5B32C

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.3.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 30
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b32C00
3C1BA 1KX4C 2CV5B 2IO5C 3W97B 4ZBJC 5B31D 3AZLD 4X23B 1JFIB 2BYKB 3AZNC 5B32G 4H9PA 1P3OA 5B1MD 3LZ1C 3KWQD 5BNVA 3KXBC 5B33D 1HTAA 4NFTA 5B0YD 4J8VA 5CPJD 3AYWA 3UTBC 5CP6D 3A6ND 2YFWA 3AZHD 3AZKD 5BO0A 5B0ZA 5BS7A 1HQ3B 2FJ7A 3VH6T 3AN2D 1P3PB 4YM6A 3MGPA 1P3AA 3X1SC 3O62D 3WKJD 5AVCB 4Z66A 5AV9B 5GXQC 2PYOC 1WWSA 5B2ID 3X1UC 3MNNB 3REKD 4H9NA 3MVDA 2F8ND 5C3IC 3AFAD 3NQUA 1M19C 4WV4B 3W99B 1P3LB 3B6GA 5JRGA 2CV5C 4YS3A 1P3MD 3W97C 3MGQD 3AZID 5AV6D 1N1JB 4X23C 3MGRA 4J8UD 3AV1A 2FJ7C 5AY8A 1BH9A 3AZJA 5B24A 1P3AC 5CHLB 2YFVA 1B6WA 5B2JB 1P3BB 5CP6A 3AZLB 4G92B 3VH6A 4G91B 4R8PB 2HIOA 1U35A 2NZDB 5GT3B 1S32B 4WNNB 4H9RB 1P3PC 5B0YB 5G49B 3X1VD 3WA9A 4KUDA 3TU4B 5GT0B 5AV9C 4JJND 3MNNC 5F99D 4CAYA 4KHAB 4LD9A 3AV2D 3X1TA 3WAAD 1P3LC 4WU9D 1KX5A 5DNMD 3UT9A 3AFAB 3AZGA 1M1AD 1EQZD 3REJA 1M18D 4XUJA 1BH8B 3RELB 4EO5C 4KUDC 1KX4D 3W96A 5KDMA 5B2JC 1ZLAB 5B32B 1AOID 3REIA 4G92C 4G91C 3UTAB 2NZDC 5GT3C 5DNND 3X1TC 1S32C 5AV8D 2NQBB 5FUGA 3TU4C 5CPIB 5GT0C 1TAFB 4Z5TA 4WU8B 3R45A 5E5AD 1P3FA 3AZMD 3B0CT 3C1BD 3W96C 3C1CA 1P3OD 4H9OA 5CPKB 5B31G 5AVBB 3AYWD 4J8VD 3RELC 1TZYB 1P3IB 1KX3B 3LELA 1ZLAC 5B32C 5B0ZD 4KGCB 3NQJA 4UUZB 3UTAC 3AZNA 2FJ7D 1P34B 4YM6D 3LZ1A 3MGPD 1P3AD 3KXBA 3WTPB 2NQBC 3UTBA 2RVQD 4Z66D 5CPIC 4AWLB 3MVDD 4H9SC 2F8NG 4WU8C 3X1SA 3B6GD 4HGAB 5JRGD 2AROB 3LELC 4YS3D 5GXQA 2PYOA 3X1UA 3MGRD 3AV1D 5BNXA 5AY8D 5CPKC 3AZJD 4XZQB 5B24D 1M19A 1P3KB 1R4VA 1H3OB 5B1LB 5AVBC 3MGSB 1TZYC 2CV5A 1P3IC 1KX3C 3W97A 4ZUXB 3V9RB 2HIOD 1P3GB 4KGCC 1U35D 4X23A 3LZ0B 1JFIA 2BYKA 4CSRB 4NE6A 2HUEB 1P34C 5GSUB 3REHB 3WA9D 4KUDD 3WTPC 4Z2MH 3B6FB 3KUYB 4AWLC 5BT1C 2CWEA 1ID3B 1F66B 4LD9D 4YM6B 4NE3A 3X1TD 2F8NK 1P3PA 3LJAB 3AZFB 3W98B 4HGAC 4QLCB 3AZEB 2AROC 5AVCA 1KX5D 5AV9A 5AV5B 3MNNA 3UT9D 3AZGD 3NQUB 5B40B 3REJD 4J8WB 4XUJD 4J8XB 2LY8A 1P3KC 5B1LC 3W96D 1P3LA 3MGSC 5B31B 3REID 3VH6W 1P3GC 1HQ3C 1N1JA 3LZ0C 5B1MB 3KWQB 5B33B 2HUEC 5CPJB 5GSUC 3REHC 5CP6B 3A6NB 3AZHB 3AZKB 5B2JA 5AVCC 1P3BA 3B6FC 3KUYC 4H9QB 3AZMA 4R8PA 3AN2B 1ID3C 3VH5W 5GT3A 4Z5TD 1S32A 1F66C 2NZDA 4WNNA 2BYMB 3WTPE 4H9RA 3LJAC 3O62B 3AZFC 5G49A 3W99C 1P3FD 3WKJB 3W98C 5B2IB 3REKB 3AZEC 3C1CD 3TU4A 5GT0A 2F8NB 5AV5C 4KHAA 5B40C 4J8WC 1P3MB 3LELD 3MGQB 1P3BC 3AZIB 5AV6B 5B31C 3AZLC 4J8UB 4R8PC 3AZND 3KSYA 5B1MC 3KWQC 3LZ1D 5B0YC 5B33C 3KXBD 5CPJC 1BH8A 3RELA 3B0BA 3UTBD 3A6NC 3AZHC 1Q9CA 3AZKC 1ZLAA 5B32A 4DRAA 3UTAA 3AN2C 4M6BA 3X1VB 3X1SD 3O62C 3WKJC 2NQBA 5B2IC 4JJNB 5GXQD 3REKC 2PYOD 3X1UD 5CPIA 5F99B 1TAFA 3AFAC 3AV2B 4H9SA 3WAAB 1M19D 4WU8A 4WU9B 3C1CB 2CV5D 3MGQC 5JA4B 3AZIC 3W97D 5DNMB 5AV6C 1M1AB 4DRBA 4J8UC 4X23D 1EQZB 1M18B 1KU5A 5CPKA 5AVBA 1KX4B 2IO5B 1AOIB 1TZYA 1P3IA 1KX3A 4KGCA 1A7WA 5DNNB 5AV8B 1WWIA 4UUZA 3LZ1B 3KXBB 1P3PD 1ULYA 3B0CW 1P34A 3WTPA 5AVCD 5AV9D 4JJNC 3MNND 5F99C 3AV2C 5E5AB 3AZMB 3C1BB 4WU9C 1P3LD 2AROA 4NE5A 5C3IB 5DNMC 4H9PB 1P3OB 1M1AC 1EQZC 5BNVB 1M18C 1F1EA 3AYWB 4J8VB 4XZQA 1P3KA 1H3OA 5B1LA 4WZSB 2YFWB 1AOIC 5B2JD 5BO0B 5B0ZB 3MGSA 1P3BD 2FJ7B 4R8PD 4ZUXA 3V9RA 1P3GA 1HQ3A 5DNNC 2NZDD 3LZ0A 5GT3D 3MGPB 5AV8C 1S32D 1P3AB 4CSRA 5GSUA 3REHA 4Z66B 3TU4D 4H9NB 5GT0D 3MVDB 3B6FA 3KUYA 1ID3A 1F66A 5E5AC 4XZQC 3B6GB 3AZMC 1B67A 3LJAA 3C1BC 3AZFA 5JRGB 3W99A 4YS3B 3W98A 4QLCA 3AZEA 3MGRB 3AV1B 5AY8B 4ZUXC 1P3OC 1BH9B 5AV5A 3AZJB 5B24B 5B40A 3VH5T 2YFVB 3AYWC 4J8WA 4J8VC 4J8XA 3RELD 3B0DB 1ZLAD 5B32D 5B0ZC 2HIOB 5BS7C 5B31A 3AZLA 1U35B 3UTAD 5B1MA 4YM6C 4Z2MG 3KWQA 3MGPC 4EO5B 3WA9B 4KUDB 5B33A 5B0YA 5CPJA 2NQBD 2RVQC 4Z66C 3A6NA 3AZHA 4QLCC 3AZKA 5CPID 4CAYB 3MVDC 4LD9B 4H9QA 3X1TB 2JSSA 3AN2A 4WU8D 2BYMA 4J8XC 3B6GC 3O62A 5JRGC 3WKJA 4YS3C 1KX5B 5B2IA 3REKA 3UT9B 3AZGB 3MGRC 2F8NA 3AV1C 5AY8C 3VH5A 3AFAA 3AZJC 3REJB 5CPKD 4XUJB 5B24C 5AVBD 3W96B 5KDMB 5CP6C 1TZYD 3B0DC 3REIB 1P3ID 1P3MA 1KX3D 3MGQA 3AZIA 2HIOC 5AV6A 1U35C 4KGCD 4J8UA 1P34D 3WA9C 5FUGB 4E44A 3WTPD 5BT1D 4LD9C 4Z5TB 3R45B 4E45A 1P3FB 3X1VA 2F8NH 1P3MC 2AROD 1KX5C 4JJNA 3UT9C 4H9OB 3AZGC 5F99A 3AV2A 3REJC 4XUJC 4XZQD 3WAAA 1P3KD 5B1LD 4WU9A 3LELB 4ZBJB 3MGSD 3REIC 3NQJB 5JA4A 3AZNB 5DNMA 4ZUXD 1M1AA 1P3GD 1HQ3D 3LZ0D 1EQZA 1M18A 3X1VC 5GSUD 3UTBB 3REHD 1KX4A 1AOIA 3B6FD 1BFMA 3KUYD 2L5AA 5DNNA 4Z5TC 1ID3D 1F66D 5AV8A 3WAAC 3X1SB 1P3FC 3LJAD 3AZFD 3W99D 3W98D 5GXQB 2PYOB 3C1CC 3X1UB 4QLCD 3AZED 5BNXB 5AV5D 1M19B 5B40D 5E5AA 4J8WD 4J8XD
chains in the Genus database with same CATH superfamily
3C1BA 1KX4C 2CV5B 2IO5C 3W97B 4ZBJC 5B31D 3AZLD 4X23B 1JFIB 1W2EA 2BYKB 5B32G 4H9PA 3AZNC 1P3OA 2Y2JA 5B1MD 3LZ1C 3KWQD 5BNVA 3KXBC 5B33D 1HTAA 4NFTA 5B0YD 4J8VA 5CPJD 3AYWA 3UTBC 5CP6D 3A6ND 2YFWA 3AZHD 3P5JB 3AZKD 5BO0A 5B0ZA 5BS7A 1HQ3B 2FJ7A 3VH6T 3AN2D 1P3PB 4YM6A 3MGPA 2Y2IA 1P3AA 3X1SC 3O62D 3WKJD 5AVCB 3EPHA 4Z66A 5AV9B 5GXQC 2PYOC 1WWSA 5B2ID 3X1UC 3MNNB 3REKD 4H9NA 3MVDA 2F8ND 5C3IC 3AFAD 4UPKA 3NQUA 1M19C 4WV4B 3W99B 1P3LB 3B6GA 5JRGA 2CV5C 4YS3A 1P3MD 3W97C 3MGQD 3AZID 5AV6D 1N1JB 4X23C 3MGRA 4J8UD 3AV1A 2FJ7C 5AY8A 1BH9A 3AZJA 5B24A 1P3AC 5CHLB 2YFVA 1B6WA 5B2JB 1P3BB 5CP6A 3AZLB 4G92B 3VH6A 4G91B 4R8PB 2HIOA 1U35A 3H0MC 2NZDB 5GT3B 1S32B 2FFFB 4WNNB 4H9RB 1P3PC 5B0YB 5G49B 3X1VD 3WA9A 4KUDA 2Y2PA 3TU4B 5GT0B 5AV9C 4JJND 3MNNC 5F99D 4CAYA 4KHAB 4LD9A 3AV2D 3X1TA 3WAAD 1P3LC 4WU9D 1KX5A 5DNMD 3UT9A 3AFAB 3AZGA 1M1AD 1EQZD 3REJA 1M18D 4XUJA 1BH8B 3RELB 4EO5C 4KUDC 1KX4D 3W96A 2Y2NA 5KDMA 5B2JC 1ZLAB 5B32B 1AOID 2G5IC 3REIA 4G92C 4G91C 3UTAB 2NZDC 5GT3C 5DNND 3X1TC 1S32C 5AV8D 2XD5A 2NQBB 5FUGA 2Y2LA 3TU4C 5CPIB 5GT0C 1TAFB 3EPJA 3EPLA 4Z5TA 4WU8B 3R45A 2BG1A 5E5AD 1P3FA 3AZMD 3B0CT 3C1BD 3W96C 3C1CA 1P3OD 4H9OA 5CPKB 5B31G 5AVBB 3AYWD 4J8VD 3RELC 1TZYB 1P3IB 1KX3B 3LELA 1ZLAC 5B32C 5B0ZD 4KGCB 3NQJA 4UUZB 3UTAC 3AZNA 2FJ7D 1P34B 4YM6D 3LZ1A 3H0RC 3MGPD 1P3AD 3EG5B 3KXBA 3WTPB 2NQBC 3UTBA 2RVQD 4Z66D 2ZY5A 5CPIC 4AWLB 3MVDD 4H9SC 2F8NG 4WU8C 3X1SA 3B6GD 4HGAB 5JRGD 2AROB 3LELC 4YS3D 5GXQA 2PYOA 3X1UA 3MGRD 3AV1D 5BNXA 5AY8D 5CPKC 3AZJD 2JCHA 4XZQB 5B24D 1M19A 1P3KB 1R4VA 1H3OB 5B1LB 5AVBC 2Y2OA 4WJ3C 3MGSB 1TZYC 2CV5A 1P3IC 1KX3C 3W97A 4ZUXB 3V9RB 2HIOD 1P3GB 4KGCC 1U35D 4X23A 3LZ0B 1JFIA 2BYKA 4CSRB 4NE6A 2HUEB 1P34C 5GSUB 3REHB 3WA9D 4KUDD 3WTPC 4Z2MH 3FDDA 3B6FB 3KUYB 4AWLC 5BT1C 2CWEA 1ID3B 1F66B 4LD9D 4YM6B 4NE3A 3X1TD 2F8NK 1P3PA 3LJAB 3AZFB 3W98B 4HGAC 4QLCB 3AZEB 2AROC 5AVCA 1KX5D 5AV9A 5AV5B 3MNNA 3UT9D 3AZGD 3NQUB 5B40B 3REJD 4J8WB 4XUJD 4J8XB 2LY8A 1P3KC 5B1LC 3W96D 1P3LA 3MGSC 5B31B 3REID 3A1IA 3VH6W 1P3GC 1HQ3C 1N1JA 3LZ0C 5B1MB 3KWQB 5B33B 2HUEC 5CPJB 5GSUC 3REHC 5CP6B 3A6NB 3AZHB 3AZKB 5B2JA 5AVCC 4DQYB 1P3BA 3EPKA 3B6FC 3KUYC 4H9QB 3AZMA 4R8PA 3AN2B 1ID3C 3VH5W 5GT3A 4Z5TD 1S32A 1F66C 2NZDA 2DF4C 4WNNA 2BYMB 3WTPE 4H9RA 3LJAC 3O62B 3AZFC 5G49A 3W99C 1P3FD 3WKJB 3W98C 5B2IB 3REKB 3AZEC 3C1CD 3TU4A 5GT0A 2F8NB 5AV5C 4KHAA 5B40C 4J8WC 1P3MB 3LELD 3MGQB 1P3BC 3AZIB 5AV6B 5B31C 3AZLC 4J8UB 4R8PC 3AZND 2G5HC 3KSYA 5B1MC 3KWQC 3LZ1D 5B0YC 5B33C 3KXBD 5CPJC 1BH8A 3RELA 3B0BA 1T3UA 3A6NC 3UTBD 3AZHC 1Q9CA 3AZKC 1ZLAA 5B32A 4DRAA 3UTAA 3AN2C 4M6BA 3X1VB 3X1SD 3O62C 3WKJC 2NQBA 2Y2HA 5B2IC 4JJNB 5GXQD 3REKC 2PYOD 3X1UD 5CPIA 5F99B 1TAFA 3AFAC 3AV2B 4H9SA 3WAAB 1M19D 4WU8A 4WU9B 3C1CB 2CV5D 3A1KA 3MGQC 5JA4B 3AZIC 3W97D 5DNMB 5AV6C 1M1AB 4DRBA 4J8UC 4X23D 2VQRA 1EQZB 1M18B 1KU5A 5CPKA 2XD1A 5AVBA 2RIQA 1KX4B 3IP4C 2IO5B 1AOIB 1TZYA 1P3IA 1KX3A 2ZY3A 4KGCA 1A7WA 5DNNB 5AV8B 1WWIA 4UUZA 3LZ1B 3KXBB 1P3PD 1ULYA 3B0CW 1P34A 3WTPA 5AVCD 2DQNC 5AV9D 4JJNC 3MNND 5F99C 3AV2C 5E5AB 3AZMB 3C1BB 4WU9C 1P3LD 2Y2GA 2AROA 4NE5A 5C3IB 5DNMC 4H9PB 1P3OB 1M1AC 1EQZC 5BNVB 1M18C 1F1EA 1PZRA 3AYWB 4J8VB 4XZQA 1P3KA 1H3OA 5B1LA 2YFWB 4WZSB 1AOIC 5B2JD 5BO0B 5B0ZB 3MGSA 1P3BD 2FJ7B 4R8PD 4ZUXA 3V9RA 2J8PA 1HQ3A 5DNNC 1P3GA 2NZDD 3LZ0A 5GT3D 3MGPB 5AV8C 1S32D 1P3AB 4CSRA 5GSUA 3REHA 4Z66B 3TU4D 4H9NB 5GT0D 3MVDB 2ZM5A 3B6FA 3KUYA 1ID3A 1F66A 5E5AC 4XZQC 3B6GB 3AZMC 1B67A 3LJAA 2F2AC 3C1BC 3AZFA 5JRGB 3W99A 4YS3B 3W98A 4QLCA 3AZEA 3MGRB 3AV1B 5AY8B 4ZUXC 1P3OC 1BH9B 5AV5A 3AZJB 5B24B 5B40A 3VH5T 2YFVB 3AYWC 4J8WA 2Y2KA 4J8VC 4J8XA 3RELD 3B0DB 1ZLAD 5B32D 5B0ZC 2HIOB 5BS7C 5B31A 3AZLA 1U35B 3UTAD 5B1MA 4YM6C 4Z2MG 3KWQA 3MGPC 4EO5B 3WA9B 4KUDB 5B33A 5B0YA 5CPJA 2NQBD 2RVQC 4Z66C 3A6NA 3AZHA 2JE5A 4QLCC 2UWXA 3AZKA 5CPID 4CAYB 3MVDC 4LD9B 4H9QA 3X1TB 2JSSA 3AN2A 4WU8D 2BYMA 4J8XC 3B6GC 3O62A 5JRGC 3WKJA 4YS3C 1KX5B 5B2IA 3REKA 3UT9B 3AZGB 3MGRC 2F8NA 3AV1C 5AY8C 3AL0C 3VH5A 3AFAA 3AZJC 3REJB 5CPKD 4XUJB 5B24C 5AVBD 3W96B 5KDMB 5CP6C 1TZYD 2ZY4A 3B0DC 3REIB 1P3ID 1P3MA 1KX3D 3MGQA 3AZIA 2HIOC 5AV6A 2W8SA 3H0LC 1U35C 4KGCD 4J8UA 1P34D 3WA9C 5FUGB 4E44A 3WTPD 3KFUG 5BT1D 2Y2QA 4LD9C 4Z5TB 3R45B 4E45A 1P3FB 3X1VA 1Z2CB 2F8NH 1P3MC 2AROD 1KX5C 4JJNA 3UT9C 4H9OB 3AZGC 5F99A 3AV2A 3REJC 4XUJC 4XZQD 3WAAA 1P3KD 5B1LD 4WU9A 3LELB 4ZBJB 3MGSD 3REIC 3NQJB 5JA4A 3AZNB 5DNMA 4ZUXD 1M1AA 1P3GD 1HQ3D 3LZ0D 1EQZA 1M18A 3X1VC 5GSUD 3UTBB 3REHD 1KX4A 2Y2MA 1AOIA 3B6FD 2ZY2A 1BFMA 3KUYD 3F6TA 2L5AA 5DNNA 4Z5TC 1ID3D 1F66D 5AV8A 3WAAC 3X1SB 1P3FC 3LJAD 3AZFD 3W99D 3W98D 5GXQB 2PYOB 3C1CC 3X1UB 4QLCD 3AZED 5BNXB 5AV5D 1M19B 5B40D 5E5AA 4J8WD 4J8XD
chains in the Genus database with same CATH topology
3C1BA 1KX4C 2CV5B 2IO5C 3W97B 4ZBJC 5B31D 3AZLD 4X23B 1JFIB 1W2EA 2BYKB 5B32G 4H9PA 3AZNC 1P3OA 2Y2JA 5B1MD 3LZ1C 3KWQD 5BNVA 3KXBC 5B33D 1HTAA 4NFTA 5B0YD 4J8VA 5CPJD 3AYWA 3UTBC 5CP6D 3A6ND 2YFWA 3AZHD 3P5JB 3AZKD 5BO0A 5B0ZA 5BS7A 1HQ3B 2FJ7A 3VH6T 3AN2D 1P3PB 4YM6A 3MGPA 2Y2IA 1P3AA 3X1SC 3O62D 3WKJD 5AVCB 3EPHA 4Z66A 5AV9B 5GXQC 2PYOC 1WWSA 5B2ID 3X1UC 3MNNB 3REKD 4H9NA 3MVDA 2F8ND 5C3IC 3AFAD 4UPKA 3NQUA 1M19C 4WV4B 3W99B 1P3LB 3B6GA 5JRGA 2CV5C 4YS3A 1P3MD 3W97C 3MGQD 3AZID 5AV6D 1N1JB 4X23C 3MGRA 4J8UD 3AV1A 2FJ7C 5AY8A 1BH9A 3AZJA 5B24A 1P3AC 5CHLB 2YFVA 1B6WA 5B2JB 1P3BB 5CP6A 3AZLB 4G92B 3VH6A 4G91B 4R8PB 2HIOA 1U35A 3H0MC 2NZDB 5GT3B 1S32B 2FFFB 4WNNB 4H9RB 1P3PC 5B0YB 5G49B 3X1VD 3WA9A 4KUDA 2Y2PA 3TU4B 5GT0B 5AV9C 4JJND 3MNNC 5F99D 4CAYA 4KHAB 4LD9A 3AV2D 3X1TA 3WAAD 1P3LC 4WU9D 1KX5A 5DNMD 3UT9A 3AFAB 3AZGA 1M1AD 1EQZD 3REJA 1M18D 4XUJA 1BH8B 3RELB 4EO5C 4KUDC 1KX4D 3W96A 2Y2NA 5KDMA 5B2JC 1ZLAB 5B32B 1AOID 2G5IC 3REIA 4G92C 4G91C 3UTAB 2NZDC 5GT3C 5DNND 3X1TC 1S32C 5AV8D 2XD5A 2NQBB 5FUGA 2Y2LA 3TU4C 5CPIB 5GT0C 1TAFB 3EPJA 3EPLA 4Z5TA 4WU8B 3R45A 2BG1A 5E5AD 1P3FA 3AZMD 3B0CT 3C1BD 3W96C 3C1CA 1P3OD 4H9OA 5CPKB 5B31G 5AVBB 3AYWD 4J8VD 3RELC 1TZYB 1P3IB 1KX3B 3LELA 1ZLAC 5B32C 5B0ZD 4KGCB 3NQJA 4UUZB 3UTAC 3AZNA 2FJ7D 1P34B 4YM6D 3LZ1A 3H0RC 3MGPD 1P3AD 3EG5B 3KXBA 3WTPB 2NQBC 3UTBA 2RVQD 4Z66D 2ZY5A 5CPIC 4AWLB 3MVDD 4H9SC 2F8NG 4WU8C 3X1SA 3B6GD 4HGAB 5JRGD 2AROB 3LELC 4YS3D 5GXQA 2PYOA 3X1UA 3MGRD 3AV1D 5BNXA 5AY8D 5CPKC 3AZJD 2JCHA 4XZQB 5B24D 1M19A 1P3KB 1R4VA 1H3OB 5B1LB 5AVBC 2Y2OA 4WJ3C 3MGSB 1TZYC 2CV5A 1P3IC 1KX3C 3W97A 4ZUXB 3V9RB 2HIOD 1P3GB 4KGCC 1U35D 4X23A 3LZ0B 1JFIA 2BYKA 4CSRB 4NE6A 2HUEB 1P34C 5GSUB 3REHB 3WA9D 4KUDD 3WTPC 4Z2MH 3FDDA 3B6FB 3KUYB 4AWLC 5BT1C 2CWEA 1ID3B 1F66B 4LD9D 4YM6B 4NE3A 3X1TD 2F8NK 1P3PA 3LJAB 3AZFB 3W98B 4HGAC 4QLCB 3AZEB 2AROC 5AVCA 1KX5D 5AV9A 5AV5B 3MNNA 3UT9D 3AZGD 3NQUB 5B40B 3REJD 4J8WB 4XUJD 4J8XB 2LY8A 1P3KC 5B1LC 3W96D 1P3LA 3MGSC 5B31B 3REID 3A1IA 3VH6W 1P3GC 1HQ3C 1N1JA 3LZ0C 5B1MB 3KWQB 5B33B 2HUEC 5CPJB 5GSUC 3REHC 5CP6B 3A6NB 3AZHB 3AZKB 5B2JA 5AVCC 4DQYB 1P3BA 3EPKA 3B6FC 3KUYC 4H9QB 3AZMA 4R8PA 3AN2B 1ID3C 3VH5W 5GT3A 4Z5TD 1S32A 1F66C 2NZDA 2DF4C 4WNNA 2BYMB 3WTPE 4H9RA 3LJAC 3O62B 3AZFC 5G49A 3W99C 1P3FD 3WKJB 3W98C 5B2IB 3REKB 3AZEC 3C1CD 3TU4A 5GT0A 2F8NB 5AV5C 4KHAA 5B40C 4J8WC 1P3MB 3LELD 3MGQB 1P3BC 3AZIB 5AV6B 5B31C 3AZLC 4J8UB 4R8PC 3AZND 2G5HC 3KSYA 5B1MC 3KWQC 3LZ1D 5B0YC 5B33C 3KXBD 5CPJC 1BH8A 3RELA 3B0BA 1T3UA 3A6NC 3UTBD 3AZHC 1Q9CA 3AZKC 1ZLAA 5B32A 4DRAA 3UTAA 3AN2C 4M6BA 3X1VB 3X1SD 3O62C 3WKJC 2NQBA 2Y2HA 5B2IC 4JJNB 5GXQD 3REKC 2PYOD 3X1UD 5CPIA 5F99B 1TAFA 3AFAC 3AV2B 4H9SA 3WAAB 1M19D 4WU8A 4WU9B 3C1CB 2CV5D 3A1KA 3MGQC 5JA4B 3AZIC 3W97D 5DNMB 5AV6C 1M1AB 4DRBA 4J8UC 4X23D 2VQRA 1EQZB 1M18B 1KU5A 5CPKA 2XD1A 5AVBA 2RIQA 1KX4B 3IP4C 2IO5B 1AOIB 1TZYA 1P3IA 1KX3A 2ZY3A 4KGCA 1A7WA 5DNNB 5AV8B 1WWIA 4UUZA 3LZ1B 3KXBB 1P3PD 1ULYA 3B0CW 1P34A 3WTPA 5AVCD 2DQNC 5AV9D 4JJNC 3MNND 5F99C 3AV2C 5E5AB 3AZMB 3C1BB 4WU9C 1P3LD 2Y2GA 2AROA 4NE5A 5C3IB 5DNMC 4H9PB 1P3OB 1M1AC 1EQZC 5BNVB 1M18C 1F1EA 1PZRA 3AYWB 4J8VB 4XZQA 1P3KA 1H3OA 5B1LA 2YFWB 4WZSB 1AOIC 5B2JD 5BO0B 5B0ZB 3MGSA 1P3BD 2FJ7B 4R8PD 4ZUXA 3V9RA 2J8PA 1HQ3A 5DNNC 1P3GA 2NZDD 3LZ0A 5GT3D 3MGPB 5AV8C 1S32D 1P3AB 4CSRA 5GSUA 3REHA 4Z66B 3TU4D 4H9NB 5GT0D 3MVDB 2ZM5A 3B6FA 3KUYA 1ID3A 1F66A 5E5AC 4XZQC 3B6GB 3AZMC 1B67A 3LJAA 2F2AC 3C1BC 3AZFA 5JRGB 3W99A 4YS3B 3W98A 4QLCA 3AZEA 3MGRB 3AV1B 5AY8B 4ZUXC 1P3OC 1BH9B 5AV5A 3AZJB 5B24B 5B40A 3VH5T 2YFVB 3AYWC 4J8WA 2Y2KA 4J8VC 4J8XA 3RELD 3B0DB 1ZLAD 5B32D 5B0ZC 2HIOB 5BS7C 5B31A 3AZLA 1U35B 3UTAD 5B1MA 4YM6C 4Z2MG 3KWQA 3MGPC 4EO5B 3WA9B 4KUDB 5B33A 5B0YA 5CPJA 2NQBD 2RVQC 4Z66C 3A6NA 3AZHA 2JE5A 4QLCC 2UWXA 3AZKA 5CPID 4CAYB 3MVDC 4LD9B 4H9QA 3X1TB 2JSSA 3AN2A 4WU8D 2BYMA 4J8XC 3B6GC 3O62A 5JRGC 3WKJA 4YS3C 1KX5B 5B2IA 3REKA 3UT9B 3AZGB 3MGRC 2F8NA 3AV1C 5AY8C 3AL0C 3VH5A 3AFAA 3AZJC 3REJB 5CPKD 4XUJB 5B24C 5AVBD 3W96B 5KDMB 5CP6C 1TZYD 2ZY4A 3B0DC 3REIB 1P3ID 1P3MA 1KX3D 3MGQA 3AZIA 2HIOC 5AV6A 2W8SA 3H0LC 1U35C 4KGCD 4J8UA 1P34D 3WA9C 5FUGB 4E44A 3WTPD 3KFUG 5BT1D 2Y2QA 4LD9C 4Z5TB 3R45B 4E45A 1P3FB 3X1VA 1Z2CB 2F8NH 1P3MC 2AROD 1KX5C 4JJNA 3UT9C 4H9OB 3AZGC 5F99A 3AV2A 3REJC 4XUJC 4XZQD 3WAAA 1P3KD 5B1LD 4WU9A 3LELB 4ZBJB 3MGSD 3REIC 3NQJB 5JA4A 3AZNB 5DNMA 4ZUXD 1M1AA 1P3GD 1HQ3D 3LZ0D 1EQZA 1M18A 3X1VC 5GSUD 3UTBB 3REHD 1KX4A 2Y2MA 1AOIA 3B6FD 2ZY2A 1BFMA 3KUYD 3F6TA 2L5AA 5DNNA 4Z5TC 1ID3D 1F66D 5AV8A 3WAAC 3X1SB 1P3FC 3LJAD 3AZFD 3W99D 3W98D 5GXQB 2PYOB 3C1CC 3X1UB 4QLCD 3AZED 5BNXB 5AV5D 1M19B 5B40D 5E5AA 4J8WD 4J8XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B A;  1KX4 C;  2CV5 B;  2IO5 C;  3W97 B;  4ZBJ C;  5B31 D;  3AZL D;  4X23 B;  1JFI B;  2BYK B;  3AZN C;  5B32 G;  4H9P A;  1P3O A;  5B1M D;  3LZ1 C;  3KWQ D;  5BNV A;  3KXB C;  5B33 D;  1HTA A;  4NFT A;  5B0Y D;  4J8V A;  5CPJ D;  3AYW A;  3UTB C;  5CP6 D;  3A6N D;  2YFW A;  3AZH D;  3AZK D;  5BO0 A;  5B0Z A;  5BS7 A;  1HQ3 B;  2FJ7 A;  3VH6 T;  3AN2 D;  1P3P B;  4YM6 A;  3MGP A;  1P3A A;  3X1S C;  3O62 D;  3WKJ D;  5AVC B;  4Z66 A;  5AV9 B;  5GXQ C;  2PYO C;  1WWS A;  5B2I D;  3X1U C;  3MNN B;  3REK D;  4H9N A;  3MVD A;  2F8N D;  5C3I C;  3AFA D;  3NQU A;  1M19 C;  4WV4 B;  3W99 B;  1P3L B;  3B6G A;  5JRG A;  2CV5 C;  4YS3 A;  1P3M D;  3W97 C;  3MGQ D;  3AZI D;  5AV6 D;  1N1J B;  4X23 C;  3MGR A;  4J8U D;  3AV1 A;  2FJ7 C;  5AY8 A;  1BH9 A;  3AZJ A;  5B24 A;  1P3A C;  5CHL B;  2YFV A;  1B6W A;  5B2J B;  1P3B B;  5CP6 A;  3AZL B;  4G92 B;  3VH6 A;  4G91 B;  4R8P B;  2HIO A;  1U35 A;  2NZD B;  5GT3 B;  1S32 B;  4WNN B;  4H9R B;  1P3P C;  5B0Y B;  5G49 B;  3X1V D;  3WA9 A;  4KUD A;  3TU4 B;  5GT0 B;  5AV9 C;  4JJN D;  3MNN C;  5F99 D;  4CAY A;  4KHA B;  4LD9 A;  3AV2 D;  3X1T A;  3WAA D;  1P3L C;  4WU9 D;  1KX5 A;  5DNM D;  3UT9 A;  3AFA B;  3AZG A;  1M1A D;  1EQZ D;  3REJ A;  1M18 D;  4XUJ A;  1BH8 B;  3REL B;  4EO5 C;  4KUD C;  1KX4 D;  3W96 A;  5KDM A;  5B2J C;  1ZLA B;  5B32 B;  1AOI D;  3REI A;  4G92 C;  4G91 C;  3UTA B;  2NZD C;  5GT3 C;  5DNN D;  3X1T C;  1S32 C;  5AV8 D;  2NQB B;  5FUG A;  3TU4 C;  5CPI B;  5GT0 C;  1TAF B;  4Z5T A;  4WU8 B;  3R45 A;  5E5A D;  1P3F A;  3AZM D;  3B0C T;  3C1B D;  3W96 C;  3C1C A;  1P3O D;  4H9O A;  5CPK B;  5B31 G;  5AVB B;  3AYW D;  4J8V D;  3REL C;  1TZY B;  1P3I B;  1KX3 B;  3LEL A;  1ZLA C;  5B32 C;  5B0Z D;  4KGC B;  3NQJ A;  4UUZ B;  3UTA C;  3AZN A;  2FJ7 D;  1P34 B;  4YM6 D;  3LZ1 A;  3MGP D;  1P3A D;  3KXB A;  3WTP B;  2NQB C;  3UTB A;  2RVQ D;  4Z66 D;  5CPI C;  4AWL B;  3MVD D;  4H9S C;  2F8N G;  4WU8 C;  3X1S A;  3B6G D;  4HGA B;  5JRG D;  2ARO B;  3LEL C;  4YS3 D;  5GXQ A;  2PYO A;  3X1U A;  3MGR D;  3AV1 D;  5BNX A;  5AY8 D;  5CPK C;  3AZJ D;  4XZQ B;  5B24 D;  1M19 A;  1P3K B;  1R4V A;  1H3O B;  5B1L B;  5AVB C;  3MGS B;  1TZY C;  2CV5 A;  1P3I C;  1KX3 C;  3W97 A;  4ZUX B;  3V9R B;  2HIO D;  1P3G B;  4KGC C;  1U35 D;  4X23 A;  3LZ0 B;  1JFI A;  2BYK A;  4CSR B;  4NE6 A;  2HUE B;  1P34 C;  5GSU B;  3REH B;  3WA9 D;  4KUD D;  3WTP C;  4Z2M H;  3B6F B;  3KUY B;  4AWL C;  5BT1 C;  2CWE A;  1ID3 B;  1F66 B;  4LD9 D;  4YM6 B;  4NE3 A;  3X1T D;  2F8N K;  1P3P A;  3LJA B;  3AZF B;  3W98 B;  4HGA C;  4QLC B;  3AZE B;  2ARO C;  5AVC A;  1KX5 D;  5AV9 A;  5AV5 B;  3MNN A;  3UT9 D;  3AZG D;  3NQU B;  5B40 B;  3REJ D;  4J8W B;  4XUJ D;  4J8X B;  2LY8 A;  1P3K C;  5B1L C;  3W96 D;  1P3L A;  3MGS C;  5B31 B;  3REI D;  3VH6 W;  1P3G C;  1HQ3 C;  1N1J A;  3LZ0 C;  5B1M B;  3KWQ B;  5B33 B;  2HUE C;  5CPJ B;  5GSU C;  3REH C;  5CP6 B;  3A6N B;  3AZH B;  3AZK B;  5B2J A;  5AVC C;  1P3B A;  3B6F C;  3KUY C;  4H9Q B;  3AZM A;  4R8P A;  3AN2 B;  1ID3 C;  3VH5 W;  5GT3 A;  4Z5T D;  1S32 A;  1F66 C;  2NZD A;  4WNN A;  2BYM B;  3WTP E;  4H9R A;  3LJA C;  3O62 B;  3AZF C;  5G49 A;  3W99 C;  1P3F D;  3WKJ B;  3W98 C;  5B2I B;  3REK B;  3AZE C;  3C1C D;  3TU4 A;  5GT0 A;  2F8N B;  5AV5 C;  4KHA A;  5B40 C;  4J8W C;  1P3M B;  3LEL D;  3MGQ B;  1P3B C;  3AZI B;  5AV6 B;  5B31 C;  3AZL C;  4J8U B;  4R8P C;  3AZN D;  3KSY A;  5B1M C;  3KWQ C;  3LZ1 D;  5B0Y C;  5B33 C;  3KXB D;  5CPJ C;  1BH8 A;  3REL A;  3B0B A;  3UTB D;  3A6N C;  3AZH C;  1Q9C A;  3AZK C;  1ZLA A;  5B32 A;  4DRA A;  3UTA A;  3AN2 C;  4M6B A;  3X1V B;  3X1S D;  3O62 C;  3WKJ C;  2NQB A;  5B2I C;  4JJN B;  5GXQ D;  3REK C;  2PYO D;  3X1U D;  5CPI A;  5F99 B;  1TAF A;  3AFA C;  3AV2 B;  4H9S A;  3WAA B;  1M19 D;  4WU8 A;  4WU9 B;  3C1C B;  2CV5 D;  3MGQ C;  5JA4 B;  3AZI C;  3W97 D;  5DNM B;  5AV6 C;  1M1A B;  4DRB A;  4J8U C;  4X23 D;  1EQZ B;  1M18 B;  1KU5 A;  5CPK A;  5AVB A;  1KX4 B;  2IO5 B;  1AOI B;  1TZY A;  1P3I A;  1KX3 A;  4KGC A;  1A7W A;  5DNN B;  5AV8 B;  1WWI A;  4UUZ A;  3LZ1 B;  3KXB B;  1P3P D;  1ULY A;  3B0C W;  1P34 A;  3WTP A;  5AVC D;  5AV9 D;  4JJN C;  3MNN D;  5F99 C;  3AV2 C;  5E5A B;  3AZM B;  3C1B B;  4WU9 C;  1P3L D;  2ARO A;  4NE5 A;  5C3I B;  5DNM C;  4H9P B;  1P3O B;  1M1A C;  1EQZ C;  5BNV B;  1M18 C;  1F1E A;  3AYW B;  4J8V B;  4XZQ A;  1P3K A;  1H3O A;  5B1L A;  4WZS B;  2YFW B;  1AOI C;  5B2J D;  5BO0 B;  5B0Z B;  3MGS A;  1P3B D;  2FJ7 B;  4R8P D;  4ZUX A;  3V9R A;  1P3G A;  1HQ3 A;  5DNN C;  2NZD D;  3LZ0 A;  5GT3 D;  3MGP B;  5AV8 C;  1S32 D;  1P3A B;  4CSR A;  5GSU A;  3REH A;  4Z66 B;  3TU4 D;  4H9N B;  5GT0 D;  3MVD B;  3B6F A;  3KUY A;  1ID3 A;  1F66 A;  5E5A C;  4XZQ C;  3B6G B;  3AZM C;  1B67 A;  3LJA A;  3C1B C;  3AZF A;  5JRG B;  3W99 A;  4YS3 B;  3W98 A;  4QLC A;  3AZE A;  3MGR B;  3AV1 B;  5AY8 B;  4ZUX C;  1P3O C;  1BH9 B;  5AV5 A;  3AZJ B;  5B24 B;  5B40 A;  3VH5 T;  2YFV B;  3AYW C;  4J8W A;  4J8V C;  4J8X A;  3REL D;  3B0D B;  1ZLA D;  5B32 D;  5B0Z C;  2HIO B;  5BS7 C;  5B31 A;  3AZL A;  1U35 B;  3UTA D;  5B1M A;  4YM6 C;  4Z2M G;  3KWQ A;  3MGP C;  4EO5 B;  3WA9 B;  4KUD B;  5B33 A;  5B0Y A;  5CPJ A;  2NQB D;  2RVQ C;  4Z66 C;  3A6N A;  3AZH A;  4QLC C;  3AZK A;  5CPI D;  4CAY B;  3MVD C;  4LD9 B;  4H9Q A;  3X1T B;  2JSS A;  3AN2 A;  4WU8 D;  2BYM A;  4J8X C;  3B6G C;  3O62 A;  5JRG C;  3WKJ A;  4YS3 C;  1KX5 B;  5B2I A;  3REK A;  3UT9 B;  3AZG B;  3MGR C;  2F8N A;  3AV1 C;  5AY8 C;  3VH5 A;  3AFA A;  3AZJ C;  3REJ B;  5CPK D;  4XUJ B;  5B24 C;  5AVB D;  3W96 B;  5KDM B;  5CP6 C;  1TZY D;  3B0D C;  3REI B;  1P3I D;  1P3M A;  1KX3 D;  3MGQ A;  3AZI A;  2HIO C;  5AV6 A;  1U35 C;  4KGC D;  4J8U A;  1P34 D;  3WA9 C;  5FUG B;  4E44 A;  3WTP D;  5BT1 D;  4LD9 C;  4Z5T B;  3R45 B;  4E45 A;  1P3F B;  3X1V A;  2F8N H;  1P3M C;  2ARO D;  1KX5 C;  4JJN A;  3UT9 C;  4H9O B;  3AZG C;  5F99 A;  3AV2 A;  3REJ C;  4XUJ C;  4XZQ D;  3WAA A;  1P3K D;  5B1L D;  4WU9 A;  3LEL B;  4ZBJ B;  3MGS D;  3REI C;  3NQJ B;  5JA4 A;  3AZN B;  5DNM A;  4ZUX D;  1M1A A;  1P3G D;  1HQ3 D;  3LZ0 D;  1EQZ A;  1M18 A;  3X1V C;  5GSU D;  3UTB B;  3REH D;  1KX4 A;  1AOI A;  3B6F D;  1BFM A;  3KUY D;  2L5A A;  5DNN A;  4Z5T C;  1ID3 D;  1F66 D;  5AV8 A;  3WAA C;  3X1S B;  1P3F C;  3LJA D;  3AZF D;  3W99 D;  3W98 D;  5GXQ B;  2PYO B;  3C1C C;  3X1U B;  4QLC D;  3AZE D;  5BNX B;  5AV5 D;  1M19 B;  5B40 D;  5E5A A;  4J8W D;  4J8X D; 
#chains in the Genus database with same CATH topology
 3C1B A;  1KX4 C;  2CV5 B;  2IO5 C;  3W97 B;  4ZBJ C;  5B31 D;  3AZL D;  4X23 B;  1JFI B;  1W2E A;  2BYK B;  5B32 G;  4H9P A;  3AZN C;  1P3O A;  2Y2J A;  5B1M D;  3LZ1 C;  3KWQ D;  5BNV A;  3KXB C;  5B33 D;  1HTA A;  4NFT A;  5B0Y D;  4J8V A;  5CPJ D;  3AYW A;  3UTB C;  5CP6 D;  3A6N D;  2YFW A;  3AZH D;  3P5J B;  3AZK D;  5BO0 A;  5B0Z A;  5BS7 A;  1HQ3 B;  2FJ7 A;  3VH6 T;  3AN2 D;  1P3P B;  4YM6 A;  3MGP A;  2Y2I A;  1P3A A;  3X1S C;  3O62 D;  3WKJ D;  5AVC B;  3EPH A;  4Z66 A;  5AV9 B;  5GXQ C;  2PYO C;  1WWS A;  5B2I D;  3X1U C;  3MNN B;  3REK D;  4H9N A;  3MVD A;  2F8N D;  5C3I C;  3AFA D;  4UPK A;  3NQU A;  1M19 C;  4WV4 B;  3W99 B;  1P3L B;  3B6G A;  5JRG A;  2CV5 C;  4YS3 A;  1P3M D;  3W97 C;  3MGQ D;  3AZI D;  5AV6 D;  1N1J B;  4X23 C;  3MGR A;  4J8U D;  3AV1 A;  2FJ7 C;  5AY8 A;  1BH9 A;  3AZJ A;  5B24 A;  1P3A C;  5CHL B;  2YFV A;  1B6W A;  5B2J B;  1P3B B;  5CP6 A;  3AZL B;  4G92 B;  3VH6 A;  4G91 B;  4R8P B;  2HIO A;  1U35 A;  3H0M C;  2NZD B;  5GT3 B;  1S32 B;  2FFF B;  4WNN B;  4H9R B;  1P3P C;  5B0Y B;  5G49 B;  3X1V D;  3WA9 A;  4KUD A;  2Y2P A;  3TU4 B;  5GT0 B;  5AV9 C;  4JJN D;  3MNN C;  5F99 D;  4CAY A;  4KHA B;  4LD9 A;  3AV2 D;  3X1T A;  3WAA D;  1P3L C;  4WU9 D;  1KX5 A;  5DNM D;  3UT9 A;  3AFA B;  3AZG A;  1M1A D;  1EQZ D;  3REJ A;  1M18 D;  4XUJ A;  1BH8 B;  3REL B;  4EO5 C;  4KUD C;  1KX4 D;  3W96 A;  2Y2N A;  5KDM A;  5B2J C;  1ZLA B;  5B32 B;  1AOI D;  2G5I C;  3REI A;  4G92 C;  4G91 C;  3UTA B;  2NZD C;  5GT3 C;  5DNN D;  3X1T C;  1S32 C;  5AV8 D;  2XD5 A;  2NQB B;  5FUG A;  2Y2L A;  3TU4 C;  5CPI B;  5GT0 C;  1TAF B;  3EPJ A;  3EPL A;  4Z5T A;  4WU8 B;  3R45 A;  2BG1 A;  5E5A D;  1P3F A;  3AZM D;  3B0C T;  3C1B D;  3W96 C;  3C1C A;  1P3O D;  4H9O A;  5CPK B;  5B31 G;  5AVB B;  3AYW D;  4J8V D;  3REL C;  1TZY B;  1P3I B;  1KX3 B;  3LEL A;  1ZLA C;  5B32 C;  5B0Z D;  4KGC B;  3NQJ A;  4UUZ B;  3UTA C;  3AZN A;  2FJ7 D;  1P34 B;  4YM6 D;  3LZ1 A;  3H0R C;  3MGP D;  1P3A D;  3EG5 B;  3KXB A;  3WTP B;  2NQB C;  3UTB A;  2RVQ D;  4Z66 D;  2ZY5 A;  5CPI C;  4AWL B;  3MVD D;  4H9S C;  2F8N G;  4WU8 C;  3X1S A;  3B6G D;  4HGA B;  5JRG D;  2ARO B;  3LEL C;  4YS3 D;  5GXQ A;  2PYO A;  3X1U A;  3MGR D;  3AV1 D;  5BNX A;  5AY8 D;  5CPK C;  3AZJ D;  2JCH A;  4XZQ B;  5B24 D;  1M19 A;  1P3K B;  1R4V A;  1H3O B;  5B1L B;  5AVB C;  2Y2O A;  4WJ3 C;  3MGS B;  1TZY C;  2CV5 A;  1P3I C;  1KX3 C;  3W97 A;  4ZUX B;  3V9R B;  2HIO D;  1P3G B;  4KGC C;  1U35 D;  4X23 A;  3LZ0 B;  1JFI A;  2BYK A;  4CSR B;  4NE6 A;  2HUE B;  1P34 C;  5GSU B;  3REH B;  3WA9 D;  4KUD D;  3WTP C;  4Z2M H;  3FDD A;  3B6F B;  3KUY B;  4AWL C;  5BT1 C;  2CWE A;  1ID3 B;  1F66 B;  4LD9 D;  4YM6 B;  4NE3 A;  3X1T D;  2F8N K;  1P3P A;  3LJA B;  3AZF B;  3W98 B;  4HGA C;  4QLC B;  3AZE B;  2ARO C;  5AVC A;  1KX5 D;  5AV9 A;  5AV5 B;  3MNN A;  3UT9 D;  3AZG D;  3NQU B;  5B40 B;  3REJ D;  4J8W B;  4XUJ D;  4J8X B;  2LY8 A;  1P3K C;  5B1L C;  3W96 D;  1P3L A;  3MGS C;  5B31 B;  3REI D;  3A1I A;  3VH6 W;  1P3G C;  1HQ3 C;  1N1J A;  3LZ0 C;  5B1M B;  3KWQ B;  5B33 B;  2HUE C;  5CPJ B;  5GSU C;  3REH C;  5CP6 B;  3A6N B;  3AZH B;  3AZK B;  5B2J A;  5AVC C;  4DQY B;  1P3B A;  3EPK A;  3B6F C;  3KUY C;  4H9Q B;  3AZM A;  4R8P A;  3AN2 B;  1ID3 C;  3VH5 W;  5GT3 A;  4Z5T D;  1S32 A;  1F66 C;  2NZD A;  2DF4 C;  4WNN A;  2BYM B;  3WTP E;  4H9R A;  3LJA C;  3O62 B;  3AZF C;  5G49 A;  3W99 C;  1P3F D;  3WKJ B;  3W98 C;  5B2I B;  3REK B;  3AZE C;  3C1C D;  3TU4 A;  5GT0 A;  2F8N B;  5AV5 C;  4KHA A;  5B40 C;  4J8W C;  1P3M B;  3LEL D;  3MGQ B;  1P3B C;  3AZI B;  5AV6 B;  5B31 C;  3AZL C;  4J8U B;  4R8P C;  3AZN D;  2G5H C;  3KSY A;  5B1M C;  3KWQ C;  3LZ1 D;  5B0Y C;  5B33 C;  3KXB D;  5CPJ C;  1BH8 A;  3REL A;  3B0B A;  1T3U A;  3A6N C;  3UTB D;  3AZH C;  1Q9C A;  3AZK C;  1ZLA A;  5B32 A;  4DRA A;  3UTA A;  3AN2 C;  4M6B A;  3X1V B;  3X1S D;  3O62 C;  3WKJ C;  2NQB A;  2Y2H A;  5B2I C;  4JJN B;  5GXQ D;  3REK C;  2PYO D;  3X1U D;  5CPI A;  5F99 B;  1TAF A;  3AFA C;  3AV2 B;  4H9S A;  3WAA B;  1M19 D;  4WU8 A;  4WU9 B;  3C1C B;  2CV5 D;  3A1K A;  3MGQ C;  5JA4 B;  3AZI C;  3W97 D;  5DNM B;  5AV6 C;  1M1A B;  4DRB A;  4J8U C;  4X23 D;  2VQR A;  1EQZ B;  1M18 B;  1KU5 A;  5CPK A;  2XD1 A;  5AVB A;  2RIQ A;  1KX4 B;  3IP4 C;  2IO5 B;  1AOI B;  1TZY A;  1P3I A;  1KX3 A;  2ZY3 A;  4KGC A;  1A7W A;  5DNN B;  5AV8 B;  1WWI A;  4UUZ A;  3LZ1 B;  3KXB B;  1P3P D;  1ULY A;  3B0C W;  1P34 A;  3WTP A;  5AVC D;  2DQN C;  5AV9 D;  4JJN C;  3MNN D;  5F99 C;  3AV2 C;  5E5A B;  3AZM B;  3C1B B;  4WU9 C;  1P3L D;  2Y2G A;  2ARO A;  4NE5 A;  5C3I B;  5DNM C;  4H9P B;  1P3O B;  1M1A C;  1EQZ C;  5BNV B;  1M18 C;  1F1E A;  1PZR A;  3AYW B;  4J8V B;  4XZQ A;  1P3K A;  1H3O A;  5B1L A;  2YFW B;  4WZS B;  1AOI C;  5B2J D;  5BO0 B;  5B0Z B;  3MGS A;  1P3B D;  2FJ7 B;  4R8P D;  4ZUX A;  3V9R A;  2J8P A;  1HQ3 A;  5DNN C;  1P3G A;  2NZD D;  3LZ0 A;  5GT3 D;  3MGP B;  5AV8 C;  1S32 D;  1P3A B;  4CSR A;  5GSU A;  3REH A;  4Z66 B;  3TU4 D;  4H9N B;  5GT0 D;  3MVD B;  2ZM5 A;  3B6F A;  3KUY A;  1ID3 A;  1F66 A;  5E5A C;  4XZQ C;  3B6G B;  3AZM C;  1B67 A;  3LJA A;  2F2A C;  3C1B C;  3AZF A;  5JRG B;  3W99 A;  4YS3 B;  3W98 A;  4QLC A;  3AZE A;  3MGR B;  3AV1 B;  5AY8 B;  4ZUX C;  1P3O C;  1BH9 B;  5AV5 A;  3AZJ B;  5B24 B;  5B40 A;  3VH5 T;  2YFV B;  3AYW C;  4J8W A;  2Y2K A;  4J8V C;  4J8X A;  3REL D;  3B0D B;  1ZLA D;  5B32 D;  5B0Z C;  2HIO B;  5BS7 C;  5B31 A;  3AZL A;  1U35 B;  3UTA D;  5B1M A;  4YM6 C;  4Z2M G;  3KWQ A;  3MGP C;  4EO5 B;  3WA9 B;  4KUD B;  5B33 A;  5B0Y A;  5CPJ A;  2NQB D;  2RVQ C;  4Z66 C;  3A6N A;  3AZH A;  2JE5 A;  4QLC C;  2UWX A;  3AZK A;  5CPI D;  4CAY B;  3MVD C;  4LD9 B;  4H9Q A;  3X1T B;  2JSS A;  3AN2 A;  4WU8 D;  2BYM A;  4J8X C;  3B6G C;  3O62 A;  5JRG C;  3WKJ A;  4YS3 C;  1KX5 B;  5B2I A;  3REK A;  3UT9 B;  3AZG B;  3MGR C;  2F8N A;  3AV1 C;  5AY8 C;  3AL0 C;  3VH5 A;  3AFA A;  3AZJ C;  3REJ B;  5CPK D;  4XUJ B;  5B24 C;  5AVB D;  3W96 B;  5KDM B;  5CP6 C;  1TZY D;  2ZY4 A;  3B0D C;  3REI B;  1P3I D;  1P3M A;  1KX3 D;  3MGQ A;  3AZI A;  2HIO C;  5AV6 A;  2W8S A;  3H0L C;  1U35 C;  4KGC D;  4J8U A;  1P34 D;  3WA9 C;  5FUG B;  4E44 A;  3WTP D;  3KFU G;  5BT1 D;  2Y2Q A;  4LD9 C;  4Z5T B;  3R45 B;  4E45 A;  1P3F B;  3X1V A;  1Z2C B;  2F8N H;  1P3M C;  2ARO D;  1KX5 C;  4JJN A;  3UT9 C;  4H9O B;  3AZG C;  5F99 A;  3AV2 A;  3REJ C;  4XUJ C;  4XZQ D;  3WAA A;  1P3K D;  5B1L D;  4WU9 A;  3LEL B;  4ZBJ B;  3MGS D;  3REI C;  3NQJ B;  5JA4 A;  3AZN B;  5DNM A;  4ZUX D;  1M1A A;  1P3G D;  1HQ3 D;  3LZ0 D;  1EQZ A;  1M18 A;  3X1V C;  5GSU D;  3UTB B;  3REH D;  1KX4 A;  2Y2M A;  1AOI A;  3B6F D;  2ZY2 A;  1BFM A;  3KUY D;  3F6T A;  2L5A A;  5DNN A;  4Z5T C;  1ID3 D;  1F66 D;  5AV8 A;  3WAA C;  3X1S B;  1P3F C;  3LJA D;  3AZF D;  3W99 D;  3W98 D;  5GXQ B;  2PYO B;  3C1C C;  3X1U B;  4QLC D;  3AZE D;  5BNX B;  5AV5 D;  1M19 B;  5B40 D;  5E5A A;  4J8W D;  4J8X D; 
#chains in the Genus database with same CATH homology
 3C1B A;  1KX4 C;  2CV5 B;  2IO5 C;  3W97 B;  4ZBJ C;  5B31 D;  3AZL D;  4X23 B;  1JFI B;  1W2E A;  2BYK B;  5B32 G;  4H9P A;  3AZN C;  1P3O A;  2Y2J A;  5B1M D;  3LZ1 C;  3KWQ D;  5BNV A;  3KXB C;  5B33 D;  1HTA A;  4NFT A;  5B0Y D;  4J8V A;  5CPJ D;  3AYW A;  3UTB C;  5CP6 D;  3A6N D;  2YFW A;  3AZH D;  3P5J B;  3AZK D;  5BO0 A;  5B0Z A;  5BS7 A;  1HQ3 B;  2FJ7 A;  3VH6 T;  3AN2 D;  1P3P B;  4YM6 A;  3MGP A;  2Y2I A;  1P3A A;  3X1S C;  3O62 D;  3WKJ D;  5AVC B;  3EPH A;  4Z66 A;  5AV9 B;  5GXQ C;  2PYO C;  1WWS A;  5B2I D;  3X1U C;  3MNN B;  3REK D;  4H9N A;  3MVD A;  2F8N D;  5C3I C;  3AFA D;  4UPK A;  3NQU A;  1M19 C;  4WV4 B;  3W99 B;  1P3L B;  3B6G A;  5JRG A;  2CV5 C;  4YS3 A;  1P3M D;  3W97 C;  3MGQ D;  3AZI D;  5AV6 D;  1N1J B;  4X23 C;  3MGR A;  4J8U D;  3AV1 A;  2FJ7 C;  5AY8 A;  1BH9 A;  3AZJ A;  5B24 A;  1P3A C;  5CHL B;  2YFV A;  1B6W A;  5B2J B;  1P3B B;  5CP6 A;  3AZL B;  4G92 B;  3VH6 A;  4G91 B;  4R8P B;  2HIO A;  1U35 A;  3H0M C;  2NZD B;  5GT3 B;  1S32 B;  2FFF B;  4WNN B;  4H9R B;  1P3P C;  5B0Y B;  5G49 B;  3X1V D;  3WA9 A;  4KUD A;  2Y2P A;  3TU4 B;  5GT0 B;  5AV9 C;  4JJN D;  3MNN C;  5F99 D;  4CAY A;  4KHA B;  4LD9 A;  3AV2 D;  3X1T A;  3WAA D;  1P3L C;  4WU9 D;  1KX5 A;  5DNM D;  3UT9 A;  3AFA B;  3AZG A;  1M1A D;  1EQZ D;  3REJ A;  1M18 D;  4XUJ A;  1BH8 B;  3REL B;  4EO5 C;  4KUD C;  1KX4 D;  3W96 A;  2Y2N A;  5KDM A;  5B2J C;  1ZLA B;  5B32 B;  1AOI D;  2G5I C;  3REI A;  4G92 C;  4G91 C;  3UTA B;  2NZD C;  5GT3 C;  5DNN D;  3X1T C;  1S32 C;  5AV8 D;  2XD5 A;  2NQB B;  5FUG A;  2Y2L A;  3TU4 C;  5CPI B;  5GT0 C;  1TAF B;  3EPJ A;  3EPL A;  4Z5T A;  4WU8 B;  3R45 A;  2BG1 A;  5E5A D;  1P3F A;  3AZM D;  3B0C T;  3C1B D;  3W96 C;  3C1C A;  1P3O D;  4H9O A;  5CPK B;  5B31 G;  5AVB B;  3AYW D;  4J8V D;  3REL C;  1TZY B;  1P3I B;  1KX3 B;  3LEL A;  1ZLA C;  5B32 C;  5B0Z D;  4KGC B;  3NQJ A;  4UUZ B;  3UTA C;  3AZN A;  2FJ7 D;  1P34 B;  4YM6 D;  3LZ1 A;  3H0R C;  3MGP D;  1P3A D;  3EG5 B;  3KXB A;  3WTP B;  2NQB C;  3UTB A;  2RVQ D;  4Z66 D;  2ZY5 A;  5CPI C;  4AWL B;  3MVD D;  4H9S C;  2F8N G;  4WU8 C;  3X1S A;  3B6G D;  4HGA B;  5JRG D;  2ARO B;  3LEL C;  4YS3 D;  5GXQ A;  2PYO A;  3X1U A;  3MGR D;  3AV1 D;  5BNX A;  5AY8 D;  5CPK C;  3AZJ D;  2JCH A;  4XZQ B;  5B24 D;  1M19 A;  1P3K B;  1R4V A;  1H3O B;  5B1L B;  5AVB C;  2Y2O A;  4WJ3 C;  3MGS B;  1TZY C;  2CV5 A;  1P3I C;  1KX3 C;  3W97 A;  4ZUX B;  3V9R B;  2HIO D;  1P3G B;  4KGC C;  1U35 D;  4X23 A;  3LZ0 B;  1JFI A;  2BYK A;  4CSR B;  4NE6 A;  2HUE B;  1P34 C;  5GSU B;  3REH B;  3WA9 D;  4KUD D;  3WTP C;  4Z2M H;  3FDD A;  3B6F B;  3KUY B;  4AWL C;  5BT1 C;  2CWE A;  1ID3 B;  1F66 B;  4LD9 D;  4YM6 B;  4NE3 A;  3X1T D;  2F8N K;  1P3P A;  3LJA B;  3AZF B;  3W98 B;  4HGA C;  4QLC B;  3AZE B;  2ARO C;  5AVC A;  1KX5 D;  5AV9 A;  5AV5 B;  3MNN A;  3UT9 D;  3AZG D;  3NQU B;  5B40 B;  3REJ D;  4J8W B;  4XUJ D;  4J8X B;  2LY8 A;  1P3K C;  5B1L C;  3W96 D;  1P3L A;  3MGS C;  5B31 B;  3REI D;  3A1I A;  3VH6 W;  1P3G C;  1HQ3 C;  1N1J A;  3LZ0 C;  5B1M B;  3KWQ B;  5B33 B;  2HUE C;  5CPJ B;  5GSU C;  3REH C;  5CP6 B;  3A6N B;  3AZH B;  3AZK B;  5B2J A;  5AVC C;  4DQY B;  1P3B A;  3EPK A;  3B6F C;  3KUY C;  4H9Q B;  3AZM A;  4R8P A;  3AN2 B;  1ID3 C;  3VH5 W;  5GT3 A;  4Z5T D;  1S32 A;  1F66 C;  2NZD A;  2DF4 C;  4WNN A;  2BYM B;  3WTP E;  4H9R A;  3LJA C;  3O62 B;  3AZF C;  5G49 A;  3W99 C;  1P3F D;  3WKJ B;  3W98 C;  5B2I B;  3REK B;  3AZE C;  3C1C D;  3TU4 A;  5GT0 A;  2F8N B;  5AV5 C;  4KHA A;  5B40 C;  4J8W C;  1P3M B;  3LEL D;  3MGQ B;  1P3B C;  3AZI B;  5AV6 B;  5B31 C;  3AZL C;  4J8U B;  4R8P C;  3AZN D;  2G5H C;  3KSY A;  5B1M C;  3KWQ C;  3LZ1 D;  5B0Y C;  5B33 C;  3KXB D;  5CPJ C;  1BH8 A;  3REL A;  3B0B A;  1T3U A;  3A6N C;  3UTB D;  3AZH C;  1Q9C A;  3AZK C;  1ZLA A;  5B32 A;  4DRA A;  3UTA A;  3AN2 C;  4M6B A;  3X1V B;  3X1S D;  3O62 C;  3WKJ C;  2NQB A;  2Y2H A;  5B2I C;  4JJN B;  5GXQ D;  3REK C;  2PYO D;  3X1U D;  5CPI A;  5F99 B;  1TAF A;  3AFA C;  3AV2 B;  4H9S A;  3WAA B;  1M19 D;  4WU8 A;  4WU9 B;  3C1C B;  2CV5 D;  3A1K A;  3MGQ C;  5JA4 B;  3AZI C;  3W97 D;  5DNM B;  5AV6 C;  1M1A B;  4DRB A;  4J8U C;  4X23 D;  2VQR A;  1EQZ B;  1M18 B;  1KU5 A;  5CPK A;  2XD1 A;  5AVB A;  2RIQ A;  1KX4 B;  3IP4 C;  2IO5 B;  1AOI B;  1TZY A;  1P3I A;  1KX3 A;  2ZY3 A;  4KGC A;  1A7W A;  5DNN B;  5AV8 B;  1WWI A;  4UUZ A;  3LZ1 B;  3KXB B;  1P3P D;  1ULY A;  3B0C W;  1P34 A;  3WTP A;  5AVC D;  2DQN C;  5AV9 D;  4JJN C;  3MNN D;  5F99 C;  3AV2 C;  5E5A B;  3AZM B;  3C1B B;  4WU9 C;  1P3L D;  2Y2G A;  2ARO A;  4NE5 A;  5C3I B;  5DNM C;  4H9P B;  1P3O B;  1M1A C;  1EQZ C;  5BNV B;  1M18 C;  1F1E A;  1PZR A;  3AYW B;  4J8V B;  4XZQ A;  1P3K A;  1H3O A;  5B1L A;  2YFW B;  4WZS B;  1AOI C;  5B2J D;  5BO0 B;  5B0Z B;  3MGS A;  1P3B D;  2FJ7 B;  4R8P D;  4ZUX A;  3V9R A;  2J8P A;  1HQ3 A;  5DNN C;  1P3G A;  2NZD D;  3LZ0 A;  5GT3 D;  3MGP B;  5AV8 C;  1S32 D;  1P3A B;  4CSR A;  5GSU A;  3REH A;  4Z66 B;  3TU4 D;  4H9N B;  5GT0 D;  3MVD B;  2ZM5 A;  3B6F A;  3KUY A;  1ID3 A;  1F66 A;  5E5A C;  4XZQ C;  3B6G B;  3AZM C;  1B67 A;  3LJA A;  2F2A C;  3C1B C;  3AZF A;  5JRG B;  3W99 A;  4YS3 B;  3W98 A;  4QLC A;  3AZE A;  3MGR B;  3AV1 B;  5AY8 B;  4ZUX C;  1P3O C;  1BH9 B;  5AV5 A;  3AZJ B;  5B24 B;  5B40 A;  3VH5 T;  2YFV B;  3AYW C;  4J8W A;  2Y2K A;  4J8V C;  4J8X A;  3REL D;  3B0D B;  1ZLA D;  5B32 D;  5B0Z C;  2HIO B;  5BS7 C;  5B31 A;  3AZL A;  1U35 B;  3UTA D;  5B1M A;  4YM6 C;  4Z2M G;  3KWQ A;  3MGP C;  4EO5 B;  3WA9 B;  4KUD B;  5B33 A;  5B0Y A;  5CPJ A;  2NQB D;  2RVQ C;  4Z66 C;  3A6N A;  3AZH A;  2JE5 A;  4QLC C;  2UWX A;  3AZK A;  5CPI D;  4CAY B;  3MVD C;  4LD9 B;  4H9Q A;  3X1T B;  2JSS A;  3AN2 A;  4WU8 D;  2BYM A;  4J8X C;  3B6G C;  3O62 A;  5JRG C;  3WKJ A;  4YS3 C;  1KX5 B;  5B2I A;  3REK A;  3UT9 B;  3AZG B;  3MGR C;  2F8N A;  3AV1 C;  5AY8 C;  3AL0 C;  3VH5 A;  3AFA A;  3AZJ C;  3REJ B;  5CPK D;  4XUJ B;  5B24 C;  5AVB D;  3W96 B;  5KDM B;  5CP6 C;  1TZY D;  2ZY4 A;  3B0D C;  3REI B;  1P3I D;  1P3M A;  1KX3 D;  3MGQ A;  3AZI A;  2HIO C;  5AV6 A;  2W8S A;  3H0L C;  1U35 C;  4KGC D;  4J8U A;  1P34 D;  3WA9 C;  5FUG B;  4E44 A;  3WTP D;  3KFU G;  5BT1 D;  2Y2Q A;  4LD9 C;  4Z5T B;  3R45 B;  4E45 A;  1P3F B;  3X1V A;  1Z2C B;  2F8N H;  1P3M C;  2ARO D;  1KX5 C;  4JJN A;  3UT9 C;  4H9O B;  3AZG C;  5F99 A;  3AV2 A;  3REJ C;  4XUJ C;  4XZQ D;  3WAA A;  1P3K D;  5B1L D;  4WU9 A;  3LEL B;  4ZBJ B;  3MGS D;  3REI C;  3NQJ B;  5JA4 A;  3AZN B;  5DNM A;  4ZUX D;  1M1A A;  1P3G D;  1HQ3 D;  3LZ0 D;  1EQZ A;  1M18 A;  3X1V C;  5GSU D;  3UTB B;  3REH D;  1KX4 A;  2Y2M A;  1AOI A;  3B6F D;  2ZY2 A;  1BFM A;  3KUY D;  3F6T A;  2L5A A;  5DNN A;  4Z5T C;  1ID3 D;  1F66 D;  5AV8 A;  3WAA C;  3X1S B;  1P3F C;  3LJA D;  3AZF D;  3W99 D;  3W98 D;  5GXQ B;  2PYO B;  3C1C C;  3X1U B;  4QLC D;  3AZE D;  5BNX B;  5AV5 D;  1M19 B;  5B40 D;  5E5A A;  4J8W D;  4J8X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...