5AVBC

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avbC00
1AOIB 1S32A 4G92C 3NQUB 5GSUB 5AV9A 1P3KD 1ZLAB 5DNMA 1S32C 5AV9C 5DNMC 2CV5A 1TZYD 4NE3A 2CV5C 3LZ1D 5C3IB 1ID3D 5B32G 3AZMB 5AV9B 2BYMB 3AZGD 4J8UA 5B2JA 4LD9B 5CPKD 4J8UC 1KU5A 4WV4B 5AV5A 2HUEC 5B2JC 3AYWA 3WAAB 2NZDD 5AV5C 3AYWC 1A7WA 4J8UB 3MNND 2HUEB 3B0BA 3C1BB 5CPIA 4HGAB 5KDMB 5CPIC 3X1TD 3LJAA 3LJAC 3KWQB 3B0DB 5F99A 5F99C 3MGPD 5CPIB 3NQJB 4YM6D 5B31D 5AVBA 3KUYA 2LY8A 3W98A 5AVBC 3KUYC 3W98C 4J8WD 4UUZA 5G49A 3AZKA 3W96A 3AZEB 3AZKC 3A6NA 5CP6D 2F8NK 1M1AB 3W98B 3A6NC 3VH5W 3AFAA 3AZND 5G49B 3AFAC 3AZKB 5BS7A 4QLCD 3X1VA 3WA9C 3UTBD 3W96B 3X1VC 5BS7C 5BNXA 3AZFB 3B6FB 3AV1C 4R8PD 3W97A 3KXBA 1N1JA 3W97C 3KXBC 3B6GA 4ZUXB 3B6GC 5B24B 5GT3A 5E5AC 1N1JB 5B1LA 4CAYB 3REHD 5B1LC 1BH8A 4H9NA 1P3OA 4WZSB 3AV2A 4Z2MH 1P3OC 5GT3B 3AV2C 3WTPE 3O62D 4KHAA 1P3OB 4Z66A 2PYOD 3C1CD 4Z66C 4Z5TB 5CPJA 3X1SA 5B0YA 3REID 5CPJC 1F66D 3X1SC 5B0YC 3AZJA 1EQZA 3AZJC 4KHAB 5B32B 1EQZC 4Z66B 1M19D 4XUJA 2NQBB 5CPJB 3X1SB 4XUJC 3WTPA 3WTPC 4KGCA 5JRGA 5DNNA 1M18D 5AY8A 4KGCC 5JRGC 4CSRB 5DNNC 4J8VA 5AY8C 2JSSA 4XZQB 4J8VC 4XUJB 4M6BA 1P3BB 3MGSA 5DNNB 4Z2MG 3X1UD 3MGSC 4J8VB 1P3PA 1P3GB 1P3PC 1Q9CA 1HQ3A 1P3AA 1HQ3C 3TU4A 1P3AC 3TU4C 3UT9A 5B2ID 5AV8B 5BNVB 3UT9C 1P3LA 3UTAD 1P3LC 3RELD 2HIOD 1U35B 5BT1C 4J8XD 4ZBJC 3MGRD 1KX4A 3MGQA 1KX4C 2F8NH 5GT0B 5B33B 3MGQC 4WU9A 4WU9C 3AN2D 3MVDA 3AZIB 3MVDC 5B0ZD 3VH6A 3LZ1A 3LZ1C 4NE5A 4WU9B 3AZMA 1P3KB 5C3IC 3AZMC 3MVDB 2BYMA 3AZGA 5FUGA 4LD9A 1TZYB 3LZ1B 4X23D 4LD9C 3REJA 3LZ0D 3WAAA 5GXQD 3REJC 3WAAC 4AWLB 1P3FD 2RVQC 3AZLD 3AZGB 5FUGB 5CPKB 4H9OA 2NZDB 5BO0B 3REJB 3C1BA 2YFWA 5KDMA 3C1BC 4HGAC 1HTAA 4NE6A 3KWQA 5AV6D 2F8NG 2IO5C 3KWQC 3B0DC 4H9OB 5GSUD 1ZLAD 5B40D 2YFWB 3X1TB 3NQJA 3WKJD 4WU8D 2IO5B 1WWIA 1KX3A 1S32D 4J8WA 4E45A 3MGPB 1KX3C 5DNMD 2CV5D 5B31B 4YM6B 4H9SA 3AZEA 5CP6A 1M1AA 3AZEC 4H9SC 1M1AC 1KX3B 4J8WB 4H9QA 1F1EA 3UTBA 4J8UD 5B2JD 5CP6B 3UTBC 3W96C 5AV5D 3AZFA 3B6FA 3AYWD 3AZFC 3B6FC 3AZNB 4H9QB 4QLCB 3UTBB 1R4VA 5CPID 4ZUXA 5B24A 3AZHA 3LJAD 4ZUXC 5B24C 3AZHC 4CAYA 5F99D 3LELA 2AROA 3V9RB 1P3IA 3LELC 2AROC 3AZHB 1P3IC 5AVBD 3KUYD 5GT3C 4KUDA 4KUDC 4H9PB 3O62A 3REHB 3LELB 2AROB 1P3IB 3AZKD 4KUDB 4Z5TA 3A6ND 3O62B 4Z5TC 1BH9B 3AFAD 5B32A 3WA9D 3X1VD 5B32C 1M19A 3C1CB 2PYOB 2NQBA 1H3OA 3AV1D 2NQBC 3REIB 1F66B 1M18A 5B31G 4CSRA 3KSYA 3KXBD 1M18C 3W97D 4XZQA 1M19B 1H3OB 4XZQC 2F8NA 3B6GD 5AVCD 3REKA 1P3BA 5E5AD 3X1UA 3REKC 1M18B 1P3BC 3X1UC 1P3GA 4YS3A 5B1LD 3VH5A 3VH6W 1P3GC 2F8NB 4YS3C 5JA4B 1P3OD 3REKB 3AV2D 3X1UB 5AV8A 4YS3B 5BNVA 5AV8C 3R45B 2HIOA 1U35A 4JJND 1U35C 4Z66D 3W99D 4WNNB 5GT0A 3X1SD 5B2IB 5B33A 5B0YD 5GT0C 3UTAB 5B33C 3AZJD 1P34A 1EQZD 3RELB 2HIOB 1P34C 1BFMA 5B1MA 3AZIA 3MGRB 5B1MC 5B0ZA 3AZIC 1P3MA 3WTPD 1P3MC 1P3KA 1P34B 1WWSA 5JRGD 4KGCD 3VH6T 1P3KC 5AY8D 5B1MB 4J8VD 1TZYA 5B0ZB 1P3MB 4X23A 1TZYC 2BYKA 4X23C 1ID3A 1ID3C 3MGSD 1P3PD 4AWLC 5CPKA 3AZGC 4X23B 2NZDA 5BO0A 2BYKB 1HQ3D 3LZ0B 5CPKC 1P3AD 1ID3B 2NZDC 1KX5D 4EO5C 3TU4D 1P3FB 3AZLB 3UT9D 1JFIA 3MNNA 1P3LD 3MNNC 2YFVB 4EO5B 5BT1D 1ULYA 3X1TA 1KX4D 3X1TC 2FJ7D 3MGQD 1JFIB 3MNNB 1AOID 4WU9D 5B40B 3MGPA 3MVDD 3MGPC 3WKJB 5B31A 4YM6A 4WU8B 5B31C 4YM6C 4G92B 3AZMD 1S32B 5AV9D 5DNMB 4J8WC 2CV5B 4LD9D 3B0CT 3REJD 5CP6C 3WAAD 2RVQD 4G91C 3AZNA 3AZNC 4QLCA 5B2JB 4QLCC 5AV5B 3AYWB 3C1BD 4G91B 4R8PA 4R8PC 3KWQD 3V9RA 4R8PB 3LJAB 4H9PA 5F99B 3REHA 1KX3D 3REHC 5AVBB 3KUYB 3AZED 1M1AD 3W98D 1BH9A 3O62C 4UUZB 3WA9A 2PYOA 3C1CA 3W96D 3A6NB 2L5AA 2PYOC 3C1CC 3AV1A 3REIA 1F66A 3AZFD 3B6FD 4DRAA 4DRBA 3REIC 1F66C 3AFAB 4H9RA 3WA9B 3X1VB 5CHLB 1M19C 3AV1B 2CWEA 5BNXB 5AVCA 4ZUXD 5AVCC 5B24D 5E5AA 3AZHD 4H9RB 3W97B 3KXBB 5JA4A 3B6GB 5AVCB 3LELD 2AROD 1P3ID 5E5AB 3VH5T 5GT3D 4KUDD 1TAFA 5B1LB 1BH8B 3R45A 4H9NB 4JJNA 3AV2B 4JJNC 3W99A 4WNNA 1TAFB 4Z5TD 3W99C 5B2IA 3UTAA 5B2IC 3UTAC 3RELA 5B32D 4JJNB 3RELC 2HIOC 1B67A 3MGRA 4J8XA 2NQBD 3W99B 4J8XC 3MGRC 5CPJD 5B0YB 3AZJB 1EQZB 3AN2A 3AN2C 4J8XB 4XZQD 4XUJD 2F8ND 5B0ZC 3WTPB 3REKD 1P3BD 5JRGB 4KGCB 5DNND 3AN2B 5AY8B 1P3GD 4YS3D 3LZ0A 5GXQA 1KX5A 3LZ0C 5GXQC 3MGSB 1KX5C 4E44A 1P3FA 3AZLA 1P3PB 1P3FC 5AV8D 3AZLC 1B6WA 1HQ3B 2YFVA 1U35D 5GXQB 1P3AB 1KX5B 3TU4B 3B0CW 2FJ7A 3UT9B 4NFTA 5AV6A 5GT0D 2FJ7C 5B33D 1AOIA 5AV6C 1P3LB 3NQUA 5GSUA 1P34D 5B40A 1AOIC 1ZLAA 5GSUC 4ZBJB 1ZLAC 5B1MD 5B40C 3AZID 1KX4B 3WKJA 4WU8A 2FJ7B 3MGQB 1P3MD 3WKJC 5AV6B 4WU8C
chains in the Genus database with same CATH superfamily
1AOIB 2ZM5A 1S32A 4G92C 3NQUB 5GSUB 5AV9A 1P3KD 1ZLAB 5DNMA 1S32C 3EPHA 5AV9C 2VQRA 5DNMC 2CV5A 1TZYD 4NE3A 2CV5C 3LZ1D 5C3IB 1ID3D 5B32G 3AZMB 5AV9B 2BYMB 3AZGD 4J8UA 5B2JA 4LD9B 5CPKD 4J8UC 1KU5A 4WV4B 5AV5A 2HUEC 5B2JC 3AYWA 3WAAB 2NZDD 5AV5C 3AYWC 1A7WA 1PZRA 4J8UB 3MNND 2HUEB 3B0BA 3C1BB 5CPIA 4HGAB 5KDMB 3A1KA 5CPIC 3X1TD 3LJAA 3LJAC 3KWQB 3B0DB 5F99A 5F99C 3MGPD 5CPIB 3NQJB 5B31D 5AVBA 4YM6D 3KUYA 2LY8A 3W98A 5AVBC 3KUYC 3W98C 4J8WD 4UUZA 5G49A 3AZKA 3W96A 3AZEB 3AZKC 3A6NA 5CP6D 2F8NK 1M1AB 3W98B 3A6NC 3VH5W 3AFAA 3AZND 5G49B 3AFAC 3AZKB 5BS7A 4QLCD 3X1VA 3WA9C 3UTBD 3W96B 3X1VC 5BS7C 5BNXA 3AZFB 3B6FB 3AV1C 4R8PD 3W97A 3KXBA 1N1JA 3W97C 3KXBC 3B6GA 2JE5A 4ZUXB 3B6GC 3AL0C 5B24B 5GT3A 5E5AC 1N1JB 3A1IA 5B1LA 4CAYB 3REHD 5B1LC 1BH8A 4H9NA 1P3OA 4WZSB 3AV2A 4Z2MH 1P3OC 5GT3B 3AV2C 3WTPE 3O62D 2XD1A 3H0LC 2DQNC 4KHAA 1P3OB 4Z66A 2ZY5A 2PYOD 3C1CD 4Z66C 4Z5TB 5CPJA 3X1SA 5B0YA 3REID 5CPJC 1F66D 3X1SC 5B0YC 3AZJA 1EQZA 3AZJC 4KHAB 5B32B 1EQZC 4Z66B 1M19D 2G5IC 4XUJA 2NQBB 5CPJB 3X1SB 4XUJC 3WTPA 3WTPC 4KGCA 5JRGA 5DNNA 1M18D 5AY8A 4KGCC 5JRGC 4CSRB 5DNNC 4J8VA 5AY8C 2JSSA 4XZQB 4J8VC 4XUJB 4M6BA 1P3BB 3MGSA 5DNNB 4Z2MG 3X1UD 3MGSC 4J8VB 1P3PA 1P3GB 1P3PC 1Q9CA 1HQ3A 1P3AA 1HQ3C 3TU4A 1P3AC 3TU4C 3UT9A 5B2ID 2G5HC 5AV8B 5BNVB 3UT9C 1P3LA 3UTAD 1P3LC 2JCHA 3RELD 2HIOD 1U35B 5BT1C 4J8XD 4ZBJC 3MGRD 1KX4A 3MGQA 1Z2CB 1KX4C 5GT0B 3EPLA 2F8NH 5B33B 3MGQC 3EPKA 4WU9A 4WU9C 3AN2D 3MVDA 3AZIB 3MVDC 5B0ZD 3VH6A 3LZ1A 3LZ1C 4NE5A 4WU9B 3AZMA 1P3KB 5C3IC 3AZMC 3MVDB 2BYMA 3AZGA 5FUGA 4LD9A 1TZYB 3LZ1B 4X23D 4LD9C 3REJA 3LZ0D 3WAAA 5GXQD 3REJC 3WAAC 4AWLB 1P3FD 2RVQC 3AZLD 3AZGB 5FUGB 2ZY4A 5CPKB 4H9OA 2NZDB 5BO0B 3REJB 3C1BA 2YFWA 5KDMA 3C1BC 2BG1A 4HGAC 3H0MC 1HTAA 4NE6A 3KWQA 5AV6D 2F8NG 2IO5C 3IP4C 3KWQC 3B0DC 4H9OB 5GSUD 1ZLAD 5B40D 2YFWB 3X1TB 3NQJA 3WKJD 4WU8D 2IO5B 1WWIA 1KX3A 1S32D 4J8WA 4E45A 3MGPB 1KX3C 5DNMD 2CV5D 5B31B 4YM6B 4H9SA 3AZEA 5CP6A 1M1AA 3AZEC 4H9SC 2Y2MA 1M1AC 1KX3B 4J8WB 4H9QA 1F1EA 3UTBA 4J8UD 5B2JD 5CP6B 3UTBC 3W96C 5AV5D 3AZFA 3B6FA 3AYWD 3AZFC 3B6FC 3AZNB 4H9QB 4QLCB 3UTBB 1R4VA 5CPID 4ZUXA 5B24A 3AZHA 3LJAD 4ZUXC 5B24C 3AZHC 3F6TA 4CAYA 5F99D 3H0RC 3LELA 2AROA 3V9RB 1P3IA 3LELC 2AROC 3AZHB 1P3IC 5AVBD 3KUYD 2Y2OA 5GT3C 4KUDA 4KUDC 4H9PB 3O62A 3REHB 2ZY2A 3LELB 2AROB 1P3IB 3AZKD 4KUDB 4Z5TA 3A6ND 3O62B 4Z5TC 1BH9B 3AFAD 5B32A 3WA9D 1T3UA 3X1VD 5B32C 1M19A 3C1CB 2PYOB 2NQBA 1H3OA 3AV1D 2NQBC 3REIB 1F66B 1M18A 5B31G 3EG5B 4CSRA 3KSYA 3KXBD 1M18C 3W97D 3FDDA 4XZQA 1M19B 1H3OB 4XZQC 2F8NA 3B6GD 5AVCD 3REKA 2XD5A 2ZY3A 1P3BA 5E5AD 3X1UA 3REKC 1M18B 1P3BC 3X1UC 1P3GA 4YS3A 5B1LD 3VH5A 3VH6W 1P3GC 2F8NB 4YS3C 5JA4B 1P3OD 3REKB 3AV2D 1W2EA 3X1UB 2Y2JA 2Y2KA 5AV8A 5BNVA 4YS3B 5AV8C 3R45B 2HIOA 1U35A 4JJND 1U35C 2Y2LA 4Z66D 3W99D 4WNNB 5GT0A 3X1SD 5B2IB 5B33A 5B0YD 5GT0C 3UTAB 5B33C 3AZJD 1P34A 1EQZD 3RELB 2HIOB 1P34C 1BFMA 5B1MA 3AZIA 3MGRB 5B1MC 5B0ZA 3AZIC 1P3MA 3WTPD 1P3MC 1P3KA 1P34B 1WWSA 5JRGD 4KGCD 3VH6T 1P3KC 5AY8D 5B1MB 4J8VD 1TZYA 5B0ZB 1P3MB 4X23A 1TZYC 2BYKA 4X23C 1ID3A 1ID3C 3MGSD 1P3PD 4AWLC 5CPKA 3AZGC 2Y2GA 4X23B 5BO0A 2BYKB 1HQ3D 3LZ0B 5CPKC 2NZDA 1P3AD 1ID3B 2NZDC 1KX5D 4EO5C 3TU4D 4DQYB 1P3FB 3AZLB 3UT9D 1JFIA 2RIQA 3MNNA 1P3LD 3MNNC 2YFVB 2W8SA 4EO5B 5BT1D 1ULYA 3X1TA 1KX4D 2F2AC 3X1TC 3MGQD 2FJ7D 1JFIB 3MNNB 1AOID 4WU9D 5B40B 3MGPA 2Y2NA 3MVDD 3MGPC 3WKJB 5B31A 4YM6A 2Y2QA 4WU8B 5B31C 4YM6C 4G92B 3AZMD 1S32B 5AV9D 5DNMB 4J8WC 2CV5B 4LD9D 3B0CT 3REJD 5CP6C 3WAAD 2RVQD 4G91C 3AZNA 3AZNC 4QLCA 5B2JB 4QLCC 5AV5B 3AYWB 3C1BD 4G91B 4R8PA 4R8PC 3KWQD 4WJ3C 3V9RA 4R8PB 3LJAB 4H9PA 5F99B 3REHA 1KX3D 3REHC 2FFFB 5AVBB 3KUYB 3AZED 1M1AD 3W98D 1BH9A 3O62C 2DF4C 4UUZB 3WA9A 2PYOA 3C1CA 3W96D 3A6NB 2L5AA 2PYOC 3C1CC 3AV1A 3P5JB 2Y2PA 3EPJA 3REIA 3AZFD 1F66A 3B6FD 4DRAA 4DRBA 3REIC 1F66C 3AFAB 4H9RA 3WA9B 3X1VB 5CHLB 1M19C 3AV1B 2CWEA 5BNXB 5AVCA 4ZUXD 5AVCC 5B24D 5E5AA 3AZHD 4H9RB 3W97B 3KXBB 5JA4A 3B6GB 5AVCB 3LELD 2AROD 1P3ID 5E5AB 3VH5T 5GT3D 4KUDD 1TAFA 5B1LB 1BH8B 2Y2HA 3R45A 4H9NB 4JJNA 3AV2B 4JJNC 3W99A 4WNNA 1TAFB 4Z5TD 3W99C 5B2IA 3UTAA 5B2IC 3UTAC 3RELA 5B32D 4JJNB 3RELC 2HIOC 1B67A 3MGRA 4J8XA 4UPKA 2NQBD 3W99B 4J8XC 3MGRC 5CPJD 5B0YB 3AZJB 1EQZB 3AN2A 3AN2C 4J8XB 4XZQD 4XUJD 2F8ND 5B0ZC 3WTPB 3REKD 1P3BD 5JRGB 4KGCB 5DNND 3AN2B 3KFUG 5AY8B 2Y2IA 1P3GD 4YS3D 3LZ0A 5GXQA 1KX5A 3LZ0C 5GXQC 3MGSB 1KX5C 4E44A 1P3FA 3AZLA 1P3PB 1P3FC 5AV8D 3AZLC 1B6WA 1HQ3B 2YFVA 1U35D 5GXQB 1P3AB 1KX5B 3TU4B 2J8PA 3B0CW 2FJ7A 3UT9B 4NFTA 5AV6A 5GT0D 2FJ7C 2UWXA 5B33D 1AOIA 5AV6C 1P3LB 3NQUA 5GSUA 1P34D 5B40A 1AOIC 1ZLAA 5GSUC 4ZBJB 1ZLAC 5B1MD 5B40C 3AZID 1KX4B 3WKJA 4WU8A 2FJ7B 3MGQB 1P3MD 3WKJC 5AV6B 4WU8C
chains in the Genus database with same CATH topology
1AOIB 2ZM5A 1S32A 4G92C 3NQUB 5GSUB 5AV9A 1P3KD 1ZLAB 5DNMA 1S32C 3EPHA 5AV9C 2VQRA 5DNMC 2CV5A 1TZYD 4NE3A 2CV5C 3LZ1D 5C3IB 1ID3D 5B32G 3AZMB 5AV9B 2BYMB 3AZGD 4J8UA 5B2JA 4LD9B 5CPKD 4J8UC 1KU5A 4WV4B 5AV5A 2HUEC 5B2JC 3AYWA 3WAAB 2NZDD 5AV5C 3AYWC 1A7WA 1PZRA 4J8UB 3MNND 2HUEB 3B0BA 3C1BB 5CPIA 4HGAB 5KDMB 3A1KA 5CPIC 3X1TD 3LJAA 3LJAC 3KWQB 3B0DB 5F99A 5F99C 3MGPD 5CPIB 3NQJB 5B31D 5AVBA 4YM6D 3KUYA 2LY8A 3W98A 5AVBC 3KUYC 3W98C 4J8WD 4UUZA 5G49A 3AZKA 3W96A 3AZEB 3AZKC 3A6NA 5CP6D 2F8NK 1M1AB 3W98B 3A6NC 3VH5W 3AFAA 3AZND 5G49B 3AFAC 3AZKB 5BS7A 4QLCD 3X1VA 3WA9C 3UTBD 3W96B 3X1VC 5BS7C 5BNXA 3AZFB 3B6FB 3AV1C 4R8PD 3W97A 3KXBA 1N1JA 3W97C 3KXBC 3B6GA 2JE5A 4ZUXB 3B6GC 3AL0C 5B24B 5GT3A 5E5AC 1N1JB 3A1IA 5B1LA 4CAYB 3REHD 5B1LC 1BH8A 4H9NA 1P3OA 4WZSB 3AV2A 4Z2MH 1P3OC 5GT3B 3AV2C 3WTPE 3O62D 2XD1A 3H0LC 2DQNC 4KHAA 1P3OB 4Z66A 2ZY5A 2PYOD 3C1CD 4Z66C 4Z5TB 5CPJA 3X1SA 5B0YA 3REID 5CPJC 1F66D 3X1SC 5B0YC 3AZJA 1EQZA 3AZJC 4KHAB 5B32B 1EQZC 4Z66B 1M19D 2G5IC 4XUJA 2NQBB 5CPJB 3X1SB 4XUJC 3WTPA 3WTPC 4KGCA 5JRGA 5DNNA 1M18D 5AY8A 4KGCC 5JRGC 4CSRB 5DNNC 4J8VA 5AY8C 2JSSA 4XZQB 4J8VC 4XUJB 4M6BA 1P3BB 3MGSA 5DNNB 4Z2MG 3X1UD 3MGSC 4J8VB 1P3PA 1P3GB 1P3PC 1Q9CA 1HQ3A 1P3AA 1HQ3C 3TU4A 1P3AC 3TU4C 3UT9A 5B2ID 2G5HC 5AV8B 5BNVB 3UT9C 1P3LA 3UTAD 1P3LC 2JCHA 3RELD 2HIOD 1U35B 5BT1C 4J8XD 4ZBJC 3MGRD 1KX4A 3MGQA 1Z2CB 1KX4C 5GT0B 3EPLA 2F8NH 5B33B 3MGQC 3EPKA 4WU9A 4WU9C 3AN2D 3MVDA 3AZIB 3MVDC 5B0ZD 3VH6A 3LZ1A 3LZ1C 4NE5A 4WU9B 3AZMA 1P3KB 5C3IC 3AZMC 3MVDB 2BYMA 3AZGA 5FUGA 4LD9A 1TZYB 3LZ1B 4X23D 4LD9C 3REJA 3LZ0D 3WAAA 5GXQD 3REJC 3WAAC 4AWLB 1P3FD 2RVQC 3AZLD 3AZGB 5FUGB 2ZY4A 5CPKB 4H9OA 2NZDB 5BO0B 3REJB 3C1BA 2YFWA 5KDMA 3C1BC 2BG1A 4HGAC 3H0MC 1HTAA 4NE6A 3KWQA 5AV6D 2F8NG 2IO5C 3IP4C 3KWQC 3B0DC 4H9OB 5GSUD 1ZLAD 5B40D 2YFWB 3X1TB 3NQJA 3WKJD 4WU8D 2IO5B 1WWIA 1KX3A 1S32D 4J8WA 4E45A 3MGPB 1KX3C 5DNMD 2CV5D 5B31B 4YM6B 4H9SA 3AZEA 5CP6A 1M1AA 3AZEC 4H9SC 2Y2MA 1M1AC 1KX3B 4J8WB 4H9QA 1F1EA 3UTBA 4J8UD 5B2JD 5CP6B 3UTBC 3W96C 5AV5D 3AZFA 3B6FA 3AYWD 3AZFC 3B6FC 3AZNB 4H9QB 4QLCB 3UTBB 1R4VA 5CPID 4ZUXA 5B24A 3AZHA 3LJAD 4ZUXC 5B24C 3AZHC 3F6TA 4CAYA 5F99D 3H0RC 3LELA 2AROA 3V9RB 1P3IA 3LELC 2AROC 3AZHB 1P3IC 5AVBD 3KUYD 2Y2OA 5GT3C 4KUDA 4KUDC 4H9PB 3O62A 3REHB 2ZY2A 3LELB 2AROB 1P3IB 3AZKD 4KUDB 4Z5TA 3A6ND 3O62B 4Z5TC 1BH9B 3AFAD 5B32A 3WA9D 1T3UA 3X1VD 5B32C 1M19A 3C1CB 2PYOB 2NQBA 1H3OA 3AV1D 2NQBC 3REIB 1F66B 1M18A 5B31G 3EG5B 4CSRA 3KSYA 3KXBD 1M18C 3W97D 3FDDA 4XZQA 1M19B 1H3OB 4XZQC 2F8NA 3B6GD 5AVCD 3REKA 2XD5A 2ZY3A 1P3BA 5E5AD 3X1UA 3REKC 1M18B 1P3BC 3X1UC 1P3GA 4YS3A 5B1LD 3VH5A 3VH6W 1P3GC 2F8NB 4YS3C 5JA4B 1P3OD 3REKB 3AV2D 1W2EA 3X1UB 2Y2JA 2Y2KA 5AV8A 5BNVA 4YS3B 5AV8C 3R45B 2HIOA 1U35A 4JJND 1U35C 2Y2LA 4Z66D 3W99D 4WNNB 5GT0A 3X1SD 5B2IB 5B33A 5B0YD 5GT0C 3UTAB 5B33C 3AZJD 1P34A 1EQZD 3RELB 2HIOB 1P34C 1BFMA 5B1MA 3AZIA 3MGRB 5B1MC 5B0ZA 3AZIC 1P3MA 3WTPD 1P3MC 1P3KA 1P34B 1WWSA 5JRGD 4KGCD 3VH6T 1P3KC 5AY8D 5B1MB 4J8VD 1TZYA 5B0ZB 1P3MB 4X23A 1TZYC 2BYKA 4X23C 1ID3A 1ID3C 3MGSD 1P3PD 4AWLC 5CPKA 3AZGC 2Y2GA 4X23B 5BO0A 2BYKB 1HQ3D 3LZ0B 5CPKC 2NZDA 1P3AD 1ID3B 2NZDC 1KX5D 4EO5C 3TU4D 4DQYB 1P3FB 3AZLB 3UT9D 1JFIA 2RIQA 3MNNA 1P3LD 3MNNC 2YFVB 2W8SA 4EO5B 5BT1D 1ULYA 3X1TA 1KX4D 2F2AC 3X1TC 3MGQD 2FJ7D 1JFIB 3MNNB 1AOID 4WU9D 5B40B 3MGPA 2Y2NA 3MVDD 3MGPC 3WKJB 5B31A 4YM6A 2Y2QA 4WU8B 5B31C 4YM6C 4G92B 3AZMD 1S32B 5AV9D 5DNMB 4J8WC 2CV5B 4LD9D 3B0CT 3REJD 5CP6C 3WAAD 2RVQD 4G91C 3AZNA 3AZNC 4QLCA 5B2JB 4QLCC 5AV5B 3AYWB 3C1BD 4G91B 4R8PA 4R8PC 3KWQD 4WJ3C 3V9RA 4R8PB 3LJAB 4H9PA 5F99B 3REHA 1KX3D 3REHC 2FFFB 5AVBB 3KUYB 3AZED 1M1AD 3W98D 1BH9A 3O62C 2DF4C 4UUZB 3WA9A 2PYOA 3C1CA 3W96D 3A6NB 2L5AA 2PYOC 3C1CC 3AV1A 3P5JB 2Y2PA 3EPJA 3REIA 3AZFD 1F66A 3B6FD 4DRAA 4DRBA 3REIC 1F66C 3AFAB 4H9RA 3WA9B 3X1VB 5CHLB 1M19C 3AV1B 2CWEA 5BNXB 5AVCA 4ZUXD 5AVCC 5B24D 5E5AA 3AZHD 4H9RB 3W97B 3KXBB 5JA4A 3B6GB 5AVCB 3LELD 2AROD 1P3ID 5E5AB 3VH5T 5GT3D 4KUDD 1TAFA 5B1LB 1BH8B 2Y2HA 3R45A 4H9NB 4JJNA 3AV2B 4JJNC 3W99A 4WNNA 1TAFB 4Z5TD 3W99C 5B2IA 3UTAA 5B2IC 3UTAC 3RELA 5B32D 4JJNB 3RELC 2HIOC 1B67A 3MGRA 4J8XA 4UPKA 2NQBD 3W99B 4J8XC 3MGRC 5CPJD 5B0YB 3AZJB 1EQZB 3AN2A 3AN2C 4J8XB 4XZQD 4XUJD 2F8ND 5B0ZC 3WTPB 3REKD 1P3BD 5JRGB 4KGCB 5DNND 3AN2B 3KFUG 5AY8B 2Y2IA 1P3GD 4YS3D 3LZ0A 5GXQA 1KX5A 3LZ0C 5GXQC 3MGSB 1KX5C 4E44A 1P3FA 3AZLA 1P3PB 1P3FC 5AV8D 3AZLC 1B6WA 1HQ3B 2YFVA 1U35D 5GXQB 1P3AB 1KX5B 3TU4B 2J8PA 3B0CW 2FJ7A 3UT9B 4NFTA 5AV6A 5GT0D 2FJ7C 2UWXA 5B33D 1AOIA 5AV6C 1P3LB 3NQUA 5GSUA 1P34D 5B40A 1AOIC 1ZLAA 5GSUC 4ZBJB 1ZLAC 5B1MD 5B40C 3AZID 1KX4B 3WKJA 4WU8A 2FJ7B 3MGQB 1P3MD 3WKJC 5AV6B 4WU8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI B;  1S32 A;  4G92 C;  3NQU B;  5GSU B;  5AV9 A;  1P3K D;  1ZLA B;  5DNM A;  1S32 C;  5AV9 C;  5DNM C;  2CV5 A;  1TZY D;  4NE3 A;  2CV5 C;  3LZ1 D;  5C3I B;  1ID3 D;  5B32 G;  3AZM B;  5AV9 B;  2BYM B;  3AZG D;  4J8U A;  5B2J A;  4LD9 B;  5CPK D;  4J8U C;  1KU5 A;  4WV4 B;  5AV5 A;  2HUE C;  5B2J C;  3AYW A;  3WAA B;  2NZD D;  5AV5 C;  3AYW C;  1A7W A;  4J8U B;  3MNN D;  2HUE B;  3B0B A;  3C1B B;  5CPI A;  4HGA B;  5KDM B;  5CPI C;  3X1T D;  3LJA A;  3LJA C;  3KWQ B;  3B0D B;  5F99 A;  5F99 C;  3MGP D;  5CPI B;  3NQJ B;  4YM6 D;  5B31 D;  5AVB A;  3KUY A;  2LY8 A;  3W98 A;  5AVB C;  3KUY C;  3W98 C;  4J8W D;  4UUZ A;  5G49 A;  3AZK A;  3W96 A;  3AZE B;  3AZK C;  3A6N A;  5CP6 D;  2F8N K;  1M1A B;  3W98 B;  3A6N C;  3VH5 W;  3AFA A;  3AZN D;  5G49 B;  3AFA C;  3AZK B;  5BS7 A;  4QLC D;  3X1V A;  3WA9 C;  3UTB D;  3W96 B;  3X1V C;  5BS7 C;  5BNX A;  3AZF B;  3B6F B;  3AV1 C;  4R8P D;  3W97 A;  3KXB A;  1N1J A;  3W97 C;  3KXB C;  3B6G A;  4ZUX B;  3B6G C;  5B24 B;  5GT3 A;  5E5A C;  1N1J B;  5B1L A;  4CAY B;  3REH D;  5B1L C;  1BH8 A;  4H9N A;  1P3O A;  4WZS B;  3AV2 A;  4Z2M H;  1P3O C;  5GT3 B;  3AV2 C;  3WTP E;  3O62 D;  4KHA A;  1P3O B;  4Z66 A;  2PYO D;  3C1C D;  4Z66 C;  4Z5T B;  5CPJ A;  3X1S A;  5B0Y A;  3REI D;  5CPJ C;  1F66 D;  3X1S C;  5B0Y C;  3AZJ A;  1EQZ A;  3AZJ C;  4KHA B;  5B32 B;  1EQZ C;  4Z66 B;  1M19 D;  4XUJ A;  2NQB B;  5CPJ B;  3X1S B;  4XUJ C;  3WTP A;  3WTP C;  4KGC A;  5JRG A;  5DNN A;  1M18 D;  5AY8 A;  4KGC C;  5JRG C;  4CSR B;  5DNN C;  4J8V A;  5AY8 C;  2JSS A;  4XZQ B;  4J8V C;  4XUJ B;  4M6B A;  1P3B B;  3MGS A;  5DNN B;  4Z2M G;  3X1U D;  3MGS C;  4J8V B;  1P3P A;  1P3G B;  1P3P C;  1Q9C A;  1HQ3 A;  1P3A A;  1HQ3 C;  3TU4 A;  1P3A C;  3TU4 C;  3UT9 A;  5B2I D;  5AV8 B;  5BNV B;  3UT9 C;  1P3L A;  3UTA D;  1P3L C;  3REL D;  2HIO D;  1U35 B;  5BT1 C;  4J8X D;  4ZBJ C;  3MGR D;  1KX4 A;  3MGQ A;  1KX4 C;  2F8N H;  5GT0 B;  5B33 B;  3MGQ C;  4WU9 A;  4WU9 C;  3AN2 D;  3MVD A;  3AZI B;  3MVD C;  5B0Z D;  3VH6 A;  3LZ1 A;  3LZ1 C;  4NE5 A;  4WU9 B;  3AZM A;  1P3K B;  5C3I C;  3AZM C;  3MVD B;  2BYM A;  3AZG A;  5FUG A;  4LD9 A;  1TZY B;  3LZ1 B;  4X23 D;  4LD9 C;  3REJ A;  3LZ0 D;  3WAA A;  5GXQ D;  3REJ C;  3WAA C;  4AWL B;  1P3F D;  2RVQ C;  3AZL D;  3AZG B;  5FUG B;  5CPK B;  4H9O A;  2NZD B;  5BO0 B;  3REJ B;  3C1B A;  2YFW A;  5KDM A;  3C1B C;  4HGA C;  1HTA A;  4NE6 A;  3KWQ A;  5AV6 D;  2F8N G;  2IO5 C;  3KWQ C;  3B0D C;  4H9O B;  5GSU D;  1ZLA D;  5B40 D;  2YFW B;  3X1T B;  3NQJ A;  3WKJ D;  4WU8 D;  2IO5 B;  1WWI A;  1KX3 A;  1S32 D;  4J8W A;  4E45 A;  3MGP B;  1KX3 C;  5DNM D;  2CV5 D;  5B31 B;  4YM6 B;  4H9S A;  3AZE A;  5CP6 A;  1M1A A;  3AZE C;  4H9S C;  1M1A C;  1KX3 B;  4J8W B;  4H9Q A;  1F1E A;  3UTB A;  4J8U D;  5B2J D;  5CP6 B;  3UTB C;  3W96 C;  5AV5 D;  3AZF A;  3B6F A;  3AYW D;  3AZF C;  3B6F C;  3AZN B;  4H9Q B;  4QLC B;  3UTB B;  1R4V A;  5CPI D;  4ZUX A;  5B24 A;  3AZH A;  3LJA D;  4ZUX C;  5B24 C;  3AZH C;  4CAY A;  5F99 D;  3LEL A;  2ARO A;  3V9R B;  1P3I A;  3LEL C;  2ARO C;  3AZH B;  1P3I C;  5AVB D;  3KUY D;  5GT3 C;  4KUD A;  4KUD C;  4H9P B;  3O62 A;  3REH B;  3LEL B;  2ARO B;  1P3I B;  3AZK D;  4KUD B;  4Z5T A;  3A6N D;  3O62 B;  4Z5T C;  1BH9 B;  3AFA D;  5B32 A;  3WA9 D;  3X1V D;  5B32 C;  1M19 A;  3C1C B;  2PYO B;  2NQB A;  1H3O A;  3AV1 D;  2NQB C;  3REI B;  1F66 B;  1M18 A;  5B31 G;  4CSR A;  3KSY A;  3KXB D;  1M18 C;  3W97 D;  4XZQ A;  1M19 B;  1H3O B;  4XZQ C;  2F8N A;  3B6G D;  5AVC D;  3REK A;  1P3B A;  5E5A D;  3X1U A;  3REK C;  1M18 B;  1P3B C;  3X1U C;  1P3G A;  4YS3 A;  5B1L D;  3VH5 A;  3VH6 W;  1P3G C;  2F8N B;  4YS3 C;  5JA4 B;  1P3O D;  3REK B;  3AV2 D;  3X1U B;  5AV8 A;  4YS3 B;  5BNV A;  5AV8 C;  3R45 B;  2HIO A;  1U35 A;  4JJN D;  1U35 C;  4Z66 D;  3W99 D;  4WNN B;  5GT0 A;  3X1S D;  5B2I B;  5B33 A;  5B0Y D;  5GT0 C;  3UTA B;  5B33 C;  3AZJ D;  1P34 A;  1EQZ D;  3REL B;  2HIO B;  1P34 C;  1BFM A;  5B1M A;  3AZI A;  3MGR B;  5B1M C;  5B0Z A;  3AZI C;  1P3M A;  3WTP D;  1P3M C;  1P3K A;  1P34 B;  1WWS A;  5JRG D;  4KGC D;  3VH6 T;  1P3K C;  5AY8 D;  5B1M B;  4J8V D;  1TZY A;  5B0Z B;  1P3M B;  4X23 A;  1TZY C;  2BYK A;  4X23 C;  1ID3 A;  1ID3 C;  3MGS D;  1P3P D;  4AWL C;  5CPK A;  3AZG C;  4X23 B;  2NZD A;  5BO0 A;  2BYK B;  1HQ3 D;  3LZ0 B;  5CPK C;  1P3A D;  1ID3 B;  2NZD C;  1KX5 D;  4EO5 C;  3TU4 D;  1P3F B;  3AZL B;  3UT9 D;  1JFI A;  3MNN A;  1P3L D;  3MNN C;  2YFV B;  4EO5 B;  5BT1 D;  1ULY A;  3X1T A;  1KX4 D;  3X1T C;  2FJ7 D;  3MGQ D;  1JFI B;  3MNN B;  1AOI D;  4WU9 D;  5B40 B;  3MGP A;  3MVD D;  3MGP C;  3WKJ B;  5B31 A;  4YM6 A;  4WU8 B;  5B31 C;  4YM6 C;  4G92 B;  3AZM D;  1S32 B;  5AV9 D;  5DNM B;  4J8W C;  2CV5 B;  4LD9 D;  3B0C T;  3REJ D;  5CP6 C;  3WAA D;  2RVQ D;  4G91 C;  3AZN A;  3AZN C;  4QLC A;  5B2J B;  4QLC C;  5AV5 B;  3AYW B;  3C1B D;  4G91 B;  4R8P A;  4R8P C;  3KWQ D;  3V9R A;  4R8P B;  3LJA B;  4H9P A;  5F99 B;  3REH A;  1KX3 D;  3REH C;  5AVB B;  3KUY B;  3AZE D;  1M1A D;  3W98 D;  1BH9 A;  3O62 C;  4UUZ B;  3WA9 A;  2PYO A;  3C1C A;  3W96 D;  3A6N B;  2L5A A;  2PYO C;  3C1C C;  3AV1 A;  3REI A;  1F66 A;  3AZF D;  3B6F D;  4DRA A;  4DRB A;  3REI C;  1F66 C;  3AFA B;  4H9R A;  3WA9 B;  3X1V B;  5CHL B;  1M19 C;  3AV1 B;  2CWE A;  5BNX B;  5AVC A;  4ZUX D;  5AVC C;  5B24 D;  5E5A A;  3AZH D;  4H9R B;  3W97 B;  3KXB B;  5JA4 A;  3B6G B;  5AVC B;  3LEL D;  2ARO D;  1P3I D;  5E5A B;  3VH5 T;  5GT3 D;  4KUD D;  1TAF A;  5B1L B;  1BH8 B;  3R45 A;  4H9N B;  4JJN A;  3AV2 B;  4JJN C;  3W99 A;  4WNN A;  1TAF B;  4Z5T D;  3W99 C;  5B2I A;  3UTA A;  5B2I C;  3UTA C;  3REL A;  5B32 D;  4JJN B;  3REL C;  2HIO C;  1B67 A;  3MGR A;  4J8X A;  2NQB D;  3W99 B;  4J8X C;  3MGR C;  5CPJ D;  5B0Y B;  3AZJ B;  1EQZ B;  3AN2 A;  3AN2 C;  4J8X B;  4XZQ D;  4XUJ D;  2F8N D;  5B0Z C;  3WTP B;  3REK D;  1P3B D;  5JRG B;  4KGC B;  5DNN D;  3AN2 B;  5AY8 B;  1P3G D;  4YS3 D;  3LZ0 A;  5GXQ A;  1KX5 A;  3LZ0 C;  5GXQ C;  3MGS B;  1KX5 C;  4E44 A;  1P3F A;  3AZL A;  1P3P B;  1P3F C;  5AV8 D;  3AZL C;  1B6W A;  1HQ3 B;  2YFV A;  1U35 D;  5GXQ B;  1P3A B;  1KX5 B;  3TU4 B;  3B0C W;  2FJ7 A;  3UT9 B;  4NFT A;  5AV6 A;  5GT0 D;  2FJ7 C;  5B33 D;  1AOI A;  5AV6 C;  1P3L B;  3NQU A;  5GSU A;  1P34 D;  5B40 A;  1AOI C;  1ZLA A;  5GSU C;  4ZBJ B;  1ZLA C;  5B1M D;  5B40 C;  3AZI D;  1KX4 B;  3WKJ A;  4WU8 A;  2FJ7 B;  3MGQ B;  1P3M D;  3WKJ C;  5AV6 B;  4WU8 C; 
#chains in the Genus database with same CATH topology
 1AOI B;  2ZM5 A;  1S32 A;  4G92 C;  3NQU B;  5GSU B;  5AV9 A;  1P3K D;  1ZLA B;  5DNM A;  1S32 C;  3EPH A;  5AV9 C;  2VQR A;  5DNM C;  2CV5 A;  1TZY D;  4NE3 A;  2CV5 C;  3LZ1 D;  5C3I B;  1ID3 D;  5B32 G;  3AZM B;  5AV9 B;  2BYM B;  3AZG D;  4J8U A;  5B2J A;  4LD9 B;  5CPK D;  4J8U C;  1KU5 A;  4WV4 B;  5AV5 A;  2HUE C;  5B2J C;  3AYW A;  3WAA B;  2NZD D;  5AV5 C;  3AYW C;  1A7W A;  1PZR A;  4J8U B;  3MNN D;  2HUE B;  3B0B A;  3C1B B;  5CPI A;  4HGA B;  5KDM B;  3A1K A;  5CPI C;  3X1T D;  3LJA A;  3LJA C;  3KWQ B;  3B0D B;  5F99 A;  5F99 C;  3MGP D;  5CPI B;  3NQJ B;  5B31 D;  5AVB A;  4YM6 D;  3KUY A;  2LY8 A;  3W98 A;  5AVB C;  3KUY C;  3W98 C;  4J8W D;  4UUZ A;  5G49 A;  3AZK A;  3W96 A;  3AZE B;  3AZK C;  3A6N A;  5CP6 D;  2F8N K;  1M1A B;  3W98 B;  3A6N C;  3VH5 W;  3AFA A;  3AZN D;  5G49 B;  3AFA C;  3AZK B;  5BS7 A;  4QLC D;  3X1V A;  3WA9 C;  3UTB D;  3W96 B;  3X1V C;  5BS7 C;  5BNX A;  3AZF B;  3B6F B;  3AV1 C;  4R8P D;  3W97 A;  3KXB A;  1N1J A;  3W97 C;  3KXB C;  3B6G A;  2JE5 A;  4ZUX B;  3B6G C;  3AL0 C;  5B24 B;  5GT3 A;  5E5A C;  1N1J B;  3A1I A;  5B1L A;  4CAY B;  3REH D;  5B1L C;  1BH8 A;  4H9N A;  1P3O A;  4WZS B;  3AV2 A;  4Z2M H;  1P3O C;  5GT3 B;  3AV2 C;  3WTP E;  3O62 D;  2XD1 A;  3H0L C;  2DQN C;  4KHA A;  1P3O B;  4Z66 A;  2ZY5 A;  2PYO D;  3C1C D;  4Z66 C;  4Z5T B;  5CPJ A;  3X1S A;  5B0Y A;  3REI D;  5CPJ C;  1F66 D;  3X1S C;  5B0Y C;  3AZJ A;  1EQZ A;  3AZJ C;  4KHA B;  5B32 B;  1EQZ C;  4Z66 B;  1M19 D;  2G5I C;  4XUJ A;  2NQB B;  5CPJ B;  3X1S B;  4XUJ C;  3WTP A;  3WTP C;  4KGC A;  5JRG A;  5DNN A;  1M18 D;  5AY8 A;  4KGC C;  5JRG C;  4CSR B;  5DNN C;  4J8V A;  5AY8 C;  2JSS A;  4XZQ B;  4J8V C;  4XUJ B;  4M6B A;  1P3B B;  3MGS A;  5DNN B;  4Z2M G;  3X1U D;  3MGS C;  4J8V B;  1P3P A;  1P3G B;  1P3P C;  1Q9C A;  1HQ3 A;  1P3A A;  1HQ3 C;  3TU4 A;  1P3A C;  3TU4 C;  3UT9 A;  5B2I D;  2G5H C;  5AV8 B;  5BNV B;  3UT9 C;  1P3L A;  3UTA D;  1P3L C;  2JCH A;  3REL D;  2HIO D;  1U35 B;  5BT1 C;  4J8X D;  4ZBJ C;  3MGR D;  1KX4 A;  3MGQ A;  1Z2C B;  1KX4 C;  5GT0 B;  3EPL A;  2F8N H;  5B33 B;  3MGQ C;  3EPK A;  4WU9 A;  4WU9 C;  3AN2 D;  3MVD A;  3AZI B;  3MVD C;  5B0Z D;  3VH6 A;  3LZ1 A;  3LZ1 C;  4NE5 A;  4WU9 B;  3AZM A;  1P3K B;  5C3I C;  3AZM C;  3MVD B;  2BYM A;  3AZG A;  5FUG A;  4LD9 A;  1TZY B;  3LZ1 B;  4X23 D;  4LD9 C;  3REJ A;  3LZ0 D;  3WAA A;  5GXQ D;  3REJ C;  3WAA C;  4AWL B;  1P3F D;  2RVQ C;  3AZL D;  3AZG B;  5FUG B;  2ZY4 A;  5CPK B;  4H9O A;  2NZD B;  5BO0 B;  3REJ B;  3C1B A;  2YFW A;  5KDM A;  3C1B C;  2BG1 A;  4HGA C;  3H0M C;  1HTA A;  4NE6 A;  3KWQ A;  5AV6 D;  2F8N G;  2IO5 C;  3IP4 C;  3KWQ C;  3B0D C;  4H9O B;  5GSU D;  1ZLA D;  5B40 D;  2YFW B;  3X1T B;  3NQJ A;  3WKJ D;  4WU8 D;  2IO5 B;  1WWI A;  1KX3 A;  1S32 D;  4J8W A;  4E45 A;  3MGP B;  1KX3 C;  5DNM D;  2CV5 D;  5B31 B;  4YM6 B;  4H9S A;  3AZE A;  5CP6 A;  1M1A A;  3AZE C;  4H9S C;  2Y2M A;  1M1A C;  1KX3 B;  4J8W B;  4H9Q A;  1F1E A;  3UTB A;  4J8U D;  5B2J D;  5CP6 B;  3UTB C;  3W96 C;  5AV5 D;  3AZF A;  3B6F A;  3AYW D;  3AZF C;  3B6F C;  3AZN B;  4H9Q B;  4QLC B;  3UTB B;  1R4V A;  5CPI D;  4ZUX A;  5B24 A;  3AZH A;  3LJA D;  4ZUX C;  5B24 C;  3AZH C;  3F6T A;  4CAY A;  5F99 D;  3H0R C;  3LEL A;  2ARO A;  3V9R B;  1P3I A;  3LEL C;  2ARO C;  3AZH B;  1P3I C;  5AVB D;  3KUY D;  2Y2O A;  5GT3 C;  4KUD A;  4KUD C;  4H9P B;  3O62 A;  3REH B;  2ZY2 A;  3LEL B;  2ARO B;  1P3I B;  3AZK D;  4KUD B;  4Z5T A;  3A6N D;  3O62 B;  4Z5T C;  1BH9 B;  3AFA D;  5B32 A;  3WA9 D;  1T3U A;  3X1V D;  5B32 C;  1M19 A;  3C1C B;  2PYO B;  2NQB A;  1H3O A;  3AV1 D;  2NQB C;  3REI B;  1F66 B;  1M18 A;  5B31 G;  3EG5 B;  4CSR A;  3KSY A;  3KXB D;  1M18 C;  3W97 D;  3FDD A;  4XZQ A;  1M19 B;  1H3O B;  4XZQ C;  2F8N A;  3B6G D;  5AVC D;  3REK A;  2XD5 A;  2ZY3 A;  1P3B A;  5E5A D;  3X1U A;  3REK C;  1M18 B;  1P3B C;  3X1U C;  1P3G A;  4YS3 A;  5B1L D;  3VH5 A;  3VH6 W;  1P3G C;  2F8N B;  4YS3 C;  5JA4 B;  1P3O D;  3REK B;  3AV2 D;  1W2E A;  3X1U B;  2Y2J A;  2Y2K A;  5AV8 A;  5BNV A;  4YS3 B;  5AV8 C;  3R45 B;  2HIO A;  1U35 A;  4JJN D;  1U35 C;  2Y2L A;  4Z66 D;  3W99 D;  4WNN B;  5GT0 A;  3X1S D;  5B2I B;  5B33 A;  5B0Y D;  5GT0 C;  3UTA B;  5B33 C;  3AZJ D;  1P34 A;  1EQZ D;  3REL B;  2HIO B;  1P34 C;  1BFM A;  5B1M A;  3AZI A;  3MGR B;  5B1M C;  5B0Z A;  3AZI C;  1P3M A;  3WTP D;  1P3M C;  1P3K A;  1P34 B;  1WWS A;  5JRG D;  4KGC D;  3VH6 T;  1P3K C;  5AY8 D;  5B1M B;  4J8V D;  1TZY A;  5B0Z B;  1P3M B;  4X23 A;  1TZY C;  2BYK A;  4X23 C;  1ID3 A;  1ID3 C;  3MGS D;  1P3P D;  4AWL C;  5CPK A;  3AZG C;  2Y2G A;  4X23 B;  5BO0 A;  2BYK B;  1HQ3 D;  3LZ0 B;  5CPK C;  2NZD A;  1P3A D;  1ID3 B;  2NZD C;  1KX5 D;  4EO5 C;  3TU4 D;  4DQY B;  1P3F B;  3AZL B;  3UT9 D;  1JFI A;  2RIQ A;  3MNN A;  1P3L D;  3MNN C;  2YFV B;  2W8S A;  4EO5 B;  5BT1 D;  1ULY A;  3X1T A;  1KX4 D;  2F2A C;  3X1T C;  3MGQ D;  2FJ7 D;  1JFI B;  3MNN B;  1AOI D;  4WU9 D;  5B40 B;  3MGP A;  2Y2N A;  3MVD D;  3MGP C;  3WKJ B;  5B31 A;  4YM6 A;  2Y2Q A;  4WU8 B;  5B31 C;  4YM6 C;  4G92 B;  3AZM D;  1S32 B;  5AV9 D;  5DNM B;  4J8W C;  2CV5 B;  4LD9 D;  3B0C T;  3REJ D;  5CP6 C;  3WAA D;  2RVQ D;  4G91 C;  3AZN A;  3AZN C;  4QLC A;  5B2J B;  4QLC C;  5AV5 B;  3AYW B;  3C1B D;  4G91 B;  4R8P A;  4R8P C;  3KWQ D;  4WJ3 C;  3V9R A;  4R8P B;  3LJA B;  4H9P A;  5F99 B;  3REH A;  1KX3 D;  3REH C;  2FFF B;  5AVB B;  3KUY B;  3AZE D;  1M1A D;  3W98 D;  1BH9 A;  3O62 C;  2DF4 C;  4UUZ B;  3WA9 A;  2PYO A;  3C1C A;  3W96 D;  3A6N B;  2L5A A;  2PYO C;  3C1C C;  3AV1 A;  3P5J B;  2Y2P A;  3EPJ A;  3REI A;  3AZF D;  1F66 A;  3B6F D;  4DRA A;  4DRB A;  3REI C;  1F66 C;  3AFA B;  4H9R A;  3WA9 B;  3X1V B;  5CHL B;  1M19 C;  3AV1 B;  2CWE A;  5BNX B;  5AVC A;  4ZUX D;  5AVC C;  5B24 D;  5E5A A;  3AZH D;  4H9R B;  3W97 B;  3KXB B;  5JA4 A;  3B6G B;  5AVC B;  3LEL D;  2ARO D;  1P3I D;  5E5A B;  3VH5 T;  5GT3 D;  4KUD D;  1TAF A;  5B1L B;  1BH8 B;  2Y2H A;  3R45 A;  4H9N B;  4JJN A;  3AV2 B;  4JJN C;  3W99 A;  4WNN A;  1TAF B;  4Z5T D;  3W99 C;  5B2I A;  3UTA A;  5B2I C;  3UTA C;  3REL A;  5B32 D;  4JJN B;  3REL C;  2HIO C;  1B67 A;  3MGR A;  4J8X A;  4UPK A;  2NQB D;  3W99 B;  4J8X C;  3MGR C;  5CPJ D;  5B0Y B;  3AZJ B;  1EQZ B;  3AN2 A;  3AN2 C;  4J8X B;  4XZQ D;  4XUJ D;  2F8N D;  5B0Z C;  3WTP B;  3REK D;  1P3B D;  5JRG B;  4KGC B;  5DNN D;  3AN2 B;  3KFU G;  5AY8 B;  2Y2I A;  1P3G D;  4YS3 D;  3LZ0 A;  5GXQ A;  1KX5 A;  3LZ0 C;  5GXQ C;  3MGS B;  1KX5 C;  4E44 A;  1P3F A;  3AZL A;  1P3P B;  1P3F C;  5AV8 D;  3AZL C;  1B6W A;  1HQ3 B;  2YFV A;  1U35 D;  5GXQ B;  1P3A B;  1KX5 B;  3TU4 B;  2J8P A;  3B0C W;  2FJ7 A;  3UT9 B;  4NFT A;  5AV6 A;  5GT0 D;  2FJ7 C;  2UWX A;  5B33 D;  1AOI A;  5AV6 C;  1P3L B;  3NQU A;  5GSU A;  1P34 D;  5B40 A;  1AOI C;  1ZLA A;  5GSU C;  4ZBJ B;  1ZLA C;  5B1M D;  5B40 C;  3AZI D;  1KX4 B;  3WKJ A;  4WU8 A;  2FJ7 B;  3MGQ B;  1P3M D;  3WKJ C;  5AV6 B;  4WU8 C; 
#chains in the Genus database with same CATH homology
 1AOI B;  2ZM5 A;  1S32 A;  4G92 C;  3NQU B;  5GSU B;  5AV9 A;  1P3K D;  1ZLA B;  5DNM A;  1S32 C;  3EPH A;  5AV9 C;  2VQR A;  5DNM C;  2CV5 A;  1TZY D;  4NE3 A;  2CV5 C;  3LZ1 D;  5C3I B;  1ID3 D;  5B32 G;  3AZM B;  5AV9 B;  2BYM B;  3AZG D;  4J8U A;  5B2J A;  4LD9 B;  5CPK D;  4J8U C;  1KU5 A;  4WV4 B;  5AV5 A;  2HUE C;  5B2J C;  3AYW A;  3WAA B;  2NZD D;  5AV5 C;  3AYW C;  1A7W A;  1PZR A;  4J8U B;  3MNN D;  2HUE B;  3B0B A;  3C1B B;  5CPI A;  4HGA B;  5KDM B;  3A1K A;  5CPI C;  3X1T D;  3LJA A;  3LJA C;  3KWQ B;  3B0D B;  5F99 A;  5F99 C;  3MGP D;  5CPI B;  3NQJ B;  5B31 D;  5AVB A;  4YM6 D;  3KUY A;  2LY8 A;  3W98 A;  5AVB C;  3KUY C;  3W98 C;  4J8W D;  4UUZ A;  5G49 A;  3AZK A;  3W96 A;  3AZE B;  3AZK C;  3A6N A;  5CP6 D;  2F8N K;  1M1A B;  3W98 B;  3A6N C;  3VH5 W;  3AFA A;  3AZN D;  5G49 B;  3AFA C;  3AZK B;  5BS7 A;  4QLC D;  3X1V A;  3WA9 C;  3UTB D;  3W96 B;  3X1V C;  5BS7 C;  5BNX A;  3AZF B;  3B6F B;  3AV1 C;  4R8P D;  3W97 A;  3KXB A;  1N1J A;  3W97 C;  3KXB C;  3B6G A;  2JE5 A;  4ZUX B;  3B6G C;  3AL0 C;  5B24 B;  5GT3 A;  5E5A C;  1N1J B;  3A1I A;  5B1L A;  4CAY B;  3REH D;  5B1L C;  1BH8 A;  4H9N A;  1P3O A;  4WZS B;  3AV2 A;  4Z2M H;  1P3O C;  5GT3 B;  3AV2 C;  3WTP E;  3O62 D;  2XD1 A;  3H0L C;  2DQN C;  4KHA A;  1P3O B;  4Z66 A;  2ZY5 A;  2PYO D;  3C1C D;  4Z66 C;  4Z5T B;  5CPJ A;  3X1S A;  5B0Y A;  3REI D;  5CPJ C;  1F66 D;  3X1S C;  5B0Y C;  3AZJ A;  1EQZ A;  3AZJ C;  4KHA B;  5B32 B;  1EQZ C;  4Z66 B;  1M19 D;  2G5I C;  4XUJ A;  2NQB B;  5CPJ B;  3X1S B;  4XUJ C;  3WTP A;  3WTP C;  4KGC A;  5JRG A;  5DNN A;  1M18 D;  5AY8 A;  4KGC C;  5JRG C;  4CSR B;  5DNN C;  4J8V A;  5AY8 C;  2JSS A;  4XZQ B;  4J8V C;  4XUJ B;  4M6B A;  1P3B B;  3MGS A;  5DNN B;  4Z2M G;  3X1U D;  3MGS C;  4J8V B;  1P3P A;  1P3G B;  1P3P C;  1Q9C A;  1HQ3 A;  1P3A A;  1HQ3 C;  3TU4 A;  1P3A C;  3TU4 C;  3UT9 A;  5B2I D;  2G5H C;  5AV8 B;  5BNV B;  3UT9 C;  1P3L A;  3UTA D;  1P3L C;  2JCH A;  3REL D;  2HIO D;  1U35 B;  5BT1 C;  4J8X D;  4ZBJ C;  3MGR D;  1KX4 A;  3MGQ A;  1Z2C B;  1KX4 C;  5GT0 B;  3EPL A;  2F8N H;  5B33 B;  3MGQ C;  3EPK A;  4WU9 A;  4WU9 C;  3AN2 D;  3MVD A;  3AZI B;  3MVD C;  5B0Z D;  3VH6 A;  3LZ1 A;  3LZ1 C;  4NE5 A;  4WU9 B;  3AZM A;  1P3K B;  5C3I C;  3AZM C;  3MVD B;  2BYM A;  3AZG A;  5FUG A;  4LD9 A;  1TZY B;  3LZ1 B;  4X23 D;  4LD9 C;  3REJ A;  3LZ0 D;  3WAA A;  5GXQ D;  3REJ C;  3WAA C;  4AWL B;  1P3F D;  2RVQ C;  3AZL D;  3AZG B;  5FUG B;  2ZY4 A;  5CPK B;  4H9O A;  2NZD B;  5BO0 B;  3REJ B;  3C1B A;  2YFW A;  5KDM A;  3C1B C;  2BG1 A;  4HGA C;  3H0M C;  1HTA A;  4NE6 A;  3KWQ A;  5AV6 D;  2F8N G;  2IO5 C;  3IP4 C;  3KWQ C;  3B0D C;  4H9O B;  5GSU D;  1ZLA D;  5B40 D;  2YFW B;  3X1T B;  3NQJ A;  3WKJ D;  4WU8 D;  2IO5 B;  1WWI A;  1KX3 A;  1S32 D;  4J8W A;  4E45 A;  3MGP B;  1KX3 C;  5DNM D;  2CV5 D;  5B31 B;  4YM6 B;  4H9S A;  3AZE A;  5CP6 A;  1M1A A;  3AZE C;  4H9S C;  2Y2M A;  1M1A C;  1KX3 B;  4J8W B;  4H9Q A;  1F1E A;  3UTB A;  4J8U D;  5B2J D;  5CP6 B;  3UTB C;  3W96 C;  5AV5 D;  3AZF A;  3B6F A;  3AYW D;  3AZF C;  3B6F C;  3AZN B;  4H9Q B;  4QLC B;  3UTB B;  1R4V A;  5CPI D;  4ZUX A;  5B24 A;  3AZH A;  3LJA D;  4ZUX C;  5B24 C;  3AZH C;  3F6T A;  4CAY A;  5F99 D;  3H0R C;  3LEL A;  2ARO A;  3V9R B;  1P3I A;  3LEL C;  2ARO C;  3AZH B;  1P3I C;  5AVB D;  3KUY D;  2Y2O A;  5GT3 C;  4KUD A;  4KUD C;  4H9P B;  3O62 A;  3REH B;  2ZY2 A;  3LEL B;  2ARO B;  1P3I B;  3AZK D;  4KUD B;  4Z5T A;  3A6N D;  3O62 B;  4Z5T C;  1BH9 B;  3AFA D;  5B32 A;  3WA9 D;  1T3U A;  3X1V D;  5B32 C;  1M19 A;  3C1C B;  2PYO B;  2NQB A;  1H3O A;  3AV1 D;  2NQB C;  3REI B;  1F66 B;  1M18 A;  5B31 G;  3EG5 B;  4CSR A;  3KSY A;  3KXB D;  1M18 C;  3W97 D;  3FDD A;  4XZQ A;  1M19 B;  1H3O B;  4XZQ C;  2F8N A;  3B6G D;  5AVC D;  3REK A;  2XD5 A;  2ZY3 A;  1P3B A;  5E5A D;  3X1U A;  3REK C;  1M18 B;  1P3B C;  3X1U C;  1P3G A;  4YS3 A;  5B1L D;  3VH5 A;  3VH6 W;  1P3G C;  2F8N B;  4YS3 C;  5JA4 B;  1P3O D;  3REK B;  3AV2 D;  1W2E A;  3X1U B;  2Y2J A;  2Y2K A;  5AV8 A;  5BNV A;  4YS3 B;  5AV8 C;  3R45 B;  2HIO A;  1U35 A;  4JJN D;  1U35 C;  2Y2L A;  4Z66 D;  3W99 D;  4WNN B;  5GT0 A;  3X1S D;  5B2I B;  5B33 A;  5B0Y D;  5GT0 C;  3UTA B;  5B33 C;  3AZJ D;  1P34 A;  1EQZ D;  3REL B;  2HIO B;  1P34 C;  1BFM A;  5B1M A;  3AZI A;  3MGR B;  5B1M C;  5B0Z A;  3AZI C;  1P3M A;  3WTP D;  1P3M C;  1P3K A;  1P34 B;  1WWS A;  5JRG D;  4KGC D;  3VH6 T;  1P3K C;  5AY8 D;  5B1M B;  4J8V D;  1TZY A;  5B0Z B;  1P3M B;  4X23 A;  1TZY C;  2BYK A;  4X23 C;  1ID3 A;  1ID3 C;  3MGS D;  1P3P D;  4AWL C;  5CPK A;  3AZG C;  2Y2G A;  4X23 B;  5BO0 A;  2BYK B;  1HQ3 D;  3LZ0 B;  5CPK C;  2NZD A;  1P3A D;  1ID3 B;  2NZD C;  1KX5 D;  4EO5 C;  3TU4 D;  4DQY B;  1P3F B;  3AZL B;  3UT9 D;  1JFI A;  2RIQ A;  3MNN A;  1P3L D;  3MNN C;  2YFV B;  2W8S A;  4EO5 B;  5BT1 D;  1ULY A;  3X1T A;  1KX4 D;  2F2A C;  3X1T C;  3MGQ D;  2FJ7 D;  1JFI B;  3MNN B;  1AOI D;  4WU9 D;  5B40 B;  3MGP A;  2Y2N A;  3MVD D;  3MGP C;  3WKJ B;  5B31 A;  4YM6 A;  2Y2Q A;  4WU8 B;  5B31 C;  4YM6 C;  4G92 B;  3AZM D;  1S32 B;  5AV9 D;  5DNM B;  4J8W C;  2CV5 B;  4LD9 D;  3B0C T;  3REJ D;  5CP6 C;  3WAA D;  2RVQ D;  4G91 C;  3AZN A;  3AZN C;  4QLC A;  5B2J B;  4QLC C;  5AV5 B;  3AYW B;  3C1B D;  4G91 B;  4R8P A;  4R8P C;  3KWQ D;  4WJ3 C;  3V9R A;  4R8P B;  3LJA B;  4H9P A;  5F99 B;  3REH A;  1KX3 D;  3REH C;  2FFF B;  5AVB B;  3KUY B;  3AZE D;  1M1A D;  3W98 D;  1BH9 A;  3O62 C;  2DF4 C;  4UUZ B;  3WA9 A;  2PYO A;  3C1C A;  3W96 D;  3A6N B;  2L5A A;  2PYO C;  3C1C C;  3AV1 A;  3P5J B;  2Y2P A;  3EPJ A;  3REI A;  3AZF D;  1F66 A;  3B6F D;  4DRA A;  4DRB A;  3REI C;  1F66 C;  3AFA B;  4H9R A;  3WA9 B;  3X1V B;  5CHL B;  1M19 C;  3AV1 B;  2CWE A;  5BNX B;  5AVC A;  4ZUX D;  5AVC C;  5B24 D;  5E5A A;  3AZH D;  4H9R B;  3W97 B;  3KXB B;  5JA4 A;  3B6G B;  5AVC B;  3LEL D;  2ARO D;  1P3I D;  5E5A B;  3VH5 T;  5GT3 D;  4KUD D;  1TAF A;  5B1L B;  1BH8 B;  2Y2H A;  3R45 A;  4H9N B;  4JJN A;  3AV2 B;  4JJN C;  3W99 A;  4WNN A;  1TAF B;  4Z5T D;  3W99 C;  5B2I A;  3UTA A;  5B2I C;  3UTA C;  3REL A;  5B32 D;  4JJN B;  3REL C;  2HIO C;  1B67 A;  3MGR A;  4J8X A;  4UPK A;  2NQB D;  3W99 B;  4J8X C;  3MGR C;  5CPJ D;  5B0Y B;  3AZJ B;  1EQZ B;  3AN2 A;  3AN2 C;  4J8X B;  4XZQ D;  4XUJ D;  2F8N D;  5B0Z C;  3WTP B;  3REK D;  1P3B D;  5JRG B;  4KGC B;  5DNN D;  3AN2 B;  3KFU G;  5AY8 B;  2Y2I A;  1P3G D;  4YS3 D;  3LZ0 A;  5GXQ A;  1KX5 A;  3LZ0 C;  5GXQ C;  3MGS B;  1KX5 C;  4E44 A;  1P3F A;  3AZL A;  1P3P B;  1P3F C;  5AV8 D;  3AZL C;  1B6W A;  1HQ3 B;  2YFV A;  1U35 D;  5GXQ B;  1P3A B;  1KX5 B;  3TU4 B;  2J8P A;  3B0C W;  2FJ7 A;  3UT9 B;  4NFT A;  5AV6 A;  5GT0 D;  2FJ7 C;  2UWX A;  5B33 D;  1AOI A;  5AV6 C;  1P3L B;  3NQU A;  5GSU A;  1P34 D;  5B40 A;  1AOI C;  1ZLA A;  5GSU C;  4ZBJ B;  1ZLA C;  5B1M D;  5B40 C;  3AZI D;  1KX4 B;  3WKJ A;  4WU8 A;  2FJ7 B;  3MGQ B;  1P3M D;  3WKJ C;  5AV6 B;  4WU8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...