5AVBC

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avbC00
1WWIA 1KX3B 1B6WA 5B32D 5CHLB 3AN2A 1HQ3C 5AY8A 5CPJD 4NE6A 5AV6B 3AZKC 3MGQD 5CP6B 3REHA 1JFIA 3AZHB 5C3IB 5B24B 3AV1B 1F1EA 3AZGD 1M1AB 4QLCD 2IO5C 5B0YA 3B6FC 3LZ0A 3RELD 4NE5A 5AV5C 5CPKD 1HQ3B 1KX3D 5F99A 4WU9C 4XUJC 3AZKB 3REIA 4J8WC 3VH5T 5BNXB 5AV6D 5CP6D 3X1VA 5AV8C 5B24D 3AV1D 1P3AC 2F8NA 5G49B 2IO5B 3LELC 3B6FB 5GT3A 5AV5B 5DNMA 4Z5TC 4WU9B 4XUJB 1HQ3D 4J8WB 5AV8B 5BO0A 1P3AB 3X1SA 2BYKA 4UUZB 3AZIC 4Z5TB 1N1JB 5FUGB 5AV9C 3REKD 1P3PD 1P3BA 4WU9D 4XUJD 2F8NK 4J8WD 1F66C 5AV8D 1ZLAD 4E45A 1P3AD 4J8XC 3C1BC 3WAAA 5DNNC 3AZIB 2FJ7C 3LZ1A 3W98A 5AV9B 3C1CC 1ULYA 4Z5TD 5B40A 1F66B 1M18A 4YM6D 5B0ZA 1TZYC 3X1UA 3B0DC 4J8XB 4WZSB 3KUYC 3REJA 3C1BB 5DNNB 1KX5A 3REHC 4JJNA 2FJ7B 5GSUD 3C1CB 3AZID 5AV9D 3AV2C 4H9SC 4Z2MG 1F66D 1TZYB 3B0DB 3KUYB 3VH6W 3WTPC 5GT0A 3LJAA 4J8XD 1U35A 3REHB 1KX4A 1JFIB 3C1BD 3AZEA 5B31C 5DNND 5BS7C 5JRGC 3C1CD 3AV2B 1ID3A 3AZFA 1P3IA 5B1MA 5AVBC 1HTAA 5GT3C 5DNMC 1TZYD 4J8UA 2JSSA 3WTPB 4R8PA 3KUYD 3B6GD 4WU8A 5B31B 1P34C 1P3OD 3REHD 5JRGB 5BNVB 2F8NB 3AYWA 4KHAA 3AV2D 5AVBB 4LD9A 3AZND 5DNMB 3V9RB 4DRAA 4ZUXC 3AZLA 2CV5C 4J8VC 3MGSA 1S32B 1BH9B 4Z66D 3WTPD 1P34B 3KXBA 5B31D 1P3MB 5JRGD 2F8ND 1B67A 5B2IA 2F8NH 5AVBD 4ZUXB 2NQBB 5DNMD 2CV5B 4J8VB 4H9PA 4CAYA 3NQJA 1KU5A 1S32D 5B33C 1P34D 1M18C 4XZQA 3AFAA 2HUEC 1AOIA 3B0BA 3B0CW 1P3MD 3NQUB 3REJC 1R4VA 1KX5C 4JJNC 4ZUXD 2NQBD 3WKJC 1EQZA 2CV5D 4J8VD 5B33B 1P3FA 1M18B 5BT1C 2BYMA 2HUEB 2PYOA 1P3KC 4KGCC 5JA4B 3REJB 5GXQA 4WV4B 1U35C 1KX5B 1P3GA 4JJNB 3AZMC 5AVCA 3AZEC 3AZHD 5E5AA 3MVDA 3WKJB 3AZFC 2YFWA 5B1MC 5B2JA 1M1AD 3WA9A 5B33D 1P3KB 4KGCB 3MGPA 1M1AC 5CPIA 3AZKD 1U35B 3REJD 5B1LA 3AZMB 1M19C 3AZEB 1KX5D 3UT9A 3MNNC 1BH8A 5KDMA 3LELB 4H9RA 3WKJD 3AZFB 5B1MB 4G91C 3MGRC 3B6FD 5AV5D 4YS3C 4M6BA 5BT1D 4H9QB 1P3KD 4KGCD 4KUDA 4X23A 1M19B 3R45A 1U35D 3W97A 3VH6A 1P3LA 3KWQA 3AZMD 3MNNB 3AZED 2AROC 4ZBJC 2NZDC 5B32A 5B2IC 4G91B 1TAFB 3VH5W 3A6NC 3LELD 3MGRB 3AZFD 3X1TC 4YS3B 3MGQA 3AZJA 3W99C 3W96C 4H9NA 1M19D 2AROB 3AN2C 4XZQC 4QLCA 5AY8C 3MNND 1H3OB 4ZBJB 2NZDB 4H9OB 5B2IB 5CPKA 3A6NB 3X1TB 3MGRD 3W99B 4YS3D 3W96B 4H9PB 5AV6A 5CP6A 3AV1A 5B0YC 1BFMA 3LZ0C 1P3FC 3AN2B 4XZQB 5AY8B 5F99C 4WNNA 2AROD 3REIC 4NE3A 2NZDD 1P3GC 3X1VC 1HQ3A 3A6ND 2FJ7D 3X1TD 4E44A 3W99D 3MVDC 5BNXA 3W96D 5B0YB 3LZ0B 2BYMB 5F99B 3AN2D 3REIB 2CWEA 5G49A 5AY8D 5B1LC 3REKA 3X1VB 1P3GB 1P3PA 4WU9A 4XUJA 4Z2MH 3MVDB 2L5AA 2LY8A 3X1SC 5GT3B 5AV8A 1ZLAA 5B0YD 1P3AA 3LZ0D 3O62A 1P3BC 5F99D 3REID 4Z5TA 1N1JA 5BO0B 1P3GD 3KWQC 3X1VD 1BH8B 5KDMB 3X1SB 2BYKB 5B32C 4YM6A 3WAAC 5GT3D 3LZ1C 3W98C 3AZJC 1P3BB 5B40C 2YFVA 5B32G 5GSUA 3UTBA 3AZIA 3KWQB 4DRBA 5B0ZC 3UTAA 3X1UC 4QLCC 3WTPE 1F66A 3WAAB 5CPKC 3X1SD 3TU4A 3LZ1B 3W98B 3AZJB 4J8XA 5B40B 3C1BA 1WWSA 1P3BD 3C1CA 5B0ZB 2HIOA 3X1UB 4QLCB 3KWQD 4AWLC 5CPKB 5GT0C 3LJAC 1KX4C 3WAAD 1TZYA 4G92C 3VH5A 3LZ1D 3KUYA 3B6GA 3W98D 3AZJD 1P3OA 1ID3C 5B40D 1P3IC 1M18D 4WNNB 3AV2A 4H9SA 5B0ZD 4AWLB 4J8UC 3X1UD 3AZNA 5GT0B 3LJAB 4R8PC 1KX4B 4WU8C 3REKC 1P3PC 4G92B 4JJND 3KSYA 3WTPA 4Z66A 3AYWC 1ID3B 1P3IB 5B31A 4LD9C 5BS7A 5JRGA 5BNVA 1ZLAC 3O62C 3AZLC 4J8UB 3MGSC 5AVBA 4R8PB 4WU8B 5GT0D 3V9RA 3LJAD 3REKB 1P3PB 1KX4D 3KXBC 3AYWB 1S32A 4KHAB 1BH9A 1P34A 1ID3D 4LD9B 4YM6C 1ZLAB 1P3ID 5B1MD 5CPJA 1P3MA 3O62B 3AZLB 3MGSB 4J8UD 5GSUC 4R8PD 4CSRA 4ZUXA 3UTBC 2NQBA 3KXBB 4WU8D 3VH6T 3AZGA 2CV5A 3AFAC 4J8VA 1AOIC 3UTAC 3RELA 3AYWD 4YM6B 1KX3A 3TU4C 4LD9D 4CAYB 3NQUA 2YFVB 3NQJB 3O62D 3AZLD 5GSUB 3MGSD 1EQZC 3AZHA 5B24A 3UTBB 3AFAB 1AOIB 3KXBD 3UTAB 2HIOC 2PYOC 1M1AA 5GXQC 5B33A 5B2ID 3TU4B 5AVCC 3AZKA 5E5AC 4NFTA 5JA4A 3B6GC 1EQZB 4EO5C 1P3OC 2RVQC 3WA9C 5B2JC 1P3FB 3UTBD 2HIOB 2PYOB 3WKJA 4XZQD 3AFAD 1AOID 3MGPC 3UTAD 5GXQB 5CPIC 3AZNC 3B6FA 5AV5A 5AVCB 4HGAC 3UT9C 3TU4D 1P3KA 5E5AB 4J8WA 4KGCA 3B6GB 4EO5B 4Z66C 1P3OB 1EQZD 3AZMA 2YFWB 3WA9B 5B2JB 1P3FD 3MGPB 3LELA 3AZNB 2HIOD 5CPIB 2PYOD 4KUDC 4UUZA 5B1LB 5B31G 5GXQD 4X23C 3W97C 4HGAB 3B0CT 5FUGA 3UT9B 4H9QA 1P3LC 5AVCD 2F8NG 4Z66B 5E5AD 1S32C 4H9RB 3MVDD 1M19A 2RVQD 3MNNA 5CPJC 5B2JD 3WA9D 3MGQC 1P3MC 4KUDB 3MGPD 3MGRA 1TAFA 4X23B 5CPID 3R45B 3W97B 4YS3A 1P3LB 5B1LD 5AV9A 2NQBC 3AZGC 3UT9D 5B32B 3RELC 1KX3C 1A7WA 5CPJB 2AROA 3MGQB 1H3OA 2NZDA 5AV6C 4H9OA 1Q9CA 5DNNA 4H9NB 5CP6C 3A6NA 3AZHC 2FJ7A 4KUDD 5C3IC 4CSRB 5B24C 3AV1C 4X23D 3X1TA 3W99A 3AZGB 3W96A 1P3LD 3W97D 3RELB
chains in the Genus database with same CATH superfamily
1WWIA 1KX3B 1B6WA 5B32D 5CHLB 2Y2JA 3AN2A 1HQ3C 5AY8A 5CPJD 4NE6A 5AV6B 3AZKC 3MGQD 5CP6B 3REHA 1JFIA 2JCHA 3AZHB 2Y2KA 5C3IB 5B24B 3AV1B 1F1EA 3AZGD 1M1AB 4QLCD 2IO5C 5B0YA 3B6FC 3LZ0A 3RELD 4NE5A 5AV5C 5CPKD 1HQ3B 1KX3D 5F99A 4WU9C 4XUJC 3AZKB 3REIA 4J8WC 3VH5T 5BNXB 5AV6D 5CP6D 4DQYB 3X1VA 3A1KA 5AV8C 5B24D 3AV1D 1P3AC 2F8NA 5G49B 2IO5B 3LELC 3B6FB 5GT3A 2Y2PA 5AV5B 5DNMA 4Z5TC 4WU9B 4XUJB 1HQ3D 4J8WB 5AV8B 2BG1A 5BO0A 1P3AB 3X1SA 2BYKA 4UUZB 2ZY4A 3AZIC 4Z5TB 1N1JB 5FUGB 5AV9C 3REKD 1P3PD 1P3BA 4WU9D 4XUJD 2F8NK 4J8WD 1F66C 5AV8D 1ZLAD 4WJ3C 4E45A 1P3AD 4J8XC 3C1BC 3WAAA 5DNNC 3AZIB 2FJ7C 3LZ1A 3W98A 5AV9B 3C1CC 1ULYA 4Z5TD 5B40A 1F66B 1M18A 4YM6D 5B0ZA 1TZYC 2XD5A 3X1UA 3B0DC 4J8XB 4WZSB 3KUYC 3REJA 3C1BB 2J8PA 5DNNB 1KX5A 3REHC 4JJNA 2FJ7B 5GSUD 2XD1A 1T3UA 3C1CB 3AZID 3FDDA 5AV9D 3A1IA 3AV2C 4H9SC 4Z2MG 1F66D 1TZYB 2JE5A 3B0DB 3KUYB 3VH6W 3WTPC 5GT0A 3LJAA 4J8XD 1U35A 3REHB 1KX4A 1JFIB 3C1BD 3AZEA 5B31C 5DNND 3EPHA 5BS7C 5JRGC 3C1CD 3AV2B 1ID3A 2ZY3A 3AZFA 1P3IA 5B1MA 5AVBC 5GT3C 1HTAA 3H0LC 5DNMC 1TZYD 4J8UA 2JSSA 3WTPB 2Y2NA 4R8PA 3KUYD 3B6GD 4WU8A 5B31B 1P34C 1P3OD 3REHD 5JRGB 5BNVB 2F8NB 3AYWA 4KHAA 3AV2D 5AVBB 4LD9A 2UWXA 3AZND 5DNMB 3V9RB 4DRAA 4ZUXC 3H0RC 3AZLA 2CV5C 4J8VC 3MGSA 1S32B 2Y2MA 1BH9B 4Z66D 3WTPD 1P34B 3H0MC 3KXBA 5B31D 1P3MB 5JRGD 2F8ND 1B67A 5B2IA 2F8NH 5AVBD 4ZUXB 2NQBB 5DNMD 3F6TA 2CV5B 4J8VB 4H9PA 4CAYA 3NQJA 1KU5A 1S32D 5B33C 1P34D 2Y2QA 1M18C 4XZQA 3AFAA 2HUEC 1AOIA 3B0BA 3B0CW 1P3MD 3NQUB 3REJC 1R4VA 1KX5C 4JJNC 4ZUXD 2NQBD 3WKJC 1EQZA 2CV5D 4J8VD 5B33B 1P3FA 1M18B 5BT1C 2BYMA 2HUEB 2PYOA 1P3KC 4KGCC 5JA4B 3REJB 5GXQA 4WV4B 1U35C 1KX5B 1P3GA 4JJNB 3AZMC 5AVCA 3AZEC 3AZHD 1Z2CB 5E5AA 3MVDA 3WKJB 3AZFC 2YFWA 5B1MC 5B2JA 1M1AD 3WA9A 5B33D 2Y2GA 1P3KB 4KGCB 3MGPA 1M1AC 5CPIA 3AZKD 1U35B 3REJD 5B1LA 3AZMB 1M19C 3AZEB 1KX5D 3UT9A 3MNNC 1BH8A 5KDMA 3LELB 4H9RA 3WKJD 3AZFB 5B1MB 4G91C 3MGRC 3B6FD 5AV5D 4YS3C 4M6BA 5BT1D 4H9QB 1P3KD 4KGCD 4KUDA 4X23A 1M19B 3R45A 1U35D 3W97A 3VH6A 1P3LA 3KWQA 3AZMD 3MNNB 3AZED 2AROC 4ZBJC 2NZDC 5B32A 5B2IC 4G91B 1TAFB 3VH5W 3A6NC 3LELD 3MGRB 3AZFD 3X1TC 4YS3B 3MGQA 3AZJA 3W99C 3W96C 4H9NA 2Y2HA 3IP4C 1M19D 2AROB 3AN2C 4XZQC 4QLCA 5AY8C 3MNND 1H3OB 4ZBJB 2NZDB 4H9OB 5B2IB 5CPKA 3A6NB 3X1TB 3MGRD 3W99B 4YS3D 3W96B 4H9PB 5AV6A 2F2AC 5CP6A 3AV1A 5B0YC 1BFMA 3LZ0C 2DQNC 1P3FC 3AN2B 4XZQB 5AY8B 5F99C 4WNNA 2AROD 3REIC 4NE3A 2NZDD 3KFUG 1P3GC 3X1VC 1HQ3A 3A6ND 2FJ7D 3X1TD 3EG5B 4E44A 3W99D 3MVDC 5BNXA 3W96D 5B0YB 3LZ0B 2BYMB 5F99B 3AN2D 3REIB 2CWEA 5G49A 5AY8D 2Y2IA 2Y2OA 5B1LC 3REKA 3X1VB 1P3GB 1P3PA 4WU9A 4XUJA 2ZY5A 4Z2MH 3MVDB 2L5AA 2LY8A 3X1SC 5GT3B 2W8SA 5AV8A 1ZLAA 5B0YD 1P3AA 3LZ0D 3O62A 1P3BC 5F99D 3REID 2G5HC 4Z5TA 1N1JA 5BO0B 1P3GD 3KWQC 3X1VD 1BH8B 5KDMB 3X1SB 2BYKB 5B32C 4YM6A 1W2EA 3WAAC 5GT3D 3LZ1C 3W98C 3AZJC 1P3BB 5B40C 2YFVA 3P5JB 5GSUA 5B32G 3UTBA 3AZIA 3KWQB 4DRBA 5B0ZC 3UTAA 3X1UC 4QLCC 3WTPE 1F66A 3WAAB 5CPKC 3X1SD 3TU4A 3LZ1B 3W98B 2ZM5A 3AZJB 4J8XA 5B40B 3C1BA 1WWSA 1P3BD 3C1CA 5B0ZB 2HIOA 3X1UB 4QLCB 3KWQD 4AWLC 5CPKB 5GT0C 3LJAC 1KX4C 3WAAD 1TZYA 4G92C 3VH5A 3LZ1D 3KUYA 3B6GA 3W98D 3AZJD 1P3OA 1ID3C 5B40D 1P3IC 1M18D 4WNNB 3AV2A 4H9SA 5B0ZD 4AWLB 4J8UC 3X1UD 3AZNA 5GT0B 2RIQA 3LJAB 4R8PC 1KX4B 4WU8C 3REKC 1P3PC 4G92B 4JJND 2FFFB 3KSYA 4Z66A 3WTPA 3AYWC 1ID3B 1P3IB 5B31A 4LD9C 5BS7A 5JRGA 5BNVA 1ZLAC 3O62C 3AZLC 4J8UB 3MGSC 5AVBA 4R8PB 4WU8B 5GT0D 3V9RA 3LJAD 3REKB 1P3PB 1KX4D 3KXBC 3AYWB 1S32A 4KHAB 1BH9A 1P34A 1ID3D 4LD9B 4YM6C 1ZLAB 1P3ID 5B1MD 5CPJA 1P3MA 3O62B 3AZLB 3MGSB 4J8UD 5GSUC 4R8PD 4CSRA 4ZUXA 3UTBC 2NQBA 3KXBB 4WU8D 3VH6T 3AZGA 2CV5A 3AFAC 3EPJA 4J8VA 1AOIC 3UTAC 3RELA 3AYWD 4UPKA 4YM6B 1PZRA 1KX3A 2G5IC 3TU4C 4LD9D 2ZY2A 4CAYB 3NQUA 2YFVB 3NQJB 3O62D 3AZLD 5GSUB 3MGSD 1EQZC 3AZHA 5B24A 3UTBB 3AFAB 1AOIB 3KXBD 3UTAB 2HIOC 2PYOC 1M1AA 5GXQC 5B33A 5B2ID 3TU4B 2DF4C 5AVCC 3AZKA 5E5AC 4NFTA 5JA4A 3B6GC 1EQZB 4EO5C 1P3OC 2RVQC 3WA9C 5B2JC 1P3FB 3UTBD 2HIOB 2PYOB 3WKJA 4XZQD 3AFAD 1AOID 3MGPC 3UTAD 5GXQB 5CPIC 3AZNC 3B6FA 5AV5A 5AVCB 4HGAC 3UT9C 3TU4D 1P3KA 5E5AB 4J8WA 4KGCA 3B6GB 4EO5B 4Z66C 1P3OB 1EQZD 3AZMA 2YFWB 3WA9B 5B2JB 2Y2LA 1P3FD 2VQRA 3MGPB 3LELA 3AZNB 2HIOD 5CPIB 2PYOD 4KUDC 4UUZA 5B1LB 5B31G 5GXQD 4X23C 3EPLA 3W97C 4HGAB 3B0CT 5FUGA 3UT9B 4H9QA 1P3LC 5AVCD 2F8NG 4Z66B 3AL0C 5E5AD 1S32C 4H9RB 3MVDD 1M19A 2RVQD 3MNNA 5CPJC 5B2JD 3WA9D 3MGQC 1P3MC 4KUDB 3MGPD 3EPKA 3MGRA 1TAFA 4X23B 5CPID 3R45B 3W97B 4YS3A 1P3LB 5B1LD 5AV9A 2NQBC 3AZGC 3UT9D 5B32B 3RELC 1KX3C 1A7WA 5CPJB 2AROA 3MGQB 1H3OA 2NZDA 5AV6C 4H9OA 1Q9CA 5CP6C 4H9NB 5DNNA 3A6NA 3AZHC 2FJ7A 4KUDD 5C3IC 4CSRB 5B24C 3AV1C 4X23D 3X1TA 3W99A 3AZGB 3W96A 1P3LD 3W97D 3RELB
chains in the Genus database with same CATH topology
1WWIA 1KX3B 1B6WA 5B32D 5CHLB 2Y2JA 3AN2A 1HQ3C 5AY8A 5CPJD 4NE6A 5AV6B 3AZKC 3MGQD 5CP6B 3REHA 1JFIA 2JCHA 3AZHB 2Y2KA 5C3IB 5B24B 3AV1B 1F1EA 3AZGD 1M1AB 4QLCD 2IO5C 5B0YA 3B6FC 3LZ0A 3RELD 4NE5A 5AV5C 5CPKD 1HQ3B 1KX3D 5F99A 4WU9C 4XUJC 3AZKB 3REIA 4J8WC 3VH5T 5BNXB 5AV6D 5CP6D 4DQYB 3X1VA 3A1KA 5AV8C 5B24D 3AV1D 1P3AC 2F8NA 5G49B 2IO5B 3LELC 3B6FB 5GT3A 2Y2PA 5AV5B 5DNMA 4Z5TC 4WU9B 4XUJB 1HQ3D 4J8WB 5AV8B 2BG1A 5BO0A 1P3AB 3X1SA 2BYKA 4UUZB 2ZY4A 3AZIC 4Z5TB 1N1JB 5FUGB 5AV9C 3REKD 1P3PD 1P3BA 4WU9D 4XUJD 2F8NK 4J8WD 1F66C 5AV8D 1ZLAD 4WJ3C 4E45A 1P3AD 4J8XC 3C1BC 3WAAA 5DNNC 3AZIB 2FJ7C 3LZ1A 3W98A 5AV9B 3C1CC 1ULYA 4Z5TD 5B40A 1F66B 1M18A 4YM6D 5B0ZA 1TZYC 2XD5A 3X1UA 3B0DC 4J8XB 4WZSB 3KUYC 3REJA 3C1BB 2J8PA 5DNNB 1KX5A 3REHC 4JJNA 2FJ7B 5GSUD 2XD1A 1T3UA 3C1CB 3AZID 3FDDA 5AV9D 3A1IA 3AV2C 4H9SC 4Z2MG 1F66D 1TZYB 2JE5A 3B0DB 3KUYB 3VH6W 3WTPC 5GT0A 3LJAA 4J8XD 1U35A 3REHB 1KX4A 1JFIB 3C1BD 3AZEA 5B31C 5DNND 3EPHA 5BS7C 5JRGC 3C1CD 3AV2B 1ID3A 2ZY3A 3AZFA 1P3IA 5B1MA 5AVBC 5GT3C 1HTAA 3H0LC 5DNMC 1TZYD 4J8UA 2JSSA 3WTPB 2Y2NA 4R8PA 3KUYD 3B6GD 4WU8A 5B31B 1P34C 1P3OD 3REHD 5JRGB 5BNVB 2F8NB 3AYWA 4KHAA 3AV2D 5AVBB 4LD9A 2UWXA 3AZND 5DNMB 3V9RB 4DRAA 4ZUXC 3H0RC 3AZLA 2CV5C 4J8VC 3MGSA 1S32B 2Y2MA 1BH9B 4Z66D 3WTPD 1P34B 3H0MC 3KXBA 5B31D 1P3MB 5JRGD 2F8ND 1B67A 5B2IA 2F8NH 5AVBD 4ZUXB 2NQBB 5DNMD 3F6TA 2CV5B 4J8VB 4H9PA 4CAYA 3NQJA 1KU5A 1S32D 5B33C 1P34D 2Y2QA 1M18C 4XZQA 3AFAA 2HUEC 1AOIA 3B0BA 3B0CW 1P3MD 3NQUB 3REJC 1R4VA 1KX5C 4JJNC 4ZUXD 2NQBD 3WKJC 1EQZA 2CV5D 4J8VD 5B33B 1P3FA 1M18B 5BT1C 2BYMA 2HUEB 2PYOA 1P3KC 4KGCC 5JA4B 3REJB 5GXQA 4WV4B 1U35C 1KX5B 1P3GA 4JJNB 3AZMC 5AVCA 3AZEC 3AZHD 1Z2CB 5E5AA 3MVDA 3WKJB 3AZFC 2YFWA 5B1MC 5B2JA 1M1AD 3WA9A 5B33D 2Y2GA 1P3KB 4KGCB 3MGPA 1M1AC 5CPIA 3AZKD 1U35B 3REJD 5B1LA 3AZMB 1M19C 3AZEB 1KX5D 3UT9A 3MNNC 1BH8A 5KDMA 3LELB 4H9RA 3WKJD 3AZFB 5B1MB 4G91C 3MGRC 3B6FD 5AV5D 4YS3C 4M6BA 5BT1D 4H9QB 1P3KD 4KGCD 4KUDA 4X23A 1M19B 3R45A 1U35D 3W97A 3VH6A 1P3LA 3KWQA 3AZMD 3MNNB 3AZED 2AROC 4ZBJC 2NZDC 5B32A 5B2IC 4G91B 1TAFB 3VH5W 3A6NC 3LELD 3MGRB 3AZFD 3X1TC 4YS3B 3MGQA 3AZJA 3W99C 3W96C 4H9NA 2Y2HA 3IP4C 1M19D 2AROB 3AN2C 4XZQC 4QLCA 5AY8C 3MNND 1H3OB 4ZBJB 2NZDB 4H9OB 5B2IB 5CPKA 3A6NB 3X1TB 3MGRD 3W99B 4YS3D 3W96B 4H9PB 5AV6A 2F2AC 5CP6A 3AV1A 5B0YC 1BFMA 3LZ0C 2DQNC 1P3FC 3AN2B 4XZQB 5AY8B 5F99C 4WNNA 2AROD 3REIC 4NE3A 2NZDD 3KFUG 1P3GC 3X1VC 1HQ3A 3A6ND 2FJ7D 3X1TD 3EG5B 4E44A 3W99D 3MVDC 5BNXA 3W96D 5B0YB 3LZ0B 2BYMB 5F99B 3AN2D 3REIB 2CWEA 5G49A 5AY8D 2Y2IA 2Y2OA 5B1LC 3REKA 3X1VB 1P3GB 1P3PA 4WU9A 4XUJA 2ZY5A 4Z2MH 3MVDB 2L5AA 2LY8A 3X1SC 5GT3B 2W8SA 5AV8A 1ZLAA 5B0YD 1P3AA 3LZ0D 3O62A 1P3BC 5F99D 3REID 2G5HC 4Z5TA 1N1JA 5BO0B 1P3GD 3KWQC 3X1VD 1BH8B 5KDMB 3X1SB 2BYKB 5B32C 4YM6A 1W2EA 3WAAC 5GT3D 3LZ1C 3W98C 3AZJC 1P3BB 5B40C 2YFVA 3P5JB 5GSUA 5B32G 3UTBA 3AZIA 3KWQB 4DRBA 5B0ZC 3UTAA 3X1UC 4QLCC 3WTPE 1F66A 3WAAB 5CPKC 3X1SD 3TU4A 3LZ1B 3W98B 2ZM5A 3AZJB 4J8XA 5B40B 3C1BA 1WWSA 1P3BD 3C1CA 5B0ZB 2HIOA 3X1UB 4QLCB 3KWQD 4AWLC 5CPKB 5GT0C 3LJAC 1KX4C 3WAAD 1TZYA 4G92C 3VH5A 3LZ1D 3KUYA 3B6GA 3W98D 3AZJD 1P3OA 1ID3C 5B40D 1P3IC 1M18D 4WNNB 3AV2A 4H9SA 5B0ZD 4AWLB 4J8UC 3X1UD 3AZNA 5GT0B 2RIQA 3LJAB 4R8PC 1KX4B 4WU8C 3REKC 1P3PC 4G92B 4JJND 2FFFB 3KSYA 4Z66A 3WTPA 3AYWC 1ID3B 1P3IB 5B31A 4LD9C 5BS7A 5JRGA 5BNVA 1ZLAC 3O62C 3AZLC 4J8UB 3MGSC 5AVBA 4R8PB 4WU8B 5GT0D 3V9RA 3LJAD 3REKB 1P3PB 1KX4D 3KXBC 3AYWB 1S32A 4KHAB 1BH9A 1P34A 1ID3D 4LD9B 4YM6C 1ZLAB 1P3ID 5B1MD 5CPJA 1P3MA 3O62B 3AZLB 3MGSB 4J8UD 5GSUC 4R8PD 4CSRA 4ZUXA 3UTBC 2NQBA 3KXBB 4WU8D 3VH6T 3AZGA 2CV5A 3AFAC 3EPJA 4J8VA 1AOIC 3UTAC 3RELA 3AYWD 4UPKA 4YM6B 1PZRA 1KX3A 2G5IC 3TU4C 4LD9D 2ZY2A 4CAYB 3NQUA 2YFVB 3NQJB 3O62D 3AZLD 5GSUB 3MGSD 1EQZC 3AZHA 5B24A 3UTBB 3AFAB 1AOIB 3KXBD 3UTAB 2HIOC 2PYOC 1M1AA 5GXQC 5B33A 5B2ID 3TU4B 2DF4C 5AVCC 3AZKA 5E5AC 4NFTA 5JA4A 3B6GC 1EQZB 4EO5C 1P3OC 2RVQC 3WA9C 5B2JC 1P3FB 3UTBD 2HIOB 2PYOB 3WKJA 4XZQD 3AFAD 1AOID 3MGPC 3UTAD 5GXQB 5CPIC 3AZNC 3B6FA 5AV5A 5AVCB 4HGAC 3UT9C 3TU4D 1P3KA 5E5AB 4J8WA 4KGCA 3B6GB 4EO5B 4Z66C 1P3OB 1EQZD 3AZMA 2YFWB 3WA9B 5B2JB 2Y2LA 1P3FD 2VQRA 3MGPB 3LELA 3AZNB 2HIOD 5CPIB 2PYOD 4KUDC 4UUZA 5B1LB 5B31G 5GXQD 4X23C 3EPLA 3W97C 4HGAB 3B0CT 5FUGA 3UT9B 4H9QA 1P3LC 5AVCD 2F8NG 4Z66B 3AL0C 5E5AD 1S32C 4H9RB 3MVDD 1M19A 2RVQD 3MNNA 5CPJC 5B2JD 3WA9D 3MGQC 1P3MC 4KUDB 3MGPD 3EPKA 3MGRA 1TAFA 4X23B 5CPID 3R45B 3W97B 4YS3A 1P3LB 5B1LD 5AV9A 2NQBC 3AZGC 3UT9D 5B32B 3RELC 1KX3C 1A7WA 5CPJB 2AROA 3MGQB 1H3OA 2NZDA 5AV6C 4H9OA 1Q9CA 5CP6C 4H9NB 5DNNA 3A6NA 3AZHC 2FJ7A 4KUDD 5C3IC 4CSRB 5B24C 3AV1C 4X23D 3X1TA 3W99A 3AZGB 3W96A 1P3LD 3W97D 3RELB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWI A;  1KX3 B;  1B6W A;  5B32 D;  5CHL B;  3AN2 A;  1HQ3 C;  5AY8 A;  5CPJ D;  4NE6 A;  5AV6 B;  3AZK C;  3MGQ D;  5CP6 B;  3REH A;  1JFI A;  3AZH B;  5C3I B;  5B24 B;  3AV1 B;  1F1E A;  3AZG D;  1M1A B;  4QLC D;  2IO5 C;  5B0Y A;  3B6F C;  3LZ0 A;  3REL D;  4NE5 A;  5AV5 C;  5CPK D;  1HQ3 B;  1KX3 D;  5F99 A;  4WU9 C;  4XUJ C;  3AZK B;  3REI A;  4J8W C;  3VH5 T;  5BNX B;  5AV6 D;  5CP6 D;  3X1V A;  5AV8 C;  5B24 D;  3AV1 D;  1P3A C;  2F8N A;  5G49 B;  2IO5 B;  3LEL C;  3B6F B;  5GT3 A;  5AV5 B;  5DNM A;  4Z5T C;  4WU9 B;  4XUJ B;  1HQ3 D;  4J8W B;  5AV8 B;  5BO0 A;  1P3A B;  3X1S A;  2BYK A;  4UUZ B;  3AZI C;  4Z5T B;  1N1J B;  5FUG B;  5AV9 C;  3REK D;  1P3P D;  1P3B A;  4WU9 D;  4XUJ D;  2F8N K;  4J8W D;  1F66 C;  5AV8 D;  1ZLA D;  4E45 A;  1P3A D;  4J8X C;  3C1B C;  3WAA A;  5DNN C;  3AZI B;  2FJ7 C;  3LZ1 A;  3W98 A;  5AV9 B;  3C1C C;  1ULY A;  4Z5T D;  5B40 A;  1F66 B;  1M18 A;  4YM6 D;  5B0Z A;  1TZY C;  3X1U A;  3B0D C;  4J8X B;  4WZS B;  3KUY C;  3REJ A;  3C1B B;  5DNN B;  1KX5 A;  3REH C;  4JJN A;  2FJ7 B;  5GSU D;  3C1C B;  3AZI D;  5AV9 D;  3AV2 C;  4H9S C;  4Z2M G;  1F66 D;  1TZY B;  3B0D B;  3KUY B;  3VH6 W;  3WTP C;  5GT0 A;  3LJA A;  4J8X D;  1U35 A;  3REH B;  1KX4 A;  1JFI B;  3C1B D;  3AZE A;  5B31 C;  5DNN D;  5BS7 C;  5JRG C;  3C1C D;  3AV2 B;  1ID3 A;  3AZF A;  1P3I A;  5B1M A;  5AVB C;  1HTA A;  5GT3 C;  5DNM C;  1TZY D;  4J8U A;  2JSS A;  3WTP B;  4R8P A;  3KUY D;  3B6G D;  4WU8 A;  5B31 B;  1P34 C;  1P3O D;  3REH D;  5JRG B;  5BNV B;  2F8N B;  3AYW A;  4KHA A;  3AV2 D;  5AVB B;  4LD9 A;  3AZN D;  5DNM B;  3V9R B;  4DRA A;  4ZUX C;  3AZL A;  2CV5 C;  4J8V C;  3MGS A;  1S32 B;  1BH9 B;  4Z66 D;  3WTP D;  1P34 B;  3KXB A;  5B31 D;  1P3M B;  5JRG D;  2F8N D;  1B67 A;  5B2I A;  2F8N H;  5AVB D;  4ZUX B;  2NQB B;  5DNM D;  2CV5 B;  4J8V B;  4H9P A;  4CAY A;  3NQJ A;  1KU5 A;  1S32 D;  5B33 C;  1P34 D;  1M18 C;  4XZQ A;  3AFA A;  2HUE C;  1AOI A;  3B0B A;  3B0C W;  1P3M D;  3NQU B;  3REJ C;  1R4V A;  1KX5 C;  4JJN C;  4ZUX D;  2NQB D;  3WKJ C;  1EQZ A;  2CV5 D;  4J8V D;  5B33 B;  1P3F A;  1M18 B;  5BT1 C;  2BYM A;  2HUE B;  2PYO A;  1P3K C;  4KGC C;  5JA4 B;  3REJ B;  5GXQ A;  4WV4 B;  1U35 C;  1KX5 B;  1P3G A;  4JJN B;  3AZM C;  5AVC A;  3AZE C;  3AZH D;  5E5A A;  3MVD A;  3WKJ B;  3AZF C;  2YFW A;  5B1M C;  5B2J A;  1M1A D;  3WA9 A;  5B33 D;  1P3K B;  4KGC B;  3MGP A;  1M1A C;  5CPI A;  3AZK D;  1U35 B;  3REJ D;  5B1L A;  3AZM B;  1M19 C;  3AZE B;  1KX5 D;  3UT9 A;  3MNN C;  1BH8 A;  5KDM A;  3LEL B;  4H9R A;  3WKJ D;  3AZF B;  5B1M B;  4G91 C;  3MGR C;  3B6F D;  5AV5 D;  4YS3 C;  4M6B A;  5BT1 D;  4H9Q B;  1P3K D;  4KGC D;  4KUD A;  4X23 A;  1M19 B;  3R45 A;  1U35 D;  3W97 A;  3VH6 A;  1P3L A;  3KWQ A;  3AZM D;  3MNN B;  3AZE D;  2ARO C;  4ZBJ C;  2NZD C;  5B32 A;  5B2I C;  4G91 B;  1TAF B;  3VH5 W;  3A6N C;  3LEL D;  3MGR B;  3AZF D;  3X1T C;  4YS3 B;  3MGQ A;  3AZJ A;  3W99 C;  3W96 C;  4H9N A;  1M19 D;  2ARO B;  3AN2 C;  4XZQ C;  4QLC A;  5AY8 C;  3MNN D;  1H3O B;  4ZBJ B;  2NZD B;  4H9O B;  5B2I B;  5CPK A;  3A6N B;  3X1T B;  3MGR D;  3W99 B;  4YS3 D;  3W96 B;  4H9P B;  5AV6 A;  5CP6 A;  3AV1 A;  5B0Y C;  1BFM A;  3LZ0 C;  1P3F C;  3AN2 B;  4XZQ B;  5AY8 B;  5F99 C;  4WNN A;  2ARO D;  3REI C;  4NE3 A;  2NZD D;  1P3G C;  3X1V C;  1HQ3 A;  3A6N D;  2FJ7 D;  3X1T D;  4E44 A;  3W99 D;  3MVD C;  5BNX A;  3W96 D;  5B0Y B;  3LZ0 B;  2BYM B;  5F99 B;  3AN2 D;  3REI B;  2CWE A;  5G49 A;  5AY8 D;  5B1L C;  3REK A;  3X1V B;  1P3G B;  1P3P A;  4WU9 A;  4XUJ A;  4Z2M H;  3MVD B;  2L5A A;  2LY8 A;  3X1S C;  5GT3 B;  5AV8 A;  1ZLA A;  5B0Y D;  1P3A A;  3LZ0 D;  3O62 A;  1P3B C;  5F99 D;  3REI D;  4Z5T A;  1N1J A;  5BO0 B;  1P3G D;  3KWQ C;  3X1V D;  1BH8 B;  5KDM B;  3X1S B;  2BYK B;  5B32 C;  4YM6 A;  3WAA C;  5GT3 D;  3LZ1 C;  3W98 C;  3AZJ C;  1P3B B;  5B40 C;  2YFV A;  5B32 G;  5GSU A;  3UTB A;  3AZI A;  3KWQ B;  4DRB A;  5B0Z C;  3UTA A;  3X1U C;  4QLC C;  3WTP E;  1F66 A;  3WAA B;  5CPK C;  3X1S D;  3TU4 A;  3LZ1 B;  3W98 B;  3AZJ B;  4J8X A;  5B40 B;  3C1B A;  1WWS A;  1P3B D;  3C1C A;  5B0Z B;  2HIO A;  3X1U B;  4QLC B;  3KWQ D;  4AWL C;  5CPK B;  5GT0 C;  3LJA C;  1KX4 C;  3WAA D;  1TZY A;  4G92 C;  3VH5 A;  3LZ1 D;  3KUY A;  3B6G A;  3W98 D;  3AZJ D;  1P3O A;  1ID3 C;  5B40 D;  1P3I C;  1M18 D;  4WNN B;  3AV2 A;  4H9S A;  5B0Z D;  4AWL B;  4J8U C;  3X1U D;  3AZN A;  5GT0 B;  3LJA B;  4R8P C;  1KX4 B;  4WU8 C;  3REK C;  1P3P C;  4G92 B;  4JJN D;  3KSY A;  3WTP A;  4Z66 A;  3AYW C;  1ID3 B;  1P3I B;  5B31 A;  4LD9 C;  5BS7 A;  5JRG A;  5BNV A;  1ZLA C;  3O62 C;  3AZL C;  4J8U B;  3MGS C;  5AVB A;  4R8P B;  4WU8 B;  5GT0 D;  3V9R A;  3LJA D;  3REK B;  1P3P B;  1KX4 D;  3KXB C;  3AYW B;  1S32 A;  4KHA B;  1BH9 A;  1P34 A;  1ID3 D;  4LD9 B;  4YM6 C;  1ZLA B;  1P3I D;  5B1M D;  5CPJ A;  1P3M A;  3O62 B;  3AZL B;  3MGS B;  4J8U D;  5GSU C;  4R8P D;  4CSR A;  4ZUX A;  3UTB C;  2NQB A;  3KXB B;  4WU8 D;  3VH6 T;  3AZG A;  2CV5 A;  3AFA C;  4J8V A;  1AOI C;  3UTA C;  3REL A;  3AYW D;  4YM6 B;  1KX3 A;  3TU4 C;  4LD9 D;  4CAY B;  3NQU A;  2YFV B;  3NQJ B;  3O62 D;  3AZL D;  5GSU B;  3MGS D;  1EQZ C;  3AZH A;  5B24 A;  3UTB B;  3AFA B;  1AOI B;  3KXB D;  3UTA B;  2HIO C;  2PYO C;  1M1A A;  5GXQ C;  5B33 A;  5B2I D;  3TU4 B;  5AVC C;  3AZK A;  5E5A C;  4NFT A;  5JA4 A;  3B6G C;  1EQZ B;  4EO5 C;  1P3O C;  2RVQ C;  3WA9 C;  5B2J C;  1P3F B;  3UTB D;  2HIO B;  2PYO B;  3WKJ A;  4XZQ D;  3AFA D;  1AOI D;  3MGP C;  3UTA D;  5GXQ B;  5CPI C;  3AZN C;  3B6F A;  5AV5 A;  5AVC B;  4HGA C;  3UT9 C;  3TU4 D;  1P3K A;  5E5A B;  4J8W A;  4KGC A;  3B6G B;  4EO5 B;  4Z66 C;  1P3O B;  1EQZ D;  3AZM A;  2YFW B;  3WA9 B;  5B2J B;  1P3F D;  3MGP B;  3LEL A;  3AZN B;  2HIO D;  5CPI B;  2PYO D;  4KUD C;  4UUZ A;  5B1L B;  5B31 G;  5GXQ D;  4X23 C;  3W97 C;  4HGA B;  3B0C T;  5FUG A;  3UT9 B;  4H9Q A;  1P3L C;  5AVC D;  2F8N G;  4Z66 B;  5E5A D;  1S32 C;  4H9R B;  3MVD D;  1M19 A;  2RVQ D;  3MNN A;  5CPJ C;  5B2J D;  3WA9 D;  3MGQ C;  1P3M C;  4KUD B;  3MGP D;  3MGR A;  1TAF A;  4X23 B;  5CPI D;  3R45 B;  3W97 B;  4YS3 A;  1P3L B;  5B1L D;  5AV9 A;  2NQB C;  3AZG C;  3UT9 D;  5B32 B;  3REL C;  1KX3 C;  1A7W A;  5CPJ B;  2ARO A;  3MGQ B;  1H3O A;  2NZD A;  5AV6 C;  4H9O A;  1Q9C A;  5DNN A;  4H9N B;  5CP6 C;  3A6N A;  3AZH C;  2FJ7 A;  4KUD D;  5C3I C;  4CSR B;  5B24 C;  3AV1 C;  4X23 D;  3X1T A;  3W99 A;  3AZG B;  3W96 A;  1P3L D;  3W97 D;  3REL B; 
#chains in the Genus database with same CATH topology
 1WWI A;  1KX3 B;  1B6W A;  5B32 D;  5CHL B;  2Y2J A;  3AN2 A;  1HQ3 C;  5AY8 A;  5CPJ D;  4NE6 A;  5AV6 B;  3AZK C;  3MGQ D;  5CP6 B;  3REH A;  1JFI A;  2JCH A;  3AZH B;  2Y2K A;  5C3I B;  5B24 B;  3AV1 B;  1F1E A;  3AZG D;  1M1A B;  4QLC D;  2IO5 C;  5B0Y A;  3B6F C;  3LZ0 A;  3REL D;  4NE5 A;  5AV5 C;  5CPK D;  1HQ3 B;  1KX3 D;  5F99 A;  4WU9 C;  4XUJ C;  3AZK B;  3REI A;  4J8W C;  3VH5 T;  5BNX B;  5AV6 D;  5CP6 D;  4DQY B;  3X1V A;  3A1K A;  5AV8 C;  5B24 D;  3AV1 D;  1P3A C;  2F8N A;  5G49 B;  2IO5 B;  3LEL C;  3B6F B;  5GT3 A;  2Y2P A;  5AV5 B;  5DNM A;  4Z5T C;  4WU9 B;  4XUJ B;  1HQ3 D;  4J8W B;  5AV8 B;  2BG1 A;  5BO0 A;  1P3A B;  3X1S A;  2BYK A;  4UUZ B;  2ZY4 A;  3AZI C;  4Z5T B;  1N1J B;  5FUG B;  5AV9 C;  3REK D;  1P3P D;  1P3B A;  4WU9 D;  4XUJ D;  2F8N K;  4J8W D;  1F66 C;  5AV8 D;  1ZLA D;  4WJ3 C;  4E45 A;  1P3A D;  4J8X C;  3C1B C;  3WAA A;  5DNN C;  3AZI B;  2FJ7 C;  3LZ1 A;  3W98 A;  5AV9 B;  3C1C C;  1ULY A;  4Z5T D;  5B40 A;  1F66 B;  1M18 A;  4YM6 D;  5B0Z A;  1TZY C;  2XD5 A;  3X1U A;  3B0D C;  4J8X B;  4WZS B;  3KUY C;  3REJ A;  3C1B B;  2J8P A;  5DNN B;  1KX5 A;  3REH C;  4JJN A;  2FJ7 B;  5GSU D;  2XD1 A;  1T3U A;  3C1C B;  3AZI D;  3FDD A;  5AV9 D;  3A1I A;  3AV2 C;  4H9S C;  4Z2M G;  1F66 D;  1TZY B;  2JE5 A;  3B0D B;  3KUY B;  3VH6 W;  3WTP C;  5GT0 A;  3LJA A;  4J8X D;  1U35 A;  3REH B;  1KX4 A;  1JFI B;  3C1B D;  3AZE A;  5B31 C;  5DNN D;  3EPH A;  5BS7 C;  5JRG C;  3C1C D;  3AV2 B;  1ID3 A;  2ZY3 A;  3AZF A;  1P3I A;  5B1M A;  5AVB C;  5GT3 C;  1HTA A;  3H0L C;  5DNM C;  1TZY D;  4J8U A;  2JSS A;  3WTP B;  2Y2N A;  4R8P A;  3KUY D;  3B6G D;  4WU8 A;  5B31 B;  1P34 C;  1P3O D;  3REH D;  5JRG B;  5BNV B;  2F8N B;  3AYW A;  4KHA A;  3AV2 D;  5AVB B;  4LD9 A;  2UWX A;  3AZN D;  5DNM B;  3V9R B;  4DRA A;  4ZUX C;  3H0R C;  3AZL A;  2CV5 C;  4J8V C;  3MGS A;  1S32 B;  2Y2M A;  1BH9 B;  4Z66 D;  3WTP D;  1P34 B;  3H0M C;  3KXB A;  5B31 D;  1P3M B;  5JRG D;  2F8N D;  1B67 A;  5B2I A;  2F8N H;  5AVB D;  4ZUX B;  2NQB B;  5DNM D;  3F6T A;  2CV5 B;  4J8V B;  4H9P A;  4CAY A;  3NQJ A;  1KU5 A;  1S32 D;  5B33 C;  1P34 D;  2Y2Q A;  1M18 C;  4XZQ A;  3AFA A;  2HUE C;  1AOI A;  3B0B A;  3B0C W;  1P3M D;  3NQU B;  3REJ C;  1R4V A;  1KX5 C;  4JJN C;  4ZUX D;  2NQB D;  3WKJ C;  1EQZ A;  2CV5 D;  4J8V D;  5B33 B;  1P3F A;  1M18 B;  5BT1 C;  2BYM A;  2HUE B;  2PYO A;  1P3K C;  4KGC C;  5JA4 B;  3REJ B;  5GXQ A;  4WV4 B;  1U35 C;  1KX5 B;  1P3G A;  4JJN B;  3AZM C;  5AVC A;  3AZE C;  3AZH D;  1Z2C B;  5E5A A;  3MVD A;  3WKJ B;  3AZF C;  2YFW A;  5B1M C;  5B2J A;  1M1A D;  3WA9 A;  5B33 D;  2Y2G A;  1P3K B;  4KGC B;  3MGP A;  1M1A C;  5CPI A;  3AZK D;  1U35 B;  3REJ D;  5B1L A;  3AZM B;  1M19 C;  3AZE B;  1KX5 D;  3UT9 A;  3MNN C;  1BH8 A;  5KDM A;  3LEL B;  4H9R A;  3WKJ D;  3AZF B;  5B1M B;  4G91 C;  3MGR C;  3B6F D;  5AV5 D;  4YS3 C;  4M6B A;  5BT1 D;  4H9Q B;  1P3K D;  4KGC D;  4KUD A;  4X23 A;  1M19 B;  3R45 A;  1U35 D;  3W97 A;  3VH6 A;  1P3L A;  3KWQ A;  3AZM D;  3MNN B;  3AZE D;  2ARO C;  4ZBJ C;  2NZD C;  5B32 A;  5B2I C;  4G91 B;  1TAF B;  3VH5 W;  3A6N C;  3LEL D;  3MGR B;  3AZF D;  3X1T C;  4YS3 B;  3MGQ A;  3AZJ A;  3W99 C;  3W96 C;  4H9N A;  2Y2H A;  3IP4 C;  1M19 D;  2ARO B;  3AN2 C;  4XZQ C;  4QLC A;  5AY8 C;  3MNN D;  1H3O B;  4ZBJ B;  2NZD B;  4H9O B;  5B2I B;  5CPK A;  3A6N B;  3X1T B;  3MGR D;  3W99 B;  4YS3 D;  3W96 B;  4H9P B;  5AV6 A;  2F2A C;  5CP6 A;  3AV1 A;  5B0Y C;  1BFM A;  3LZ0 C;  2DQN C;  1P3F C;  3AN2 B;  4XZQ B;  5AY8 B;  5F99 C;  4WNN A;  2ARO D;  3REI C;  4NE3 A;  2NZD D;  3KFU G;  1P3G C;  3X1V C;  1HQ3 A;  3A6N D;  2FJ7 D;  3X1T D;  3EG5 B;  4E44 A;  3W99 D;  3MVD C;  5BNX A;  3W96 D;  5B0Y B;  3LZ0 B;  2BYM B;  5F99 B;  3AN2 D;  3REI B;  2CWE A;  5G49 A;  5AY8 D;  2Y2I A;  2Y2O A;  5B1L C;  3REK A;  3X1V B;  1P3G B;  1P3P A;  4WU9 A;  4XUJ A;  2ZY5 A;  4Z2M H;  3MVD B;  2L5A A;  2LY8 A;  3X1S C;  5GT3 B;  2W8S A;  5AV8 A;  1ZLA A;  5B0Y D;  1P3A A;  3LZ0 D;  3O62 A;  1P3B C;  5F99 D;  3REI D;  2G5H C;  4Z5T A;  1N1J A;  5BO0 B;  1P3G D;  3KWQ C;  3X1V D;  1BH8 B;  5KDM B;  3X1S B;  2BYK B;  5B32 C;  4YM6 A;  1W2E A;  3WAA C;  5GT3 D;  3LZ1 C;  3W98 C;  3AZJ C;  1P3B B;  5B40 C;  2YFV A;  3P5J B;  5GSU A;  5B32 G;  3UTB A;  3AZI A;  3KWQ B;  4DRB A;  5B0Z C;  3UTA A;  3X1U C;  4QLC C;  3WTP E;  1F66 A;  3WAA B;  5CPK C;  3X1S D;  3TU4 A;  3LZ1 B;  3W98 B;  2ZM5 A;  3AZJ B;  4J8X A;  5B40 B;  3C1B A;  1WWS A;  1P3B D;  3C1C A;  5B0Z B;  2HIO A;  3X1U B;  4QLC B;  3KWQ D;  4AWL C;  5CPK B;  5GT0 C;  3LJA C;  1KX4 C;  3WAA D;  1TZY A;  4G92 C;  3VH5 A;  3LZ1 D;  3KUY A;  3B6G A;  3W98 D;  3AZJ D;  1P3O A;  1ID3 C;  5B40 D;  1P3I C;  1M18 D;  4WNN B;  3AV2 A;  4H9S A;  5B0Z D;  4AWL B;  4J8U C;  3X1U D;  3AZN A;  5GT0 B;  2RIQ A;  3LJA B;  4R8P C;  1KX4 B;  4WU8 C;  3REK C;  1P3P C;  4G92 B;  4JJN D;  2FFF B;  3KSY A;  4Z66 A;  3WTP A;  3AYW C;  1ID3 B;  1P3I B;  5B31 A;  4LD9 C;  5BS7 A;  5JRG A;  5BNV A;  1ZLA C;  3O62 C;  3AZL C;  4J8U B;  3MGS C;  5AVB A;  4R8P B;  4WU8 B;  5GT0 D;  3V9R A;  3LJA D;  3REK B;  1P3P B;  1KX4 D;  3KXB C;  3AYW B;  1S32 A;  4KHA B;  1BH9 A;  1P34 A;  1ID3 D;  4LD9 B;  4YM6 C;  1ZLA B;  1P3I D;  5B1M D;  5CPJ A;  1P3M A;  3O62 B;  3AZL B;  3MGS B;  4J8U D;  5GSU C;  4R8P D;  4CSR A;  4ZUX A;  3UTB C;  2NQB A;  3KXB B;  4WU8 D;  3VH6 T;  3AZG A;  2CV5 A;  3AFA C;  3EPJ A;  4J8V A;  1AOI C;  3UTA C;  3REL A;  3AYW D;  4UPK A;  4YM6 B;  1PZR A;  1KX3 A;  2G5I C;  3TU4 C;  4LD9 D;  2ZY2 A;  4CAY B;  3NQU A;  2YFV B;  3NQJ B;  3O62 D;  3AZL D;  5GSU B;  3MGS D;  1EQZ C;  3AZH A;  5B24 A;  3UTB B;  3AFA B;  1AOI B;  3KXB D;  3UTA B;  2HIO C;  2PYO C;  1M1A A;  5GXQ C;  5B33 A;  5B2I D;  3TU4 B;  2DF4 C;  5AVC C;  3AZK A;  5E5A C;  4NFT A;  5JA4 A;  3B6G C;  1EQZ B;  4EO5 C;  1P3O C;  2RVQ C;  3WA9 C;  5B2J C;  1P3F B;  3UTB D;  2HIO B;  2PYO B;  3WKJ A;  4XZQ D;  3AFA D;  1AOI D;  3MGP C;  3UTA D;  5GXQ B;  5CPI C;  3AZN C;  3B6F A;  5AV5 A;  5AVC B;  4HGA C;  3UT9 C;  3TU4 D;  1P3K A;  5E5A B;  4J8W A;  4KGC A;  3B6G B;  4EO5 B;  4Z66 C;  1P3O B;  1EQZ D;  3AZM A;  2YFW B;  3WA9 B;  5B2J B;  2Y2L A;  1P3F D;  2VQR A;  3MGP B;  3LEL A;  3AZN B;  2HIO D;  5CPI B;  2PYO D;  4KUD C;  4UUZ A;  5B1L B;  5B31 G;  5GXQ D;  4X23 C;  3EPL A;  3W97 C;  4HGA B;  3B0C T;  5FUG A;  3UT9 B;  4H9Q A;  1P3L C;  5AVC D;  2F8N G;  4Z66 B;  3AL0 C;  5E5A D;  1S32 C;  4H9R B;  3MVD D;  1M19 A;  2RVQ D;  3MNN A;  5CPJ C;  5B2J D;  3WA9 D;  3MGQ C;  1P3M C;  4KUD B;  3MGP D;  3EPK A;  3MGR A;  1TAF A;  4X23 B;  5CPI D;  3R45 B;  3W97 B;  4YS3 A;  1P3L B;  5B1L D;  5AV9 A;  2NQB C;  3AZG C;  3UT9 D;  5B32 B;  3REL C;  1KX3 C;  1A7W A;  5CPJ B;  2ARO A;  3MGQ B;  1H3O A;  2NZD A;  5AV6 C;  4H9O A;  1Q9C A;  5CP6 C;  4H9N B;  5DNN A;  3A6N A;  3AZH C;  2FJ7 A;  4KUD D;  5C3I C;  4CSR B;  5B24 C;  3AV1 C;  4X23 D;  3X1T A;  3W99 A;  3AZG B;  3W96 A;  1P3L D;  3W97 D;  3REL B; 
#chains in the Genus database with same CATH homology
 1WWI A;  1KX3 B;  1B6W A;  5B32 D;  5CHL B;  2Y2J A;  3AN2 A;  1HQ3 C;  5AY8 A;  5CPJ D;  4NE6 A;  5AV6 B;  3AZK C;  3MGQ D;  5CP6 B;  3REH A;  1JFI A;  2JCH A;  3AZH B;  2Y2K A;  5C3I B;  5B24 B;  3AV1 B;  1F1E A;  3AZG D;  1M1A B;  4QLC D;  2IO5 C;  5B0Y A;  3B6F C;  3LZ0 A;  3REL D;  4NE5 A;  5AV5 C;  5CPK D;  1HQ3 B;  1KX3 D;  5F99 A;  4WU9 C;  4XUJ C;  3AZK B;  3REI A;  4J8W C;  3VH5 T;  5BNX B;  5AV6 D;  5CP6 D;  4DQY B;  3X1V A;  3A1K A;  5AV8 C;  5B24 D;  3AV1 D;  1P3A C;  2F8N A;  5G49 B;  2IO5 B;  3LEL C;  3B6F B;  5GT3 A;  2Y2P A;  5AV5 B;  5DNM A;  4Z5T C;  4WU9 B;  4XUJ B;  1HQ3 D;  4J8W B;  5AV8 B;  2BG1 A;  5BO0 A;  1P3A B;  3X1S A;  2BYK A;  4UUZ B;  2ZY4 A;  3AZI C;  4Z5T B;  1N1J B;  5FUG B;  5AV9 C;  3REK D;  1P3P D;  1P3B A;  4WU9 D;  4XUJ D;  2F8N K;  4J8W D;  1F66 C;  5AV8 D;  1ZLA D;  4WJ3 C;  4E45 A;  1P3A D;  4J8X C;  3C1B C;  3WAA A;  5DNN C;  3AZI B;  2FJ7 C;  3LZ1 A;  3W98 A;  5AV9 B;  3C1C C;  1ULY A;  4Z5T D;  5B40 A;  1F66 B;  1M18 A;  4YM6 D;  5B0Z A;  1TZY C;  2XD5 A;  3X1U A;  3B0D C;  4J8X B;  4WZS B;  3KUY C;  3REJ A;  3C1B B;  2J8P A;  5DNN B;  1KX5 A;  3REH C;  4JJN A;  2FJ7 B;  5GSU D;  2XD1 A;  1T3U A;  3C1C B;  3AZI D;  3FDD A;  5AV9 D;  3A1I A;  3AV2 C;  4H9S C;  4Z2M G;  1F66 D;  1TZY B;  2JE5 A;  3B0D B;  3KUY B;  3VH6 W;  3WTP C;  5GT0 A;  3LJA A;  4J8X D;  1U35 A;  3REH B;  1KX4 A;  1JFI B;  3C1B D;  3AZE A;  5B31 C;  5DNN D;  3EPH A;  5BS7 C;  5JRG C;  3C1C D;  3AV2 B;  1ID3 A;  2ZY3 A;  3AZF A;  1P3I A;  5B1M A;  5AVB C;  5GT3 C;  1HTA A;  3H0L C;  5DNM C;  1TZY D;  4J8U A;  2JSS A;  3WTP B;  2Y2N A;  4R8P A;  3KUY D;  3B6G D;  4WU8 A;  5B31 B;  1P34 C;  1P3O D;  3REH D;  5JRG B;  5BNV B;  2F8N B;  3AYW A;  4KHA A;  3AV2 D;  5AVB B;  4LD9 A;  2UWX A;  3AZN D;  5DNM B;  3V9R B;  4DRA A;  4ZUX C;  3H0R C;  3AZL A;  2CV5 C;  4J8V C;  3MGS A;  1S32 B;  2Y2M A;  1BH9 B;  4Z66 D;  3WTP D;  1P34 B;  3H0M C;  3KXB A;  5B31 D;  1P3M B;  5JRG D;  2F8N D;  1B67 A;  5B2I A;  2F8N H;  5AVB D;  4ZUX B;  2NQB B;  5DNM D;  3F6T A;  2CV5 B;  4J8V B;  4H9P A;  4CAY A;  3NQJ A;  1KU5 A;  1S32 D;  5B33 C;  1P34 D;  2Y2Q A;  1M18 C;  4XZQ A;  3AFA A;  2HUE C;  1AOI A;  3B0B A;  3B0C W;  1P3M D;  3NQU B;  3REJ C;  1R4V A;  1KX5 C;  4JJN C;  4ZUX D;  2NQB D;  3WKJ C;  1EQZ A;  2CV5 D;  4J8V D;  5B33 B;  1P3F A;  1M18 B;  5BT1 C;  2BYM A;  2HUE B;  2PYO A;  1P3K C;  4KGC C;  5JA4 B;  3REJ B;  5GXQ A;  4WV4 B;  1U35 C;  1KX5 B;  1P3G A;  4JJN B;  3AZM C;  5AVC A;  3AZE C;  3AZH D;  1Z2C B;  5E5A A;  3MVD A;  3WKJ B;  3AZF C;  2YFW A;  5B1M C;  5B2J A;  1M1A D;  3WA9 A;  5B33 D;  2Y2G A;  1P3K B;  4KGC B;  3MGP A;  1M1A C;  5CPI A;  3AZK D;  1U35 B;  3REJ D;  5B1L A;  3AZM B;  1M19 C;  3AZE B;  1KX5 D;  3UT9 A;  3MNN C;  1BH8 A;  5KDM A;  3LEL B;  4H9R A;  3WKJ D;  3AZF B;  5B1M B;  4G91 C;  3MGR C;  3B6F D;  5AV5 D;  4YS3 C;  4M6B A;  5BT1 D;  4H9Q B;  1P3K D;  4KGC D;  4KUD A;  4X23 A;  1M19 B;  3R45 A;  1U35 D;  3W97 A;  3VH6 A;  1P3L A;  3KWQ A;  3AZM D;  3MNN B;  3AZE D;  2ARO C;  4ZBJ C;  2NZD C;  5B32 A;  5B2I C;  4G91 B;  1TAF B;  3VH5 W;  3A6N C;  3LEL D;  3MGR B;  3AZF D;  3X1T C;  4YS3 B;  3MGQ A;  3AZJ A;  3W99 C;  3W96 C;  4H9N A;  2Y2H A;  3IP4 C;  1M19 D;  2ARO B;  3AN2 C;  4XZQ C;  4QLC A;  5AY8 C;  3MNN D;  1H3O B;  4ZBJ B;  2NZD B;  4H9O B;  5B2I B;  5CPK A;  3A6N B;  3X1T B;  3MGR D;  3W99 B;  4YS3 D;  3W96 B;  4H9P B;  5AV6 A;  2F2A C;  5CP6 A;  3AV1 A;  5B0Y C;  1BFM A;  3LZ0 C;  2DQN C;  1P3F C;  3AN2 B;  4XZQ B;  5AY8 B;  5F99 C;  4WNN A;  2ARO D;  3REI C;  4NE3 A;  2NZD D;  3KFU G;  1P3G C;  3X1V C;  1HQ3 A;  3A6N D;  2FJ7 D;  3X1T D;  3EG5 B;  4E44 A;  3W99 D;  3MVD C;  5BNX A;  3W96 D;  5B0Y B;  3LZ0 B;  2BYM B;  5F99 B;  3AN2 D;  3REI B;  2CWE A;  5G49 A;  5AY8 D;  2Y2I A;  2Y2O A;  5B1L C;  3REK A;  3X1V B;  1P3G B;  1P3P A;  4WU9 A;  4XUJ A;  2ZY5 A;  4Z2M H;  3MVD B;  2L5A A;  2LY8 A;  3X1S C;  5GT3 B;  2W8S A;  5AV8 A;  1ZLA A;  5B0Y D;  1P3A A;  3LZ0 D;  3O62 A;  1P3B C;  5F99 D;  3REI D;  2G5H C;  4Z5T A;  1N1J A;  5BO0 B;  1P3G D;  3KWQ C;  3X1V D;  1BH8 B;  5KDM B;  3X1S B;  2BYK B;  5B32 C;  4YM6 A;  1W2E A;  3WAA C;  5GT3 D;  3LZ1 C;  3W98 C;  3AZJ C;  1P3B B;  5B40 C;  2YFV A;  3P5J B;  5GSU A;  5B32 G;  3UTB A;  3AZI A;  3KWQ B;  4DRB A;  5B0Z C;  3UTA A;  3X1U C;  4QLC C;  3WTP E;  1F66 A;  3WAA B;  5CPK C;  3X1S D;  3TU4 A;  3LZ1 B;  3W98 B;  2ZM5 A;  3AZJ B;  4J8X A;  5B40 B;  3C1B A;  1WWS A;  1P3B D;  3C1C A;  5B0Z B;  2HIO A;  3X1U B;  4QLC B;  3KWQ D;  4AWL C;  5CPK B;  5GT0 C;  3LJA C;  1KX4 C;  3WAA D;  1TZY A;  4G92 C;  3VH5 A;  3LZ1 D;  3KUY A;  3B6G A;  3W98 D;  3AZJ D;  1P3O A;  1ID3 C;  5B40 D;  1P3I C;  1M18 D;  4WNN B;  3AV2 A;  4H9S A;  5B0Z D;  4AWL B;  4J8U C;  3X1U D;  3AZN A;  5GT0 B;  2RIQ A;  3LJA B;  4R8P C;  1KX4 B;  4WU8 C;  3REK C;  1P3P C;  4G92 B;  4JJN D;  2FFF B;  3KSY A;  4Z66 A;  3WTP A;  3AYW C;  1ID3 B;  1P3I B;  5B31 A;  4LD9 C;  5BS7 A;  5JRG A;  5BNV A;  1ZLA C;  3O62 C;  3AZL C;  4J8U B;  3MGS C;  5AVB A;  4R8P B;  4WU8 B;  5GT0 D;  3V9R A;  3LJA D;  3REK B;  1P3P B;  1KX4 D;  3KXB C;  3AYW B;  1S32 A;  4KHA B;  1BH9 A;  1P34 A;  1ID3 D;  4LD9 B;  4YM6 C;  1ZLA B;  1P3I D;  5B1M D;  5CPJ A;  1P3M A;  3O62 B;  3AZL B;  3MGS B;  4J8U D;  5GSU C;  4R8P D;  4CSR A;  4ZUX A;  3UTB C;  2NQB A;  3KXB B;  4WU8 D;  3VH6 T;  3AZG A;  2CV5 A;  3AFA C;  3EPJ A;  4J8V A;  1AOI C;  3UTA C;  3REL A;  3AYW D;  4UPK A;  4YM6 B;  1PZR A;  1KX3 A;  2G5I C;  3TU4 C;  4LD9 D;  2ZY2 A;  4CAY B;  3NQU A;  2YFV B;  3NQJ B;  3O62 D;  3AZL D;  5GSU B;  3MGS D;  1EQZ C;  3AZH A;  5B24 A;  3UTB B;  3AFA B;  1AOI B;  3KXB D;  3UTA B;  2HIO C;  2PYO C;  1M1A A;  5GXQ C;  5B33 A;  5B2I D;  3TU4 B;  2DF4 C;  5AVC C;  3AZK A;  5E5A C;  4NFT A;  5JA4 A;  3B6G C;  1EQZ B;  4EO5 C;  1P3O C;  2RVQ C;  3WA9 C;  5B2J C;  1P3F B;  3UTB D;  2HIO B;  2PYO B;  3WKJ A;  4XZQ D;  3AFA D;  1AOI D;  3MGP C;  3UTA D;  5GXQ B;  5CPI C;  3AZN C;  3B6F A;  5AV5 A;  5AVC B;  4HGA C;  3UT9 C;  3TU4 D;  1P3K A;  5E5A B;  4J8W A;  4KGC A;  3B6G B;  4EO5 B;  4Z66 C;  1P3O B;  1EQZ D;  3AZM A;  2YFW B;  3WA9 B;  5B2J B;  2Y2L A;  1P3F D;  2VQR A;  3MGP B;  3LEL A;  3AZN B;  2HIO D;  5CPI B;  2PYO D;  4KUD C;  4UUZ A;  5B1L B;  5B31 G;  5GXQ D;  4X23 C;  3EPL A;  3W97 C;  4HGA B;  3B0C T;  5FUG A;  3UT9 B;  4H9Q A;  1P3L C;  5AVC D;  2F8N G;  4Z66 B;  3AL0 C;  5E5A D;  1S32 C;  4H9R B;  3MVD D;  1M19 A;  2RVQ D;  3MNN A;  5CPJ C;  5B2J D;  3WA9 D;  3MGQ C;  1P3M C;  4KUD B;  3MGP D;  3EPK A;  3MGR A;  1TAF A;  4X23 B;  5CPI D;  3R45 B;  3W97 B;  4YS3 A;  1P3L B;  5B1L D;  5AV9 A;  2NQB C;  3AZG C;  3UT9 D;  5B32 B;  3REL C;  1KX3 C;  1A7W A;  5CPJ B;  2ARO A;  3MGQ B;  1H3O A;  2NZD A;  5AV6 C;  4H9O A;  1Q9C A;  5CP6 C;  4H9N B;  5DNN A;  3A6N A;  3AZH C;  2FJ7 A;  4KUD D;  5C3I C;  4CSR B;  5B24 C;  3AV1 C;  4X23 D;  3X1T A;  3W99 A;  3AZG B;  3W96 A;  1P3L D;  3W97 D;  3REL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...