5AVBC

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
b'KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avbC00
3LZ0D 4G91B 2RVQD 5DNMC 5FUGA 5CP6D 4J8UC 3AZHA 3TU4C 3NQUA 3KWQA 3O62A 3W97C 5AVBC 1ZLAD 5GT3A 3REHA 1P3FA 3AZLD 1P3PA 3VH6T 4CAYA 4ZUXA 3X1VB 4X23A 4J8XC 3VH6A 2AROD 5G49A 3MGPD 3REIB 3AZKC 5B0ZA 5JRGB 4WU8C 3W98B 1TZYA 3AV1B 1S32D 3B0CT 2CV5C 3VH5A 3AZEA 3RELC 5B1LC 5B31B 3AZGB 5CPKC 5E5AA 5GSUA 4H9QB 4QLCA 3WA9C 5B33C 3A6NC 1P3OB 3NQJA 5B24A 5AY8C 4YM6C 5CPJA 5BO0B 5B1MA 4Z2MG 5B2JC 3MGSA 3LZ1A 5AV8B 1B67A 3KXBD 3AFAD 1KU5A 3R45A 1P3MC 1P34C 3B6GD 4H9RB 3C1CB 4WV4B 3AZNC 1P3BA 3X1TA 1M1AD 5F99C 5AV6C 4H9SA 5AV5C 3WAAA 2PYOB 2LY8A 4XUJD 3UT9D 4HGAC 4JJNB 2NZDA 4XZQD 4YS3B 3W99B 3UTAD 5GT0C 3LZ0B 3MVDC 4KUDC 2L5AA 5AVCA 5CP6B 3AN2C 3AYWD 2F8NG 1EQZC 3VH6W 1P3IA 1ZLAB 3KSYA 4WU9D 4J8VA 3AZHC 3KWQC 5DNMD 3B0CW 3O62C 2AROB 5GT3C 3LJAA 5KDMA 3MGPB 4J8UD 3REHC 3TU4D 1P3FC 1P3PC 1U35B 1S32B 4ZUXC 4X23C 2FJ7D 3UTBD 5B0ZC 4H9PB 4Z66B 3B6FC 3WKJA 4J8XD 4ZBJC 1TZYC 5AV9B 2BYMB 3AZKD 4WU8D 3X1VA 3AZEC 2YFWA 2CV5D 3RELD 5E5AC 5B1LD 5GSUC 4QLCC 5BNXB 3WTPE 4G92B 3V9RA 5CPKD 1KX3A 2HUEB 5B40C 5C3IB 5B24C 5B33D 3KXBB 3AFAB 1M18B 4J8WB 3A6ND 5CPJC 5B1MC 3MGSC 3LZ1C 5AY8D 4YM6D 1P3OA 3MGRA 1H3OB 1BFMA 1JFIB 1M1AB 5B2JD 1ID3A 4DRBA 5BO0A 1P3MD 5AV8A 1P34D 1P3BC 2F8ND 3B0DC 3AZND 3UT9B 3X1TC 1Q9CA 4XZQB 4H9SC 3C1CA 3WAAC 5B32G 4H9NB 3UTAB 5F99D 5AV6D 3X1UA 5AV5D 2NZDC 3AZIA 3X1SA 3AYWB 2NQBC 5BS7A 3REKA 5GT0D 4WNNA 5AVCC 4WU9B 3W99A 5CPIB 3MVDD 4AWLC 4KUDD 1P3IC 5DNMB 1AOIB 1EQZD 1TAFB 4LD9A 2IO5B 4J8VC 3AV2D 2FJ7B 3LJAC 3UTBB 3AZHD 4J8XB 3KWQD 3O62D 3B0BA 5GT3D 4WU8B 3AZKB 3REHD 1B6WA 1P3PD 2AROA 1WWIA 4UUZA 2CV5B 3WKJC 3AZJA 1P3AA 5DNND 1U35A 3RELB 5GXQC 5B1LB 5B0ZD 3W96A 4DRAA 3X1VC 3MNNB 3B6FD 1TZYD 5B2IA 4Z66A 5CPKB 4Z5TA 3AZED 5B33B 5AV9A 2BYMA 3A6NB 1P3LB 5B32D 1KX3C 5E5AD 5GSUD 4YM6B 3WTPA 4QLCD 4R8PC 3AZFA 5B0YB 5B2JB 5B40D 5BNXA 4KGCD 5B24D 1P3MB 5CPJD 2F8NB 1P3OC 3MGRC 3KXBA 1M18A 3AZNB 5B1MD 3MGSD 4J8WA 3LZ1D 1ID3C 3AZMC 3REJA 1KX4A 1F66A 5AV8C 5AV6B 3MGQD 5AV5B 1P3KA 3KUYA 2CWEA 1HQ3A 1P3BD 1M19A 3C1CC 4HGAB 1P3GA 1BH8B 3LELA 3X1UC 3WAAD 5JA4A 3AZIC 3X1SC 1KX5D 4H9NA 5BS7C 4KUDB 3C1BA 3REKC 4EO5B 1R4VA 2NQBD 1EQZB 3AZLB 3W99C 2HIOA 5BNVB 3AV2B 5FUGB 5AVCD 3W97D 5AVBD 3AZHB 1P3ID 3NQUB 3KWQB 4LD9C 3O62B 5CPIA 5GT3B 1HTAA 3REHB 1P3PB 4CAYB 1AOIA 4J8VD 1TAFA 5DNNB 4E44A 1N1JB 5G49B 3LJAD 5B0ZB 3B6FB 3REIA 3W98A 2FJ7A 5JRGA 1TZYB 2AROC 3UTBA 3AV1A 3AZJC 1P3AC 3AZEB 1U35C 1WWSA 3W96C 3WKJD 5B31A 5B2IC 5B32B 4Z66C 5GXQD 5E5AB 5GSUB 3AZGA 3WA9D 4Z5TC 4QLCB 5AV9C 4H9QA 4NE6A 3B6GB 3MNNA 5B40B 4NE3A 4KGCB 4KHAB 3WTPC 3AZFC 5B1MB 3MGSB 1KX3D 3LZ1B 4R8PD 1P3LA 4XUJB 4YM6A 3KXBC 3MGQB 1M18C 4H9RA 5B0YA 4J8WC 1P3BB 1P3OD 3MGRD 3B0DB 3REJC 1KX4C 1F66C 1ID3D 2F8NA 3AZMD 1P3KC 3WAAB 3KUYC 5AV8D 1HQ3C 1M19C 2PYOA 1KX5B 4H9OB 1P3GC 3LELC 4JJNA 4YS3A 5AV5A 2NQBB 3X1UD 3AZID 3AN2D 3LZ0A 3C1BC 4J8UB 3X1SD 3TU4B 3W97B 5AVBB 5CP6A 4AWLB 1P3IB 3REKD 2HIOC 1ZLAA 4G91C 3W99D 1ULYA 1EQZA 4WZSB 3AZLA 5CPIC 3LJAB 1P3FD 5KDMB 4CSRB 3MGPA 3AV2A 4ZUXD 4LD9D 4X23D 4NFTA 1AOIC 1S32A 2IO5C 3REIC 3WKJB 3W98C 2FJ7C 4H9PA 5JRGC 2YFVB 3UTBC 5GXQB 3AV1C 3WA9B 5BT1C 5DNNA 1N1JA 4E45A 2YFWB 3B6FA 3AZJD 1P3AD 5B31C 1U35D 3VH5T 5AY8B 2BYKB 3AZGC 3W96D 5B2ID 3V9RB 4Z66D 1KX3B 3MNNC 4Z5TD 4R8PB 5AV9D 5B32A 1P34B 3AFAA 1F1EA 3B6GA 3WTPD 5B40A 3MGRB 1P3LC 3AZFD 4KGCA 5F99B 1H3OA 4KHAA 1ID3B 1JFIA 1M1AA 3AZMB 5B0YC 3X1TD 2JSSA 1BH9B 1M18D 4J8WD 4XUJA 3UT9A 5B31G 4XZQA 3MGQA 5GT0B 3REJD 1KX4D 1F66D 2PYOC 2NZDD 3UTAA 3X1UB 1P3KD 3KUYD 3MVDB 1HQ3D 4JJNC 1M19D 3AZIB 4YS3C 3AN2B 3X1SB 1P3GD 3LELD 3AYWA 3REKB 1KX5A 4H9OA 4WNNB 1A7WA 3LZ0C 2RVQC 4WU9A 2NQBA 5CP6C 3C1BD 5DNMA 1P3FB 1ZLAC 4J8UA 4EO5C 2HIOD 4ZUXB 4X23B 4LD9B 3TU4A 3W97A 3AZLC 5AVBA 4ZBJB 3MGPC 3AV2C 5CPID 4J8XA 2F8NK 1S32C 4WU8A 3VH5W 3AZKA 1AOID 4UUZB 4CSRA 3AZJB 1P3AB 3X1VD 2CV5A 5CHLB 3W96B 3REID 3RELA 3W98D 5B1LA 5JRGD 5DNNC 5B2IB 3NQJB 5B24B 3AV1D 4Z5TB 5CPKA 4Z2MH 2YFVA 5BT1D 5CPJB 5GXQA 3WA9A 5B33A 5B31D 3A6NA 3AZGD 4G92C 3WTPB 3R45B 2HUEC 3AZFB 5B32C 5AY8A 5C3IC 2BYKA 3AFAC 3MNND 5B2JA 3B6GC 3X1TB 4M6BA 1P3MA 4R8PA 4KGCC 1P34A 3AZNA 1M1AC 1P3LD 3REJB 1KX4B 1F66B 2NZDB 5F99A 1P3KB 5AV6A 5B0YD 3KUYB 3C1CD 4XUJC 3UT9C 1HQ3B 1M19B 3MGQC 4XZQC 3AZMA 1P3GB 3LELB 1BH9A 3UTAC 1BH8A 2F8NH 5JA4B 2PYOD 5AVCB 5GT0A 4JJND 4YS3D 3AYWC 3C1BB 3MVDA 1KX5C 4KUDA 3AN2A 4J8VB 2HIOB 4NE5A 4WU9C 5BNVA
chains in the Genus database with same CATH superfamily
3A1KA 3LZ0D 4G91B 2RVQD 5DNMC 5FUGA 5CP6D 4J8UC 3AZHA 3TU4C 3NQUA 3KWQA 3O62A 3W97C 5AVBC 1ZLAD 5GT3A 3REHA 1P3FA 3AZLD 1P3PA 3VH6T 4CAYA 4ZUXA 3X1VB 4X23A 4J8XC 3VH6A 2AROD 5G49A 3MGPD 3REIB 3AZKC 5B0ZA 5JRGB 4WU8C 3W98B 1TZYA 3AV1B 1S32D 3B0CT 2CV5C 3VH5A 3AZEA 3RELC 5B1LC 5B31B 3AZGB 5CPKC 5E5AA 5GSUA 4H9QB 4QLCA 3WA9C 5B33C 3A6NC 3P5JB 1P3OB 3NQJA 5B24A 5AY8C 4YM6C 5CPJA 5BO0B 5B1MA 4Z2MG 5B2JC 3MGSA 3LZ1A 5AV8B 3EPHA 1B67A 3KXBD 3AFAD 1KU5A 3R45A 1P3MC 1P34C 3B6GD 4H9RB 3C1CB 4WV4B 3AZNC 2JCHA 2Y2LA 1P3BA 3X1TA 1M1AD 5F99C 5AV6C 4H9SA 5AV5C 3WAAA 2PYOB 2LY8A 4XUJD 3UT9D 4HGAC 4JJNB 2NZDA 4XZQD 4YS3B 2Y2GA 3W99B 3UTAD 2W8SA 5GT0C 2Y2OA 2DQNC 3IP4C 3LZ0B 3MVDC 4KUDC 2L5AA 5AVCA 5CP6B 3AN2C 3AYWD 2F8NG 2ZY4A 1EQZC 3VH6W 1P3IA 1ZLAB 3KSYA 4WU9D 2JE5A 4J8VA 3AZHC 3KWQC 5DNMD 3B0CW 3O62C 2AROB 5GT3C 3LJAA 5KDMA 3MGPB 4J8UD 3REHC 3TU4D 1P3FC 1P3PC 1U35B 1S32B 4ZUXC 4X23C 2FJ7D 3UTBD 5B0ZC 4H9PB 4Z66B 3B6FC 3WKJA 4J8XD 4ZBJC 1TZYC 5AV9B 2BYMB 3AZKD 4WU8D 3H0LC 3X1VA 2Y2JA 3AZEC 2YFWA 2CV5D 1W2EA 3RELD 5E5AC 5B1LD 5GSUC 4QLCC 5BNXB 3WTPE 4G92B 3V9RA 5CPKD 1KX3A 2HUEB 3EPLA 2RIQA 5B40C 1PZRA 5B24C 5B33D 5C3IB 3KXBB 3AFAB 1M18B 4J8WB 3A6ND 5CPJC 5B1MC 3MGSC 3H0MC 3LZ1C 2Y2HA 5AY8D 4YM6D 1P3OA 3MGRA 1H3OB 1BFMA 1JFIB 1M1AB 5B2JD 1ID3A 4DRBA 5BO0A 1P3MD 5AV8A 1P34D 1P3BC 2F8ND 2UWXA 3B0DC 3AZND 3UT9B 3X1TC 1Q9CA 4XZQB 4H9SC 3C1CA 3WAAC 5B32G 4H9NB 3UTAB 5F99D 5AV6D 3X1UA 5AV5D 2NZDC 3AZIA 3X1SA 3AYWB 2NQBC 5BS7A 3REKA 5GT0D 4WNNA 5AVCC 4WU9B 3W99A 5CPIB 3MVDD 4AWLC 4KUDD 1P3IC 5DNMB 1AOIB 1EQZD 1TAFB 4LD9A 2IO5B 4J8VC 3AV2D 2FJ7B 3LJAC 3UTBB 3AZHD 4J8XB 3KWQD 3O62D 3B0BA 5GT3D 4WU8B 3AZKB 3REHD 1B6WA 1P3PD 2AROA 1WWIA 4UUZA 2CV5B 3WKJC 3AZJA 1P3AA 5DNND 1U35A 3RELB 5GXQC 5B1LB 5B0ZD 3W96A 4DRAA 3X1VC 3MNNB 3B6FD 1TZYD 5B2IA 4Z66A 5CPKB 4Z5TA 3AZED 5B33B 5AV9A 2BYMA 3EPJA 2ZY2A 3A6NB 1P3LB 5B32D 1KX3C 5E5AD 5GSUD 4YM6B 4QLCD 3WTPA 4R8PC 3AZFA 3EG5B 5B0YB 5B2JB 5B40D 5BNXA 4KGCD 5B24D 2G5HC 1P3MB 5CPJD 2F8NB 1P3OC 3MGRC 3KXBA 1M18A 3AZNB 5B1MD 3MGSD 4J8WA 3LZ1D 1ID3C 3AZMC 3REJA 1KX4A 1F66A 5AV8C 5AV6B 3MGQD 5AV5B 1P3KA 3KUYA 2CWEA 1HQ3A 1P3BD 1M19A 4UPKA 3C1CC 2XD5A 4HGAB 1P3GA 1BH8B 3LELA 3X1UC 3WAAD 4DQYB 5JA4A 3AZIC 3X1SC 1KX5D 4H9NA 5BS7C 4KUDB 2F2AC 3C1BA 3REKC 4EO5B 1R4VA 2NQBD 1EQZB 3AZLB 3W99C 2HIOA 5BNVB 2J8PA 3AV2B 5FUGB 5AVCD 3W97D 5AVBD 3AZHB 1P3ID 3NQUB 3KWQB 4LD9C 3O62B 5CPIA 5GT3B 1HTAA 3REHB 1P3PB 4CAYB 1AOIA 4J8VD 1TAFA 5DNNB 2Y2QA 1N1JB 5G49B 4E44A 3LJAD 5B0ZB 3B6FB 3REIA 3W98A 2FJ7A 5JRGA 1TZYB 2AROC 3UTBA 3AV1A 3AZJC 1P3AC 3AZEB 1U35C 1Z2CB 1WWSA 3W96C 3WKJD 5B31A 5B2IC 5B32B 4Z66C 5GXQD 5E5AB 5GSUB 3AZGA 3WA9D 4Z5TC 4QLCB 5AV9C 4H9QA 4NE6A 3B6GB 2Y2IA 3MNNA 5B40B 4NE3A 4KGCB 4KHAB 3WTPC 3AZFC 5B1MB 3MGSB 1KX3D 3LZ1B 3H0RC 4R8PD 1P3LA 4XUJB 2FFFB 4YM6A 3KXBC 3MGQB 1M18C 4H9RA 5B0YA 4J8WC 1P3BB 1P3OD 3MGRD 3B0DB 3REJC 1KX4C 1F66C 1ID3D 2F8NA 2Y2MA 3AZMD 1P3KC 3WAAB 3A1IA 3KUYC 5AV8D 1HQ3C 1M19C 2PYOA 1KX5B 4H9OB 1P3GC 3LELC 4JJNA 4YS3A 5AV5A 2NQBB 2XD1A 3X1UD 3AZID 3AN2D 3LZ0A 3C1BC 4J8UB 3X1SD 3TU4B 3W97B 5AVBB 5CP6A 4AWLB 1P3IB 3REKD 2HIOC 2BG1A 1ZLAA 4G91C 3W99D 1ULYA 1EQZA 4WZSB 3AZLA 5CPIC 3LJAB 1P3FD 5KDMB 4CSRB 3MGPA 3AV2A 4ZUXD 4LD9D 4X23D 4NFTA 1AOIC 2ZY5A 1S32A 2IO5C 3REIC 3WKJB 3FDDA 3W98C 2FJ7C 4H9PA 5JRGC 2YFVB 3UTBC 5GXQB 3AV1C 2G5IC 3WA9B 5BT1C 5DNNA 1N1JA 4E45A 2YFWB 3B6FA 3AZJD 1P3AD 5B31C 1U35D 3VH5T 5AY8B 2BYKB 3AZGC 3W96D 5B2ID 3V9RB 4Z66D 1KX3B 3MNNC 4Z5TD 4R8PB 5AV9D 5B32A 1P34B 3AFAA 1F1EA 3B6GA 3WTPD 5B40A 3MGRB 1P3LC 3AZFD 2Y2NA 5F99B 4KGCA 1H3OA 4KHAA 1ID3B 2Y2KA 1JFIA 1M1AA 4WJ3C 3AZMB 5B0YC 3X1TD 2JSSA 1BH9B 1M18D 4J8WD 4XUJA 3UT9A 3AL0C 5B31G 4XZQA 3MGQA 2DF4C 5GT0B 3REJD 1KX4D 1F66D 2PYOC 2NZDD 3UTAA 3X1UB 1P3KD 3KUYD 3MVDB 1HQ3D 4JJNC 1M19D 3AZIB 4YS3C 3AN2B 3X1SB 1P3GD 3LELD 3AYWA 3REKB 1KX5A 4H9OA 4WNNB 1A7WA 3LZ0C 2RVQC 4WU9A 2NQBA 5CP6C 3C1BD 5DNMA 1P3FB 1ZLAC 4J8UA 4EO5C 2HIOD 4ZUXB 4X23B 4LD9B 3TU4A 3W97A 3AZLC 5AVBA 4ZBJB 3MGPC 3AV2C 5CPID 2ZM5A 4J8XA 2F8NK 1S32C 4WU8A 3VH5W 3AZKA 1AOID 4UUZB 4CSRA 3AZJB 1P3AB 3X1VD 2CV5A 5CHLB 3W96B 3REID 3RELA 3W98D 5B1LA 5JRGD 5DNNC 5B2IB 3NQJB 5B24B 3AV1D 4Z5TB 5CPKA 4Z2MH 2YFVA 5BT1D 5CPJB 2VQRA 5GXQA 5B33A 3F6TA 3WA9A 5B31D 3A6NA 3KFUG 3AZGD 4G92C 3WTPB 3R45B 2HUEC 3AZFB 5B32C 5AY8A 5C3IC 2BYKA 2Y2PA 3MNND 3AFAC 5B2JA 3B6GC 3X1TB 4M6BA 1P3MA 4R8PA 4KGCC 1P34A 3AZNA 1M1AC 1P3LD 3REJB 3EPKA 1KX4B 1F66B 2NZDB 5F99A 1P3KB 5AV6A 5B0YD 3KUYB 3C1CD 4XUJC 3UT9C 1HQ3B 1M19B 3MGQC 4XZQC 3AZMA 1P3GB 3LELB 1BH9A 3UTAC 1BH8A 2F8NH 5JA4B 2PYOD 5AVCB 5GT0A 4JJND 4YS3D 3AYWC 1T3UA 3C1BB 3MVDA 1KX5C 2ZY3A 4KUDA 3AN2A 4J8VB 2HIOB 4NE5A 4WU9C 5BNVA
chains in the Genus database with same CATH topology
3A1KA 3LZ0D 4G91B 2RVQD 5DNMC 5FUGA 5CP6D 4J8UC 3AZHA 3TU4C 3NQUA 3KWQA 3O62A 3W97C 5AVBC 1ZLAD 5GT3A 3REHA 1P3FA 3AZLD 1P3PA 3VH6T 4CAYA 4ZUXA 3X1VB 4X23A 4J8XC 3VH6A 2AROD 5G49A 3MGPD 3REIB 3AZKC 5B0ZA 5JRGB 4WU8C 3W98B 1TZYA 3AV1B 1S32D 3B0CT 2CV5C 3VH5A 3AZEA 3RELC 5B1LC 5B31B 3AZGB 5CPKC 5E5AA 5GSUA 4H9QB 4QLCA 3WA9C 5B33C 3A6NC 3P5JB 1P3OB 3NQJA 5B24A 5AY8C 4YM6C 5CPJA 5BO0B 5B1MA 4Z2MG 5B2JC 3MGSA 3LZ1A 5AV8B 3EPHA 1B67A 3KXBD 3AFAD 1KU5A 3R45A 1P3MC 1P34C 3B6GD 4H9RB 3C1CB 4WV4B 3AZNC 2JCHA 2Y2LA 1P3BA 3X1TA 1M1AD 5F99C 5AV6C 4H9SA 5AV5C 3WAAA 2PYOB 2LY8A 4XUJD 3UT9D 4HGAC 4JJNB 2NZDA 4XZQD 4YS3B 2Y2GA 3W99B 3UTAD 2W8SA 5GT0C 2Y2OA 2DQNC 3IP4C 3LZ0B 3MVDC 4KUDC 2L5AA 5AVCA 5CP6B 3AN2C 3AYWD 2F8NG 2ZY4A 1EQZC 3VH6W 1P3IA 1ZLAB 3KSYA 4WU9D 2JE5A 4J8VA 3AZHC 3KWQC 5DNMD 3B0CW 3O62C 2AROB 5GT3C 3LJAA 5KDMA 3MGPB 4J8UD 3REHC 3TU4D 1P3FC 1P3PC 1U35B 1S32B 4ZUXC 4X23C 2FJ7D 3UTBD 5B0ZC 4H9PB 4Z66B 3B6FC 3WKJA 4J8XD 4ZBJC 1TZYC 5AV9B 2BYMB 3AZKD 4WU8D 3H0LC 3X1VA 2Y2JA 3AZEC 2YFWA 2CV5D 1W2EA 3RELD 5E5AC 5B1LD 5GSUC 4QLCC 5BNXB 3WTPE 4G92B 3V9RA 5CPKD 1KX3A 2HUEB 3EPLA 2RIQA 5B40C 1PZRA 5B24C 5B33D 5C3IB 3KXBB 3AFAB 1M18B 4J8WB 3A6ND 5CPJC 5B1MC 3MGSC 3H0MC 3LZ1C 2Y2HA 5AY8D 4YM6D 1P3OA 3MGRA 1H3OB 1BFMA 1JFIB 1M1AB 5B2JD 1ID3A 4DRBA 5BO0A 1P3MD 5AV8A 1P34D 1P3BC 2F8ND 2UWXA 3B0DC 3AZND 3UT9B 3X1TC 1Q9CA 4XZQB 4H9SC 3C1CA 3WAAC 5B32G 4H9NB 3UTAB 5F99D 5AV6D 3X1UA 5AV5D 2NZDC 3AZIA 3X1SA 3AYWB 2NQBC 5BS7A 3REKA 5GT0D 4WNNA 5AVCC 4WU9B 3W99A 5CPIB 3MVDD 4AWLC 4KUDD 1P3IC 5DNMB 1AOIB 1EQZD 1TAFB 4LD9A 2IO5B 4J8VC 3AV2D 2FJ7B 3LJAC 3UTBB 3AZHD 4J8XB 3KWQD 3O62D 3B0BA 5GT3D 4WU8B 3AZKB 3REHD 1B6WA 1P3PD 2AROA 1WWIA 4UUZA 2CV5B 3WKJC 3AZJA 1P3AA 5DNND 1U35A 3RELB 5GXQC 5B1LB 5B0ZD 3W96A 4DRAA 3X1VC 3MNNB 3B6FD 1TZYD 5B2IA 4Z66A 5CPKB 4Z5TA 3AZED 5B33B 5AV9A 2BYMA 3EPJA 2ZY2A 3A6NB 1P3LB 5B32D 1KX3C 5E5AD 5GSUD 4YM6B 4QLCD 3WTPA 4R8PC 3AZFA 3EG5B 5B0YB 5B2JB 5B40D 5BNXA 4KGCD 5B24D 2G5HC 1P3MB 5CPJD 2F8NB 1P3OC 3MGRC 3KXBA 1M18A 3AZNB 5B1MD 3MGSD 4J8WA 3LZ1D 1ID3C 3AZMC 3REJA 1KX4A 1F66A 5AV8C 5AV6B 3MGQD 5AV5B 1P3KA 3KUYA 2CWEA 1HQ3A 1P3BD 1M19A 4UPKA 3C1CC 2XD5A 4HGAB 1P3GA 1BH8B 3LELA 3X1UC 3WAAD 4DQYB 5JA4A 3AZIC 3X1SC 1KX5D 4H9NA 5BS7C 4KUDB 2F2AC 3C1BA 3REKC 4EO5B 1R4VA 2NQBD 1EQZB 3AZLB 3W99C 2HIOA 5BNVB 2J8PA 3AV2B 5FUGB 5AVCD 3W97D 5AVBD 3AZHB 1P3ID 3NQUB 3KWQB 4LD9C 3O62B 5CPIA 5GT3B 1HTAA 3REHB 1P3PB 4CAYB 1AOIA 4J8VD 1TAFA 5DNNB 2Y2QA 1N1JB 5G49B 4E44A 3LJAD 5B0ZB 3B6FB 3REIA 3W98A 2FJ7A 5JRGA 1TZYB 2AROC 3UTBA 3AV1A 3AZJC 1P3AC 3AZEB 1U35C 1Z2CB 1WWSA 3W96C 3WKJD 5B31A 5B2IC 5B32B 4Z66C 5GXQD 5E5AB 5GSUB 3AZGA 3WA9D 4Z5TC 4QLCB 5AV9C 4H9QA 4NE6A 3B6GB 2Y2IA 3MNNA 5B40B 4NE3A 4KGCB 4KHAB 3WTPC 3AZFC 5B1MB 3MGSB 1KX3D 3LZ1B 3H0RC 4R8PD 1P3LA 4XUJB 2FFFB 4YM6A 3KXBC 3MGQB 1M18C 4H9RA 5B0YA 4J8WC 1P3BB 1P3OD 3MGRD 3B0DB 3REJC 1KX4C 1F66C 1ID3D 2F8NA 2Y2MA 3AZMD 1P3KC 3WAAB 3A1IA 3KUYC 5AV8D 1HQ3C 1M19C 2PYOA 1KX5B 4H9OB 1P3GC 3LELC 4JJNA 4YS3A 5AV5A 2NQBB 2XD1A 3X1UD 3AZID 3AN2D 3LZ0A 3C1BC 4J8UB 3X1SD 3TU4B 3W97B 5AVBB 5CP6A 4AWLB 1P3IB 3REKD 2HIOC 2BG1A 1ZLAA 4G91C 3W99D 1ULYA 1EQZA 4WZSB 3AZLA 5CPIC 3LJAB 1P3FD 5KDMB 4CSRB 3MGPA 3AV2A 4ZUXD 4LD9D 4X23D 4NFTA 1AOIC 2ZY5A 1S32A 2IO5C 3REIC 3WKJB 3FDDA 3W98C 2FJ7C 4H9PA 5JRGC 2YFVB 3UTBC 5GXQB 3AV1C 2G5IC 3WA9B 5BT1C 5DNNA 1N1JA 4E45A 2YFWB 3B6FA 3AZJD 1P3AD 5B31C 1U35D 3VH5T 5AY8B 2BYKB 3AZGC 3W96D 5B2ID 3V9RB 4Z66D 1KX3B 3MNNC 4Z5TD 4R8PB 5AV9D 5B32A 1P34B 3AFAA 1F1EA 3B6GA 3WTPD 5B40A 3MGRB 1P3LC 3AZFD 2Y2NA 5F99B 4KGCA 1H3OA 4KHAA 1ID3B 2Y2KA 1JFIA 1M1AA 4WJ3C 3AZMB 5B0YC 3X1TD 2JSSA 1BH9B 1M18D 4J8WD 4XUJA 3UT9A 3AL0C 5B31G 4XZQA 3MGQA 2DF4C 5GT0B 3REJD 1KX4D 1F66D 2PYOC 2NZDD 3UTAA 3X1UB 1P3KD 3KUYD 3MVDB 1HQ3D 4JJNC 1M19D 3AZIB 4YS3C 3AN2B 3X1SB 1P3GD 3LELD 3AYWA 3REKB 1KX5A 4H9OA 4WNNB 1A7WA 3LZ0C 2RVQC 4WU9A 2NQBA 5CP6C 3C1BD 5DNMA 1P3FB 1ZLAC 4J8UA 4EO5C 2HIOD 4ZUXB 4X23B 4LD9B 3TU4A 3W97A 3AZLC 5AVBA 4ZBJB 3MGPC 3AV2C 5CPID 2ZM5A 4J8XA 2F8NK 1S32C 4WU8A 3VH5W 3AZKA 1AOID 4UUZB 4CSRA 3AZJB 1P3AB 3X1VD 2CV5A 5CHLB 3W96B 3REID 3RELA 3W98D 5B1LA 5JRGD 5DNNC 5B2IB 3NQJB 5B24B 3AV1D 4Z5TB 5CPKA 4Z2MH 2YFVA 5BT1D 5CPJB 2VQRA 5GXQA 5B33A 3F6TA 3WA9A 5B31D 3A6NA 3KFUG 3AZGD 4G92C 3WTPB 3R45B 2HUEC 3AZFB 5B32C 5AY8A 5C3IC 2BYKA 2Y2PA 3MNND 3AFAC 5B2JA 3B6GC 3X1TB 4M6BA 1P3MA 4R8PA 4KGCC 1P34A 3AZNA 1M1AC 1P3LD 3REJB 3EPKA 1KX4B 1F66B 2NZDB 5F99A 1P3KB 5AV6A 5B0YD 3KUYB 3C1CD 4XUJC 3UT9C 1HQ3B 1M19B 3MGQC 4XZQC 3AZMA 1P3GB 3LELB 1BH9A 3UTAC 1BH8A 2F8NH 5JA4B 2PYOD 5AVCB 5GT0A 4JJND 4YS3D 3AYWC 1T3UA 3C1BB 3MVDA 1KX5C 2ZY3A 4KUDA 3AN2A 4J8VB 2HIOB 4NE5A 4WU9C 5BNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ0 D;  4G91 B;  2RVQ D;  5DNM C;  5FUG A;  5CP6 D;  4J8U C;  3AZH A;  3TU4 C;  3NQU A;  3KWQ A;  3O62 A;  3W97 C;  5AVB C;  1ZLA D;  5GT3 A;  3REH A;  1P3F A;  3AZL D;  1P3P A;  3VH6 T;  4CAY A;  4ZUX A;  3X1V B;  4X23 A;  4J8X C;  3VH6 A;  2ARO D;  5G49 A;  3MGP D;  3REI B;  3AZK C;  5B0Z A;  5JRG B;  4WU8 C;  3W98 B;  1TZY A;  3AV1 B;  1S32 D;  3B0C T;  2CV5 C;  3VH5 A;  3AZE A;  3REL C;  5B1L C;  5B31 B;  3AZG B;  5CPK C;  5E5A A;  5GSU A;  4H9Q B;  4QLC A;  3WA9 C;  5B33 C;  3A6N C;  1P3O B;  3NQJ A;  5B24 A;  5AY8 C;  4YM6 C;  5CPJ A;  5BO0 B;  5B1M A;  4Z2M G;  5B2J C;  3MGS A;  3LZ1 A;  5AV8 B;  1B67 A;  3KXB D;  3AFA D;  1KU5 A;  3R45 A;  1P3M C;  1P34 C;  3B6G D;  4H9R B;  3C1C B;  4WV4 B;  3AZN C;  1P3B A;  3X1T A;  1M1A D;  5F99 C;  5AV6 C;  4H9S A;  5AV5 C;  3WAA A;  2PYO B;  2LY8 A;  4XUJ D;  3UT9 D;  4HGA C;  4JJN B;  2NZD A;  4XZQ D;  4YS3 B;  3W99 B;  3UTA D;  5GT0 C;  3LZ0 B;  3MVD C;  4KUD C;  2L5A A;  5AVC A;  5CP6 B;  3AN2 C;  3AYW D;  2F8N G;  1EQZ C;  3VH6 W;  1P3I A;  1ZLA B;  3KSY A;  4WU9 D;  4J8V A;  3AZH C;  3KWQ C;  5DNM D;  3B0C W;  3O62 C;  2ARO B;  5GT3 C;  3LJA A;  5KDM A;  3MGP B;  4J8U D;  3REH C;  3TU4 D;  1P3F C;  1P3P C;  1U35 B;  1S32 B;  4ZUX C;  4X23 C;  2FJ7 D;  3UTB D;  5B0Z C;  4H9P B;  4Z66 B;  3B6F C;  3WKJ A;  4J8X D;  4ZBJ C;  1TZY C;  5AV9 B;  2BYM B;  3AZK D;  4WU8 D;  3X1V A;  3AZE C;  2YFW A;  2CV5 D;  3REL D;  5E5A C;  5B1L D;  5GSU C;  4QLC C;  5BNX B;  3WTP E;  4G92 B;  3V9R A;  5CPK D;  1KX3 A;  2HUE B;  5B40 C;  5C3I B;  5B24 C;  5B33 D;  3KXB B;  3AFA B;  1M18 B;  4J8W B;  3A6N D;  5CPJ C;  5B1M C;  3MGS C;  3LZ1 C;  5AY8 D;  4YM6 D;  1P3O A;  3MGR A;  1H3O B;  1BFM A;  1JFI B;  1M1A B;  5B2J D;  1ID3 A;  4DRB A;  5BO0 A;  1P3M D;  5AV8 A;  1P34 D;  1P3B C;  2F8N D;  3B0D C;  3AZN D;  3UT9 B;  3X1T C;  1Q9C A;  4XZQ B;  4H9S C;  3C1C A;  3WAA C;  5B32 G;  4H9N B;  3UTA B;  5F99 D;  5AV6 D;  3X1U A;  5AV5 D;  2NZD C;  3AZI A;  3X1S A;  3AYW B;  2NQB C;  5BS7 A;  3REK A;  5GT0 D;  4WNN A;  5AVC C;  4WU9 B;  3W99 A;  5CPI B;  3MVD D;  4AWL C;  4KUD D;  1P3I C;  5DNM B;  1AOI B;  1EQZ D;  1TAF B;  4LD9 A;  2IO5 B;  4J8V C;  3AV2 D;  2FJ7 B;  3LJA C;  3UTB B;  3AZH D;  4J8X B;  3KWQ D;  3O62 D;  3B0B A;  5GT3 D;  4WU8 B;  3AZK B;  3REH D;  1B6W A;  1P3P D;  2ARO A;  1WWI A;  4UUZ A;  2CV5 B;  3WKJ C;  3AZJ A;  1P3A A;  5DNN D;  1U35 A;  3REL B;  5GXQ C;  5B1L B;  5B0Z D;  3W96 A;  4DRA A;  3X1V C;  3MNN B;  3B6F D;  1TZY D;  5B2I A;  4Z66 A;  5CPK B;  4Z5T A;  3AZE D;  5B33 B;  5AV9 A;  2BYM A;  3A6N B;  1P3L B;  5B32 D;  1KX3 C;  5E5A D;  5GSU D;  4YM6 B;  3WTP A;  4QLC D;  4R8P C;  3AZF A;  5B0Y B;  5B2J B;  5B40 D;  5BNX A;  4KGC D;  5B24 D;  1P3M B;  5CPJ D;  2F8N B;  1P3O C;  3MGR C;  3KXB A;  1M18 A;  3AZN B;  5B1M D;  3MGS D;  4J8W A;  3LZ1 D;  1ID3 C;  3AZM C;  3REJ A;  1KX4 A;  1F66 A;  5AV8 C;  5AV6 B;  3MGQ D;  5AV5 B;  1P3K A;  3KUY A;  2CWE A;  1HQ3 A;  1P3B D;  1M19 A;  3C1C C;  4HGA B;  1P3G A;  1BH8 B;  3LEL A;  3X1U C;  3WAA D;  5JA4 A;  3AZI C;  3X1S C;  1KX5 D;  4H9N A;  5BS7 C;  4KUD B;  3C1B A;  3REK C;  4EO5 B;  1R4V A;  2NQB D;  1EQZ B;  3AZL B;  3W99 C;  2HIO A;  5BNV B;  3AV2 B;  5FUG B;  5AVC D;  3W97 D;  5AVB D;  3AZH B;  1P3I D;  3NQU B;  3KWQ B;  4LD9 C;  3O62 B;  5CPI A;  5GT3 B;  1HTA A;  3REH B;  1P3P B;  4CAY B;  1AOI A;  4J8V D;  1TAF A;  5DNN B;  4E44 A;  1N1J B;  5G49 B;  3LJA D;  5B0Z B;  3B6F B;  3REI A;  3W98 A;  2FJ7 A;  5JRG A;  1TZY B;  2ARO C;  3UTB A;  3AV1 A;  3AZJ C;  1P3A C;  3AZE B;  1U35 C;  1WWS A;  3W96 C;  3WKJ D;  5B31 A;  5B2I C;  5B32 B;  4Z66 C;  5GXQ D;  5E5A B;  5GSU B;  3AZG A;  3WA9 D;  4Z5T C;  4QLC B;  5AV9 C;  4H9Q A;  4NE6 A;  3B6G B;  3MNN A;  5B40 B;  4NE3 A;  4KGC B;  4KHA B;  3WTP C;  3AZF C;  5B1M B;  3MGS B;  1KX3 D;  3LZ1 B;  4R8P D;  1P3L A;  4XUJ B;  4YM6 A;  3KXB C;  3MGQ B;  1M18 C;  4H9R A;  5B0Y A;  4J8W C;  1P3B B;  1P3O D;  3MGR D;  3B0D B;  3REJ C;  1KX4 C;  1F66 C;  1ID3 D;  2F8N A;  3AZM D;  1P3K C;  3WAA B;  3KUY C;  5AV8 D;  1HQ3 C;  1M19 C;  2PYO A;  1KX5 B;  4H9O B;  1P3G C;  3LEL C;  4JJN A;  4YS3 A;  5AV5 A;  2NQB B;  3X1U D;  3AZI D;  3AN2 D;  3LZ0 A;  3C1B C;  4J8U B;  3X1S D;  3TU4 B;  3W97 B;  5AVB B;  5CP6 A;  4AWL B;  1P3I B;  3REK D;  2HIO C;  1ZLA A;  4G91 C;  3W99 D;  1ULY A;  1EQZ A;  4WZS B;  3AZL A;  5CPI C;  3LJA B;  1P3F D;  5KDM B;  4CSR B;  3MGP A;  3AV2 A;  4ZUX D;  4LD9 D;  4X23 D;  4NFT A;  1AOI C;  1S32 A;  2IO5 C;  3REI C;  3WKJ B;  3W98 C;  2FJ7 C;  4H9P A;  5JRG C;  2YFV B;  3UTB C;  5GXQ B;  3AV1 C;  3WA9 B;  5BT1 C;  5DNN A;  1N1J A;  4E45 A;  2YFW B;  3B6F A;  3AZJ D;  1P3A D;  5B31 C;  1U35 D;  3VH5 T;  5AY8 B;  2BYK B;  3AZG C;  3W96 D;  5B2I D;  3V9R B;  4Z66 D;  1KX3 B;  3MNN C;  4Z5T D;  4R8P B;  5AV9 D;  5B32 A;  1P34 B;  3AFA A;  1F1E A;  3B6G A;  3WTP D;  5B40 A;  3MGR B;  1P3L C;  3AZF D;  4KGC A;  5F99 B;  1H3O A;  4KHA A;  1ID3 B;  1JFI A;  1M1A A;  3AZM B;  5B0Y C;  3X1T D;  2JSS A;  1BH9 B;  1M18 D;  4J8W D;  4XUJ A;  3UT9 A;  5B31 G;  4XZQ A;  3MGQ A;  5GT0 B;  3REJ D;  1KX4 D;  1F66 D;  2PYO C;  2NZD D;  3UTA A;  3X1U B;  1P3K D;  3KUY D;  3MVD B;  1HQ3 D;  4JJN C;  1M19 D;  3AZI B;  4YS3 C;  3AN2 B;  3X1S B;  1P3G D;  3LEL D;  3AYW A;  3REK B;  1KX5 A;  4H9O A;  4WNN B;  1A7W A;  3LZ0 C;  2RVQ C;  4WU9 A;  2NQB A;  5CP6 C;  3C1B D;  5DNM A;  1P3F B;  1ZLA C;  4J8U A;  4EO5 C;  2HIO D;  4ZUX B;  4X23 B;  4LD9 B;  3TU4 A;  3W97 A;  3AZL C;  5AVB A;  4ZBJ B;  3MGP C;  3AV2 C;  5CPI D;  4J8X A;  2F8N K;  1S32 C;  4WU8 A;  3VH5 W;  3AZK A;  1AOI D;  4UUZ B;  4CSR A;  3AZJ B;  1P3A B;  3X1V D;  2CV5 A;  5CHL B;  3W96 B;  3REI D;  3REL A;  3W98 D;  5B1L A;  5JRG D;  5DNN C;  5B2I B;  3NQJ B;  5B24 B;  3AV1 D;  4Z5T B;  5CPK A;  4Z2M H;  2YFV A;  5BT1 D;  5CPJ B;  5GXQ A;  3WA9 A;  5B33 A;  5B31 D;  3A6N A;  3AZG D;  4G92 C;  3WTP B;  3R45 B;  2HUE C;  3AZF B;  5B32 C;  5AY8 A;  5C3I C;  2BYK A;  3AFA C;  3MNN D;  5B2J A;  3B6G C;  3X1T B;  4M6B A;  1P3M A;  4R8P A;  4KGC C;  1P34 A;  3AZN A;  1M1A C;  1P3L D;  3REJ B;  1KX4 B;  1F66 B;  2NZD B;  5F99 A;  1P3K B;  5AV6 A;  5B0Y D;  3KUY B;  3C1C D;  4XUJ C;  3UT9 C;  1HQ3 B;  1M19 B;  3MGQ C;  4XZQ C;  3AZM A;  1P3G B;  3LEL B;  1BH9 A;  3UTA C;  1BH8 A;  2F8N H;  5JA4 B;  2PYO D;  5AVC B;  5GT0 A;  4JJN D;  4YS3 D;  3AYW C;  3C1B B;  3MVD A;  1KX5 C;  4KUD A;  3AN2 A;  4J8V B;  2HIO B;  4NE5 A;  4WU9 C;  5BNV A; 
#chains in the Genus database with same CATH topology
 3A1K A;  3LZ0 D;  4G91 B;  2RVQ D;  5DNM C;  5FUG A;  5CP6 D;  4J8U C;  3AZH A;  3TU4 C;  3NQU A;  3KWQ A;  3O62 A;  3W97 C;  5AVB C;  1ZLA D;  5GT3 A;  3REH A;  1P3F A;  3AZL D;  1P3P A;  3VH6 T;  4CAY A;  4ZUX A;  3X1V B;  4X23 A;  4J8X C;  3VH6 A;  2ARO D;  5G49 A;  3MGP D;  3REI B;  3AZK C;  5B0Z A;  5JRG B;  4WU8 C;  3W98 B;  1TZY A;  3AV1 B;  1S32 D;  3B0C T;  2CV5 C;  3VH5 A;  3AZE A;  3REL C;  5B1L C;  5B31 B;  3AZG B;  5CPK C;  5E5A A;  5GSU A;  4H9Q B;  4QLC A;  3WA9 C;  5B33 C;  3A6N C;  3P5J B;  1P3O B;  3NQJ A;  5B24 A;  5AY8 C;  4YM6 C;  5CPJ A;  5BO0 B;  5B1M A;  4Z2M G;  5B2J C;  3MGS A;  3LZ1 A;  5AV8 B;  3EPH A;  1B67 A;  3KXB D;  3AFA D;  1KU5 A;  3R45 A;  1P3M C;  1P34 C;  3B6G D;  4H9R B;  3C1C B;  4WV4 B;  3AZN C;  2JCH A;  2Y2L A;  1P3B A;  3X1T A;  1M1A D;  5F99 C;  5AV6 C;  4H9S A;  5AV5 C;  3WAA A;  2PYO B;  2LY8 A;  4XUJ D;  3UT9 D;  4HGA C;  4JJN B;  2NZD A;  4XZQ D;  4YS3 B;  2Y2G A;  3W99 B;  3UTA D;  2W8S A;  5GT0 C;  2Y2O A;  2DQN C;  3IP4 C;  3LZ0 B;  3MVD C;  4KUD C;  2L5A A;  5AVC A;  5CP6 B;  3AN2 C;  3AYW D;  2F8N G;  2ZY4 A;  1EQZ C;  3VH6 W;  1P3I A;  1ZLA B;  3KSY A;  4WU9 D;  2JE5 A;  4J8V A;  3AZH C;  3KWQ C;  5DNM D;  3B0C W;  3O62 C;  2ARO B;  5GT3 C;  3LJA A;  5KDM A;  3MGP B;  4J8U D;  3REH C;  3TU4 D;  1P3F C;  1P3P C;  1U35 B;  1S32 B;  4ZUX C;  4X23 C;  2FJ7 D;  3UTB D;  5B0Z C;  4H9P B;  4Z66 B;  3B6F C;  3WKJ A;  4J8X D;  4ZBJ C;  1TZY C;  5AV9 B;  2BYM B;  3AZK D;  4WU8 D;  3H0L C;  3X1V A;  2Y2J A;  3AZE C;  2YFW A;  2CV5 D;  1W2E A;  3REL D;  5E5A C;  5B1L D;  5GSU C;  4QLC C;  5BNX B;  3WTP E;  4G92 B;  3V9R A;  5CPK D;  1KX3 A;  2HUE B;  3EPL A;  2RIQ A;  5B40 C;  1PZR A;  5B24 C;  5B33 D;  5C3I B;  3KXB B;  3AFA B;  1M18 B;  4J8W B;  3A6N D;  5CPJ C;  5B1M C;  3MGS C;  3H0M C;  3LZ1 C;  2Y2H A;  5AY8 D;  4YM6 D;  1P3O A;  3MGR A;  1H3O B;  1BFM A;  1JFI B;  1M1A B;  5B2J D;  1ID3 A;  4DRB A;  5BO0 A;  1P3M D;  5AV8 A;  1P34 D;  1P3B C;  2F8N D;  2UWX A;  3B0D C;  3AZN D;  3UT9 B;  3X1T C;  1Q9C A;  4XZQ B;  4H9S C;  3C1C A;  3WAA C;  5B32 G;  4H9N B;  3UTA B;  5F99 D;  5AV6 D;  3X1U A;  5AV5 D;  2NZD C;  3AZI A;  3X1S A;  3AYW B;  2NQB C;  5BS7 A;  3REK A;  5GT0 D;  4WNN A;  5AVC C;  4WU9 B;  3W99 A;  5CPI B;  3MVD D;  4AWL C;  4KUD D;  1P3I C;  5DNM B;  1AOI B;  1EQZ D;  1TAF B;  4LD9 A;  2IO5 B;  4J8V C;  3AV2 D;  2FJ7 B;  3LJA C;  3UTB B;  3AZH D;  4J8X B;  3KWQ D;  3O62 D;  3B0B A;  5GT3 D;  4WU8 B;  3AZK B;  3REH D;  1B6W A;  1P3P D;  2ARO A;  1WWI A;  4UUZ A;  2CV5 B;  3WKJ C;  3AZJ A;  1P3A A;  5DNN D;  1U35 A;  3REL B;  5GXQ C;  5B1L B;  5B0Z D;  3W96 A;  4DRA A;  3X1V C;  3MNN B;  3B6F D;  1TZY D;  5B2I A;  4Z66 A;  5CPK B;  4Z5T A;  3AZE D;  5B33 B;  5AV9 A;  2BYM A;  3EPJ A;  2ZY2 A;  3A6N B;  1P3L B;  5B32 D;  1KX3 C;  5E5A D;  5GSU D;  4YM6 B;  4QLC D;  3WTP A;  4R8P C;  3AZF A;  3EG5 B;  5B0Y B;  5B2J B;  5B40 D;  5BNX A;  4KGC D;  5B24 D;  2G5H C;  1P3M B;  5CPJ D;  2F8N B;  1P3O C;  3MGR C;  3KXB A;  1M18 A;  3AZN B;  5B1M D;  3MGS D;  4J8W A;  3LZ1 D;  1ID3 C;  3AZM C;  3REJ A;  1KX4 A;  1F66 A;  5AV8 C;  5AV6 B;  3MGQ D;  5AV5 B;  1P3K A;  3KUY A;  2CWE A;  1HQ3 A;  1P3B D;  1M19 A;  4UPK A;  3C1C C;  2XD5 A;  4HGA B;  1P3G A;  1BH8 B;  3LEL A;  3X1U C;  3WAA D;  4DQY B;  5JA4 A;  3AZI C;  3X1S C;  1KX5 D;  4H9N A;  5BS7 C;  4KUD B;  2F2A C;  3C1B A;  3REK C;  4EO5 B;  1R4V A;  2NQB D;  1EQZ B;  3AZL B;  3W99 C;  2HIO A;  5BNV B;  2J8P A;  3AV2 B;  5FUG B;  5AVC D;  3W97 D;  5AVB D;  3AZH B;  1P3I D;  3NQU B;  3KWQ B;  4LD9 C;  3O62 B;  5CPI A;  5GT3 B;  1HTA A;  3REH B;  1P3P B;  4CAY B;  1AOI A;  4J8V D;  1TAF A;  5DNN B;  2Y2Q A;  1N1J B;  5G49 B;  4E44 A;  3LJA D;  5B0Z B;  3B6F B;  3REI A;  3W98 A;  2FJ7 A;  5JRG A;  1TZY B;  2ARO C;  3UTB A;  3AV1 A;  3AZJ C;  1P3A C;  3AZE B;  1U35 C;  1Z2C B;  1WWS A;  3W96 C;  3WKJ D;  5B31 A;  5B2I C;  5B32 B;  4Z66 C;  5GXQ D;  5E5A B;  5GSU B;  3AZG A;  3WA9 D;  4Z5T C;  4QLC B;  5AV9 C;  4H9Q A;  4NE6 A;  3B6G B;  2Y2I A;  3MNN A;  5B40 B;  4NE3 A;  4KGC B;  4KHA B;  3WTP C;  3AZF C;  5B1M B;  3MGS B;  1KX3 D;  3LZ1 B;  3H0R C;  4R8P D;  1P3L A;  4XUJ B;  2FFF B;  4YM6 A;  3KXB C;  3MGQ B;  1M18 C;  4H9R A;  5B0Y A;  4J8W C;  1P3B B;  1P3O D;  3MGR D;  3B0D B;  3REJ C;  1KX4 C;  1F66 C;  1ID3 D;  2F8N A;  2Y2M A;  3AZM D;  1P3K C;  3WAA B;  3A1I A;  3KUY C;  5AV8 D;  1HQ3 C;  1M19 C;  2PYO A;  1KX5 B;  4H9O B;  1P3G C;  3LEL C;  4JJN A;  4YS3 A;  5AV5 A;  2NQB B;  2XD1 A;  3X1U D;  3AZI D;  3AN2 D;  3LZ0 A;  3C1B C;  4J8U B;  3X1S D;  3TU4 B;  3W97 B;  5AVB B;  5CP6 A;  4AWL B;  1P3I B;  3REK D;  2HIO C;  2BG1 A;  1ZLA A;  4G91 C;  3W99 D;  1ULY A;  1EQZ A;  4WZS B;  3AZL A;  5CPI C;  3LJA B;  1P3F D;  5KDM B;  4CSR B;  3MGP A;  3AV2 A;  4ZUX D;  4LD9 D;  4X23 D;  4NFT A;  1AOI C;  2ZY5 A;  1S32 A;  2IO5 C;  3REI C;  3WKJ B;  3FDD A;  3W98 C;  2FJ7 C;  4H9P A;  5JRG C;  2YFV B;  3UTB C;  5GXQ B;  3AV1 C;  2G5I C;  3WA9 B;  5BT1 C;  5DNN A;  1N1J A;  4E45 A;  2YFW B;  3B6F A;  3AZJ D;  1P3A D;  5B31 C;  1U35 D;  3VH5 T;  5AY8 B;  2BYK B;  3AZG C;  3W96 D;  5B2I D;  3V9R B;  4Z66 D;  1KX3 B;  3MNN C;  4Z5T D;  4R8P B;  5AV9 D;  5B32 A;  1P34 B;  3AFA A;  1F1E A;  3B6G A;  3WTP D;  5B40 A;  3MGR B;  1P3L C;  3AZF D;  2Y2N A;  5F99 B;  4KGC A;  1H3O A;  4KHA A;  1ID3 B;  2Y2K A;  1JFI A;  1M1A A;  4WJ3 C;  3AZM B;  5B0Y C;  3X1T D;  2JSS A;  1BH9 B;  1M18 D;  4J8W D;  4XUJ A;  3UT9 A;  3AL0 C;  5B31 G;  4XZQ A;  3MGQ A;  2DF4 C;  5GT0 B;  3REJ D;  1KX4 D;  1F66 D;  2PYO C;  2NZD D;  3UTA A;  3X1U B;  1P3K D;  3KUY D;  3MVD B;  1HQ3 D;  4JJN C;  1M19 D;  3AZI B;  4YS3 C;  3AN2 B;  3X1S B;  1P3G D;  3LEL D;  3AYW A;  3REK B;  1KX5 A;  4H9O A;  4WNN B;  1A7W A;  3LZ0 C;  2RVQ C;  4WU9 A;  2NQB A;  5CP6 C;  3C1B D;  5DNM A;  1P3F B;  1ZLA C;  4J8U A;  4EO5 C;  2HIO D;  4ZUX B;  4X23 B;  4LD9 B;  3TU4 A;  3W97 A;  3AZL C;  5AVB A;  4ZBJ B;  3MGP C;  3AV2 C;  5CPI D;  2ZM5 A;  4J8X A;  2F8N K;  1S32 C;  4WU8 A;  3VH5 W;  3AZK A;  1AOI D;  4UUZ B;  4CSR A;  3AZJ B;  1P3A B;  3X1V D;  2CV5 A;  5CHL B;  3W96 B;  3REI D;  3REL A;  3W98 D;  5B1L A;  5JRG D;  5DNN C;  5B2I B;  3NQJ B;  5B24 B;  3AV1 D;  4Z5T B;  5CPK A;  4Z2M H;  2YFV A;  5BT1 D;  5CPJ B;  2VQR A;  5GXQ A;  5B33 A;  3F6T A;  3WA9 A;  5B31 D;  3A6N A;  3KFU G;  3AZG D;  4G92 C;  3WTP B;  3R45 B;  2HUE C;  3AZF B;  5B32 C;  5AY8 A;  5C3I C;  2BYK A;  2Y2P A;  3MNN D;  3AFA C;  5B2J A;  3B6G C;  3X1T B;  4M6B A;  1P3M A;  4R8P A;  4KGC C;  1P34 A;  3AZN A;  1M1A C;  1P3L D;  3REJ B;  3EPK A;  1KX4 B;  1F66 B;  2NZD B;  5F99 A;  1P3K B;  5AV6 A;  5B0Y D;  3KUY B;  3C1C D;  4XUJ C;  3UT9 C;  1HQ3 B;  1M19 B;  3MGQ C;  4XZQ C;  3AZM A;  1P3G B;  3LEL B;  1BH9 A;  3UTA C;  1BH8 A;  2F8N H;  5JA4 B;  2PYO D;  5AVC B;  5GT0 A;  4JJN D;  4YS3 D;  3AYW C;  1T3U A;  3C1B B;  3MVD A;  1KX5 C;  2ZY3 A;  4KUD A;  3AN2 A;  4J8V B;  2HIO B;  4NE5 A;  4WU9 C;  5BNV A; 
#chains in the Genus database with same CATH homology
 3A1K A;  3LZ0 D;  4G91 B;  2RVQ D;  5DNM C;  5FUG A;  5CP6 D;  4J8U C;  3AZH A;  3TU4 C;  3NQU A;  3KWQ A;  3O62 A;  3W97 C;  5AVB C;  1ZLA D;  5GT3 A;  3REH A;  1P3F A;  3AZL D;  1P3P A;  3VH6 T;  4CAY A;  4ZUX A;  3X1V B;  4X23 A;  4J8X C;  3VH6 A;  2ARO D;  5G49 A;  3MGP D;  3REI B;  3AZK C;  5B0Z A;  5JRG B;  4WU8 C;  3W98 B;  1TZY A;  3AV1 B;  1S32 D;  3B0C T;  2CV5 C;  3VH5 A;  3AZE A;  3REL C;  5B1L C;  5B31 B;  3AZG B;  5CPK C;  5E5A A;  5GSU A;  4H9Q B;  4QLC A;  3WA9 C;  5B33 C;  3A6N C;  3P5J B;  1P3O B;  3NQJ A;  5B24 A;  5AY8 C;  4YM6 C;  5CPJ A;  5BO0 B;  5B1M A;  4Z2M G;  5B2J C;  3MGS A;  3LZ1 A;  5AV8 B;  3EPH A;  1B67 A;  3KXB D;  3AFA D;  1KU5 A;  3R45 A;  1P3M C;  1P34 C;  3B6G D;  4H9R B;  3C1C B;  4WV4 B;  3AZN C;  2JCH A;  2Y2L A;  1P3B A;  3X1T A;  1M1A D;  5F99 C;  5AV6 C;  4H9S A;  5AV5 C;  3WAA A;  2PYO B;  2LY8 A;  4XUJ D;  3UT9 D;  4HGA C;  4JJN B;  2NZD A;  4XZQ D;  4YS3 B;  2Y2G A;  3W99 B;  3UTA D;  2W8S A;  5GT0 C;  2Y2O A;  2DQN C;  3IP4 C;  3LZ0 B;  3MVD C;  4KUD C;  2L5A A;  5AVC A;  5CP6 B;  3AN2 C;  3AYW D;  2F8N G;  2ZY4 A;  1EQZ C;  3VH6 W;  1P3I A;  1ZLA B;  3KSY A;  4WU9 D;  2JE5 A;  4J8V A;  3AZH C;  3KWQ C;  5DNM D;  3B0C W;  3O62 C;  2ARO B;  5GT3 C;  3LJA A;  5KDM A;  3MGP B;  4J8U D;  3REH C;  3TU4 D;  1P3F C;  1P3P C;  1U35 B;  1S32 B;  4ZUX C;  4X23 C;  2FJ7 D;  3UTB D;  5B0Z C;  4H9P B;  4Z66 B;  3B6F C;  3WKJ A;  4J8X D;  4ZBJ C;  1TZY C;  5AV9 B;  2BYM B;  3AZK D;  4WU8 D;  3H0L C;  3X1V A;  2Y2J A;  3AZE C;  2YFW A;  2CV5 D;  1W2E A;  3REL D;  5E5A C;  5B1L D;  5GSU C;  4QLC C;  5BNX B;  3WTP E;  4G92 B;  3V9R A;  5CPK D;  1KX3 A;  2HUE B;  3EPL A;  2RIQ A;  5B40 C;  1PZR A;  5B24 C;  5B33 D;  5C3I B;  3KXB B;  3AFA B;  1M18 B;  4J8W B;  3A6N D;  5CPJ C;  5B1M C;  3MGS C;  3H0M C;  3LZ1 C;  2Y2H A;  5AY8 D;  4YM6 D;  1P3O A;  3MGR A;  1H3O B;  1BFM A;  1JFI B;  1M1A B;  5B2J D;  1ID3 A;  4DRB A;  5BO0 A;  1P3M D;  5AV8 A;  1P34 D;  1P3B C;  2F8N D;  2UWX A;  3B0D C;  3AZN D;  3UT9 B;  3X1T C;  1Q9C A;  4XZQ B;  4H9S C;  3C1C A;  3WAA C;  5B32 G;  4H9N B;  3UTA B;  5F99 D;  5AV6 D;  3X1U A;  5AV5 D;  2NZD C;  3AZI A;  3X1S A;  3AYW B;  2NQB C;  5BS7 A;  3REK A;  5GT0 D;  4WNN A;  5AVC C;  4WU9 B;  3W99 A;  5CPI B;  3MVD D;  4AWL C;  4KUD D;  1P3I C;  5DNM B;  1AOI B;  1EQZ D;  1TAF B;  4LD9 A;  2IO5 B;  4J8V C;  3AV2 D;  2FJ7 B;  3LJA C;  3UTB B;  3AZH D;  4J8X B;  3KWQ D;  3O62 D;  3B0B A;  5GT3 D;  4WU8 B;  3AZK B;  3REH D;  1B6W A;  1P3P D;  2ARO A;  1WWI A;  4UUZ A;  2CV5 B;  3WKJ C;  3AZJ A;  1P3A A;  5DNN D;  1U35 A;  3REL B;  5GXQ C;  5B1L B;  5B0Z D;  3W96 A;  4DRA A;  3X1V C;  3MNN B;  3B6F D;  1TZY D;  5B2I A;  4Z66 A;  5CPK B;  4Z5T A;  3AZE D;  5B33 B;  5AV9 A;  2BYM A;  3EPJ A;  2ZY2 A;  3A6N B;  1P3L B;  5B32 D;  1KX3 C;  5E5A D;  5GSU D;  4YM6 B;  4QLC D;  3WTP A;  4R8P C;  3AZF A;  3EG5 B;  5B0Y B;  5B2J B;  5B40 D;  5BNX A;  4KGC D;  5B24 D;  2G5H C;  1P3M B;  5CPJ D;  2F8N B;  1P3O C;  3MGR C;  3KXB A;  1M18 A;  3AZN B;  5B1M D;  3MGS D;  4J8W A;  3LZ1 D;  1ID3 C;  3AZM C;  3REJ A;  1KX4 A;  1F66 A;  5AV8 C;  5AV6 B;  3MGQ D;  5AV5 B;  1P3K A;  3KUY A;  2CWE A;  1HQ3 A;  1P3B D;  1M19 A;  4UPK A;  3C1C C;  2XD5 A;  4HGA B;  1P3G A;  1BH8 B;  3LEL A;  3X1U C;  3WAA D;  4DQY B;  5JA4 A;  3AZI C;  3X1S C;  1KX5 D;  4H9N A;  5BS7 C;  4KUD B;  2F2A C;  3C1B A;  3REK C;  4EO5 B;  1R4V A;  2NQB D;  1EQZ B;  3AZL B;  3W99 C;  2HIO A;  5BNV B;  2J8P A;  3AV2 B;  5FUG B;  5AVC D;  3W97 D;  5AVB D;  3AZH B;  1P3I D;  3NQU B;  3KWQ B;  4LD9 C;  3O62 B;  5CPI A;  5GT3 B;  1HTA A;  3REH B;  1P3P B;  4CAY B;  1AOI A;  4J8V D;  1TAF A;  5DNN B;  2Y2Q A;  1N1J B;  5G49 B;  4E44 A;  3LJA D;  5B0Z B;  3B6F B;  3REI A;  3W98 A;  2FJ7 A;  5JRG A;  1TZY B;  2ARO C;  3UTB A;  3AV1 A;  3AZJ C;  1P3A C;  3AZE B;  1U35 C;  1Z2C B;  1WWS A;  3W96 C;  3WKJ D;  5B31 A;  5B2I C;  5B32 B;  4Z66 C;  5GXQ D;  5E5A B;  5GSU B;  3AZG A;  3WA9 D;  4Z5T C;  4QLC B;  5AV9 C;  4H9Q A;  4NE6 A;  3B6G B;  2Y2I A;  3MNN A;  5B40 B;  4NE3 A;  4KGC B;  4KHA B;  3WTP C;  3AZF C;  5B1M B;  3MGS B;  1KX3 D;  3LZ1 B;  3H0R C;  4R8P D;  1P3L A;  4XUJ B;  2FFF B;  4YM6 A;  3KXB C;  3MGQ B;  1M18 C;  4H9R A;  5B0Y A;  4J8W C;  1P3B B;  1P3O D;  3MGR D;  3B0D B;  3REJ C;  1KX4 C;  1F66 C;  1ID3 D;  2F8N A;  2Y2M A;  3AZM D;  1P3K C;  3WAA B;  3A1I A;  3KUY C;  5AV8 D;  1HQ3 C;  1M19 C;  2PYO A;  1KX5 B;  4H9O B;  1P3G C;  3LEL C;  4JJN A;  4YS3 A;  5AV5 A;  2NQB B;  2XD1 A;  3X1U D;  3AZI D;  3AN2 D;  3LZ0 A;  3C1B C;  4J8U B;  3X1S D;  3TU4 B;  3W97 B;  5AVB B;  5CP6 A;  4AWL B;  1P3I B;  3REK D;  2HIO C;  2BG1 A;  1ZLA A;  4G91 C;  3W99 D;  1ULY A;  1EQZ A;  4WZS B;  3AZL A;  5CPI C;  3LJA B;  1P3F D;  5KDM B;  4CSR B;  3MGP A;  3AV2 A;  4ZUX D;  4LD9 D;  4X23 D;  4NFT A;  1AOI C;  2ZY5 A;  1S32 A;  2IO5 C;  3REI C;  3WKJ B;  3FDD A;  3W98 C;  2FJ7 C;  4H9P A;  5JRG C;  2YFV B;  3UTB C;  5GXQ B;  3AV1 C;  2G5I C;  3WA9 B;  5BT1 C;  5DNN A;  1N1J A;  4E45 A;  2YFW B;  3B6F A;  3AZJ D;  1P3A D;  5B31 C;  1U35 D;  3VH5 T;  5AY8 B;  2BYK B;  3AZG C;  3W96 D;  5B2I D;  3V9R B;  4Z66 D;  1KX3 B;  3MNN C;  4Z5T D;  4R8P B;  5AV9 D;  5B32 A;  1P34 B;  3AFA A;  1F1E A;  3B6G A;  3WTP D;  5B40 A;  3MGR B;  1P3L C;  3AZF D;  2Y2N A;  5F99 B;  4KGC A;  1H3O A;  4KHA A;  1ID3 B;  2Y2K A;  1JFI A;  1M1A A;  4WJ3 C;  3AZM B;  5B0Y C;  3X1T D;  2JSS A;  1BH9 B;  1M18 D;  4J8W D;  4XUJ A;  3UT9 A;  3AL0 C;  5B31 G;  4XZQ A;  3MGQ A;  2DF4 C;  5GT0 B;  3REJ D;  1KX4 D;  1F66 D;  2PYO C;  2NZD D;  3UTA A;  3X1U B;  1P3K D;  3KUY D;  3MVD B;  1HQ3 D;  4JJN C;  1M19 D;  3AZI B;  4YS3 C;  3AN2 B;  3X1S B;  1P3G D;  3LEL D;  3AYW A;  3REK B;  1KX5 A;  4H9O A;  4WNN B;  1A7W A;  3LZ0 C;  2RVQ C;  4WU9 A;  2NQB A;  5CP6 C;  3C1B D;  5DNM A;  1P3F B;  1ZLA C;  4J8U A;  4EO5 C;  2HIO D;  4ZUX B;  4X23 B;  4LD9 B;  3TU4 A;  3W97 A;  3AZL C;  5AVB A;  4ZBJ B;  3MGP C;  3AV2 C;  5CPI D;  2ZM5 A;  4J8X A;  2F8N K;  1S32 C;  4WU8 A;  3VH5 W;  3AZK A;  1AOI D;  4UUZ B;  4CSR A;  3AZJ B;  1P3A B;  3X1V D;  2CV5 A;  5CHL B;  3W96 B;  3REI D;  3REL A;  3W98 D;  5B1L A;  5JRG D;  5DNN C;  5B2I B;  3NQJ B;  5B24 B;  3AV1 D;  4Z5T B;  5CPK A;  4Z2M H;  2YFV A;  5BT1 D;  5CPJ B;  2VQR A;  5GXQ A;  5B33 A;  3F6T A;  3WA9 A;  5B31 D;  3A6N A;  3KFU G;  3AZG D;  4G92 C;  3WTP B;  3R45 B;  2HUE C;  3AZF B;  5B32 C;  5AY8 A;  5C3I C;  2BYK A;  2Y2P A;  3MNN D;  3AFA C;  5B2J A;  3B6G C;  3X1T B;  4M6B A;  1P3M A;  4R8P A;  4KGC C;  1P34 A;  3AZN A;  1M1A C;  1P3L D;  3REJ B;  3EPK A;  1KX4 B;  1F66 B;  2NZD B;  5F99 A;  1P3K B;  5AV6 A;  5B0Y D;  3KUY B;  3C1C D;  4XUJ C;  3UT9 C;  1HQ3 B;  1M19 B;  3MGQ C;  4XZQ C;  3AZM A;  1P3G B;  3LEL B;  1BH9 A;  3UTA C;  1BH8 A;  2F8N H;  5JA4 B;  2PYO D;  5AVC B;  5GT0 A;  4JJN D;  4YS3 D;  3AYW C;  1T3U A;  3C1B B;  3MVD A;  1KX5 C;  2ZY3 A;  4KUD A;  3AN2 A;  4J8V B;  2HIO B;  4NE5 A;  4WU9 C;  5BNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...