BNX A;  1KX4 B;  4J8W B;  1P34 A;  3WTP E;  4WU8 B;  3MNN D;  1S32 D;  1ID3 A;  4EO5 B;  5GXQ B;  3O62 D;  4H9P A;  3EPH A;  5B33 A;  2RVQ D;  5GT0 B;  5BNV B;  5CPI A;  5B0Y D;  3MGS C;  3B6F D;  1WWI A;  1BH9 B;  1H3O A;  4UUZ B;  3EPL A;  5AY8 C;  1TAF B;  3WKJ A;  2NQB A;  4H9S A;  3MGR C;  3B0C W;  5B1L B;  5KDM B;  3X1V A;  4WU9 D;  3MGQ A;  1P3G C;  5JRG A;  3REL A;  2F8N D;  3MVD B;  4LD9 C;  4XUJ A;  1P3F B;  4KHA A;  2PYO A;  2BYK A;  4NE5 A;  3MNN C;  1S32 C;  5CP6 D;  4J8V A;  3REH B;  4KGC D;  2RVQ C;  2Y2Q A;  3AZF B;  4ZBJ B;  5B0Y C;  3W98 A;  3B6F C;  2NZD D;  3UTB A;  3NQJ A;  5C3I B;  3W96 A;  5CPJ B;  2Y2L A;  3AZM B;  5BT1 C;  3AV1 A;  3B0C T;  3REI A;  2Y2P A;  3AZI B;  4WU9 C;  3AYW B;  3UTA B;  1P3L B;  3AZN D;  3WTP D;  3MGS A;  4J8X C;  1F66 B;  1BH8 A;  5DNN B;  2ZY3 A;  3VH5 W;  2FJ7 D;  2BYM B;  5AY8 A;  3AZK B;  2HIO D;  5CP6 C;  5AV5 A;  2ZM5 A;  5B0Z D;  4KGC C;  5GT3 A;  1P3G A;  1Q9C A;  5AVB B;  2NZD C;  3A1K A;  4H9P B;  5B33 B;  3C1C B;  1HTA A;  2CWE A;  3A6N A;  1TZY A;  3B0D C;  4X23 B;  3REJ D;  3KXB B;  4H9O B;  3MNN A;  1S32 A;  3O62 A;  3AFA D;  3AZE D;  3AZN C;  1ZLA A;  3WTP C;  2YFW B;  5B0Y A;  4KUD B;  5FUG A;  3VH5 T;  4JJN D;  2FJ7 C;  3VH5 A;  5GSU D;  2HIO C;  4ZUX D;  5E5A C;  2PYO B;  4HGA B; 
#chains in the Genus database with same CATH homology
 1M1A C;  5B0Z C;  4WU9 A;  2ARO A;  2F8N A;  3AZL D;  3C1B D;  5B1M A;  3REJ C;  3LZ0 B;  5BS7 C;  1P3P B;  3W97 D;  3W99 D;  3X1V D;  5B2J A;  3MGQ D;  4R8P B;  3AFA C;  3P5J B;  1KU5 A;  4KGC A;  3AZE C;  1P3B A;  2W8S A;  2NZD A;  1BFM A;  5GSU C;  2Y2H A;  4ZUX C;  2YFV A;  4G92 C;  4G91 C;  3MGR B;  3AZN A;  3MGP B;  3WTP A;  3W96 D;  3AZL C;  3C1B C;  3AZG D;  5B31 A;  4LD9 B;  3REK B;  3AV1 D;  2FJ7 A;  3W97 C;  3W99 C;  3X1V C;  3MGQ C;  2HIO A;  3NQU A;  5JRG C;  5B0Z A;  3LJA D;  3H0M C;  1P3A D;  4UPK A;  5B0Y B;  3B6F B;  5CPK D;  3REJ A;  2CV5 B;  5GT3 D;  1M19 A;  4Z2M G;  3AFA A;  3UTB C;  3H0R C;  3AZE A;  3W96 C;  4J8U D;  1KX5 B;  4WNN A;  2IO5 B;  3AZG C;  3AV1 C;  4JJN A;  3REI C;  4J8X B;  2ZY2 A;  5GSU A;  3KUY B;  3WAA D;  4ZUX A;  1EQZ D;  4CSR A;  1ZLA D;  3WA9 D;  4NFT A;  5CP6 B;  5AV6 D;  4H9Q A;  1P3A C;  4M6B A;  3AZL A;  5B32 B;  3C1B A;  5BO0 B;  4Z2M H;  4XZQ D;  4NE6 A;  5DNM B;  3B0D B;  3W97 A;  5AV5 C;  3KWQ D;  3W99 A;  5GT3 C;  2ARO D;  3V9R A;  3UT9 B;  1W2E A;  2YFV B;  1JFI B;  1P3M B;  5F99 A;  1AOI D;  3B6G A;  4J8U C;  3VH6 A;  3A6N C;  1TZY C;  2F2A C;  5B1M D;  3WTP B;  5AV9 D;  3WAA C;  3A1I A;  5B2J D;  1KX3 D;  1PZR A;  2Y2J A;  3O62 C;  1M18 D;  1EQZ C;  2FJ7 B;  2DF4 C;  3X1S D;  3TU4 D;  1P3B D;  1ZLA C;  4CAY A;  5B32 G;  4YS3 B;  3WA9 C;  1N1J B;  5E5A B;  3AV2 B;  1M1A B;  2G5I C;  3R45 A;  3X1T D;  3AZG A;  1T3U A;  3LZ1 D;  5AVC D;  2JCH A;  3EPK A;  3AN2 D;  4XZQ C;  1P3K D;  3KWQ C;  4J8W D;  2ARO C;  4DRA A;  3REJ B;  1AOI C;  5B2I B;  3LJA A;  4Z66 A;  5B31 D;  3AZJ B;  5AV8 A;  5GT0 D;  5B1M C;  1P3A A;  5AV9 C;  3KSY A;  3X1U D;  5BNX B;  5CPK A;  5B2J C;  1KX3 C;  1M18 C;  3X1S C;  1P34 B;  3TU4 C;  1P3B C;  1ID3 B;  3B0B A;  1U35 D;  4J8U A;  5CPI B;  3X1T C;  5AVC C;  1H3O B;  3LEL D;  3AN2 C;  3WAA A;  4J8W C;  3WKJ B;  2NQB B;  1M19 D;  1EQZ A;  3X1V B;  4Z5T D;  3MGQ B;  3WA9 A;  4EO5 C;  5AV6 A;  5JRG B;  5B31 C;  1B67 A;  4WZS B;  3REH D;  3REL B;  4XUJ B;  3AZF D;  3X1U C;  2F8N K;  1HQ3 D;  4WJ3 C;  4KHA B;  4XZQ A;  5B40 D;  4YM6 D;  2BYK B;  3KWQ A;  2J8P A;  2Y2O A;  1AOI A;  4J8V B;  1U35 C;  4CAY B;  3AYW D;  3UTA D;  1P3L D;  4H9R A;  4QLC D;  3UTB B;  3H0L C;  3W98 B;  3NQJ B;  1ULY A;  3LEL C;  3W96 B;  5AV9 A;  1F66 D;  5DNN D;  5B24 A;  1KX3 A;  3AV1 B;  1M18 A;  1M19 C;  3REI B;  3X1S A;  5F99 D;  3TU4 A;  3B6G D;  3AZK D;  4Z5T C;  2JSS A;  5G49 A;  4JJN C;  4ZBJ C;  3X1T A;  3MGS B;  5AVB D;  1HQ3 C;  1P3O A;  1BH8 B;  5AVC A;  5C3I C;  3LZ1 A;  3C1C D;  3AZH D;  3AN2 A;  5B40 C;  1P3K A;  4YM6 C;  4X23 D;  5AY8 B;  4J8W A;  3KXB D;  5AV5 B;  4WU8 A;  5GT3 B;  1P3G B;  3AYW C;  5CHL B;  1P3L C;  4QLC C;  5GT0 A;  5BNV A;  3X1U A;  1F66 C;  3A6N B;  1TZY B;  4KUD D;  1BH9 A;  2DQN C;  4UUZ A;  1TAF A;  5F99 C;  3B6G C;  3AZK C;  3MNN B;  1S32 B;  4Z66 D;  3O62 B;  2FFF B;  5B1L A;  1B6W A;  5KDM A;  5AV8 D;  1U35 A;  1ZLA B;  5AVB C;  5FUG B;  1WWS A;  3LEL A;  3C1C C;  3AZH C;  4AWL C;  4DRB A;  1P3P D;  3VH6 W;  4Z5T A;  4WU9 B;  4R8P D;  2ARO B;  3REH A;  3FDD A;  1AOI B;  2F8N B;  3AZF A;  4KUD C;  1HQ3 A;  4H9R B;  5B1M B;  5B40 A;  1P3I D;  4YM6 A;  3LJA C;  5B2J B;  4Z66 C;  5AV8 C;  2Y2G A;  4KGC B;  1P3B B;  2XD1 A;  3AYW A;  3UTA A;  1P3L A;  2NZD B;  4QLC A;  2BG1 A;  5CPK C;  3MGP D;  1F66 A;  5DNN A;  2LY8 A;  3REK D;  5AVC B;  4WV4 B;  3AN2 B;  2BYM A;  1P3P C;  3VH6 T;  2F8N G;  3AZK A;  4R8P C;  3AZN B;  5AVB A;  5B24 D;  5B31 B;  3C1C A;  3AZH A;  1P3I C;  3X1U B;  4X23 A;  2HIO B;  3NQU B;  3KXB A;  5AV6 C;  2CV5 D;  5B0Z B;  4H9O A;  5BT1 D;  1P3O D;  3MGP C;  1U35 B;  1KX5 D;  2YFW A;  2F8N H;  1KX4 D;  4KUD A;  3REK C;  3LEL B;  4J8X D;  3KUY D;  4WU8 D;  2JE5 A;  3IP4 C;  5GXQ D;  3AFA B;  1M19 B;  5B31 G;  3AZE B;  4Z5T B;  4WNN B;  5B24 C;  4NE3 A;  5B32 D;  4JJN B;  5GSU B;  1HQ3 B;  3LZ0 A;  3EPJ A;  4ZUX B;  5B40 B;  2VQR A;  5B1L D;  5DNM D;  4YM6 B;  4CSR B;  2HUE C;  2CV5 C;  4G92 B;  1P3P A;  4G91 B;  4R8P A;  3UT9 D;  3EG5 B;  1P3O C;  4H9N A;  3LZ1 C;  3MVD D;  1P3M D;  1P3F D;  1P3K C;  4H9Q B;  1KX5 C;  3AZL B;  1KX4 C;  3C1B B;  2IO5 C;  2ZY5 A;  4QLC B;  1P3I A;  3KUY C;  3W97 B;  4WU8 C;  3W99 B;  5GXQ C;  3V9R B;  2G5H C;  5GT0 C;  5F99 B;  3B6G B;  4YS3 D;  3MGR A;  2Y2N A;  5E5A D;  3AV2 D;  1M1A D;  5CPJ D;  3MGP A;  5B32 C;  4DQY B;  3AZM D;  5JA4 A;  4LD9 A;  3REK A;  1A7W A;  3AZH B;  5B1L C;  5DNM C;  4AWL B;  3AZI D;  3AL0 C;  3UT9 C;  3MVD C;  1P3M C;  5B2I D;  1P3F C;  3R45 B;  3AZG B;  3AZJ D;  4E45 A;  2Y2I A;  3B6F A;  2CV5 A;  3REH C;  1P34 D;  3AZF C;  3LJA B;  4YS3 C;  4E44 A;  1ID3 D;  4Z66 B;  5B33 D;  3AV2 C;  5AV8 B;  5CPJ C;  1P3A B;  1KX5 A;  5CPI D;  1KX4 A;  3F6T A;  3AZM C;  2Y2M A;  5CPK B;  4J8X A;  3KUY A;  3AZI C;  3WKJ D;  2NQB D;  2ZY4 A;  5GXQ A;  3UTA C;  5B2I C;  4J8U B;  2Y2K A;  5CP6 A;  5JRG D;  3REL D;  5DNN C;  3AZJ C;  4H9N B;  4XUJ D;  2UWX A;  5B32 A;  3WAA B;  1Z2C B;  5BO0 A;  1EQZ B;  2PYO D;  5DNM A;  1P3I B;  1P34 C;  3WA9 B;  3UT9 A;  1ID3 C;  5AV6 B;  3MVD A;  4J8V D;  5B33 C;  1P3M A;  1JFI A;  1P3F A;  3KFU G;  5CPI C;  3W98 D;  4X23 C;  3UTB D;  3LZ0 D;  3KXB C;  4XZQ B;  2RIQ A;  3KWQ B;  5JA4 B;  3WKJ C;  2NQB C;  4H9S C;  3REI D;  4YS3 A;  1N1J A;  2XD5 A;  5E5A A;  3REL C;  3AV2 A;  1M1A A;  5CPJ A;  4XUJ C;  5AV9 B;  3MGS D;  3AZM A;  5B24 B;  1KX3 B;  1R4V A;  1M18 B;  2PYO C;  4HGA C;  5AY8 D;  3X1S B;  3AZI A;  3TU4 B;  1F1E A;  3MGR D;  5BS7 A;  5AV5 D;  4J8V C;  2HUE B;  5B2I A;  5G49 B;  1P3G D;  3X1T B;  2L5A A;  3W98 C;  3AZJ A;  1P3O B;  4LD9 D;  3LZ1 B;  3LZ0 C;  1P3K B;  3A6N D;  1TZY D;  5BNX A;  1KX4 B;  4J8W B;  1P34 A;  3WTP E;  4WU8 B;  3MNN D;  1S32 D;  1ID3 A;  4EO5 B;  5GXQ B;  3O62 D;  4H9P A;  3EPH A;  5B33 A;  2RVQ D;  5GT0 B;  5BNV B;  5CPI A;  5B0Y D;  3MGS C;  3B6F D;  1WWI A;  1BH9 B;  1H3O A;  4UUZ B;  3EPL A;  5AY8 C;  1TAF B;  3WKJ A;  2NQB A;  4H9S A;  3MGR C;  3B0C W;  5B1L B;  5KDM B;  3X1V A;  4WU9 D;  3MGQ A;  1P3G C;  5JRG A;  3REL A;  2F8N D;  3MVD B;  4LD9 C;  4XUJ A;  1P3F B;  4KHA A;  2PYO A;  2BYK A;  4NE5 A;  3MNN C;  1S32 C;  5CP6 D;  4J8V A;  3REH B;  4KGC D;  2RVQ C;  2Y2Q A;  3AZF B;  4ZBJ B;  5B0Y C;  3W98 A;  3B6F C;  2NZD D;  3UTB A;  3NQJ A;  5C3I B;  3W96 A;  5CPJ B;  2Y2L A;  3AZM B;  5BT1 C;  3AV1 A;  3B0C T;  3REI A;  2Y2P A;  3AZI B;  4WU9 C;  3AYW B;  3UTA B;  1P3L B;  3AZN D;  3WTP D;  3MGS A;  4J8X C;  1F66 B;  1BH8 A;  5DNN B;  2ZY3 A;  3VH5 W;  2FJ7 D;  2BYM B;  5AY8 A;  3AZK B;  2HIO D;  5CP6 C;  5AV5 A;  2ZM5 A;  5B0Z D;  4KGC C;  5GT3 A;  1P3G A;  1Q9C A;  5AVB B;  2NZD C;  3A1K A;  4H9P B;  5B33 B;  3C1C B;  1HTA A;  2CWE A;  3A6N A;  1TZY A;  3B0D C;  4X23 B;  3REJ D;  3KXB B;  4H9O B;  3MNN A;  1S32 A;  3O62 A;  3AFA D;  3AZE D;  3AZN C;  1ZLA A;  3WTP C;  2YFW B;  5B0Y A;  4KUD B;  5FUG A;  3VH5 T;  4JJN D;  2FJ7 C;  3VH5 A;  5GSU D;  2HIO C;  4ZUX D;  5E5A C;  2PYO B;  4HGA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...