5B32C

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.3.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b32C00
3A6NA 5E5AA 1HQ3B 3W97B 3MVDD 3AYWB 3AZLA 1P3GC 4ZUXB 3AZNB 3UTBA 2BYMB 1P3FC 1TZYB 2RVQC 5AV6C 4WU9B 3REHB 3W99C 3AZJD 5JRGC 3UT9A 4Z66A 5AVCA 5F99C 3RELA 5B1MD 3VH6A 4H9NB 3X1TA 4HGAB 3AN2B 1HQ3D 3V9RA 4YS3A 3KUYB 2PYOA 3B6GA 2FJ7A 3W97D 3AYWD 3UTAA 3AV2B 2HIOB 3AZLC 5DNMA 3VH6T 4XUJA 5CPIC 1U35B 3AZND 5B2IA 5B40C 3UTBC 1TZYD 4H9QA 5GXQA 5B24D 2AROD 4DRAA 4UUZB 4WU9D 3REHD 5GT3A 4KGCB 1M19B 3MGSA 4Z66C 2HUEB 1B6WA 3AN2D 3AZHB 2PYOC 4Z5TB 2IO5B 4YS3C 4J8WC 4JJNB 1F1EA 2BYKB 3AV2D 1P3PC 3B6GC 1U35D 4XUJC 3NQUB 5KDMB 5B2IC 3WTPC 5BS7C 1P34B 4CAYA 5B0ZA 1BFMA 3AZMB 1KX5D 3VH5W 3REIC 3X1SC 5B31B 4WZSB 3R45A 4WU8D 4H9SA 4KGCD 1AOIA 1M19D 4E44A 4H9OA 1KX3C 1H3OB 5B2JB 3AZKB 3AZHD 4Z5TD 4H9PB 3WKJA 5GSUA 1F66C 3KWQA 5AY8B 4WNNB 1P34D 4E45A 3AZGB 5G49B 5BO0B 3KSYA 3LELB 3LZ1A 1EQZA 1AOIC 2NQBB 4KUDD 5B2JD 3AZKD 5FUGA 1JFIB 3WAAB 3AZFB 3REKB 5JA4A 5CP6C 4H9RB 3C1BA 5AY8D 3KWQC 2F8NA 5B32B 4EO5C 1P3OC 1M1AC 2LY8A 3AV1D 3KXBC 3AZEB 1ID3C 3A6NB 5E5AB 5AVBA 1HTAA 1P3GD 5B0YA 1P3FD 3WAAD 3MNNA 4Z2MG 2RVQD 3C1CA 5AV8C 1KX4A 4G91B 3X1UC 3C1BC 3B6FA 3AZED 3UT9B 5AVCB 1TAFA 3RELB 3MGPB 3A6ND 5E5AD 1P3BA 3X1TB 4QLCA 3V9RB 5AVBC 3AV1A 4YS3B 1S32A 2FJ7B 3UTAB 5B1LA 3AZLD 3X1VA 5DNMB 3UTBD 2NZDC 1P3AC 3MNNC 5GT0C 1WWSA 4H9QB 5GXQB 3C1CC 3REJC 4NE5A 5GT3B 3B6FC 3UT9D 4Z66D 5AV6A 5AVCD 3MGSB 5CPJC 3W99A 2PYOD 5JRGA 4YS3D 1ZLAC 1P3PD 4R8PC 3B6GD 5F99A 3UTAD 5DNNC 5DNMD 3X1VC 4XUJD 3O62C 5B2ID 2F8NG 2CV5A 4CAYB 5B0ZB 5GXQD 5CPIA 5B40A 3R45B 5GT3D 3AFAC 5B24B 5C3IB 3MGSD 2AROB 3W96C 5BT1D 3WKJB 5GSUB 4ZBJB 4J8WA 1P3PA 4M6BA 2CV5C 5B0ZD 1A7WA 4LD9C 3LJAC 3WTPA 5BS7A 3LZ1B 1EQZB 1AOID 3NQJB 1P3LC 1KX5B 4YM6A 4AWLB 3X1SA 3MGQA 3REIA 4WU8B 4G92C 5FUGB 3TU4C 1R4VA 3WKJD 5GSUD 5JA4B 3KWQD 1KX3A 1M18C 5AV5C 4J8UC 4KHAA 2CWEA 1F66A 1P3MA 1P3IC 5AVBB 3LZ1D 1EQZD 4YM6C 3MGQC 4J8VC 5B0YB 3W98C 1BH8A 3MGRC 1KX4B 2L5AA 2YFVA 3C1BD 4KUDB 5B33C 4XZQC 2F8ND 5CP6A 5CPKA 3AZIC 1BH9B 1P3MC 1M1AA 1P3BB 1P3OA 5AVBD 4QLCB 3KXBA 3AV1B 1P3KC 1S32B 1ID3A 5B1LB 3MVDC 3LZ0C 5B0YD 4ZUXA 3MNND 1N1JA 3B0CT 3C1CD 1P3GB 1KX4D 1P3FB 4X23C 1WWIA 3B6FD 3VH6W 5AV8A 3X1UA 5AV6B 5CPKC 3AZJC 1P3BD 5BNXA 3W99B 5B1MC 4H9NA 4QLCD 5JRGB 1ZLAD 1S32D 1HQ3C 5B1LD 5F99B 3KUYA 3W97C 3AYWC 3X1VD 3O62D 4ZUXC 3AZNC 3AZLB 5CPIB 1TZYC 5B40B 3UTBB 1P3AA 2NZDA 4WU9C 5GT0A 3REHC 5AV6D 4J8XA 3REJA 3W99D 1Q9CA 5JRGD 4HGAC 3AN2C 5F99D 4Z66B 4JJNA 3KUYC 5CPJA 3AV2C 3WTPE 3WA9A 2HIOC 2PYOB 1ZLAA 4R8PA 4J8WB 2CV5D 1U35C 1P3PB 3B6GB 3NQUA 5DNNA 5CPID 3O62A 4XUJB 3AZMA 5B40D 5B2IB 3WTPB 4KGCC 3X1SB 3MGQB 4J8XC 3REIB 1M19C 4WV4B 3TU4D 1H3OA 2HUEC 3AFAA 3AZHC 4Z5TC 2IO5C 4JJNC 3W96A 1KX3B 4J8UD 3WA9C 4J8WD 3B0CW 4KHAB 1F66B 1P34C 3AZGA 1P3MB 5BO0A 3AZMC 3WTPD 3LELA 5B31C 3B0BA 4LD9A 5AV9A 4YM6D 3X1SD 3LJAA 3MGQD 3REID 1AOIB 1BH8B 5B2JC 3AZKC 1P3LA 3B0DC 3VH5A 1KX3D 2YFVB 4H9OB 4H9RA 5B33D 3TU4A 5AY8C 5B1LC 5B32A 3VH5T 1F66D 5CP6B 3AZID 1M18A 5BNVA 5AV5A 3KWQB 1P3MD 3AZGC 4J8UA 2YFWA 4EO5B 1P3OB 1M1AB 1P3KD 3KXBB 3LELC 1ID3B 5AV9C 3LZ0D 1P3IA 2NQBC 1N1JB 3WAAC 3AZFC 4J8VA 3W98A 4X23D 3REKC 5B31G 3MGRA 4NE3A 5CHLB 5AV8B 5B32C 5CP6D 5CPKD 3X1UB 3C1BB 3AZEC 5B33A 4XZQA 1M1AD 1P3OD 5BNXB 3MGPA 2F8NB 3KXBD 3A6NC 5E5AC 3AZIA 4DRBA 1ID3D 1P3KA 4ZUXD 3MVDA 3LZ0A 2NZDB 1P3AB 3MNNB 4G91C 5GT0B 5AV8D 3C1CB 3X1UD 4J8XB 4X23A 3REJB 3UT9C 5AVCC 3RELC 3B6FB 4Z2MH 3MGPC 3X1TC 5CPJB 3KUYD 3AZJA 1TAFB 2FJ7C 3UTAC 4CSRA 2HIOD 3WA9B 5B1MA 1ZLAB 5DNMC 4R8PB 1HQ3A 4NE6A 3W97A 1KU5A 5B32G 5DNNB 3AYWA 3X1VB 3O62B 5GXQC 2NZDD 1P3AD 3AZNA 2BYMA 5GT0D 5GT3C 1TZYA 4J8XD 3REJD 5B24A 2AROA 3MGSC 4WU9A 3REHA 5BT1C 3B0DB 5CPJD 3AFAB 4JJND 3W96B 3WA9D 4R8PD 3AN2A 4NFTA 5DNND 3AV2A 5B0ZC 2HIOA 3AZMD 1U35A 2CV5B 5B31D 4LD9B 4H9SC 5AV9B 3NQJA 3LJAB 1KX5A 2F8NH 5B24C 5C3IC 2AROC 4UUZA 4WU8A 1P3LB 3AFAD 4KGCA 1M19A 3W96D 3WKJC 4G92B 5GSUC 3TU4B 3AZHA 4Z5TA 4ZBJC 2BYKA 1M18B 5BNVB 5AV5B 3AZGD 2F8NK 4J8UB 2YFWB 3LELD 5KDMA 1P34A 1ULYA 3LZ1C 1EQZC 4LD9D 5AV9D 2JSSA 3LJAD 1P3IB 1B67A 4AWLC 1KX5C 2NQBD 5B31A 4WU8C 1P3LD 3AZFD 4YM6B 4J8VB 3W98B 3REKD 4KUDA 5B2JA 3AZKA 3MGRB 5B32D 4H9PA 1M18D 5AV5D 5B33B 4XZQB 5AY8A 4WNNA 1BH9A 3AZIB 5G49A 1P3ID 1P3KB 5B0YC 3MVDB 4J8VD 3LZ0B 2NQBA 3W98D 1P3GA 1KX4C 4KUDC 1P3FA 3WAAA 1JFIA 3AZFA 3MGRD 3REKA 4X23B 4XZQD 3RELD 3MGPD 3X1TD 1P3BC 5CPKB 4QLCC 3AZJB 3AV1C 3AZEA 2FJ7D 1S32C 4CSRB 5B1MB
chains in the Genus database with same CATH superfamily
3A6NA 5E5AA 1HQ3B 3W97B 3MVDD 3AYWB 3AZLA 1P3GC 4ZUXB 3AZNB 3UTBA 2BYMB 1P3FC 2XD1A 1TZYB 2RVQC 5AV6C 4WU9B 3REHB 3W99C 3AZJD 5JRGC 3UT9A 4Z66A 5AVCA 5F99C 3RELA 5B1MD 3VH6A 4H9NB 3X1TA 4HGAB 3FDDA 1HQ3D 3V9RA 3AN2B 3KUYB 4YS3A 2PYOA 2FJ7A 3B6GA 3AYWD 3UTAA 3AV2B 3W97D 2HIOB 3AZLC 2W8SA 3VH6T 4XUJA 5CPIC 5DNMA 3AZND 1U35B 5B2IA 5B40C 3UTBC 2Y2JA 1TZYD 4H9QA 5GXQA 5B24D 2AROD 4DRAA 4UUZB 4WU9D 3REHD 5GT3A 4KGCB 1M19B 3MGSA 4Z66C 2HUEB 1B6WA 3AN2D 3AZHB 2PYOC 3H0MC 2IO5B 4Z5TB 4YS3C 4J8WC 1F1EA 2BYKB 4JJNB 3AV2D 1P3PC 3B6GC 1U35D 4XUJC 3NQUB 5KDMB 5B2IC 3WTPC 5BS7C 1P34B 4CAYA 5B0ZA 3AL0C 1BFMA 3AZMB 1KX5D 3VH5W 3REIC 3X1SC 5B31B 4WZSB 3R45A 4WU8D 4H9SA 4KGCD 1AOIA 1M19D 4E44A 4H9OA 1KX3C 1H3OB 5B2JB 3AZKB 3AZHD 1T3UA 4Z5TD 4H9PB 3WKJA 5GSUA 1F66C 3KWQA 5AY8B 4WNNB 2ZY2A 1P34D 4E45A 3AZGB 3H0RC 5G49B 5BO0B 3KSYA 3LELB 2Y2NA 3LZ1A 1EQZA 1AOIC 2NQBB 3EG5B 4KUDD 5B2JD 3AZKD 5FUGA 1JFIB 3WAAB 3AZFB 3REKB 5JA4A 5CP6C 4H9RB 3C1BA 5AY8D 3KWQC 2Y2LA 5B32B 4EO5C 1P3OC 1M1AC 2F8NA 2LY8A 3AV1D 3KXBC 3AZEB 1ID3C 2Y2IA 3A6NB 5E5AB 5AVBA 2G5IC 1HTAA 1P3GD 3EPKA 5B0YA 1P3FD 3WAAD 3EPHA 3MNNA 4Z2MG 2RVQD 3C1CA 3IP4C 5AV8C 1KX4A 4G91B 3X1UC 3C1BC 3B6FA 3AZED 3UT9B 5AVCB 1TAFA 3RELB 3MGPB 3A6ND 5E5AD 1P3BA 3X1TB 4QLCA 3V9RB 5AVBC 3AV1A 4YS3B 1S32A 2FJ7B 3UTAB 5B1LA 3AZLD 3X1VA 5DNMB 3UTBD 2NZDC 1P3AC 3MNNC 5GT0C 1WWSA 4H9QB 5GXQB 3C1CC 3F6TA 2ZM5A 3REJC 2Y2GA 4NE5A 5GT3B 3B6FC 3UT9D 4Z66D 5AV6A 5AVCD 3MGSB 5CPJC 3W99A 2PYOD 5JRGA 4YS3D 1ZLAC 1P3PD 4R8PC 3B6GD 5F99A 3UTAD 5DNNC 5DNMD 3X1VC 4XUJD 3O62C 5B2ID 2F8NG 2CV5A 2Y2PA 4CAYB 5B0ZB 5GXQD 5CPIA 5B40A 2VQRA 3R45B 5GT3D 2F2AC 3AFAC 5B24B 5C3IB 3MGSD 2AROB 3W96C 5BT1D 3WKJB 5GSUB 4ZBJB 4J8WA 1P3PA 4M6BA 2CV5C 2FFFB 5B0ZD 1A7WA 4LD9C 3LJAC 3WTPA 5BS7A 3LZ1B 1EQZB 1AOID 3NQJB 1P3LC 1KX5B 4YM6A 4AWLB 3X1SA 3MGQA 3REIA 4WU8B 4G92C 5FUGB 3TU4C 1R4VA 3WKJD 5GSUD 5JA4B 3KWQD 1KX3A 1M18C 5AV5C 4J8UC 4KHAA 2CWEA 1F66A 1P3MA 1P3IC 5AVBB 3LZ1D 1EQZD 4YM6C 3MGQC 4J8VC 5B0YB 3W98C 2JCHA 1BH8A 2Y2QA 3MGRC 1KX4B 2L5AA 2YFVA 2JE5A 3C1BD 4KUDB 5B33C 4XZQC 2F8ND 5CP6A 5CPKA 2Y2KA 3AZIC 1BH9B 1P3MC 1M1AA 1P3BB 1P3OA 5AVBD 4QLCB 3KXBA 3AV1B 2ZY4A 1P3KC 1S32B 1ID3A 5B1LB 3MVDC 3LZ0C 5B0YD 4ZUXA 3MNND 1N1JA 3B0CT 3C1CD 1P3GB 1KX4D 1P3FB 4X23C 1WWIA 3B6FD 3VH6W 5AV8A 3X1UA 5AV6B 5CPKC 3AZJC 1P3BD 5BNXA 3W99B 2UWXA 5B1MC 4H9NA 4QLCD 5JRGB 1ZLAD 1S32D 1HQ3C 5B1LD 5F99B 3KUYA 3W97C 3AYWC 3X1VD 3O62D 4ZUXC 3AZNC 3AZLB 5CPIB 1TZYC 5B40B 3UTBB 1P3AA 2NZDA 4WU9C 2ZY5A 5GT0A 3REHC 3KFUG 5AV6D 4J8XA 3REJA 4UPKA 3W99D 1Q9CA 5JRGD 4HGAC 3AN2C 5F99D 4Z66B 4JJNA 3KUYC 5CPJA 4WJ3C 3AV2C 3WTPE 3WA9A 2HIOC 2PYOB 1ZLAA 4R8PA 4J8WB 2CV5D 1U35C 1P3PB 3B6GB 3NQUA 5DNNA 1W2EA 5CPID 3O62A 4XUJB 3AZMA 5B40D 5B2IB 3WTPB 2G5HC 4KGCC 3X1SB 3MGQB 4J8XC 3REIB 2DQNC 1M19C 4WV4B 3TU4D 2DF4C 1H3OA 2HUEC 3AFAA 3AZHC 4Z5TC 2IO5C 4JJNC 2J8PA 3W96A 1KX3B 4J8UD 3WA9C 4J8WD 3B0CW 4KHAB 1F66B 1P34C 3AZGA 1P3MB 5BO0A 3AZMC 3WTPD 3LELA 5B31C 2RIQA 3B0BA 4LD9A 5AV9A 4YM6D 3X1SD 3LJAA 3MGQD 3REID 2BG1A 1AOIB 1BH8B 5B2JC 3AZKC 1P3LA 3B0DC 3VH5A 1KX3D 2YFVB 4H9OB 4H9RA 5B33D 3TU4A 5AY8C 5B1LC 5B32A 3VH5T 1F66D 5CP6B 3AZID 1M18A 5BNVA 5AV5A 3KWQB 1P3MD 3AZGC 4J8UA 2YFWA 4EO5B 1P3OB 1PZRA 1M1AB 1P3KD 3KXBB 3LELC 1ID3B 5AV9C 3LZ0D 1P3IA 2NQBC 1N1JB 3WAAC 3AZFC 4J8VA 3W98A 4X23D 3REKC 3EPJA 5B31G 3MGRA 4NE3A 5CHLB 5AV8B 5B32C 5CP6D 5CPKD 3X1UB 3C1BB 3A1KA 3AZEC 5B33A 4XZQA 1M1AD 1P3OD 5BNXB 3MGPA 2Y2MA 2F8NB 3KXBD 3A6NC 5E5AC 3AZIA 4DRBA 1ID3D 1P3KA 4ZUXD 3MVDA 3LZ0A 2XD5A 2ZY3A 3P5JB 2NZDB 1P3AB 3MNNB 4G91C 1Z2CB 5GT0B 5AV8D 3C1CB 3X1UD 4J8XB 4X23A 3REJB 3UT9C 5AVCC 3RELC 3B6FB 4Z2MH 3MGPC 3EPLA 3X1TC 5CPJB 3KUYD 3AZJA 1TAFB 3A1IA 2FJ7C 3UTAC 4CSRA 2HIOD 3WA9B 5B1MA 1ZLAB 5DNMC 4R8PB 1HQ3A 4NE6A 3W97A 1KU5A 5B32G 5DNNB 3AYWA 3X1VB 3O62B 5GXQC 2NZDD 1P3AD 3AZNA 2BYMA 5GT0D 5GT3C 1TZYA 4J8XD 3REJD 5B24A 2AROA 3MGSC 4WU9A 3REHA 5BT1C 2Y2OA 3B0DB 5CPJD 3AFAB 4JJND 3W96B 3WA9D 4R8PD 3AN2A 4NFTA 5DNND 3AV2A 5B0ZC 2HIOA 3AZMD 1U35A 2CV5B 5B31D 4LD9B 4H9SC 5AV9B 3NQJA 3LJAB 1KX5A 2F8NH 5B24C 5C3IC 2AROC 4UUZA 4WU8A 1P3LB 3AFAD 4KGCA 1M19A 3W96D 3WKJC 4G92B 5GSUC 3TU4B 3H0LC 3AZHA 4Z5TA 4DQYB 4ZBJC 2BYKA 1M18B 5BNVB 5AV5B 3AZGD 2F8NK 4J8UB 2YFWB 3LELD 5KDMA 1P34A 1ULYA 3LZ1C 1EQZC 4LD9D 5AV9D 2JSSA 3LJAD 1P3IB 1B67A 4AWLC 1KX5C 2NQBD 5B31A 4WU8C 2Y2HA 1P3LD 3AZFD 4YM6B 4J8VB 3W98B 3REKD 4KUDA 5B2JA 3AZKA 3MGRB 5B32D 4H9PA 1M18D 5AV5D 5B33B 4XZQB 5AY8A 4WNNA 1BH9A 3AZIB 5G49A 1P3ID 1P3KB 5B0YC 3MVDB 4J8VD 3LZ0B 2NQBA 3W98D 1P3GA 1KX4C 4KUDC 1P3FA 3WAAA 1JFIA 3AZFA 3MGRD 3REKA 4X23B 4XZQD 3RELD 3MGPD 3X1TD 1P3BC 5CPKB 4QLCC 3AZJB 3AV1C 3AZEA 2FJ7D 1S32C 4CSRB 5B1MB
chains in the Genus database with same CATH topology
3A6NA 5E5AA 1HQ3B 3W97B 3MVDD 3AYWB 3AZLA 1P3GC 4ZUXB 3AZNB 3UTBA 2BYMB 1P3FC 2XD1A 1TZYB 2RVQC 5AV6C 4WU9B 3REHB 3W99C 3AZJD 5JRGC 3UT9A 4Z66A 5AVCA 5F99C 3RELA 5B1MD 3VH6A 4H9NB 3X1TA 4HGAB 3FDDA 1HQ3D 3V9RA 3AN2B 3KUYB 4YS3A 2PYOA 2FJ7A 3B6GA 3AYWD 3UTAA 3AV2B 3W97D 2HIOB 3AZLC 2W8SA 3VH6T 4XUJA 5CPIC 5DNMA 3AZND 1U35B 5B2IA 5B40C 3UTBC 2Y2JA 1TZYD 4H9QA 5GXQA 5B24D 2AROD 4DRAA 4UUZB 4WU9D 3REHD 5GT3A 4KGCB 1M19B 3MGSA 4Z66C 2HUEB 1B6WA 3AN2D 3AZHB 2PYOC 3H0MC 2IO5B 4Z5TB 4YS3C 4J8WC 1F1EA 2BYKB 4JJNB 3AV2D 1P3PC 3B6GC 1U35D 4XUJC 3NQUB 5KDMB 5B2IC 3WTPC 5BS7C 1P34B 4CAYA 5B0ZA 3AL0C 1BFMA 3AZMB 1KX5D 3VH5W 3REIC 3X1SC 5B31B 4WZSB 3R45A 4WU8D 4H9SA 4KGCD 1AOIA 1M19D 4E44A 4H9OA 1KX3C 1H3OB 5B2JB 3AZKB 3AZHD 1T3UA 4Z5TD 4H9PB 3WKJA 5GSUA 1F66C 3KWQA 5AY8B 4WNNB 2ZY2A 1P34D 4E45A 3AZGB 3H0RC 5G49B 5BO0B 3KSYA 3LELB 2Y2NA 3LZ1A 1EQZA 1AOIC 2NQBB 3EG5B 4KUDD 5B2JD 3AZKD 5FUGA 1JFIB 3WAAB 3AZFB 3REKB 5JA4A 5CP6C 4H9RB 3C1BA 5AY8D 3KWQC 2Y2LA 5B32B 4EO5C 1P3OC 1M1AC 2F8NA 2LY8A 3AV1D 3KXBC 3AZEB 1ID3C 2Y2IA 3A6NB 5E5AB 5AVBA 2G5IC 1HTAA 1P3GD 3EPKA 5B0YA 1P3FD 3WAAD 3EPHA 3MNNA 4Z2MG 2RVQD 3C1CA 3IP4C 5AV8C 1KX4A 4G91B 3X1UC 3C1BC 3B6FA 3AZED 3UT9B 5AVCB 1TAFA 3RELB 3MGPB 3A6ND 5E5AD 1P3BA 3X1TB 4QLCA 3V9RB 5AVBC 3AV1A 4YS3B 1S32A 2FJ7B 3UTAB 5B1LA 3AZLD 3X1VA 5DNMB 3UTBD 2NZDC 1P3AC 3MNNC 5GT0C 1WWSA 4H9QB 5GXQB 3C1CC 3F6TA 2ZM5A 3REJC 2Y2GA 4NE5A 5GT3B 3B6FC 3UT9D 4Z66D 5AV6A 5AVCD 3MGSB 5CPJC 3W99A 2PYOD 5JRGA 4YS3D 1ZLAC 1P3PD 4R8PC 3B6GD 5F99A 3UTAD 5DNNC 5DNMD 3X1VC 4XUJD 3O62C 5B2ID 2F8NG 2CV5A 2Y2PA 4CAYB 5B0ZB 5GXQD 5CPIA 5B40A 2VQRA 3R45B 5GT3D 2F2AC 3AFAC 5B24B 5C3IB 3MGSD 2AROB 3W96C 5BT1D 3WKJB 5GSUB 4ZBJB 4J8WA 1P3PA 4M6BA 2CV5C 2FFFB 5B0ZD 1A7WA 4LD9C 3LJAC 3WTPA 5BS7A 3LZ1B 1EQZB 1AOID 3NQJB 1P3LC 1KX5B 4YM6A 4AWLB 3X1SA 3MGQA 3REIA 4WU8B 4G92C 5FUGB 3TU4C 1R4VA 3WKJD 5GSUD 5JA4B 3KWQD 1KX3A 1M18C 5AV5C 4J8UC 4KHAA 2CWEA 1F66A 1P3MA 1P3IC 5AVBB 3LZ1D 1EQZD 4YM6C 3MGQC 4J8VC 5B0YB 3W98C 2JCHA 1BH8A 2Y2QA 3MGRC 1KX4B 2L5AA 2YFVA 2JE5A 3C1BD 4KUDB 5B33C 4XZQC 2F8ND 5CP6A 5CPKA 2Y2KA 3AZIC 1BH9B 1P3MC 1M1AA 1P3BB 1P3OA 5AVBD 4QLCB 3KXBA 3AV1B 2ZY4A 1P3KC 1S32B 1ID3A 5B1LB 3MVDC 3LZ0C 5B0YD 4ZUXA 3MNND 1N1JA 3B0CT 3C1CD 1P3GB 1KX4D 1P3FB 4X23C 1WWIA 3B6FD 3VH6W 5AV8A 3X1UA 5AV6B 5CPKC 3AZJC 1P3BD 5BNXA 3W99B 2UWXA 5B1MC 4H9NA 4QLCD 5JRGB 1ZLAD 1S32D 1HQ3C 5B1LD 5F99B 3KUYA 3W97C 3AYWC 3X1VD 3O62D 4ZUXC 3AZNC 3AZLB 5CPIB 1TZYC 5B40B 3UTBB 1P3AA 2NZDA 4WU9C 2ZY5A 5GT0A 3REHC 3KFUG 5AV6D 4J8XA 3REJA 4UPKA 3W99D 1Q9CA 5JRGD 4HGAC 3AN2C 5F99D 4Z66B 4JJNA 3KUYC 5CPJA 4WJ3C 3AV2C 3WTPE 3WA9A 2HIOC 2PYOB 1ZLAA 4R8PA 4J8WB 2CV5D 1U35C 1P3PB 3B6GB 3NQUA 5DNNA 1W2EA 5CPID 3O62A 4XUJB 3AZMA 5B40D 5B2IB 3WTPB 2G5HC 4KGCC 3X1SB 3MGQB 4J8XC 3REIB 2DQNC 1M19C 4WV4B 3TU4D 2DF4C 1H3OA 2HUEC 3AFAA 3AZHC 4Z5TC 2IO5C 4JJNC 2J8PA 3W96A 1KX3B 4J8UD 3WA9C 4J8WD 3B0CW 4KHAB 1F66B 1P34C 3AZGA 1P3MB 5BO0A 3AZMC 3WTPD 3LELA 5B31C 2RIQA 3B0BA 4LD9A 5AV9A 4YM6D 3X1SD 3LJAA 3MGQD 3REID 2BG1A 1AOIB 1BH8B 5B2JC 3AZKC 1P3LA 3B0DC 3VH5A 1KX3D 2YFVB 4H9OB 4H9RA 5B33D 3TU4A 5AY8C 5B1LC 5B32A 3VH5T 1F66D 5CP6B 3AZID 1M18A 5BNVA 5AV5A 3KWQB 1P3MD 3AZGC 4J8UA 2YFWA 4EO5B 1P3OB 1PZRA 1M1AB 1P3KD 3KXBB 3LELC 1ID3B 5AV9C 3LZ0D 1P3IA 2NQBC 1N1JB 3WAAC 3AZFC 4J8VA 3W98A 4X23D 3REKC 3EPJA 5B31G 3MGRA 4NE3A 5CHLB 5AV8B 5B32C 5CP6D 5CPKD 3X1UB 3C1BB 3A1KA 3AZEC 5B33A 4XZQA 1M1AD 1P3OD 5BNXB 3MGPA 2Y2MA 2F8NB 3KXBD 3A6NC 5E5AC 3AZIA 4DRBA 1ID3D 1P3KA 4ZUXD 3MVDA 3LZ0A 2XD5A 2ZY3A 3P5JB 2NZDB 1P3AB 3MNNB 4G91C 1Z2CB 5GT0B 5AV8D 3C1CB 3X1UD 4J8XB 4X23A 3REJB 3UT9C 5AVCC 3RELC 3B6FB 4Z2MH 3MGPC 3EPLA 3X1TC 5CPJB 3KUYD 3AZJA 1TAFB 3A1IA 2FJ7C 3UTAC 4CSRA 2HIOD 3WA9B 5B1MA 1ZLAB 5DNMC 4R8PB 1HQ3A 4NE6A 3W97A 1KU5A 5B32G 5DNNB 3AYWA 3X1VB 3O62B 5GXQC 2NZDD 1P3AD 3AZNA 2BYMA 5GT0D 5GT3C 1TZYA 4J8XD 3REJD 5B24A 2AROA 3MGSC 4WU9A 3REHA 5BT1C 2Y2OA 3B0DB 5CPJD 3AFAB 4JJND 3W96B 3WA9D 4R8PD 3AN2A 4NFTA 5DNND 3AV2A 5B0ZC 2HIOA 3AZMD 1U35A 2CV5B 5B31D 4LD9B 4H9SC 5AV9B 3NQJA 3LJAB 1KX5A 2F8NH 5B24C 5C3IC 2AROC 4UUZA 4WU8A 1P3LB 3AFAD 4KGCA 1M19A 3W96D 3WKJC 4G92B 5GSUC 3TU4B 3H0LC 3AZHA 4Z5TA 4DQYB 4ZBJC 2BYKA 1M18B 5BNVB 5AV5B 3AZGD 2F8NK 4J8UB 2YFWB 3LELD 5KDMA 1P34A 1ULYA 3LZ1C 1EQZC 4LD9D 5AV9D 2JSSA 3LJAD 1P3IB 1B67A 4AWLC 1KX5C 2NQBD 5B31A 4WU8C 2Y2HA 1P3LD 3AZFD 4YM6B 4J8VB 3W98B 3REKD 4KUDA 5B2JA 3AZKA 3MGRB 5B32D 4H9PA 1M18D 5AV5D 5B33B 4XZQB 5AY8A 4WNNA 1BH9A 3AZIB 5G49A 1P3ID 1P3KB 5B0YC 3MVDB 4J8VD 3LZ0B 2NQBA 3W98D 1P3GA 1KX4C 4KUDC 1P3FA 3WAAA 1JFIA 3AZFA 3MGRD 3REKA 4X23B 4XZQD 3RELD 3MGPD 3X1TD 1P3BC 5CPKB 4QLCC 3AZJB 3AV1C 3AZEA 2FJ7D 1S32C 4CSRB 5B1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6N A;  5E5A A;  1HQ3 B;  3W97 B;  3MVD D;  3AYW B;  3AZL A;  1P3G C;  4ZUX B;  3AZN B;  3UTB A;  2BYM B;  1P3F C;  1TZY B;  2RVQ C;  5AV6 C;  4WU9 B;  3REH B;  3W99 C;  3AZJ D;  5JRG C;  3UT9 A;  4Z66 A;  5AVC A;  5F99 C;  3REL A;  5B1M D;  3VH6 A;  4H9N B;  3X1T A;  4HGA B;  3AN2 B;  1HQ3 D;  3V9R A;  4YS3 A;  3KUY B;  2PYO A;  3B6G A;  2FJ7 A;  3W97 D;  3AYW D;  3UTA A;  3AV2 B;  2HIO B;  3AZL C;  5DNM A;  3VH6 T;  4XUJ A;  5CPI C;  1U35 B;  3AZN D;  5B2I A;  5B40 C;  3UTB C;  1TZY D;  4H9Q A;  5GXQ A;  5B24 D;  2ARO D;  4DRA A;  4UUZ B;  4WU9 D;  3REH D;  5GT3 A;  4KGC B;  1M19 B;  3MGS A;  4Z66 C;  2HUE B;  1B6W A;  3AN2 D;  3AZH B;  2PYO C;  4Z5T B;  2IO5 B;  4YS3 C;  4J8W C;  4JJN B;  1F1E A;  2BYK B;  3AV2 D;  1P3P C;  3B6G C;  1U35 D;  4XUJ C;  3NQU B;  5KDM B;  5B2I C;  3WTP C;  5BS7 C;  1P34 B;  4CAY A;  5B0Z A;  1BFM A;  3AZM B;  1KX5 D;  3VH5 W;  3REI C;  3X1S C;  5B31 B;  4WZS B;  3R45 A;  4WU8 D;  4H9S A;  4KGC D;  1AOI A;  1M19 D;  4E44 A;  4H9O A;  1KX3 C;  1H3O B;  5B2J B;  3AZK B;  3AZH D;  4Z5T D;  4H9P B;  3WKJ A;  5GSU A;  1F66 C;  3KWQ A;  5AY8 B;  4WNN B;  1P34 D;  4E45 A;  3AZG B;  5G49 B;  5BO0 B;  3KSY A;  3LEL B;  3LZ1 A;  1EQZ A;  1AOI C;  2NQB B;  4KUD D;  5B2J D;  3AZK D;  5FUG A;  1JFI B;  3WAA B;  3AZF B;  3REK B;  5JA4 A;  5CP6 C;  4H9R B;  3C1B A;  5AY8 D;  3KWQ C;  2F8N A;  5B32 B;  4EO5 C;  1P3O C;  1M1A C;  2LY8 A;  3AV1 D;  3KXB C;  3AZE B;  1ID3 C;  3A6N B;  5E5A B;  5AVB A;  1HTA A;  1P3G D;  5B0Y A;  1P3F D;  3WAA D;  3MNN A;  4Z2M G;  2RVQ D;  3C1C A;  5AV8 C;  1KX4 A;  4G91 B;  3X1U C;  3C1B C;  3B6F A;  3AZE D;  3UT9 B;  5AVC B;  1TAF A;  3REL B;  3MGP B;  3A6N D;  5E5A D;  1P3B A;  3X1T B;  4QLC A;  3V9R B;  5AVB C;  3AV1 A;  4YS3 B;  1S32 A;  2FJ7 B;  3UTA B;  5B1L A;  3AZL D;  3X1V A;  5DNM B;  3UTB D;  2NZD C;  1P3A C;  3MNN C;  5GT0 C;  1WWS A;  4H9Q B;  5GXQ B;  3C1C C;  3REJ C;  4NE5 A;  5GT3 B;  3B6F C;  3UT9 D;  4Z66 D;  5AV6 A;  5AVC D;  3MGS B;  5CPJ C;  3W99 A;  2PYO D;  5JRG A;  4YS3 D;  1ZLA C;  1P3P D;  4R8P C;  3B6G D;  5F99 A;  3UTA D;  5DNN C;  5DNM D;  3X1V C;  4XUJ D;  3O62 C;  5B2I D;  2F8N G;  2CV5 A;  4CAY B;  5B0Z B;  5GXQ D;  5CPI A;  5B40 A;  3R45 B;  5GT3 D;  3AFA C;  5B24 B;  5C3I B;  3MGS D;  2ARO B;  3W96 C;  5BT1 D;  3WKJ B;  5GSU B;  4ZBJ B;  4J8W A;  1P3P A;  4M6B A;  2CV5 C;  5B0Z D;  1A7W A;  4LD9 C;  3LJA C;  3WTP A;  5BS7 A;  3LZ1 B;  1EQZ B;  1AOI D;  3NQJ B;  1P3L C;  1KX5 B;  4YM6 A;  4AWL B;  3X1S A;  3MGQ A;  3REI A;  4WU8 B;  4G92 C;  5FUG B;  3TU4 C;  1R4V A;  3WKJ D;  5GSU D;  5JA4 B;  3KWQ D;  1KX3 A;  1M18 C;  5AV5 C;  4J8U C;  4KHA A;  2CWE A;  1F66 A;  1P3M A;  1P3I C;  5AVB B;  3LZ1 D;  1EQZ D;  4YM6 C;  3MGQ C;  4J8V C;  5B0Y B;  3W98 C;  1BH8 A;  3MGR C;  1KX4 B;  2L5A A;  2YFV A;  3C1B D;  4KUD B;  5B33 C;  4XZQ C;  2F8N D;  5CP6 A;  5CPK A;  3AZI C;  1BH9 B;  1P3M C;  1M1A A;  1P3B B;  1P3O A;  5AVB D;  4QLC B;  3KXB A;  3AV1 B;  1P3K C;  1S32 B;  1ID3 A;  5B1L B;  3MVD C;  3LZ0 C;  5B0Y D;  4ZUX A;  3MNN D;  1N1J A;  3B0C T;  3C1C D;  1P3G B;  1KX4 D;  1P3F B;  4X23 C;  1WWI A;  3B6F D;  3VH6 W;  5AV8 A;  3X1U A;  5AV6 B;  5CPK C;  3AZJ C;  1P3B D;  5BNX A;  3W99 B;  5B1M C;  4H9N A;  4QLC D;  5JRG B;  1ZLA D;  1S32 D;  1HQ3 C;  5B1L D;  5F99 B;  3KUY A;  3W97 C;  3AYW C;  3X1V D;  3O62 D;  4ZUX C;  3AZN C;  3AZL B;  5CPI B;  1TZY C;  5B40 B;  3UTB B;  1P3A A;  2NZD A;  4WU9 C;  5GT0 A;  3REH C;  5AV6 D;  4J8X A;  3REJ A;  3W99 D;  1Q9C A;  5JRG D;  4HGA C;  3AN2 C;  5F99 D;  4Z66 B;  4JJN A;  3KUY C;  5CPJ A;  3AV2 C;  3WTP E;  3WA9 A;  2HIO C;  2PYO B;  1ZLA A;  4R8P A;  4J8W B;  2CV5 D;  1U35 C;  1P3P B;  3B6G B;  3NQU A;  5DNN A;  5CPI D;  3O62 A;  4XUJ B;  3AZM A;  5B40 D;  5B2I B;  3WTP B;  4KGC C;  3X1S B;  3MGQ B;  4J8X C;  3REI B;  1M19 C;  4WV4 B;  3TU4 D;  1H3O A;  2HUE C;  3AFA A;  3AZH C;  4Z5T C;  2IO5 C;  4JJN C;  3W96 A;  1KX3 B;  4J8U D;  3WA9 C;  4J8W D;  3B0C W;  4KHA B;  1F66 B;  1P34 C;  3AZG A;  1P3M B;  5BO0 A;  3AZM C;  3WTP D;  3LEL A;  5B31 C;  3B0B A;  4LD9 A;  5AV9 A;  4YM6 D;  3X1S D;  3LJA A;  3MGQ D;  3REI D;  1AOI B;  1BH8 B;  5B2J C;  3AZK C;  1P3L A;  3B0D C;  3VH5 A;  1KX3 D;  2YFV B;  4H9O B;  4H9R A;  5B33 D;  3TU4 A;  5AY8 C;  5B1L C;  5B32 A;  3VH5 T;  1F66 D;  5CP6 B;  3AZI D;  1M18 A;  5BNV A;  5AV5 A;  3KWQ B;  1P3M D;  3AZG C;  4J8U A;  2YFW A;  4EO5 B;  1P3O B;  1M1A B;  1P3K D;  3KXB B;  3LEL C;  1ID3 B;  5AV9 C;  3LZ0 D;  1P3I A;  2NQB C;  1N1J B;  3WAA C;  3AZF C;  4J8V A;  3W98 A;  4X23 D;  3REK C;  5B31 G;  3MGR A;  4NE3 A;  5CHL B;  5AV8 B;  5B32 C;  5CP6 D;  5CPK D;  3X1U B;  3C1B B;  3AZE C;  5B33 A;  4XZQ A;  1M1A D;  1P3O D;  5BNX B;  3MGP A;  2F8N B;  3KXB D;  3A6N C;  5E5A C;  3AZI A;  4DRB A;  1ID3 D;  1P3K A;  4ZUX D;  3MVD A;  3LZ0 A;  2NZD B;  1P3A B;  3MNN B;  4G91 C;  5GT0 B;  5AV8 D;  3C1C B;  3X1U D;  4J8X B;  4X23 A;  3REJ B;  3UT9 C;  5AVC C;  3REL C;  3B6F B;  4Z2M H;  3MGP C;  3X1T C;  5CPJ B;  3KUY D;  3AZJ A;  1TAF B;  2FJ7 C;  3UTA C;  4CSR A;  2HIO D;  3WA9 B;  5B1M A;  1ZLA B;  5DNM C;  4R8P B;  1HQ3 A;  4NE6 A;  3W97 A;  1KU5 A;  5B32 G;  5DNN B;  3AYW A;  3X1V B;  3O62 B;  5GXQ C;  2NZD D;  1P3A D;  3AZN A;  2BYM A;  5GT0 D;  5GT3 C;  1TZY A;  4J8X D;  3REJ D;  5B24 A;  2ARO A;  3MGS C;  4WU9 A;  3REH A;  5BT1 C;  3B0D B;  5CPJ D;  3AFA B;  4JJN D;  3W96 B;  3WA9 D;  4R8P D;  3AN2 A;  4NFT A;  5DNN D;  3AV2 A;  5B0Z C;  2HIO A;  3AZM D;  1U35 A;  2CV5 B;  5B31 D;  4LD9 B;  4H9S C;  5AV9 B;  3NQJ A;  3LJA B;  1KX5 A;  2F8N H;  5B24 C;  5C3I C;  2ARO C;  4UUZ A;  4WU8 A;  1P3L B;  3AFA D;  4KGC A;  1M19 A;  3W96 D;  3WKJ C;  4G92 B;  5GSU C;  3TU4 B;  3AZH A;  4Z5T A;  4ZBJ C;  2BYK A;  1M18 B;  5BNV B;  5AV5 B;  3AZG D;  2F8N K;  4J8U B;  2YFW B;  3LEL D;  5KDM A;  1P34 A;  1ULY A;  3LZ1 C;  1EQZ C;  4LD9 D;  5AV9 D;  2JSS A;  3LJA D;  1P3I B;  1B67 A;  4AWL C;  1KX5 C;  2NQB D;  5B31 A;  4WU8 C;  1P3L D;  3AZF D;  4YM6 B;  4J8V B;  3W98 B;  3REK D;  4KUD A;  5B2J A;  3AZK A;  3MGR B;  5B32 D;  4H9P A;  1M18 D;  5AV5 D;  5B33 B;  4XZQ B;  5AY8 A;  4WNN A;  1BH9 A;  3AZI B;  5G49 A;  1P3I D;  1P3K B;  5B0Y C;  3MVD B;  4J8V D;  3LZ0 B;  2NQB A;  3W98 D;  1P3G A;  1KX4 C;  4KUD C;  1P3F A;  3WAA A;  1JFI A;  3AZF A;  3MGR D;  3REK A;  4X23 B;  4XZQ D;  3REL D;  3MGP D;  3X1T D;  1P3B C;  5CPK B;  4QLC C;  3AZJ B;  3AV1 C;  3AZE A;  2FJ7 D;  1S32 C;  4CSR B;  5B1M B; 
#chains in the Genus database with same CATH topology
 3A6N A;  5E5A A;  1HQ3 B;  3W97 B;  3MVD D;  3AYW B;  3AZL A;  1P3G C;  4ZUX B;  3AZN B;  3UTB A;  2BYM B;  1P3F C;  2XD1 A;  1TZY B;  2RVQ C;  5AV6 C;  4WU9 B;  3REH B;  3W99 C;  3AZJ D;  5JRG C;  3UT9 A;  4Z66 A;  5AVC A;  5F99 C;  3REL A;  5B1M D;  3VH6 A;  4H9N B;  3X1T A;  4HGA B;  3FDD A;  1HQ3 D;  3V9R A;  3AN2 B;  3KUY B;  4YS3 A;  2PYO A;  2FJ7 A;  3B6G A;  3AYW D;  3UTA A;  3AV2 B;  3W97 D;  2HIO B;  3AZL C;  2W8S A;  3VH6 T;  4XUJ A;  5CPI C;  5DNM A;  3AZN D;  1U35 B;  5B2I A;  5B40 C;  3UTB C;  2Y2J A;  1TZY D;  4H9Q A;  5GXQ A;  5B24 D;  2ARO D;  4DRA A;  4UUZ B;  4WU9 D;  3REH D;  5GT3 A;  4KGC B;  1M19 B;  3MGS A;  4Z66 C;  2HUE B;  1B6W A;  3AN2 D;  3AZH B;  2PYO C;  3H0M C;  2IO5 B;  4Z5T B;  4YS3 C;  4J8W C;  1F1E A;  2BYK B;  4JJN B;  3AV2 D;  1P3P C;  3B6G C;  1U35 D;  4XUJ C;  3NQU B;  5KDM B;  5B2I C;  3WTP C;  5BS7 C;  1P34 B;  4CAY A;  5B0Z A;  3AL0 C;  1BFM A;  3AZM B;  1KX5 D;  3VH5 W;  3REI C;  3X1S C;  5B31 B;  4WZS B;  3R45 A;  4WU8 D;  4H9S A;  4KGC D;  1AOI A;  1M19 D;  4E44 A;  4H9O A;  1KX3 C;  1H3O B;  5B2J B;  3AZK B;  3AZH D;  1T3U A;  4Z5T D;  4H9P B;  3WKJ A;  5GSU A;  1F66 C;  3KWQ A;  5AY8 B;  4WNN B;  2ZY2 A;  1P34 D;  4E45 A;  3AZG B;  3H0R C;  5G49 B;  5BO0 B;  3KSY A;  3LEL B;  2Y2N A;  3LZ1 A;  1EQZ A;  1AOI C;  2NQB B;  3EG5 B;  4KUD D;  5B2J D;  3AZK D;  5FUG A;  1JFI B;  3WAA B;  3AZF B;  3REK B;  5JA4 A;  5CP6 C;  4H9R B;  3C1B A;  5AY8 D;  3KWQ C;  2Y2L A;  5B32 B;  4EO5 C;  1P3O C;  1M1A C;  2F8N A;  2LY8 A;  3AV1 D;  3KXB C;  3AZE B;  1ID3 C;  2Y2I A;  3A6N B;  5E5A B;  5AVB A;  2G5I C;  1HTA A;  1P3G D;  3EPK A;  5B0Y A;  1P3F D;  3WAA D;  3EPH A;  3MNN A;  4Z2M G;  2RVQ D;  3C1C A;  3IP4 C;  5AV8 C;  1KX4 A;  4G91 B;  3X1U C;  3C1B C;  3B6F A;  3AZE D;  3UT9 B;  5AVC B;  1TAF A;  3REL B;  3MGP B;  3A6N D;  5E5A D;  1P3B A;  3X1T B;  4QLC A;  3V9R B;  5AVB C;  3AV1 A;  4YS3 B;  1S32 A;  2FJ7 B;  3UTA B;  5B1L A;  3AZL D;  3X1V A;  5DNM B;  3UTB D;  2NZD C;  1P3A C;  3MNN C;  5GT0 C;  1WWS A;  4H9Q B;  5GXQ B;  3C1C C;  3F6T A;  2ZM5 A;  3REJ C;  2Y2G A;  4NE5 A;  5GT3 B;  3B6F C;  3UT9 D;  4Z66 D;  5AV6 A;  5AVC D;  3MGS B;  5CPJ C;  3W99 A;  2PYO D;  5JRG A;  4YS3 D;  1ZLA C;  1P3P D;  4R8P C;  3B6G D;  5F99 A;  3UTA D;  5DNN C;  5DNM D;  3X1V C;  4XUJ D;  3O62 C;  5B2I D;  2F8N G;  2CV5 A;  2Y2P A;  4CAY B;  5B0Z B;  5GXQ D;  5CPI A;  5B40 A;  2VQR A;  3R45 B;  5GT3 D;  2F2A C;  3AFA C;  5B24 B;  5C3I B;  3MGS D;  2ARO B;  3W96 C;  5BT1 D;  3WKJ B;  5GSU B;  4ZBJ B;  4J8W A;  1P3P A;  4M6B A;  2CV5 C;  2FFF B;  5B0Z D;  1A7W A;  4LD9 C;  3LJA C;  3WTP A;  5BS7 A;  3LZ1 B;  1EQZ B;  1AOI D;  3NQJ B;  1P3L C;  1KX5 B;  4YM6 A;  4AWL B;  3X1S A;  3MGQ A;  3REI A;  4WU8 B;  4G92 C;  5FUG B;  3TU4 C;  1R4V A;  3WKJ D;  5GSU D;  5JA4 B;  3KWQ D;  1KX3 A;  1M18 C;  5AV5 C;  4J8U C;  4KHA A;  2CWE A;  1F66 A;  1P3M A;  1P3I C;  5AVB B;  3LZ1 D;  1EQZ D;  4YM6 C;  3MGQ C;  4J8V C;  5B0Y B;  3W98 C;  2JCH A;  1BH8 A;  2Y2Q A;  3MGR C;  1KX4 B;  2L5A A;  2YFV A;  2JE5 A;  3C1B D;  4KUD B;  5B33 C;  4XZQ C;  2F8N D;  5CP6 A;  5CPK A;  2Y2K A;  3AZI C;  1BH9 B;  1P3M C;  1M1A A;  1P3B B;  1P3O A;  5AVB D;  4QLC B;  3KXB A;  3AV1 B;  2ZY4 A;  1P3K C;  1S32 B;  1ID3 A;  5B1L B;  3MVD C;  3LZ0 C;  5B0Y D;  4ZUX A;  3MNN D;  1N1J A;  3B0C T;  3C1C D;  1P3G B;  1KX4 D;  1P3F B;  4X23 C;  1WWI A;  3B6F D;  3VH6 W;  5AV8 A;  3X1U A;  5AV6 B;  5CPK C;  3AZJ C;  1P3B D;  5BNX A;  3W99 B;  2UWX A;  5B1M C;  4H9N A;  4QLC D;  5JRG B;  1ZLA D;  1S32 D;  1HQ3 C;  5B1L D;  5F99 B;  3KUY A;  3W97 C;  3AYW C;  3X1V D;  3O62 D;  4ZUX C;  3AZN C;  3AZL B;  5CPI B;  1TZY C;  5B40 B;  3UTB B;  1P3A A;  2NZD A;  4WU9 C;  2ZY5 A;  5GT0 A;  3REH C;  3KFU G;  5AV6 D;  4J8X A;  3REJ A;  4UPK A;  3W99 D;  1Q9C A;  5JRG D;  4HGA C;  3AN2 C;  5F99 D;  4Z66 B;  4JJN A;  3KUY C;  5CPJ A;  4WJ3 C;  3AV2 C;  3WTP E;  3WA9 A;  2HIO C;  2PYO B;  1ZLA A;  4R8P A;  4J8W B;  2CV5 D;  1U35 C;  1P3P B;  3B6G B;  3NQU A;  5DNN A;  1W2E A;  5CPI D;  3O62 A;  4XUJ B;  3AZM A;  5B40 D;  5B2I B;  3WTP B;  2G5H C;  4KGC C;  3X1S B;  3MGQ B;  4J8X C;  3REI B;  2DQN C;  1M19 C;  4WV4 B;  3TU4 D;  2DF4 C;  1H3O A;  2HUE C;  3AFA A;  3AZH C;  4Z5T C;  2IO5 C;  4JJN C;  2J8P A;  3W96 A;  1KX3 B;  4J8U D;  3WA9 C;  4J8W D;  3B0C W;  4KHA B;  1F66 B;  1P34 C;  3AZG A;  1P3M B;  5BO0 A;  3AZM C;  3WTP D;  3LEL A;  5B31 C;  2RIQ A;  3B0B A;  4LD9 A;  5AV9 A;  4YM6 D;  3X1S D;  3LJA A;  3MGQ D;  3REI D;  2BG1 A;  1AOI B;  1BH8 B;  5B2J C;  3AZK C;  1P3L A;  3B0D C;  3VH5 A;  1KX3 D;  2YFV B;  4H9O B;  4H9R A;  5B33 D;  3TU4 A;  5AY8 C;  5B1L C;  5B32 A;  3VH5 T;  1F66 D;  5CP6 B;  3AZI D;  1M18 A;  5BNV A;  5AV5 A;  3KWQ B;  1P3M D;  3AZG C;  4J8U A;  2YFW A;  4EO5 B;  1P3O B;  1PZR A;  1M1A B;  1P3K D;  3KXB B;  3LEL C;  1ID3 B;  5AV9 C;  3LZ0 D;  1P3I A;  2NQB C;  1N1J B;  3WAA C;  3AZF C;  4J8V A;  3W98 A;  4X23 D;  3REK C;  3EPJ A;  5B31 G;  3MGR A;  4NE3 A;  5CHL B;  5AV8 B;  5B32 C;  5CP6 D;  5CPK D;  3X1U B;  3C1B B;  3A1K A;  3AZE C;  5B33 A;  4XZQ A;  1M1A D;  1P3O D;  5BNX B;  3MGP A;  2Y2M A;  2F8N B;  3KXB D;  3A6N C;  5E5A C;  3AZI A;  4DRB A;  1ID3 D;  1P3K A;  4ZUX D;  3MVD A;  3LZ0 A;  2XD5 A;  2ZY3 A;  3P5J B;  2NZD B;  1P3A B;  3MNN B;  4G91 C;  1Z2C B;  5GT0 B;  5AV8 D;  3C1C B;  3X1U D;  4J8X B;  4X23 A;  3REJ B;  3UT9 C;  5AVC C;  3REL C;  3B6F B;  4Z2M H;  3MGP C;  3EPL A;  3X1T C;  5CPJ B;  3KUY D;  3AZJ A;  1TAF B;  3A1I A;  2FJ7 C;  3UTA C;  4CSR A;  2HIO D;  3WA9 B;  5B1M A;  1ZLA B;  5DNM C;  4R8P B;  1HQ3 A;  4NE6 A;  3W97 A;  1KU5 A;  5B32 G;  5DNN B;  3AYW A;  3X1V B;  3O62 B;  5GXQ C;  2NZD D;  1P3A D;  3AZN A;  2BYM A;  5GT0 D;  5GT3 C;  1TZY A;  4J8X D;  3REJ D;  5B24 A;  2ARO A;  3MGS C;  4WU9 A;  3REH A;  5BT1 C;  2Y2O A;  3B0D B;  5CPJ D;  3AFA B;  4JJN D;  3W96 B;  3WA9 D;  4R8P D;  3AN2 A;  4NFT A;  5DNN D;  3AV2 A;  5B0Z C;  2HIO A;  3AZM D;  1U35 A;  2CV5 B;  5B31 D;  4LD9 B;  4H9S C;  5AV9 B;  3NQJ A;  3LJA B;  1KX5 A;  2F8N H;  5B24 C;  5C3I C;  2ARO C;  4UUZ A;  4WU8 A;  1P3L B;  3AFA D;  4KGC A;  1M19 A;  3W96 D;  3WKJ C;  4G92 B;  5GSU C;  3TU4 B;  3H0L C;  3AZH A;  4Z5T A;  4DQY B;  4ZBJ C;  2BYK A;  1M18 B;  5BNV B;  5AV5 B;  3AZG D;  2F8N K;  4J8U B;  2YFW B;  3LEL D;  5KDM A;  1P34 A;  1ULY A;  3LZ1 C;  1EQZ C;  4LD9 D;  5AV9 D;  2JSS A;  3LJA D;  1P3I B;  1B67 A;  4AWL C;  1KX5 C;  2NQB D;  5B31 A;  4WU8 C;  2Y2H A;  1P3L D;  3AZF D;  4YM6 B;  4J8V B;  3W98 B;  3REK D;  4KUD A;  5B2J A;  3AZK A;  3MGR B;  5B32 D;  4H9P A;  1M18 D;  5AV5 D;  5B33 B;  4XZQ B;  5AY8 A;  4WNN A;  1BH9 A;  3AZI B;  5G49 A;  1P3I D;  1P3K B;  5B0Y C;  3MVD B;  4J8V D;  3LZ0 B;  2NQB A;  3W98 D;  1P3G A;  1KX4 C;  4KUD C;  1P3F A;  3WAA A;  1JFI A;  3AZF A;  3MGR D;  3REK A;  4X23 B;  4XZQ D;  3REL D;  3MGP D;  3X1T D;  1P3B C;  5CPK B;  4QLC C;  3AZJ B;  3AV1 C;  3AZE A;  2FJ7 D;  1S32 C;  4CSR B;  5B1M B; 
#chains in the Genus database with same CATH homology
 3A6N A;  5E5A A;  1HQ3 B;  3W97 B;  3MVD D;  3AYW B;  3AZL A;  1P3G C;  4ZUX B;  3AZN B;  3UTB A;  2BYM B;  1P3F C;  2XD1 A;  1TZY B;  2RVQ C;  5AV6 C;  4WU9 B;  3REH B;  3W99 C;  3AZJ D;  5JRG C;  3UT9 A;  4Z66 A;  5AVC A;  5F99 C;  3REL A;  5B1M D;  3VH6 A;  4H9N B;  3X1T A;  4HGA B;  3FDD A;  1HQ3 D;  3V9R A;  3AN2 B;  3KUY B;  4YS3 A;  2PYO A;  2FJ7 A;  3B6G A;  3AYW D;  3UTA A;  3AV2 B;  3W97 D;  2HIO B;  3AZL C;  2W8S A;  3VH6 T;  4XUJ A;  5CPI C;  5DNM A;  3AZN D;  1U35 B;  5B2I A;  5B40 C;  3UTB C;  2Y2J A;  1TZY D;  4H9Q A;  5GXQ A;  5B24 D;  2ARO D;  4DRA A;  4UUZ B;  4WU9 D;  3REH D;  5GT3 A;  4KGC B;  1M19 B;  3MGS A;  4Z66 C;  2HUE B;  1B6W A;  3AN2 D;  3AZH B;  2PYO C;  3H0M C;  2IO5 B;  4Z5T B;  4YS3 C;  4J8W C;  1F1E A;  2BYK B;  4JJN B;  3AV2 D;  1P3P C;  3B6G C;  1U35 D;  4XUJ C;  3NQU B;  5KDM B;  5B2I C;  3WTP C;  5BS7 C;  1P34 B;  4CAY A;  5B0Z A;  3AL0 C;  1BFM A;  3AZM B;  1KX5 D;  3VH5 W;  3REI C;  3X1S C;  5B31 B;  4WZS B;  3R45 A;  4WU8 D;  4H9S A;  4KGC D;  1AOI A;  1M19 D;  4E44 A;  4H9O A;  1KX3 C;  1H3O B;  5B2J B;  3AZK B;  3AZH D;  1T3U A;  4Z5T D;  4H9P B;  3WKJ A;  5GSU A;  1F66 C;  3KWQ A;  5AY8 B;  4WNN B;  2ZY2 A;  1P34 D;  4E45 A;  3AZG B;  3H0R C;  5G49 B;  5BO0 B;  3KSY A;  3LEL B;  2Y2N A;  3LZ1 A;  1EQZ A;  1AOI C;  2NQB B;  3EG5 B;  4KUD D;  5B2J D;  3AZK D;  5FUG A;  1JFI B;  3WAA B;  3AZF B;  3REK B;  5JA4 A;  5CP6 C;  4H9R B;  3C1B A;  5AY8 D;  3KWQ C;  2Y2L A;  5B32 B;  4EO5 C;  1P3O C;  1M1A C;  2F8N A;  2LY8 A;  3AV1 D;  3KXB C;  3AZE B;  1ID3 C;  2Y2I A;  3A6N B;  5E5A B;  5AVB A;  2G5I C;  1HTA A;  1P3G D;  3EPK A;  5B0Y A;  1P3F D;  3WAA D;  3EPH A;  3MNN A;  4Z2M G;  2RVQ D;  3C1C A;  3IP4 C;  5AV8 C;  1KX4 A;  4G91 B;  3X1U C;  3C1B C;  3B6F A;  3AZE D;  3UT9 B;  5AVC B;  1TAF A;  3REL B;  3MGP B;  3A6N D;  5E5A D;  1P3B A;  3X1T B;  4QLC A;  3V9R B;  5AVB C;  3AV1 A;  4YS3 B;  1S32 A;  2FJ7 B;  3UTA B;  5B1L A;  3AZL D;  3X1V A;  5DNM B;  3UTB D;  2NZD C;  1P3A C;  3MNN C;  5GT0 C;  1WWS A;  4H9Q B;  5GXQ B;  3C1C C;  3F6T A;  2ZM5 A;  3REJ C;  2Y2G A;  4NE5 A;  5GT3 B;  3B6F C;  3UT9 D;  4Z66 D;  5AV6 A;  5AVC D;  3MGS B;  5CPJ C;  3W99 A;  2PYO D;  5JRG A;  4YS3 D;  1ZLA C;  1P3P D;  4R8P C;  3B6G D;  5F99 A;  3UTA D;  5DNN C;  5DNM D;  3X1V C;  4XUJ D;  3O62 C;  5B2I D;  2F8N G;  2CV5 A;  2Y2P A;  4CAY B;  5B0Z B;  5GXQ D;  5CPI A;  5B40 A;  2VQR A;  3R45 B;  5GT3 D;  2F2A C;  3AFA C;  5B24 B;  5C3I B;  3MGS D;  2ARO B;  3W96 C;  5BT1 D;  3WKJ B;  5GSU B;  4ZBJ B;  4J8W A;  1P3P A;  4M6B A;  2CV5 C;  2FFF B;  5B0Z D;  1A7W A;  4LD9 C;  3LJA C;  3WTP A;  5BS7 A;  3LZ1 B;  1EQZ B;  1AOI D;  3NQJ B;  1P3L C;  1KX5 B;  4YM6 A;  4AWL B;  3X1S A;  3MGQ A;  3REI A;  4WU8 B;  4G92 C;  5FUG B;  3TU4 C;  1R4V A;  3WKJ D;  5GSU D;  5JA4 B;  3KWQ D;  1KX3 A;  1M18 C;  5AV5 C;  4J8U C;  4KHA A;  2CWE A;  1F66 A;  1P3M A;  1P3I C;  5AVB B;  3LZ1 D;  1EQZ D;  4YM6 C;  3MGQ C;  4J8V C;  5B0Y B;  3W98 C;  2JCH A;  1BH8 A;  2Y2Q A;  3MGR C;  1KX4 B;  2L5A A;  2YFV A;  2JE5 A;  3C1B D;  4KUD B;  5B33 C;  4XZQ C;  2F8N D;  5CP6 A;  5CPK A;  2Y2K A;  3AZI C;  1BH9 B;  1P3M C;  1M1A A;  1P3B B;  1P3O A;  5AVB D;  4QLC B;  3KXB A;  3AV1 B;  2ZY4 A;  1P3K C;  1S32 B;  1ID3 A;  5B1L B;  3MVD C;  3LZ0 C;  5B0Y D;  4ZUX A;  3MNN D;  1N1J A;  3B0C T;  3C1C D;  1P3G B;  1KX4 D;  1P3F B;  4X23 C;  1WWI A;  3B6F D;  3VH6 W;  5AV8 A;  3X1U A;  5AV6 B;  5CPK C;  3AZJ C;  1P3B D;  5BNX A;  3W99 B;  2UWX A;  5B1M C;  4H9N A;  4QLC D;  5JRG B;  1ZLA D;  1S32 D;  1HQ3 C;  5B1L D;  5F99 B;  3KUY A;  3W97 C;  3AYW C;  3X1V D;  3O62 D;  4ZUX C;  3AZN C;  3AZL B;  5CPI B;  1TZY C;  5B40 B;  3UTB B;  1P3A A;  2NZD A;  4WU9 C;  2ZY5 A;  5GT0 A;  3REH C;  3KFU G;  5AV6 D;  4J8X A;  3REJ A;  4UPK A;  3W99 D;  1Q9C A;  5JRG D;  4HGA C;  3AN2 C;  5F99 D;  4Z66 B;  4JJN A;  3KUY C;  5CPJ A;  4WJ3 C;  3AV2 C;  3WTP E;  3WA9 A;  2HIO C;  2PYO B;  1ZLA A;  4R8P A;  4J8W B;  2CV5 D;  1U35 C;  1P3P B;  3B6G B;  3NQU A;  5DNN A;  1W2E A;  5CPI D;  3O62 A;  4XUJ B;  3AZM A;  5B40 D;  5B2I B;  3WTP B;  2G5H C;  4KGC C;  3X1S B;  3MGQ B;  4J8X C;  3REI B;  2DQN C;  1M19 C;  4WV4 B;  3TU4 D;  2DF4 C;  1H3O A;  2HUE C;  3AFA A;  3AZH C;  4Z5T C;  2IO5 C;  4JJN C;  2J8P A;  3W96 A;  1KX3 B;  4J8U D;  3WA9 C;  4J8W D;  3B0C W;  4KHA B;  1F66 B;  1P34 C;  3AZG A;  1P3M B;  5BO0 A;  3AZM C;  3WTP D;  3LEL A;  5B31 C;  2RIQ A;  3B0B A;  4LD9 A;  5AV9 A;  4YM6 D;  3X1S D;  3LJA A;  3MGQ D;  3REI D;  2BG1 A;  1AOI B;  1BH8 B;  5B2J C;  3AZK C;  1P3L A;  3B0D C;  3VH5 A;  1KX3 D;  2YFV B;  4H9O B;  4H9R A;  5B33 D;  3TU4 A;  5AY8 C;  5B1L C;  5B32 A;  3VH5 T;  1F66 D;  5CP6 B;  3AZI D;  1M18 A;  5BNV A;  5AV5 A;  3KWQ B;  1P3M D;  3AZG C;  4J8U A;  2YFW A;  4EO5 B;  1P3O B;  1PZR A;  1M1A B;  1P3K D;  3KXB B;  3LEL C;  1ID3 B;  5AV9 C;  3LZ0 D;  1P3I A;  2NQB C;  1N1J B;  3WAA C;  3AZF C;  4J8V A;  3W98 A;  4X23 D;  3REK C;  3EPJ A;  5B31 G;  3MGR A;  4NE3 A;  5CHL B;  5AV8 B;  5B32 C;  5CP6 D;  5CPK D;  3X1U B;  3C1B B;  3A1K A;  3AZE C;  5B33 A;  4XZQ A;  1M1A D;  1P3O D;  5BNX B;  3MGP A;  2Y2M A;  2F8N B;  3KXB D;  3A6N C;  5E5A C;  3AZI A;  4DRB A;  1ID3 D;  1P3K A;  4ZUX D;  3MVD A;  3LZ0 A;  2XD5 A;  2ZY3 A;  3P5J B;  2NZD B;  1P3A B;  3MNN B;  4G91 C;  1Z2C B;  5GT0 B;  5AV8 D;  3C1C B;  3X1U D;  4J8X B;  4X23 A;  3REJ B;  3UT9 C;  5AVC C;  3REL C;  3B6F B;  4Z2M H;  3MGP C;  3EPL A;  3X1T C;  5CPJ B;  3KUY D;  3AZJ A;  1TAF B;  3A1I A;  2FJ7 C;  3UTA C;  4CSR A;  2HIO D;  3WA9 B;  5B1M A;  1ZLA B;  5DNM C;  4R8P B;  1HQ3 A;  4NE6 A;  3W97 A;  1KU5 A;  5B32 G;  5DNN B;  3AYW A;  3X1V B;  3O62 B;  5GXQ C;  2NZD D;  1P3A D;  3AZN A;  2BYM A;  5GT0 D;  5GT3 C;  1TZY A;  4J8X D;  3REJ D;  5B24 A;  2ARO A;  3MGS C;  4WU9 A;  3REH A;  5BT1 C;  2Y2O A;  3B0D B;  5CPJ D;  3AFA B;  4JJN D;  3W96 B;  3WA9 D;  4R8P D;  3AN2 A;  4NFT A;  5DNN D;  3AV2 A;  5B0Z C;  2HIO A;  3AZM D;  1U35 A;  2CV5 B;  5B31 D;  4LD9 B;  4H9S C;  5AV9 B;  3NQJ A;  3LJA B;  1KX5 A;  2F8N H;  5B24 C;  5C3I C;  2ARO C;  4UUZ A;  4WU8 A;  1P3L B;  3AFA D;  4KGC A;  1M19 A;  3W96 D;  3WKJ C;  4G92 B;  5GSU C;  3TU4 B;  3H0L C;  3AZH A;  4Z5T A;  4DQY B;  4ZBJ C;  2BYK A;  1M18 B;  5BNV B;  5AV5 B;  3AZG D;  2F8N K;  4J8U B;  2YFW B;  3LEL D;  5KDM A;  1P34 A;  1ULY A;  3LZ1 C;  1EQZ C;  4LD9 D;  5AV9 D;  2JSS A;  3LJA D;  1P3I B;  1B67 A;  4AWL C;  1KX5 C;  2NQB D;  5B31 A;  4WU8 C;  2Y2H A;  1P3L D;  3AZF D;  4YM6 B;  4J8V B;  3W98 B;  3REK D;  4KUD A;  5B2J A;  3AZK A;  3MGR B;  5B32 D;  4H9P A;  1M18 D;  5AV5 D;  5B33 B;  4XZQ B;  5AY8 A;  4WNN A;  1BH9 A;  3AZI B;  5G49 A;  1P3I D;  1P3K B;  5B0Y C;  3MVD B;  4J8V D;  3LZ0 B;  2NQB A;  3W98 D;  1P3G A;  1KX4 C;  4KUD C;  1P3F A;  3WAA A;  1JFI A;  3AZF A;  3MGR D;  3REK A;  4X23 B;  4XZQ D;  3REL D;  3MGP D;  3X1T D;  1P3B C;  5CPK B;  4QLC C;  3AZJ B;  3AV1 C;  3AZE A;  2FJ7 D;  1S32 C;  4CSR B;  5B1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...